1UFHA

Structure of putative acetyltransferase, yycn protein of bacillus subtilis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
155
structure length
155
Chain Sequence
TIMLTPMQTEEFRSYLTYTTKHYAEEKVKAGTWLPEDAQLLSKQVFTDLLPRGLETPHHHLWSLKLNEKDIVGWLWIHAEPEHPQQEAFIYDFGLYEPYRGKGYAKQALAALDQAARSMGIRKLSLHVFAHNQTARKLYEQTGFQETDVVMSKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the bacillus subtilis YYCN protein: a putative N-acetyltransferase
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Structural genomics, unknown function
molecule keywords YYCN protein
total genus 41
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1ufhA00
4I49A 1QSNA 2RC4A 4KOYA 2OU2A 4QVTA 3FXTA 2ZW5A 4GS4A 3G3SA 1RO5A 3TOBA 2EUIA 3LODA 1IICA 2BL1A 2FE7A 1OZPA 5F49A 3DSBA 2PR8A 1Y9WA 1J4JA 1NE9A 1IB1E 1Q2YA 4M3SA 4KUBA 4KOTA 3IGRA 4J3GA 2Q7BA 4KZTA 2CNMA 1XMTA 2Q44A 1YVOA 3EY5A 4YGOA 3NE7A 1PU9A 3D2MA 4KLWA 1P0HA 5F47A 4MY3A 1IYLA 3F8KA 3FIXA 2X7BA 1MJBA 3W6SA 3I3GA 3BLNA 3CXPA 3FNCA 2R1IA 2B3UA 3W6XA 3GKRA 2ZW6A 2BUEA 2VZZA 4F0YA 4KVXA 1B87A 2VXKA 4UWIA 4E8OA 4UWJA 1I21A 4CRZB 2DXQA 2B4DB 1YGHA 5IB0A 3R96A 3TO6A 2J8NA 2P6EA 1S60A 1KUVA 4L8AA 3S6FA 2AJ6A 3ZJ0A 3FB3A 2O28A 5EC4A 1VHSA 4AG7A 3D8PA 4UBRA 1Q2DA 3D3SA 4MBUA 3EC4A 2PRBA 5KTCA 2WPXA 4YRHA 1TIQA 3MGDA 3TFYA 2OZUA 3W91A 1S3ZA 4ZBGA 4NSQA 2PC1A 2B4BA 3T90A 4R9MA 4ONUA 4QBJA 4X5KA 2QIRA 2F5IA 3F0AA 1KUYA 3FBUA 3S6GA 2B4DA 2Q4YA 4R87A 2FS5A 4R57A 1R57A 2HQYA 1QSMA 4JXQA 4AVAA 4XPDB 1KZFA 4XPDC 2J8MA 2GANA 5F46A 1Z9UA 4Y49B 2HV2A 3WR7A 3F5BA 1S5KA 3PGPA 2BSWA 3EXNA 5EBVA 4AG9A 2B5GB 4PK2A 2B58A 2PR1A 2PQ8A 3E0KA 1U6MA 2D4PA 4JD6A 3TCVA 4OLLA 4KVME 2PSWA 2B5GA 4MJ8A 1WWZA 3B8GA 3OWCA 4AVCA 5IX3A 2J8RA 4B5PB 5JPHA 4B5OA 1YX0A 2VI7A 3DNSA 2CY2A 1YK3A 1QSTA 4IUSA 4CRYB 4QC6A 5I0CA 3G8WA 3DR8A 3R9EA 4II9A 4NF1A 2JDDA 2P6GA 3TO9A 1YR0A 1YREA 4JXRA 3PP9A 3R9FA 4PK3A 2REFA 3H4QA 2GE3A 2VQYA 5JQ4A 5C82A 4FD7A 4UA3A 3D2PA 5IV0A 2QECA 3KKWA 4AVBA 2PDOA 4KORA 3DR6A 2CNTA 3BJ8A 5E96A 2GIVA 2P0WA 1IIDA 1QSOA 4JLYA 1IYKA 4BMHA 1V0CA 4KVOE 1Y7RA 2VBQA 1VKCA 4U9YA 2G3TA 4U5YA 1UFHA 3C26A 1RXTA 1NMTA 2CNSA 1QSRA 1SQHA 2JEVA 1FY7A 2FCKA 4FD6A 3IWGA 3VWEA 4RI1A 3N7ZA 2I79A 3P2HA 1XE4A 3SXNA 4PSWA 1K4JA 1PUAA 3BJ7A 3PZJA 2REEA 4R3KA 2ZXVA 2ATRA 1XF8A 2FL4A 4JWPA 4FD4A 1Z4EA 3JVNA 3P2FA 2H5MA 4K30A 1WK4A 1MJAA 2HUZA 2ZW4A 4CAXA 4KUAA 1NSLA 2IL4A 1MJ9A 2Q04A 5C88A 4HNYB 4XNHC 1M4IA 2FSRA 4NXYA 2WPWA 4EVYA 1M4DA 4AB7A 1XIXA 2VZYA 3RYOA 3TT2A 4XPKA 1S7LA 1CM0A 3V8IA 5CNPA 4QB9A 2K5TA 4E0AA 4Y49C 2FT0A 1ON0A 4KOUA 5DWMA 4OADA 3S6HA 2A4NA 2BEIA 3TO7A 1MK4A 3UY5A 3EO4A 1XEBA 3JUWA 4H6UA 3TOAA 3CXSA 4OAEA 2OZHA 3VWDA 3TTHA 5H86A 4E2AA 2Z11A 1S7NA 2Q4VA 3TE4A 2ZW7A 5FVJA 4JJXA 5DWNA 4LUAA 2Y0MA 2EVNA 2ARHA 4QUSA 1M1DA 1S7KA 3I9SA 5HH1A 4MY0A 3S6KA 1CJWA 4NEXA 1N71A 2D4OA 1KUXA 4ORFA 4HNWB 5HMNA 2FIWA 2OZGA 4KOVA 4NCZA 5H84A 2NMTA 2JDCA 4B5PA 4LX9A 1B6BA 2R8VA 4KOSA 5J8CA 3SHPA 3EFAA 2OB0A 2QMLA 4KLVA 3FRMA 1BOBA 5F48A 1BO4A 2C27A 4KOWA 5KTDA 2G3AA 4H6ZA 4RS2A 2JLMA 4HNXB 2ZPAA 1YLEA 4CAWA 4IF5A 2R7HA 4FD5A 1YVKA 1M4GA 3SXOA 2Q0YA 1Y9KA 2Z0ZA 3GY9A 4PV6A 1I12A 5GCNA 4MHDA 4KOXA 1I1DA 4DNCA 3R1KA 1LRZA 2B3VA 4MI4A 4F6AA 3LD2A 1P4NA 2P6FA 4L89A 2FIAA 4XPLA 4U9ZA 2OH1A 5ISVA 3ZZIA 4CAVA 4H89A 2I00A 4HKFA 3R9GA 3K9UA 3QAHA 1Q2CA 4XNHB 3FYNA 2KCWA 1Z4RA 2VEZA 2G0BA 2AE6A 4M85A 3GYAA 3R95A 1L0CA 4YFJA 3DDDA 4R3LA 2FXFA 3CXQA 1M44A 3QB8A 1S7FA 3T9YA 4CS0B 1GHEA 2R98A 5J8FA 2Z10A 5KTAA 4PSXA
chains in the Genus database with same CATH superfamily
