1UFMA

Solution structure of the pci domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
84
Chain Sequence
GSSGSSGGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COP9 complex subunit 4
publication title Solution structure of the PCI domain
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 16
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2003-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ufmA00
3QP5A 3EQLF 3GFIA 4A5MA 1TW2A 4XLNF 2H6CA 4BAYA 4P9FA 3JW4A 4L5IA 1SD6A 3FX3A 3MAJA 1DP7P 2IT0A 2FXAA 3ISPA 1W7PB 2HWVA 1ON1A 1SD4A 3SZPA 1Z7UA 1W5TA 2MLGA 2IVMA 5BQTA 1V3FA 5L3EA 2FE3A 2Z3YA 1Z91A 3V7CA 3KP3A 2HOEA 3GF2A 3R0AA 2L4MA 1MDMB 4ZYGA 5IT9Z 2XIGA 1PDNC 2DW4A 4G7HF 2LKPA 2CQKA 1T6SA 2JPBA 5HS9A 1BM9A 5CVRA 2O8XA 5BPIA 5E1XA 4L9VA 2CG4A 3C18A 1IZ1A 2M87A 1LEAA 3HRSA 3TGNA 4HW0A 1R22A 4HZFA 4R79A 3KEOA 2IA0A 3WU1B 3IRRA 4EV0A 5D6EA 1XB4A 2DQRA 1MJ9A 2B0LA 1RZ4A 1XMKA 4WX9A 3L09A 2DFIA 3QPTA 3TOAA 3F8MA 2YR2A 3T8RA 1CGPA 4B8XA 1PP7U 4G8XA 4JK1X 2DI3A 1OMIA 3TO9A 3ELKA 5L3CA 4L18B 3RJPA 4OMYA 4UXNA 4HOBA 1FX7A 1WI9A 2VOPA 4GXOA 5LEJA 4M9XA 1USTA 5HDNA 2H09A 1FP1D 2FA5A 3JTGA 2ZFWA 4U7DA 4EJOA 3IRQA 1IXRC 3CUOA 4L5JA 3HOTA 1F9NA 2GQQA 2VE9A 3M1EA 4GCVA 3FXQA 3HHGA 5BOXA 1S6LA 3E6CC 4HQMA 2EJRA 1DPRA 1XSDA 4LJZF 2M45A 5KVRA 5L3FA 3P9CA 2VBZA 3HSRA 2EV6A 2KKOA 2QM3A 4ZZDA 4I09A 4LLNA 1H9TA 1BOAA 2EFNA 3HHHA 4EGZA 4CDGA 4U0VA 4QWQA 1GVJA 4ZYHA 2RQPA 1G3YA 3M8EA 3ML6A 2Z5UA 2O6GE 3LAJA 3BJAA 1B6AA 4AWXB 4BHCA 2ELHA 2ZXJA 6PAXA 2PFBA 3CTAA 5HLGA 4HF2A 4G7ZF 2XROA 4E70A 1JHFA 3N4MA 3ERED 1XGOA 3E6BA 3WTWC 4I2OA 2IW5A 1D3YA 3S2WA 1D5VA 5BPDA 4M72A 2P8TA 3QP6A 4HQEA 4HV6A 1O3SA 2A5YB 1RUOA 4WXDA 3W6KB 2O0YA 2CYYA 4HX7A 2VBXA 3IWFA 4A0XA 2L4AA 3MEXA 4CICA 3MCZA 4L9NA 2XKPA 5D8LB 1FSEA 2HZTA 