1UF7A

Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-valine
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
303
structure length
303
Chain Sequence
TRQMILAVGQQGPIARAETREQVVVRLLDMLTKAASRGANFIVFPELALTTFFPRWHFTDEAELDSFYETEMPGPVVRPLFEKAAELGIGFNLGYAELVVEGGVKRRFNTSILVDKSGKIVGKYRKIHLPGHKEYEAYRPFQHLEKRYFEPGDLGFPVYDVDAAKMGMFIANDRRWPEAWRVMGLRGAEIICGGYNTPTHNPPVPQHDHLTSFHHLLSMQAGSYQNGAWSAAAGKAGMEENCMLLGHSCIVAPTGEIVALTTTLEDEVITAAVDLDRCRELREHIFNFKQHRQPQHYGLIAEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of C171A/V236A Mutant of N-carbamyl-D-amino acid amidohydrolase
rcsb
source organism Agrobacterium sp.
molecule tags Hydrolase
molecule keywords N-carbamyl-D-amino acid amidohydrolase
total genus 103
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature ec 3.5.1.77: N-carbamoyl-D-amino-acid hydrolase.
pdb deposition date 2003-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00795 CN_hydrolase Carbon-nitrogen hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.110.10 Alpha Beta 4-Layer Sandwich Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase Carbon-nitrogen hydrolase 1uf7A00
1UF8A 4HG5A 2W1VA 4KZFA 3IW3A 3SEQA 1ERZA 3KLCA 3SDBA 4IZSA 3WUYA 1FO6A 1UF7A 4GYNA 4F4HA 4IZUA 5JQNA 2VHIA 3HKXA 3SYTA 3SEZA 4CYGA 1UF4A 4IZWA 4IZVA 4CYFA 1EMSA 2DYVA 5H8JA 3ILVA 3N05A 2UXYA 2E2LA 2E2KA 3IVZA 4IZTA 5H8KA 3DLAA 4HG3A 5H8IA 2GGKA 5KHAA 4H5UA 2PLQA 4LF0A 5H8LA 3SZGA 1J31A 2E11A 2VHHA 1F89A 2GGLA 4CYYA 3KI8A 3P8KA 2DYUA 4GYLA 4HGDA 1UF5A
chains in the Genus database with same CATH superfamily
1UF8A 4HG5A 2W1VA 4KZFA 3IW3A 3SEQA 1ERZA 3KLCA 3SDBA 4IZSA 3WUYA 1FO6A 1UF7A 4GYNA 4F4HA 4IZUA 5JQNA 2VHIA 3HKXA 3SYTA 3SEZA 4CYGA 1UF4A 4IZWA 4IZVA 4CYFA 1EMSA 2DYVA 5H8JA 3ILVA 3N05A 2UXYA 2E2LA 2E2KA 3IVZA 4IZTA 5H8KA 3DLAA 4HG3A 5H8IA 2GGKA 5KHAA 4H5UA 2PLQA 4LF0A 5H8LA 3SZGA 1J31A 2E11A 2VHHA 1F89A 2GGLA 4CYYA 3KI8A 3P8KA 2DYUA 4GYLA 4HGDA 1UF5A
chains in the Genus database with same CATH topology
1UF8A 4HG5A 2W1VA 4KZFA 3IW3A 3SEQA 1ERZA 3KLCA 3SDBA 4IZSA 3WUYA 1FO6A 1UF7A 4GYNA 4F4HA 4IZUA 5JQNA 2VHIA 3HKXA 3SYTA 3SEZA 4CYGA 1UF4A 4IZWA 4IZVA 4CYFA 1EMSA 2DYVA 5H8JA 3ILVA 3N05A 2UXYA 2E2LA 2E2KA 3IVZA 4IZTA 5H8KA 3DLAA 4HG3A 5H8IA 2GGKA 5KHAA 4H5UA 2PLQA 4LF0A 5H8LA 3SZGA 1J31A 2E11A 2VHHA 1F89A 2GGLA 4CYYA 3KI8A 3P8KA 2DYUA 4GYLA 4HGDA 1UF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UF8 A;  4HG5 A;  2W1V A;  4KZF A;  3IW3 A;  3SEQ A;  1ERZ A;  3KLC A;  3SDB A;  4IZS A;  3WUY A;  1FO6 A;  1UF7 A;  4GYN A;  4F4H A;  4IZU A;  5JQN A;  2VHI A;  3HKX A;  3SYT A;  3SEZ A;  4CYG A;  1UF4 A;  4IZW A;  4IZV A;  4CYF A;  1EMS A;  2DYV A;  5H8J A;  3ILV A;  3N05 A;  2UXY A;  2E2L A;  2E2K A;  3IVZ A;  4IZT A;  5H8K A;  3DLA A;  4HG3 A;  5H8I A;  2GGK A;  5KHA A;  4H5U A;  2PLQ A;  4LF0 A;  5H8L A;  3SZG A;  1J31 A;  2E11 A;  2VHH A;  1F89 A;  2GGL A;  4CYY A;  3KI8 A;  3P8K A;  2DYU A;  4GYL A;  4HGD A;  1UF5 A; 
#chains in the Genus database with same CATH topology
 1UF8 A;  4HG5 A;  2W1V A;  4KZF A;  3IW3 A;  3SEQ A;  1ERZ A;  3KLC A;  3SDB A;  4IZS A;  3WUY A;  1FO6 A;  1UF7 A;  4GYN A;  4F4H A;  4IZU A;  5JQN A;  2VHI A;  3HKX A;  3SYT A;  3SEZ A;  4CYG A;  1UF4 A;  4IZW A;  4IZV A;  4CYF A;  1EMS A;  2DYV A;  5H8J A;  3ILV A;  3N05 A;  2UXY A;  2E2L A;  2E2K A;  3IVZ A;  4IZT A;  5H8K A;  3DLA A;  4HG3 A;  5H8I A;  2GGK A;  5KHA A;  4H5U A;  2PLQ A;  4LF0 A;  5H8L A;  3SZG A;  1J31 A;  2E11 A;  2VHH A;  1F89 A;  2GGL A;  4CYY A;  3KI8 A;  3P8K A;  2DYU A;  4GYL A;  4HGD A;  1UF5 A; 
#chains in the Genus database with same CATH homology
 1UF8 A;  4HG5 A;  2W1V A;  4KZF A;  3IW3 A;  3SEQ A;  1ERZ A;  3KLC A;  3SDB A;  4IZS A;  3WUY A;  1FO6 A;  1UF7 A;  4GYN A;  4F4H A;  4IZU A;  5JQN A;  2VHI A;  3HKX A;  3SYT A;  3SEZ A;  4CYG A;  1UF4 A;  4IZW A;  4IZV A;  4CYF A;  1EMS A;  2DYV A;  5H8J A;  3ILV A;  3N05 A;  2UXY A;  2E2L A;  2E2K A;  3IVZ A;  4IZT A;  5H8K A;  3DLA A;  4HG3 A;  5H8I A;  2GGK A;  5KHA A;  4H5U A;  2PLQ A;  4LF0 A;  5H8L A;  3SZG A;  1J31 A;  2E11 A;  2VHH A;  1F89 A;  2GGL A;  4CYY A;  3KI8 A;  3P8K A;  2DYU A;  4GYL A;  4HGD A;  1UF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...