2PJ5A 4EFDA 1BAVA 4ZY1A 4I49A 1QSNA 2RC4A 3KASA 4KOYA 4OC5A 2CTCA 2OU2A 3WABA 4LQ6A 4QVTA 2BCOA 3FXTA 2ZW5A 4GS4A 3G3SA 1RO5A 3SI0A 3TOBA 2EUIA 3LODA 1IICA 3H8GA 4NGRA 2BL1A 2FE7A 4CYPA 3T8WA 3K9TA 3CPXA 1OZPA 5F49A 3S9MA 3DSBA 2PR8A 4CYOA 1Y9WA 1J4JA 4Q36A 4C7IA 2C6CA 1NE9A 5JH9A 1IB1E 1Q2YA 4M3SA 2Z3OA 5K8PA 1F2OA 2Q7SA 2ZEEA 4PXDA 4UEEA 4KUBA 4KOTA 3IGRA 3S9NA 2ZEPA 4J3GA 2Q7BA 4KZTA 2CNMA 1XMTA 2Q44A 1YVOA 4UEFA 3L2NA 2FVGA 3EY5A 4YGOA 2Q43A 1ZG8A 3NE7A 2Q51A 1PU9A 3D2MA 3SJEA 4KLWA 1YQEA 1P0HA 3FH4A 3HUVA 4MCSA 4MY3A 1IYLA 3F8KA 5F47A 4CAFA 3VH9A 3FIXA 2X7BA 1MJBA 3W6SA 3I3GA 3BLNA 3CXPA 2WYRA 3V38A 3D4UA 3QAYA 4A30A 2PJ4A 3FNCA 2R1IA 1BLLE 2B3UA 3B3WA 3W6XA 3GKRA 1TKFA 1LCPA 2PVWA 4CGMA 2EO8A 2ZW6A 2BUEA 1PCAA 2VZZA 4OC3A 3V7ZA 4F0YA 3B35A 2POKA 3BHXA 4KVXA 1B87A 2VXKA 4UWIA 5CBMA 3DLJA 5AG5A 4CYNA 5BWAB 4E8OA 4UWJA 1M4LA 2PJ9A 4B11A 3LACA 1I21A 4MXUA 4CRZB 1F57A 3JRUA 3BI1A 1HDUA 3B3SA 3KQXA 4B12A 2DXQA 1YLOA 1TF9A 2B4DB 1XJOA 1AMPA 2PE3A 3B3TA 5LRKA 1YGHA 4MHZA 4OC0A 5IB0A 3KR4A 3R96A 3D67A 4ZX8A 3TO6A 3D7FA 2J8NA 2DPSA 2P6EA 2PJCA 4MFZA 4P4EA 5AGEA 1TKJA 1S60A 1KUVA 2CXAA 4L8AA 4AXVA 4B10A 4DJLA 2Z10A 3B7IA 3S6FA 4C68A 3PBEA 1VHEA 3KQZA 2AJ6A 3FVLA 5HVFA 2V8VA 3FB3A 2O28A 3ZJ0A 4X3RA 5DS0A 5EC4A 2ZOGA 1VHSA 3RBUA 4UF4A 4AG7A 3D8PA 4UBRA 1Q2DA 4BD9A 1CPXA 3D3SA 2DEAA 4MBUA 3EC4A 2PRBA 1XBUA 5KTCA 2WPXA 2AFOA 3NH4A 4MHPA 2PJ7A 5J1QA 3NFZA 4YRHA 3BI0A 4PXEA 4MCQA 4ZY0A 1LAMA 1TIQA 2ZELA 3MGDA 3TFYA 1FT7A 4LQGA 4OC1A 2OZUA 3W91A 4YU9A 1ELLP 4M6IA 1XOVA 1S3ZA 4CGNA 2C6PA 3IFEA 4ZBGA 2CIJA 4NSQA 2PC1A 2B4BA 3IU1A 3D7DA 3T90A 4R9MA 4ONUA 2GREA 4B14A 2Z3LA 4X5KA 4QBJA 3PFOA 2QIRA 2C1CA 4WJBA 1VHOA 1HDQA 2F5IA 3F0AA 1KUYA 3IWWA 3FBUA 3IO1A 4W9YA 4C7HA 3FMCA 3SI2A 3D7GA 4NGPA 1AUGA 3S6GA 2B4DA 2OR4A 2PJ0A 2Q4YA 4R87A 2FS5A 4IK2A 4A38A 4R57A 1R57A 2HQYA 1QSMA 4JXQA 3D68A 4F8ZA 3CT9A 5J8CA 4AVAA 4MFPA 4XPDB 5ELYA 1KZFA 5A28A 4XPDC 3D66A 4PPZA 2ZEDA 2J8MA 3PB6X 5JM6A 4ZGYB 2GANA 2EK9A 1ZO0A 3IU2A 5LRJA 5F46A 1IOFA 4M6GA 2ODFA 3PBBA 1Z9UA 4WWVA 4Y49B 1YW6A 4CGLA 2HV2A 3RO0A 4OMEA 5F09A 3FX6A 4MRIA 1Z8LA 2EBJA 2PJ8A 3IJ3A 3WR7A 2EWBA 3F5BA 1S5KA 3PGPA 2BSWA 1NSAA 5LRGA 3EXNA 3WC6A 1DTDA 5EBVA 4AG9A 2B5GB 4PK2A 2YNCA 4OKOA 4JYWA 4X2TA 4FWUA 2B58A 2PR1A 3SJGA 4Z65A 2PQ8A 4YWYA 5A27A 1R3NA 3ISXA 3K2KA 5LYDA 4OC4A 4NGQA 3E0KA 1U6MA 4MFLA 6CPAA 2D4PA 4JD6A 3TCVA 4OLLA 3A9LA 4MFKA 3RZAA 2PCUA 3FJUA 2PSWA 4KVME 4KSFA 2YNEA 2B5GA 4MJ8A 4R8FA 5EMIA 4PXBA 1WWZA 3B8GA 4G1PA 2PVVA 3OWCA 4AVCA 3B3CA 2JBKA 5HXDA 5IX3A 2J8RA 3HLPA 2RB7A 3PEIA 4NJRA 4B5PB 2GLFA 4A2ZA 5JPHA 2O53A 5I4MA 4OIWA 2Z3PA 8CPAA 3H8FA 3RNZA 4B5OA 1YX0A 2VI7A 1IOIA 3DNSA 4KSAA 5LYLA 2CY2A 1YK3A 1IGBA 1QSTA 2Z3KA 4IUSA 4CRYB 4QC6A 4CYQA 5I0CA 3LMSA 5IB9A 3G8WA 3DR8A 3R9EA 4II9A 3S9LA 4NF1A 2QVPA 1UWYA 1ZLIA 1YSJA 3GB0A 4BBHA 2JDDA 1ARMA 2P6GA 3FEDA 3TO9A 1YR0A 4KS9A 1YREA 1IU8A 1XFOA 4JXRA 2IMOA 4F0XA 3PP9A 3PB8X 4H2KA 3R9FA 3N5FA 4PK3A 2REFA 3H4QA 2GE3A 3FF3A 2VQYA 5LYIA 5JQ4A 5C82A 3WC5A 4FD7A 4UA3A 3D2PA 1IY7A 3NH8A 5IV0A 2QECA 3KKWA 4AVBA 2DPTA 1BPNA 3H5ZA 2PDOA 2C6GA 4KORA 3DR6A 4DYOA 2IJZA 2CNTA 3TC8A 3BJ8A 3IWEA 5E96A 2GIVA 3KGQA 3KL9A 2P0WA 1IIDA 1XRYA 4UEZA 2NYQA 4P6YA 1QSOA 1DE4C 2PIZA 4JLYA 1IYKA 4BMHA 1V0CA 2PJAA 4KVOE 1Y7RA 2VBQA 1VKCA 4U9YA 4Q38A 4ZYQA 2G3TA 1LANA 4U5YA 1UFHA 3C26A 1RXTA 1NMTA 2CNSA 1QSRA 1SQHA 2JEVA 4NGNA 4C2XA 5G22A 4EWTA 1H8LA 2FCKA 4FD6A 1X12A 4MCRA 3PB4X 3IWGA 4A39A 3VWEA 4RI1A 3N7ZA 2I79A 3IC1A 3P2HA 2O4HA 1Z8WA 3ISZA 1PYTB 4B6ZA 2PIYA 4F9UA 1XE4A 4UIBA 3NA6A 3SXNA 4PSWA 1K4JA 1ZG9A 2PRQA 1YMEA 1PUAA 3BJ7A 3CZXA 3PZJA 2REEA 4R3KA 4EMEA 2ZXVA 2ATRA 1BPMA 2HC9A 4UFXA 1XF8A 2ZEHA 1Y7EA 2FL4A 3MN8A 4JWPA 4FD4A 1Z4EA 3JVNA 4MMOA 1LAPA 3KI9A 4ZI6A 3P2FA 2H5MA 5HVGA 4K30A 5G20A 1WK4A 2Z3NA 1MJAA 2HUZA 2ZW4A 4CAXA 2WUUA 4KUAA 2RFHA 1NSLA 2CF4A 1RTQA 2BOAA 2IL4A 3IEHA 1MJ9A 2Q04A 1TXRA 5C88A 3FEEA 2XEJA 4HNYB 4XNHC 4P4JA 1M4IA 2GU2A 2PJ2A 2PJ1A 1A2ZA 2FSRA 4NXYA 2WPWA 4X8IA 4EVYA 1M4DA 4AB7A 4NJQA 4O23A 1XIXA 2QYVA 2VZYA 3RYOA 4XPKA 3TT2A 2PJ6A 1LFWA 1S7LA 1CM0A 4P4DA 4P10A 4CGPA 1OBRA 5CNPA 3V8IA 2V8HA 4QB9A 2K5TA 4E0AA 2CTBA 4Y49C 3WT4A 2FT0A 1QMUA 1Z2LA 1ON0A 4KOUA 2GLJA 5DWMA 4K3NA 3B2YA 4OADA 3S6HA 2A4NA 2BEIA 3TO7A 1MK4A 3UY5A 3FECA 3EO4A 1XEBA 3JUWA 4H6UA 3NH5A 3TOAA 3CXSA 4GM5A 4OAEA 4FUUA 2OZHA 3VWDA 1KWMA 3TTHA 1Y0YA 5H86A 1TKHA 1R43A 3KHZA 4NGSA 4CAEA 4E2AA 4ONWA 4TWEA 2Z11A 4R7MA 4UCPA 1S7NA 2Q4VA 3TE4A 2IQ6A 1CPSA 2ZW7A 5JGFA 4GXHA 4PXCA 4C2ZA 2F7VA 3H8EA 