1XDSA 1EH6A 4BNCA 1I5ZA 2UXXA 4MNUA 4ZYDA 1QBJA 3HYIA 3ULQB 4H0EA 2FRHA 3F21A 5H6RA 4UV9A 3HSFA 1O3RA 3FWEA 4RB1A 3AAFA 5D6FA 4R1HA 1HW1A 3WTTC 3MFKA 2W84A 2XASA 1F4KA 2XKOA 3IL2A 1ZHFA 5J6XA 3VODA 3HRUA 5E18F 1MDMA 1ZG3A 4EM2A 2D2WA 2MH9A 4I0BA 5H20A 1JHHA 1U5TB 3KP5A 5LGNA 4M6YA 1R00A 5ILUA 2O3FA 1ZG1A 2HYGD 2XHKA 4IRGA 5FGMA 5FLXZ 3U2RA 5LHGA 2DT5A 3QAHA 2IPQX 1B59A 1RI7A 3I59A 1OYIA 3MZYA 4MTEA 3RTRA 3KZZA 2Z99A 3F22A 2KJBA 2CGPA 3JAMK 2RNJA 1RNLA 2DTRA 4ASNA 2R7FA 3V4GA 1VTNC 1HW2A 3HSEA 3BP8A 2D45A 3PQKA 2BEOA 4KYWA 2COMA 3R0JA 3BOQA 3V7RA 4HDVA 2LDUA 3EYIA 3LWFA 1O3TA 1BI0A 5F64A 3ZQ7A 5JFRA 1DUXC 1U8RA 4L9TA 2E1NA 4P9UA 3C1DA 1T38A 2P7CB 2CW0F 3E5UA 3Q5FA 5D5XB 4MGRA 1BIBA 2EWNA 4WF2A 4PCQA 2KIFA 5TRDA 2CSOA 2Y48A 4U0WA 5CJ9A 1IN4A 1TNTA 5D4RA 1H9GA 2ADUA 3GFLA 4U0YA 1SFUA 1QQIA 2YU3A 1P2FA 3GZ6A 4UUVA 1HXDA 4IRIA 3F72A 2DO7A 5CYVA 2NAZA 5BMZA 1YG2A 1F1ZA 2ETHA 4ENNA 1QZZA 4ZYEA 3ZMSA 1FOKA 4EMSA 5DUKA 1S7OA 2YX4A 3GVAA 4LLLA 2D1VA 4GO1A 1BC7C 1WQ2A 2QQBA 1YLFA 3FMQA 3WTZA 4KN4X 5AIQA 2H6BA 1G6NA 3GLXA 1I1GA 2P4WA 2EFOA 4BYYA 2K4BA 3IKVA 2YSRA 4A6EA 5LBQA 2BGCA 3LA7A 3J81K 1T98A 1Z05A 3L7WA 4YIIA 2HS5A 3WTVC 2M30A 2XAFA 2MD5A 4BH9A 3E3VA 1LVAA 5DD4A 5LRRA 1MZBA 3T5XA 2HQNA 2K86A 4LK0F 3F6VA 3TO7A 4O3MA 4AVPA 4GYIA 5HLIA 4G6QA 2IP2A 1KYWA 3F3XA 3E5QA 4YFXF 3I4PA 3RKXA 5IT3A 2XAJA 3QRFF 4NQWA 5KK1A 3WGHA 4UVCA 1U6GA 2QQ9A 2NNYA 2Q8KA 2P5LC 4RGSA 1HW5A 2PLYA 3EETA 2LF8A 1O3QA 2OA4A 2DU9A 5LRSA 2RV8A 3VOEA 3MQ0A 1B9NA 2EA2A 3DXJF 4UV8A 1ZRDA 2TDXA 3GO5A 1EH7A 3KLOA 4CXFA 3Q9SA 1QNTA 4RAYA 3WODF 2FU4A 2ZMEA 5D5WB 4OIPF 3BROA 1G4DA 1AWCA 1WWXA 1T2KA 1TTYA 4I98B 1L0OC 4A5NA 1WSUA 2VN2A 3KEQA 2GZWA 1U5TA 2ZO4A 3ZMTA 3QPHA 3I58A 2F2EA 1S3JA 3NEUA 2AXLA 4P96A 1BN5A 2CFXA 5ILVA 4KMUX 4HDUA 2A6HF 1FC3A 