4UFVA 3SJFA 5FVJA 2WSAA 1CX8A 5AG7A 4A37A 4JJXA 3PRTA 4P44A 4NGMA 2VL1A 5DWNA 2AFSA 2Y0MA 4LUAA 2EVNA 2AFMA 2QJ8A 4P45A 2ARHA 4R6TA 4QUSA 3LWUA 1M1DA 1S7KA 2BO9A 2JBJA 4MHNA 4CPAA 4M6HA 2YNCC 3KR5A 3I9SA 5HH1A 4MY0A 4P4FA 3S6KA 3MRUA 1CJWA 4NEXA 1N71A 2D4OA 3IIBA 4MCPA 3TX8A 1KUXA 4ORFA 4HNWB 4RN7A 5HMNA 2FIWA 4A32A 2OZGA 4KOVA 2GFQA 4NCZA 1CP6A 5H84A 2NMTA 2JDCA 2HB6A 3CDXA 4B5PA 2ABZA 3NE8A 1F2PA 4LX9A 3GUXA 4RUHA 1JQGA 1HEEA 1VGYA 2PJBA 3D7HA 4A94A 2NSMA 1B6BA 2ZOFA 4KSIA 2R8VA 4KOSA 1FNOA 2JEWA 2WZNA 2AFWA 1CBXA 2I3CA 3EFAA 4IAVA 4OIDA 1Z5RA 2OB0A 4Q7AA 3SHPA 2QMLA 4KLVA 3FRMA 1BOBA 4NFRA 5F48A 1LOKA 1BO4A 2C27A 3SI1A 4ZY2A 4KOWA 5KTDA 1AYEA 2G3AA 4A95A 4F9VA 4H6ZA 3KZWA 4RS2A 4MFJA 1QQ9A 2ANPA 4UCNA 7CPAA 2JLMA 4HNXB 1CP7A 1Y0RA 2ZPAA 1YW4A 1YLEA 2OOTA 4CAWA 4IF5A 4ZX9A 5HVHA 5LYFA 2R7HA 2ZEOA 1TF8A 3CPAA 1GYTA 4FD5A 2ZEGA 1XMBA 5THWA 1YVKA 2V8DA 2ZEMA 1M4GA 4C2YA 2EK8A 3RAMA 4NGTA 1EE3P 2Q0YA 3SXOA 1Y9KA 2XEFA 4FBEA 1ARLA 2Z0ZA 2AFUA 1X10A 4B13A 5D8NA 2ZEFA 3I1UA 3GY9A 1I12A 3BXMA 4PV6A 4MHDA 5GCNA 5K8OA 4KOXA 4R76A 1I1DA 3VATA 5AG6A 4DNCA 3GIUA 2PJ3A 3R1KA 3PB9X 5G1ZA 1LRZA 2B3VA 4FAIA 4MI4A 4F6AA 3LD2A 3PFEA 2V8GA 1P4NA 3KHXA 2P6FA 1Z8TA 4DUKA 4L89A 2FIAA 3WC7A 5CPAA 4XPLA 2AFZA 4U9ZA 2OH1A 4BINA 4TNUA 2Z3MA 3DGVA 2F8HA 2AFXA 5ISVA 5D29A 4A31A 2V77A 3ZZIA 2XEGA 1ZLHA 4CAVA 2ZENA 2YNDA 4OP4A 4HPSA 5K8MA 4H89A 2I00A 4HKFA 4PQAA 3K9UA 3R9GA 3QAHA 1CG2A 1Z8XA 2J9AA 3QNVA 4JZ0A 5G21A 1Q2CA 4UFWA 4P4IA 4XNHB 3FYNA 2KCWA 3JTKA 1Z4RA 3VARA 3SJXA 2VEZA 2DF5A 2G0BA 2AE6A 4M85A 3GYAA 4OC2A 3R95A 4P4BA 1L0CA 1ELMP 4MHYA 4UIAA 4YFJA 5K8NA 4MFQA 3B3VA 3DDDA 4R3LA 2XEIA 2YGWA 2FXFA 3CXQA 3GLJA 1M44A 4CGOA 1Q7LA 3QB8A 1S7FA 2G9DA 3T9YA 4CS0B 2Q4ZA 1VIXA 1GHEA 1ZG7A 5AG4A 4UCMA 3PB7X 2R98A 4IHMA 5J8FA 1FY7A 4A33A 5KTAA 1JWQA 4PSXA
chains in the Genus database with same CATH topology
4I49A 1QSNA 2RC4A 4KOYA 2OU2A 4QVTA 3FXTA 2ZW5A 4GS4A 3G3SA 1RO5A 3TOBA 2EUIA 3LODA 1IICA 2BL1A 2FE7A 4CYPA 1OZPA 5F49A 4CYOA 3DSBA 2PR8A 1Y9WA 1J4JA 4Q36A 4C7IA 1NE9A 1IB1E 1Q2YA 4M3SA 2Z3OA 4KUBA 4KOTA 3IGRA 4J3GA 2Q7BA 4KZTA 2CNMA 1XMTA 2Q44A 1YVOA 3EY5A 4YGOA 3NE7A 1PU9A 3D2MA 4KLWA 1P0HA 5F47A 4MY3A 1IYLA 3F8KA 4CAFA 3FIXA 2X7BA 1MJBA 3W6SA 3I3GA 3BLNA 3CXPA 4A30A 3FNCA 2R1IA 2B3UA 3W6XA 3GKRA 4CGMA 2ZW6A 2BUEA 2VZZA 4F0YA 4KVXA 1B87A 2VXKA 4UWIA 5AG5A 4CYNA 5BWAB 4E8OA 4UWJA 4B11A 1I21A 4CRZB 4B12A 2DXQA 2B4DB 1YGHA 5IB0A 3R96A 3TO6A 2J8NA 2DPSA 2P6EA 4MFZA 5AGEA 1S60A 1KUVA 2CXAA 4L8AA 4B10A 4C68A 3S6FA 2AJ6A 3ZJ0A 3FB3A 2O28A 5EC4A 1VHSA 4AG7A 3D8PA 4UBRA 1Q2DA 3D3SA 4MBUA 3EC4A 2PRBA 5KTCA 2WPXA 4YRHA 1TIQA 3MGDA 3TFYA 2OZUA 3W91A 1S3ZA 4CGNA 4ZBGA 4NSQA 2PC1A 2B4BA 3IU1A 3T90A 4R9MA 4ONUA 4B14A 4QBJA 2Z3LA 4X5KA 2QIRA 2F5IA 3F0AA 1KUYA 3FBUA 4C7HA 3S6GA 2B4DA 2Q4YA 4R87A 2FS5A 4R57A 1R57A 2HQYA 1QSMA 4JXQA 4AVAA 4MFPA 4XPDB 1KZFA 5A28A 4XPDC 2J8MA 4ZGYB 2GANA 5F46A 1ZO0A 3IU2A 1Z9UA 4Y49B 4CGLA 2HV2A 3WR7A 3F5BA 1S5KA 3PGPA 2BSWA 3EXNA 5EBVA 4AG9A 2B5GB 4PK2A 2YNCA 2B58A 2PR1A 2PQ8A 5A27A 3E0KA 1U6MA 4MFLA 2D4PA 4JD6A 3TCVA 4OLLA 3A9LA 4MFKA 4KVME 2PSWA 4KSFA 2YNEA 2B5GA 4MJ8A 1WWZA 3B8GA 3OWCA 4AVCA 5IX3A 2J8RA 4B5PB 5JPHA 4A2ZA 2Z3PA 4B5OA 1YX0A 2VI7A 3DNSA 4KSAA 2CY2A 1YK3A 1QSTA 2Z3KA 4IUSA 4CRYB 4QC6A 4CYQA 5I0CA 3G8WA 3DR8A 3R9EA 4II9A 4NF1A 4BBHA 2JDDA 2P6GA 3TO9A 1YR0A 4KS9A 1YREA 4JXRA 4F0XA 3PP9A 3R9FA 4PK3A 2REFA 3H4QA 2GE3A 2VQYA 5JQ4A 5C82A 4FD7A 4UA3A 3D2PA 5IV0A 2QECA 3KKWA 4AVBA 2DPTA 3H5ZA 2PDOA 4KORA 3DR6A 2CNTA 3IWEA 3BJ8A 5E96A 2GIVA 2P0WA 1IIDA 1QSOA 4JLYA 1IYKA 4BMHA 1V0CA 4KVOE 1Y7RA 2VBQA 1VKCA 4U9YA 4Q38A 2G3TA 4U5YA 1UFHA 3C26A 1RXTA 1NMTA 2CNSA 1QSRA 1SQHA 2JEVA 4C2XA 5G22A 1FY7A 2FCKA 4FD6A 3IWGA 3VWEA 4RI1A 3N7ZA 2I79A 3P2HA 1XE4A 3SXNA 4PSWA 1K4JA 1PUAA 3BJ7A 3PZJA 2REEA 4R3KA 2ZXVA 2ATRA 4UFXA 1XF8A 2FL4A 4JWPA 4FD4A 1Z4EA 3JVNA 3P2FA 2H5MA 4K30A 5G20A 1WK4A 2Z3NA 1MJAA 2HUZA 2ZW4A 4CAXA 2WUUA 4KUAA 1NSLA 2IL4A 1MJ9A 2Q04A 5C88A 4HNYB 4XNHC 1M4IA 2FSRA 4NXYA 2WPWA 4EVYA 1M4DA 4AB7A 1XIXA 2VZYA 3RYOA 3TT2A 4XPKA 4CGPA 1S7LA 1CM0A 3V8IA 5CNPA 4QB9A 2K5TA 4E0AA 4Y49C 2FT0A 1ON0A 4KOUA 5DWMA 4OADA 3S6HA 2A4NA 2BEIA 3TO7A 1MK4A 3UY5A 3EO4A 1XEBA 3JUWA 4H6UA 3TOAA 3CXSA 4OAEA 2OZHA 3VWDA 3TTHA 5H86A 4CAEA 4E2AA 2Z11A 4UCPA 1S7NA 2Q4VA 3TE4A 2ZW7A 4C2ZA 4UFVA 5FVJA 2WSAA 5AG7A 4JJXA 5DWNA 4LUAA 2Y0MA 2EVNA 2ARHA 4QUSA 1M1DA 1S7KA 2YNCC 3I9SA 5HH1A 4MY0A 3S6KA 1CJWA 4NEXA 1N71A 2D4OA 1KUXA 4ORFA 4HNWB 5HMNA 2FIWA 4A32A 2OZGA 4KOVA 4NCZA 5H84A 2NMTA 2JDCA 4B5PA 4LX9A 1B6BA 2R8VA 4KOSA 5J8CA 3SHPA 3EFAA 2OB0A 2QMLA 4KLVA 3FRMA 1BOBA 5F48A 1BO4A 2C27A 4KOWA 5KTDA 2G3AA 4A95A 4H6ZA 4RS2A 4MFJA 4UCNA 2JLMA 4HNXB 2ZPAA 1YLEA 4CAWA 4IF5A 2R7HA 4FD5A 1YVKA 1M4GA 4C2YA 3SXOA 2Q0YA 1Y9KA 2Z0ZA 4B13A 3GY9A 1I12A 4PV6A 5GCNA 4MHDA 4KOXA 1I1DA 5AG6A 4DNCA 3R1KA 5G1ZA 1LRZA 2B3VA 4MI4A 4F6AA 3LD2A 1P4NA 2P6FA 4L89A 2FIAA 4XPLA 4U9ZA 2OH1A 2Z3MA 5ISVA 4A31A 3ZZIA 4CAVA 2YNDA 4H89A 2I00A 4HKFA 3R9GA 3K9UA 3QAHA 5G21A 1Q2CA 4UFWA 4XNHB 3FYNA 2KCWA 3JTKA 1Z4RA 2VEZA 2G0BA 2AE6A 4M85A 3GYAA 3R95A 1L0CA 4YFJA 4MFQA 3DDDA 4R3LA 2YGWA 2FXFA 3CXQA 4CGOA 1M44A 3QB8A 1S7FA 3T9YA 4CS0B 1GHEA 5AG4A 4UCMA 2R98A 5J8FA 2Z10A 4A33A 5KTAA 4PSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I49 A;  1QSN A;  2RC4 A;  4KOY A;  2OU2 A;  4QVT A;  3FXT A;  2ZW5 A;  4GS4 A;  3G3S A;  1RO5 A;  3TOB A;  2EUI A;  3LOD A;  1IIC A;  2BL1 A;  2FE7 A;  1OZP A;  5F49 A;  3DSB A;  2PR8 A;  1Y9W A;  1J4J A;  1NE9 A;  1IB1 E;  1Q2Y A;  4M3S A;  4KUB A;  4KOT A;  3IGR A;  4J3G A;  2Q7B A;  4KZT A;  2CNM A;  1XMT A;  2Q44 A;  1YVO A;  3EY5 A;  4YGO A;  3NE7 A;  1PU9 A;  3D2M A;  4KLW A;  1P0H A;  5F47 A;  4MY3 A;  1IYL A;  3F8K A;  3FIX A;  2X7B A;  1MJB A;  3W6S A;  3I3G A;  3BLN A;  3CXP A;  3FNC A;  2R1I A;  2B3U A;  3W6X A;  3GKR A;  2ZW6 A;  2BUE A;  2VZZ A;  4F0Y A;  4KVX A;  1B87 A;  2VXK A;  4UWI A;  4E8O A;  4UWJ A;  1I21 A;  4CRZ B;  2DXQ A;  2B4D B;  1YGH A;  5IB0 A;  3R96 A;  3TO6 A;  2J8N A;  2P6E A;  1S60 A;  1KUV A;  4L8A A;  3S6F A;  2AJ6 A;  3ZJ0 A;  3FB3 A;  2O28 A;  5EC4 A;  1VHS A;  4AG7 A;  3D8P A;  4UBR A;  1Q2D A;  3D3S A;  4MBU A;  3EC4 A;  2PRB A;  5KTC A;  2WPX A;  4YRH A;  1TIQ A;  3MGD A;  3TFY A;  2OZU A;  3W91 A;  1S3Z A;  4ZBG A;  4NSQ A;  2PC1 A;  2B4B A;  3T90 A;  4R9M A;  4ONU A;  4QBJ A;  4X5K A;  2QIR A;  2F5I A;  3F0A A;  1KUY A;  3FBU A;  3S6G A;  2B4D A;  2Q4Y A;  4R87 A;  2FS5 A;  4R57 A;  1R57 A;  2HQY A;  1QSM A;  4JXQ A;  4AVA A;  4XPD B;  1KZF A;  4XPD C;  2J8M A;  2GAN A;  5F46 A;  1Z9U A;  4Y49 B;  2HV2 A;  3WR7 A;  3F5B A;  1S5K A;  3PGP A;  2BSW A;  3EXN A;  5EBV A;  4AG9 A;  2B5G B;  4PK2 A;  2B58 A;  2PR1 A;  2PQ8 A;  3E0K A;  1U6M A;  2D4P A;  4JD6 A;  3TCV A;  4OLL A;  4KVM E;  2PSW A;  2B5G A;  4MJ8 A;  1WWZ A;  3B8G A;  3OWC A;  4AVC A;  5IX3 A;  2J8R A;  4B5P B;  5JPH A;  4B5O A;  1YX0 A;  2VI7 A;  3DNS A;  2CY2 A;  1YK3 A;  1QST A;  4IUS A;  4CRY B;  4QC6 A;  5I0C A;  3G8W A;  3DR8 A;  3R9E A;  4II9 A;  4NF1 A;  2JDD A;  2P6G A;  3TO9 A;  1YR0 A;  1YRE A;  4JXR A;  3PP9 A;  3R9F A;  4PK3 A;  2REF A;  3H4Q A;  2GE3 A;  2VQY A;  5JQ4 A;  5C82 A;  4FD7 A;  4UA3 A;  3D2P A;  5IV0 A;  2QEC A;  3KKW A;  4AVB A;  2PDO A;  4KOR A;  3DR6 A;  2CNT A;  3BJ8 A;  5E96 A;  2GIV A;  2P0W A;  1IID A;  1QSO A;  4JLY A;  1IYK A;  4BMH A;  1V0C A;  4KVO E;  1Y7R A;  2VBQ A;  1VKC A;  4U9Y A;  2G3T A;  4U5Y A;  1UFH A;  3C26 A;  1RXT A;  1NMT A;  2CNS A;  1QSR A;  1SQH A;  2JEV A;  1FY7 A;  2FCK A;  4FD6 A;  3IWG A;  3VWE A;  4RI1 A;  3N7Z A;  2I79 A;  3P2H A;  1XE4 A;  3SXN A;  4PSW A;  1K4J A;  1PUA A;  3BJ7 A;  3PZJ A;  2REE A;  4R3K A;  2ZXV A;  2ATR A;  1XF8 A;  2FL4 A;  4JWP A;  4FD4 A;  1Z4E A;  3JVN A;  3P2F A;  2H5M A;  4K30 A;  1WK4 A;  1MJA A;  2HUZ A;  2ZW4 A;  4CAX A;  4KUA A;  1NSL A;  2IL4 A;  1MJ9 A;  2Q04 A;  5C88 A;  4HNY B;  4XNH C;  1M4I A;  2FSR A;  4NXY A;  2WPW A;  4EVY A;  1M4D A;  4AB7 A;  1XIX A;  2VZY A;  3RYO A;  3TT2 A;  4XPK A;  1S7L A;  1CM0 A;  3V8I A;  5CNP A;  