2JSCA 3N97A 3B02A 1G3TA 1LNWA 5HS7A 1SFEA 5BS6A 1P4AA 3FXUA 3QU3A 2F5DA 4UVBA 3PFIA 1UB9A 3RKWA 1YIOA 1SD7A 3VFZA 5LGTA 4RGRA 3I54A 1HSTA 1R5GA 3B73A 4KT5C 2HFHA 2DPDA 2R3SA 4UNOA 1U5TC 4A0ZA 1R1UA 2V79A 1J59A 1B9MA 3I59B 3R61A 4MQVA 1ZARA 2GIVA 1IN8A 4YFNF 1T39A 3IKTA 3I53A 1IUYA 3F8NA 3RYRA 2V1UA 5FD6A 4ENKA 4N0BA 3CUQA 2ZNZA 2ZCWA 4YG2F 3GX4X 5D5UB 2KIMA 4KN7X 1U78A 1J75A 4AIKA 4DNCA 1FYLA 2C6YA 5EEHA 1R5HA 3BWGA 3BJ6A 3WTUC 4EGYA 1MJBA 1KA8A 3KFWX 3J80K 2L01A 3LSTA 4ZH4F 1YW8A 1XSVA 3G3ZA 3K1NA 3H3UA 1K7AA 4HF1A 5DCMA 2E1CA 2FOKA 3WGIA 5F1RA 5ICEA 4PZJA 5JI6A 3I5UA 5E8IA 3CUQC 3DFGA 1YO5C 4S05A 1E17A 1STZA 3LQRA 5AONA 3OV8A 2GA2A 3F6OA 1H0MA 2DK8A 1NHAA 3ECHA 3GW2A 3C3WA 1HKTA 1L3LA 2KRFA 1HQCA 2DLLA 3O3KA 3R4KA 4KDPA 2E7WA 1E2XA 2IA1A 2ZKZA 4A0YA 3ECOA 1Z1DA 4AD9A 4EJWA 2EK5A 3U1DA 4G7OF 3V7SA 2Y0MA 3DKWA 2JTVA 3GFJA 4LB6B 4KNYA 5K5OA 3K1MA 1XSXA 2V9VA 2A61A 5HS8A 4WK8F 3KZYA 2DPUA 4HA8A 2PEXA 2QVOA 1IRGA 1QPMA 1GXPA 3JTHA 3LFKA 3E6DA 1JXSA 3KLNA 2M8EA 3BZ6A 4S04A 2Q2EA 4HX4A 1R1TA 2PBIA 2QENA 3K69A 4KIGA 4IHSA 3F23A 1REPC 4XRFA 3CO7C 1XGMA 1MGTA 1J0RA 2V1XA 2VXZA 3HTSB 3NQOA 1A04A 3DPLC 2AS5F 2RVCA 1Z9CA 3DP7A 1OYYA 2OZUA 3T0YA 3CDHA 3BPXA 4G94A 3R60A 1LEBA 1DDNA 1YYVA 4IHTA 2VT3A 3BY6A 1CF7B 1K6OA 2H27A 4JQFA 3BJOA 3FXRA 1LQ1A 3RPQA 1ZAOA 1S7AA 4M73A 3FM3A 1V4RA 1YW7A 1FY7A 2ZMEB 2RDPA 2PQ8A 1J5YA 1FPQA 2QYOA 3R6SA 3JSPA 2HEOA 5IT9K 4OINF 4L0YB 3FM5A 1KQ8A 2VC1A 4KFCA 2EFWA 1YTYA 2FEZA 5A2QZ 1FSHA 2Z33A 4N9HA 1PP8F 1XDUA 5LHIA 3P7NA 3TDUC 2M1BA 3GXOA 4IF4A 3WG9A 3CO6C 4A12A 1XCVA 5DDGA 3E5XA 4I01A 1OR7A 4BHBA 1Y0UA 1KU2A 2J5PA 1R23A 2XUBA 2VODA 1FLIA 2NYXA 2GXBA 1X3UA 3I64A 3DPTA 4Z2YA 1I27A 5E20A 2OD5A 5D4SA 3KP7A 1IN6A 3VEPA 4GGGA 3BPVA 3IHUA 2PG4A 2XAQA 1ZGAA 3CUQB 1P4XA 2KJCA 1ZG5A 4I0AA 2K4JA 