4QB9 A;  2K5T A;  4E0A A;  4Y49 C;  2FT0 A;  1ON0 A;  4KOU A;  5DWM A;  4OAD A;  3S6H A;  2A4N A;  2BEI A;  3TO7 A;  1MK4 A;  3UY5 A;  3EO4 A;  1XEB A;  3JUW A;  4H6U A;  3TOA A;  3CXS A;  4OAE A;  2OZH A;  3VWD A;  3TTH A;  5H86 A;  4E2A A;  2Z11 A;  1S7N A;  2Q4V A;  3TE4 A;  2ZW7 A;  5FVJ A;  4JJX A;  5DWN A;  4LUA A;  2Y0M A;  2EVN A;  2ARH A;  4QUS A;  1M1D A;  1S7K A;  3I9S A;  5HH1 A;  4MY0 A;  3S6K A;  1CJW A;  4NEX A;  1N71 A;  2D4O A;  1KUX A;  4ORF A;  4HNW B;  5HMN A;  2FIW A;  2OZG A;  4KOV A;  4NCZ A;  5H84 A;  2NMT A;  2JDC A;  4B5P A;  4LX9 A;  1B6B A;  2R8V A;  4KOS A;  5J8C A;  3SHP A;  3EFA A;  2OB0 A;  2QML A;  4KLV A;  3FRM A;  1BOB A;  5F48 A;  1BO4 A;  2C27 A;  4KOW A;  5KTD A;  2G3A A;  4H6Z A;  4RS2 A;  2JLM A;  4HNX B;  2ZPA A;  1YLE A;  4CAW A;  4IF5 A;  2R7H A;  4FD5 A;  1YVK A;  1M4G A;  3SXO A;  2Q0Y A;  1Y9K A;  2Z0Z A;  3GY9 A;  4PV6 A;  1I12 A;  5GCN A;  4MHD A;  4KOX A;  1I1D A;  4DNC A;  3R1K A;  1LRZ A;  2B3V A;  4MI4 A;  4F6A A;  3LD2 A;  1P4N A;  2P6F A;  4L89 A;  2FIA A;  4XPL A;  4U9Z A;  2OH1 A;  5ISV A;  3ZZI A;  4CAV A;  4H89 A;  2I00 A;  4HKF A;  3R9G A;  3K9U A;  3QAH A;  1Q2C A;  4XNH B;  3FYN A;  2KCW A;  1Z4R A;  2VEZ A;  2G0B A;  2AE6 A;  4M85 A;  3GYA A;  3R95 A;  1L0C A;  4YFJ A;  3DDD A;  4R3L A;  2FXF A;  3CXQ A;  1M44 A;  3QB8 A;  1S7F A;  3T9Y A;  4CS0 B;  1GHE A;  2R98 A;  5J8F A;  2Z10 A;  5KTA A;  4PSX A; 
#chains in the Genus database with same CATH topology
 2PJ5 A;  4EFD A;  1BAV A;  4ZY1 A;  4I49 A;  1QSN A;  2RC4 A;  3KAS A;  4KOY A;  4OC5 A;  2CTC A;  2OU2 A;  3WAB A;  4LQ6 A;  4QVT A;  2BCO A;  3FXT A;  2ZW5 A;  4GS4 A;  3G3S A;  1RO5 A;  3SI0 A;  3TOB A;  2EUI A;  3LOD A;  1IIC A;  3H8G A;  4NGR A;  2BL1 A;  2FE7 A;  4CYP A;  3T8W A;  3K9T A;  3CPX A;  1OZP A;  5F49 A;  3S9M A;  3DSB A;  2PR8 A;  4CYO A;  1Y9W A;  1J4J A;  4Q36 A;  4C7I A;  2C6C A;  1NE9 A;  5JH9 A;  1IB1 E;  1Q2Y A;  4M3S A;  2Z3O A;  5K8P A;  1F2O A;  2Q7S A;  2ZEE A;  4PXD A;  4UEE A;  4KUB A;  4KOT A;  3IGR A;  3S9N A;  2ZEP A;  4J3G A;  2Q7B A;  4KZT A;  2CNM A;  1XMT A;  2Q44 A;  1YVO A;  4UEF A;  3L2N A;  2FVG A;  3EY5 A;  4YGO A;  2Q43 A;  1ZG8 A;  3NE7 A;  2Q51 A;  1PU9 A;  3D2M A;  3SJE A;  4KLW A;  1YQE A;  1P0H A;  3FH4 A;  3HUV A;  4MCS A;  4MY3 A;  1IYL A;  3F8K A;  5F47 A;  4CAF A;  3VH9 A;  3FIX A;  2X7B A;  1MJB A;  3W6S A;  3I3G A;  3BLN A;  3CXP A;  2WYR A;  3V38 A;  3D4U A;  3QAY A;  4A30 A;  2PJ4 A;  3FNC A;  2R1I A;  1BLL E;  2B3U A;  3B3W A;  3W6X A;  3GKR A;  1TKF A;  1LCP A;  2PVW A;  4CGM A;  2EO8 A;  2ZW6 A;  2BUE A;  1PCA A;  2VZZ A;  4OC3 A;  3V7Z A;  4F0Y A;  3B35 A;  2POK A;  3BHX A;  4KVX A;  1B87 A;  2VXK A;  4UWI A;  5CBM A;  3DLJ A;  5AG5 A;  4CYN A;  5BWA B;  4E8O A;  4UWJ A;  1M4L A;  2PJ9 A;  4B11 A;  3LAC A;  1I21 A;  4MXU A;  4CRZ B;  1F57 A;  3JRU A;  3BI1 A;  1HDU A;  3B3S A;  3KQX A;  4B12 A;  2DXQ A;  1YLO A;  1TF9 A;  2B4D B;  1XJO A;  1AMP A;  2PE3 A;  3B3T A;  5LRK A;  1YGH A;  4MHZ A;  4OC0 A;  5IB0 A;  3KR4 A;  3R96 A;  3D67 A;  4ZX8 A;  3TO6 A;  3D7F A;  2J8N A;  2DPS A;  2P6E A;  2PJC A;  4MFZ A;  4P4E A;  5AGE A;  1TKJ A;  1S60 A;  1KUV A;  2CXA A;  4L8A A;  4AXV A;  4B10 A;  4DJL A;  2Z10 A;  3B7I A;  3S6F A;  4C68 A;  3PBE A;  1VHE A;  3KQZ A;  2AJ6 A;  3FVL A;  5HVF A;  2V8V A;  3FB3 A;  2O28 A;  3ZJ0 A;  4X3R A;  5DS0 A;  5EC4 A;  2ZOG A;  1VHS A;  3RBU A;  4UF4 A;  4AG7 A;  3D8P A;  4UBR A;  1Q2D A;  4BD9 A;  1CPX A;  3D3S A;  2DEA A;  4MBU A;  3EC4 A;  2PRB A;  1XBU A;  5KTC A;  2WPX A;  2AFO A;  3NH4 A;  4MHP A;  2PJ7 A;  5J1Q A;  3NFZ A;  4YRH A;  3BI0 A;  4PXE A;  4MCQ A;  4ZY0 A;  1LAM A;  1TIQ A;  2ZEL A;  3MGD A;  3TFY A;  1FT7 A;  4LQG A;  4OC1 A;  2OZU A;  3W91 A;  4YU9 A;  1ELL P;  4M6I A;  1XOV A;  1S3Z A;  4CGN A;  2C6P A;  3IFE A;  4ZBG A;  2CIJ A;  4NSQ A;  2PC1 A;  2B4B A;  3IU1 A;  3D7D A;  3T90 A;  4R9M A;  4ONU A;  2GRE A;  4B14 A;  2Z3L A;  4X5K A;  4QBJ A;  3PFO A;  2QIR A;  2C1C A;  4WJB A;  1VHO A;  1HDQ A;  2F5I A;  3F0A A;  1KUY A;  3IWW A;  3FBU A;  3IO1 A;  4W9Y A;  4C7H A;  3FMC A;  3SI2 A;  3D7G A;  4NGP A;  1AUG A;  3S6G A;  2B4D A;  2OR4 A;  2PJ0 A;  2Q4Y A;  4R87 A;  2FS5 A;  4IK2 A;  4A38 A;  4R57 A;  1R57 A;  2HQY A;  1QSM A;  4JXQ A;  3D68 A;  4F8Z A;  3CT9 A;  5J8C A;  4AVA A;  4MFP A;  4XPD B;  5ELY A;  1KZF A;  5A28 A;  4XPD C;  3D66 A;  4PPZ A;  2ZED A;  2J8M A;  3PB6 X;  5JM6 A;  4ZGY B;  2GAN A;  2EK9 A;  1ZO0 A;  3IU2 A;  5LRJ A;  5F46 A;  1IOF A;  4M6G A;  2ODF A;  3PBB A;  1Z9U A;  4WWV A;  4Y49 B;  1YW6 A;  4CGL A;  2HV2 A;  3RO0 A;  4OME A;  5F09 A;  3FX6 A;  4MRI A;  1Z8L A;  2EBJ A;  2PJ8 A;  3IJ3 A;  3WR7 A;  2EWB A;  3F5B A;  1S5K A;  3PGP A;  2BSW A;  1NSA A;  5LRG A;  3EXN A;  3WC6 A;  1DTD A;  5EBV A;  4AG9 A;  2B5G B;  4PK2 A;  2YNC A;  4OKO A;  4JYW A;  4X2T A;  4FWU A;  2B58 A;  2PR1 A;  3SJG A;  4Z65 A;  2PQ8 A;  4YWY A;  5A27 A;  1R3N A;  3ISX A;  3K2K A;  5LYD A;  4OC4 A;  4NGQ A;  3E0K A;  1U6M A;  4MFL A;  6CPA A;  2D4P A;  4JD6 A;  3TCV A;  4OLL A;  3A9L A;  4MFK A;  3RZA A;  2PCU A;  3FJU A;  2PSW A;  4KVM E;  4KSF A;  2YNE A;  2B5G A;  4MJ8 A;  4R8F A;  5EMI A;  4PXB A;  1WWZ A;  3B8G A;  4G1P A;  2PVV A;  3OWC A;  4AVC A;  3B3C A;  2JBK A;  5HXD A;  5IX3 A;  2J8R A;  3HLP A;  2RB7 A;  3PEI A;  4NJR A;  4B5P B;  2GLF A;  4A2Z A;  5JPH A;  2O53 A;  5I4M A;  4OIW A;  2Z3P A;  8CPA A;  3H8F A;  3RNZ A;  4B5O A;  1YX0 A;  2VI7 A;  1IOI A;  3DNS A;  4KSA A;  5LYL A;  2CY2 A;  1YK3 A;  1IGB A;  1QST A;  2Z3K A;  4IUS A;  4CRY B;  4QC6 A;  4CYQ A;  5I0C A;  3LMS A;  5IB9 A;  3G8W A;  3DR8 A;  3R9E A;  4II9 A;  3S9L A;  4NF1 A;  2QVP A;  1UWY A;  1ZLI A;  1YSJ A;  3GB0 A;  4BBH A;  2JDD A;  1ARM A;  2P6G A;  3FED A;  3TO9 A;  1YR0 A;  4KS9 A;  1YRE A;  1IU8 A;  1XFO A;  4JXR A;  2IMO A;  4F0X A;  3PP9 A;  3PB8 X;  4H2K A;  3R9F A;  3N5F A;  4PK3 A;  2REF A;  3H4Q A;  2GE3 A;  3FF3 A;  2VQY A;  5LYI A;  5JQ4 A;  5C82 A;  3WC5 A;  4FD7 A;  4UA3 A;  3D2P A;  1IY7 A;  3NH8 A;  5IV0 A;  2QEC A;  3KKW A;  4AVB A;  2DPT A;  1BPN A;  3H5Z A;  2PDO A;  2C6G A;  4KOR A;  3DR6 A;  4DYO A;  2IJZ A;  2CNT A;  3TC8 A;  3BJ8 A;  3IWE A;  5E96 A;  2GIV A;  3KGQ A;  3KL9 A;  2P0W A;  1IID A;  1XRY A;  4UEZ A;  2NYQ A;  4P6Y A;  1QSO A;  1DE4 C;  2PIZ A;  4JLY A;  1IYK A;  4BMH A;  1V0C A;  2PJA A;  4KVO E;  1Y7R A;  2VBQ A;  1VKC A;  4U9Y A;  4Q38 A;  4ZYQ A;  2G3T A;  1LAN A;  4U5Y A;  1UFH A;  3C26 A;  1RXT A;  1NMT A;  2CNS A;  1QSR A;  1SQH A;  2JEV A;  4NGN A;  4C2X A;  5G22 A;  4EWT A;  1H8L A;  2FCK A;  4FD6 A;  1X12 A;  4MCR A;  3PB4 X;  3IWG A;  4A39 A;  3VWE A;  4RI1 A;  3N7Z A;  2I79 A;  3IC1 A;  3P2H A;  2O4H A;  1Z8W A;  3ISZ A;  1PYT B;  4B6Z A;  2PIY A;  4F9U A;  1XE4 A;  4UIB A;  3NA6 A;  3SXN A;  4PSW A;  1K4J A;  1ZG9 A;  2PRQ A;  1YME A;  1PUA A;  3BJ7 A;  3CZX A;  3PZJ A;  2REE A;  4R3K A;  4EME A;  2ZXV A;  2ATR A;  1BPM A;  2HC9 A;  4UFX A;  1XF8 A;  2ZEH A;  1Y7E A;  2FL4 A;  3MN8 A;  4JWP A;  4FD4 A;  1Z4E A;  3JVN A;  4MMO A;  1LAP A;  3KI9 A;  4ZI6 A;  3P2F A;  2H5M A;  5HVG A;  4K30 A;  5G20 A;  1WK4 A;  2Z3N A;  1MJA A;  2HUZ A;  2ZW4 A;  4CAX A;  2WUU A;  4KUA A;  2RFH A;  1NSL A;  2CF4 A;  1RTQ A;  2BOA A;  2IL4 A;  3IEH A;  1MJ9 A;  2Q04 A;  1TXR A;  5C88 A;  3FEE A;  2XEJ A;  4HNY B;  4XNH C;  4P4J A;  1M4I A;  2GU2 A;  2PJ2 A;  2PJ1 A;  1A2Z A;  2FSR A;  4NXY A;  2WPW A;  4X8I A;  4EVY A;  1M4D A;  4AB7 A;  4NJQ A;  4O23 A;  1XIX A;  2QYV A;  2VZY A;  3RYO A;  4XPK A;  3TT2 A;  2PJ6 A;  1LFW A;  1S7L A;  1CM0 A;  4P4D A;  4P10 A;  4CGP A;  1OBR A;  5CNP A;  3V8I A;  2V8H A;  4QB9 A;  2K5T A;  4E0A A;  2CTB A;  4Y49 C;  3WT4 A;  2FT0 A;  1QMU A;  1Z2L A;  1ON0 A;  4KOU A;  2GLJ A;  5DWM A;  4K3N A;  3B2Y A;  4OAD A;  3S6H A;  2A4N A;  2BEI A;  3TO7 A;  1MK4 A;  3UY5 A;  3FEC A;  3EO4 A;  1XEB A;  3JUW A;  4H6U A;  3NH5 A;  3TOA A;  3CXS A;  4GM5 A;  4OAE A;  4FUU A;  2OZH A;  3VWD A;  1KWM A;  3TTH A;  1Y0Y A;  5H86 A;  1TKH A;  1R43 