2O61A 3IC7A 4XLPF 3M8FA 4LD5A 5HOOA 5DD8A 4ESBA 5TJJA 2P5VA 5FD5A 3LQQA 1AOYA 4Y13A 1QGPA 4HX8A 3KETA 3SQNA 1ZREA 1YS6A 2V6CA 1FP2A 1KYZA 2Q0OA 3TO6A 2F5FA 1EH8A 2P6SA 5DCMB 1FNNA 2V1DA 4P55A 2IJLA 4O5VA 1LB2A 4HV5A 2ISZA 4GYGA 4WWCA 4EM0B 2Y75A 4DQ2A 3SFZA 1QO0D 3PQJA 4JBAA 4OIRF 4IVNA 1K78B 4TV7A 3K1PA 5CVIA 5DUIA 4CO8A 5HDKA 3FF5A 4CHUA 5HLHA 2QUFA 5ICGA 1BBYA 2XVCA 2RN7A 4ON0A 2K27A 2K02A 1BC8C 4IPAA 3D0SA 4U7BA 2HYFA 1LJ9A 1YW9A 5FO5A 2GA1A 3IWZA 2HKXA 1LDKB 1MJAA 3WTSC 2ISYA 5E8GA 2JT1A 5FB2A 5K1YA 2VC0A 2XAHA 2P5KA 3GUDA 2EB7A 5DCFA 2Z9OA 1SD5A 3DEUA 2CWEA 2XV4S 3EDPA 4U88A 1ZLJA 4OU0A 5HDGA 1CF7A 3GEZA 1IRFA 3SXYA 2DK5A 1XN7A 1HKSA 2W25A 4YIFA 3WGGA 4A2UA 3TQNA 2QWWA 5ICFA 4HBLA 1JGSA 1FWZA 4WCGA 2X4HA 3WE3A 4OMZA 3V8LA 3KP6A 1LDJA 1B1BA 3FZVA 1SAXA 3L00A 3H92A 2OQRA 1TNSA 2G7HA 4Y17A 1UFMA 3K9TA 2F5EA 3C7JA 2ESNA 2F5CA 4KA4A 4OIOF 2WTEA 2VE8A 1G3SA 1R7JA 2QBYB 3WU0A 2X0LA 3P9IA 5JVTA 4KIFA 2JRTA 1JE8A 3KCCA 4LLGF 1R36A 1B4AA 1FBQA 1C0WA 5FLXK 2RKHA 4M9SA 1W4MA 5A2QK 1IF1A 5E17F 5H6QA 1YQAA 2VOOA 1FBUA 4AIHA 2WWYA 5E1WA 1O57A 1ZN2A 3MWMA 3KP4A 4M71A 4IXAA 2QQAA 2UXNA 4UVAA 2ACJA 3ZN0A 2H94A 2O03A 4Y15A 4XBFA 5LGUA 2NRAC 3ZPLA 2STTA 2HGCA 4OIQF 1KQ9A 2ESHA 1XCBA 2XAGA 2FNPA 2NS0A 3CJNA 4BQAA 4NHJA 3RDIA 3DF8A 1KU9A 1BI3A 4PGGA 1ON2A 2VBYA 1ZH5A 2R7DA 2HDCA 2FF4A 2OBPA 2BBYA 1ZRFA 1IXSB 3GWZA 1Z6RA 3JAMZ 1W5SA 5ED4A 1FZPB 1HBXG 5JHUA 3K2ZA 5DEQA 2EFQA 4LGWA 4ETSA 3KP2A 4MQ9F 4HYEA 5E1ZB 2G7UA 2STWA 5CLSA 3RKYA 4A6DA 1D8KA 5EEGA 3ZP5A 2YX7A 4EJTA 1FYKA 3RYPA 4ENMA 3OOPA 1S29A 4FT8A 1MKMA 4HF0A 4AIJA 4IJAA 4F7ZA 4P5OA 2PMHA 1ONVA 4G9YA 3F8FA 5JR3A 2FMYA 3SZTA 4L9JA 5CVJA 1UCRA 3HRMA 1U3EM 3QOPA 1G3WA 4BHPA 2D1HA 3KE2A 3VB2A 2L3DA 4RS8A 1LDDA 1K78A 3ROUA 3ZMUA 2RGVA 2GXGA 3GYHX 2FMLA 2ZJ2A 1HSJA 3TDZC 