A;  3KHZ A;  4NGS A;  4CAE A;  4E2A A;  4ONW A;  4TWE A;  2Z11 A;  4R7M A;  4UCP A;  1S7N A;  2Q4V A;  3TE4 A;  2IQ6 A;  1CPS A;  2ZW7 A;  5JGF A;  4GXH A;  4PXC A;  4C2Z A;  2F7V A;  3H8E A;  4UFV A;  3SJF A;  5FVJ A;  2WSA A;  1CX8 A;  5AG7 A;  4A37 A;  4JJX A;  3PRT A;  4P44 A;  4NGM A;  2VL1 A;  5DWN A;  2AFS A;  2Y0M A;  4LUA A;  2EVN A;  2AFM A;  2QJ8 A;  4P45 A;  2ARH A;  4R6T A;  4QUS A;  3LWU A;  1M1D A;  1S7K A;  2BO9 A;  2JBJ A;  4MHN A;  4CPA A;  4M6H A;  2YNC C;  3KR5 A;  3I9S A;  5HH1 A;  4MY0 A;  4P4F A;  3S6K A;  3MRU A;  1CJW A;  4NEX A;  1N71 A;  2D4O A;  3IIB A;  4MCP A;  3TX8 A;  1KUX A;  4ORF A;  4HNW B;  4RN7 A;  5HMN A;  2FIW A;  4A32 A;  2OZG A;  4KOV A;  2GFQ A;  4NCZ A;  1CP6 A;  5H84 A;  2NMT A;  2JDC A;  2HB6 A;  3CDX A;  4B5P A;  2ABZ A;  3NE8 A;  1F2P A;  4LX9 A;  3GUX A;  4RUH A;  1JQG A;  1HEE A;  1VGY A;  2PJB A;  3D7H A;  4A94 A;  2NSM A;  1B6B A;  2ZOF A;  4KSI A;  2R8V A;  4KOS A;  1FNO A;  2JEW A;  2WZN A;  2AFW A;  1CBX A;  2I3C A;  3EFA A;  4IAV A;  4OID A;  1Z5R A;  2OB0 A;  4Q7A A;  3SHP A;  2QML A;  4KLV A;  3FRM A;  1BOB A;  4NFR A;  5F48 A;  1LOK A;  1BO4 A;  2C27 A;  3SI1 A;  4ZY2 A;  4KOW A;  5KTD A;  1AYE A;  2G3A A;  4A95 A;  4F9V A;  4H6Z A;  3KZW A;  4RS2 A;  4MFJ A;  1QQ9 A;  2ANP A;  4UCN A;  7CPA A;  2JLM A;  4HNX B;  1CP7 A;  1Y0R A;  2ZPA A;  1YW4 A;  1YLE A;  2OOT A;  4CAW A;  4IF5 A;  4ZX9 A;  5HVH A;  5LYF A;  2R7H A;  2ZEO A;  1TF8 A;  3CPA A;  1GYT A;  4FD5 A;  2ZEG A;  1XMB A;  5THW A;  1YVK A;  2V8D A;  2ZEM A;  1M4G A;  4C2Y A;  2EK8 A;  3RAM A;  4NGT A;  1EE3 P;  2Q0Y A;  3SXO A;  1Y9K A;  2XEF A;  4FBE A;  1ARL A;  2Z0Z A;  2AFU A;  1X10 A;  4B13 A;  5D8N A;  2ZEF A;  3I1U A;  3GY9 A;  1I12 A;  3BXM A;  4PV6 A;  4MHD A;  5GCN A;  5K8O A;  4KOX A;  4R76 A;  1I1D A;  3VAT A;  5AG6 A;  4DNC A;  3GIU A;  2PJ3 A;  3R1K A;  3PB9 X;  5G1Z A;  1LRZ A;  2B3V A;  4FAI A;  4MI4 A;  4F6A A;  3LD2 A;  3PFE A;  2V8G A;  1P4N A;  3KHX A;  2P6F A;  1Z8T A;  4DUK A;  4L89 A;  2FIA A;  3WC7 A;  5CPA A;  4XPL A;  2AFZ A;  4U9Z A;  2OH1 A;  4BIN A;  4TNU A;  2Z3M A;  3DGV A;  2F8H A;  2AFX A;  5ISV A;  5D29 A;  4A31 A;  2V77 A;  3ZZI A;  2XEG A;  1ZLH A;  4CAV A;  2ZEN A;  2YND A;  4OP4 A;  4HPS A;  5K8M A;  4H89 A;  2I00 A;  4HKF A;  4PQA A;  3K9U A;  3R9G A;  3QAH A;  1CG2 A;  1Z8X A;  2J9A A;  3QNV A;  4JZ0 A;  5G21 A;  1Q2C A;  4UFW A;  4P4I A;  4XNH B;  3FYN A;  2KCW A;  3JTK A;  1Z4R A;  3VAR A;  3SJX A;  2VEZ A;  2DF5 A;  2G0B A;  2AE6 A;  4M85 A;  3GYA A;  4OC2 A;  3R95 A;  4P4B A;  1L0C A;  1ELM P;  4MHY A;  4UIA A;  4YFJ A;  5K8N A;  4MFQ A;  3B3V A;  3DDD A;  4R3L A;  2XEI A;  2YGW A;  2FXF A;  3CXQ A;  3GLJ A;  1M44 A;  4CGO A;  1Q7L A;  3QB8 A;  1S7F A;  2G9D A;  3T9Y A;  4CS0 B;  2Q4Z A;  1VIX A;  1GHE A;  1ZG7 A;  5AG4 A;  4UCM A;  3PB7 X;  2R98 A;  4IHM A;  5J8F A;  1FY7 A;  4A33 A;  5KTA A;  1JWQ A;  4PSX A; 
#chains in the Genus database with same CATH homology
 4I49 A;  1QSN A;  2RC4 A;  4KOY A;  2OU2 A;  4QVT A;  3FXT A;  2ZW5 A;  4GS4 A;  3G3S A;  1RO5 A;  3TOB A;  2EUI A;  3LOD A;  1IIC A;  2BL1 A;  2FE7 A;  4CYP A;  1OZP A;  5F49 A;  4CYO A;  3DSB A;  2PR8 A;  1Y9W A;  1J4J A;  4Q36 A;  4C7I A;  1NE9 A;  1IB1 E;  1Q2Y A;  4M3S A;  2Z3O A;  4KUB A;  4KOT A;  3IGR A;  4J3G A;  2Q7B A;  4KZT A;  2CNM A;  1XMT A;  2Q44 A;  1YVO A;  3EY5 A;  4YGO A;  3NE7 A;  1PU9 A;  3D2M A;  4KLW A;  1P0H A;  5F47 A;  4MY3 A;  1IYL A;  3F8K A;  4CAF A;  3FIX A;  2X7B A;  1MJB A;  3W6S A;  3I3G A;  3BLN A;  3CXP A;  4A30 A;  3FNC A;  2R1I A;  2B3U A;  3W6X A;  3GKR A;  4CGM A;  2ZW6 A;  2BUE A;  2VZZ A;  4F0Y A;  4KVX A;  1B87 A;  2VXK A;  4UWI A;  5AG5 A;  4CYN A;  5BWA B;  4E8O A;  4UWJ A;  4B11 A;  1I21 A;  4CRZ B;  4B12 A;  2DXQ A;  2B4D B;  1YGH A;  5IB0 A;  3R96 A;  3TO6 A;  2J8N A;  2DPS A;  2P6E A;  4MFZ A;  5AGE A;  1S60 A;  1KUV A;  2CXA A;  4L8A A;  4B10 A;  4C68 A;  3S6F A;  2AJ6 A;  3ZJ0 A;  3FB3 A;  2O28 A;  5EC4 A;  1VHS A;  4AG7 A;  3D8P A;  4UBR A;  1Q2D A;  3D3S A;  4MBU A;  3EC4 A;  2PRB A;  5KTC A;  2WPX A;  4YRH A;  1TIQ A;  3MGD A;  3TFY A;  2OZU A;  3W91 A;  1S3Z A;  4CGN A;  4ZBG A;  4NSQ A;  2PC1 A;  2B4B A;  3IU1 A;  3T90 A;  4R9M A;  4ONU A;  4B14 A;  4QBJ A;  2Z3L A;  4X5K A;  2QIR A;  2F5I A;  3F0A A;  1KUY A;  3FBU A;  4C7H A;  3S6G A;  2B4D A;  2Q4Y A;  4R87 A;  2FS5 A;  4R57 A;  1R57 A;  2HQY A;  1QSM A;  4JXQ A;  4AVA A;  4MFP A;  4XPD B;  1KZF A;  5A28 A;  4XPD C;  2J8M A;  4ZGY B;  2GAN A;  5F46 A;  1ZO0 A;  3IU2 A;  1Z9U A;  4Y49 B;  4CGL A;  2HV2 A;  3WR7 A;  3F5B A;  1S5K A;  3PGP A;  2BSW A;  3EXN A;  5EBV A;  4AG9 A;  2B5G B;  4PK2 A;  2YNC A;  2B58 A;  2PR1 A;  2PQ8 A;  5A27 A;  3E0K A;  1U6M A;  4MFL A;  2D4P A;  4JD6 A;  3TCV A;  4OLL A;  3A9L A;  4MFK A;  4KVM E;  2PSW A;  4KSF A;  2YNE A;  2B5G A;  4MJ8 A;  1WWZ A;  3B8G A;  3OWC A;  4AVC A;  5IX3 A;  2J8R A;  4B5P B;  5JPH A;  4A2Z A;  2Z3P A;  4B5O A;  1YX0 A;  2VI7 A;  3DNS A;  4KSA A;  2CY2 A;  1YK3 A;  1QST A;  2Z3K A;  4IUS A;  4CRY B;  4QC6 A;  4CYQ A;  5I0C A;  3G8W A;  3DR8 A;  3R9E A;  4II9 A;  4NF1 A;  4BBH A;  2JDD A;  2P6G A;  3TO9 A;  1YR0 A;  4KS9 A;  1YRE A;  4JXR A;  4F0X A;  3PP9 A;  3R9F A;  4PK3 A;  2REF A;  3H4Q A;  2GE3 A;  2VQY A;  5JQ4 A;  5C82 A;  4FD7 A;  4UA3 A;  3D2P A;  5IV0 A;  2QEC A;  3KKW A;  4AVB A;  2DPT A;  3H5Z A;  2PDO A;  4KOR A;  3DR6 A;  2CNT A;  3IWE A;  3BJ8 A;  5E96 A;  2GIV A;  2P0W A;  1IID A;  1QSO A;  4JLY A;  1IYK A;  4BMH A;  1V0C A;  4KVO E;  1Y7R A;  2VBQ A;  1VKC A;  4U9Y A;  4Q38 A;  2G3T A;  4U5Y A;  1UFH A;  3C26 A;  1RXT A;  1NMT A;  2CNS A;  1QSR A;  1SQH A;  2JEV A;  4C2X A;  5G22 A;  1FY7 A;  2FCK A;  4FD6 A;  3IWG A;  3VWE A;  4RI1 A;  3N7Z A;  2I79 A;  3P2H A;  1XE4 A;  3SXN A;  4PSW A;  1K4J A;  1PUA A;  3BJ7 A;  3PZJ A;  2REE A;  4R3K A;  2ZXV A;  2ATR A;  4UFX A;  1XF8 A;  2FL4 A;  4JWP A;  4FD4 A;  1Z4E A;  3JVN A;  3P2F A;  2H5M A;  4K30 A;  5G20 A;  1WK4 A;  2Z3N A;  1MJA A;  2HUZ A;  2ZW4 A;  4CAX A;  2WUU A;  4KUA A;  1NSL A;  2IL4 A;  1MJ9 A;  2Q04 A;  5C88 A;  4HNY B;  4XNH C;  1M4I A;  2FSR A;  4NXY A;  2WPW A;  4EVY A;  1M4D A;  4AB7 A;  1XIX A;  2VZY A;  3RYO A;  3TT2 A;  4XPK A;  4CGP A;  1S7L A;  1CM0 A;  3V8I A;  5CNP A;  4QB9 A;  2K5T A;  4E0A A;  4Y49 C;  2FT0 A;  1ON0 A;  4KOU A;  5DWM A;  4OAD A;  3S6H A;  2A4N A;  2BEI A;  3TO7 A;  1MK4 A;  3UY5 A;  3EO4 A;  1XEB A;  3JUW A;  4H6U A;  3TOA A;  3CXS A;  4OAE A;  2OZH A;  3VWD A;  3TTH A;  5H86 A;  4CAE A;  4E2A A;  2Z11 A;  4UCP A;  1S7N A;  2Q4V A;  3TE4 A;  2ZW7 A;  4C2Z A;  4UFV A;  5FVJ A;  2WSA A;  5AG7 A;  4JJX A;  5DWN A;  4LUA A;  2Y0M A;  2EVN A;  2ARH A;  4QUS A;  1M1D A;  1S7K A;  2YNC C;  3I9S A;  5HH1 A;  4MY0 A;  3S6K A;  1CJW A;  4NEX A;  1N71 A;  2D4O A;  1KUX A;  4ORF A;  4HNW B;  5HMN A;  2FIW A;  4A32 A;  2OZG A;  4KOV A;  4NCZ A;  5H84 A;  2NMT A;  2JDC A;  4B5P A;  4LX9 A;  1B6B A;  2R8V A;  4KOS A;  5J8C A;  3SHP A;  3EFA A;  2OB0 A;  2QML A;  4KLV A;  3FRM A;  1BOB A;  5F48 A;  1BO4 A;  2C27 A;  4KOW A;  5KTD A;  2G3A A;  4A95 A;  4H6Z A;  4RS2 A;  4MFJ A;  4UCN A;  2JLM A;  4HNX B;  2ZPA A;  1YLE A;  4CAW A;  4IF5 A;  2R7H A;  4FD5 A;  1YVK A;  1M4G A;  4C2Y A;  3SXO A;  2Q0Y A;  1Y9K A;  2Z0Z A;  4B13 A;  3GY9 A;  1I12 A;  4PV6 A;  5GCN A;  4MHD A;  4KOX A;  1I1D A;  5AG6 A;  4DNC A;  3R1K A;  5G1Z A;  1LRZ A;  2B3V A;  4MI4 A;  4F6A A;  3LD2 A;  1P4N A;  2P6F A;  4L89 A;  2FIA A;  4XPL A;  4U9Z A;  2OH1 A;  2Z3M A;  5ISV A;  4A31 A;  3ZZI A;  4CAV A;  2YND A;  4H89 A;  2I00 A;  4HKF A;  3R9G A;  3K9U A;  3QAH A;  5G21 A;  1Q2C A;  4UFW A;  4XNH B;  3FYN A;  2KCW A;  3JTK A;  1Z4R A;  2VEZ A;  2G0B A;  2AE6 A;  4M85 A;  3GYA A;  3R95 A;  1L0C A;  4YFJ A;  4MFQ A;  3DDD A;  4R3L A;  2YGW A;  2FXF A;  3CXQ A;  4CGO A;  1M44 A;  3QB8 A;  1S7F A;  3T9Y A;  4CS0 B;  1GHE A;  5AG4 A;  4UCM A;  2R98 A;  5J8F A;  2Z10 A;  4A33 A;  5KTA A;  4PSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...