4OOIA 2FNAA 2MH2A 1TQIA 1USSA 1XMAA 5L3DA 2BE5F 2WC2A 4NB5A 1ZRCA 1UHMA 5LHHA 5ERIA 4FHTA 3WTYC 1GHCA 1P4WA 2FBHA 1KGSA 5ILSA 4PGHA 2MLKA 3K0LA 1OYWA 2HTJA 1ODDA 1P6RA 3M7GA 3J81Z 1TQPA 2FBKA 2BYVE 2XRNA 1S8NA 2PMUA 3FMRA 4CGZA 2IA2A 1RIOH 3QU6A 4LFUA 4LK1F 2L02A 4PDKA 4ESJA 3ZN1A 2PJPA 3RPUA 1FT9A 4FX0A 2KIUA 4EVIA 3LA2A 4MHGA 2UZKA 1UHWA 1D8JA 4B09A 1KQ0A 1XGSA 2GAUA 1EV7A 3FHZA 5D5VB 2NNNA 1F5TA 1J9IA 2JZYA 5HVQC 5K5RA 2PN6A 4CZZA 1BJAA 4HLXA 4Q47A 1BI2A 2FBIA 1ZGJA 3U9GA 4M74A 2WV0A 3F8CA 2LF7A 4M9ZA 2QBYA 5D8KB 3F8BA 2G9WA 3V8JA 1OPCA 1P92A 4LG0B 5K5QA 2M5WA 1XD7A 2FSWA 2FQ3A 5DV5A 1SMYF 4RB3C 1W7PA 3GFMA 1TQMA 3ZMDA 2MA3A 1I6XA 1ZLKA 2DQLA 1DPUA 4XSZF 2EV5A 4BXUA 4M6XA 3V8KA 2OAZA 4K2EA 2IRFG 2OZ6A 4XSXF 4MTDA 4ZZLA 1FYMA 3FMSA 1SFXA 3EUHA 1RUNA 3NRVA 4LB5A 3HUGA 3E6MA 5J8CA 5L3GA 1WKMA 1XGNA 2OQGA 2OU2A 2VONA 4HLYA 5L3BA 5LLQA 1BI1A 1R1VA 1MD0A 3GZ5A 3L9FA 2MC3A 2QLZA 1O7LA 2DBBA 4EM1A 2JPCA 3I71A 2ZNYA 4ESFA 1TW3A 5ICCA 1U2WA 4RGXA 1Z6TA 3HRTA 1KU3A 1GXQA 2EV0A 1IN7A 2LNBA 3O2PE 2VT2A 3RIRA 3LAPA 3L2CA 2J5OA 1FBSA 2HKOA 4KICA 3JSOA 2EA4A 1TBXA 5FFZA 4KUMA 1YFHA 3HIFA 1KU7A 3T8TA 4KIBA 4KMFA 3J7AO 3W6JB 3M9AA 4MEYF 3O6BB 1J7KA 1Q1HA 2DAOA 3LA3A 4RB0A 5AIPA 3HOSA 4N9IA 1HKQA 5CVVA 3RI4A 2XGXA 1IXCA 3WE2A 1WRJA 4G6DA 4LMYA 2LSOA 4CYDA 3ZMZA 3DV8A 2HQRA 3ABUA 4IRHA 3J80Z 2P7VB 5CVUA 2EFPA 3HTUA 4YFKF 2GWRA 5LEKA 2P6TA 1SMTA 2ZBKA 5F6FA 3T1BA 2YPRA 1I1SA 2HTSA 2W24A 1PUEE 4Q4ZF 5FFXA 4Q48A 4ENJA 4RGUA 3MZHA 1IAWA 4Q5SF 1K79A 1QZYA 4L0ZB 2A07F 5DYMA 1O7FA 2W85A 4I02A 4I7HA 2MBFA 3ZMVA 2A3SA 4RAZA 1R58A 3Q9VA 2A68F 1T0FA 1BIAA 3CLOA 3WTXC 1ZYRF 3COAC 4D0PA 1IW7F 2QZ8A 4EJVA 1OKRA 2VBWA 3BDDA 4EJUA 2A6EF 4QLCU 3E97A 3H3ZA 2L54A 3ABTA 4UHTA 4FX4A 4RB2C 2K7LA 2CO5A 4MEXF 1IN5A 3D5LA 1W7PD 2E7XA 2W57A 3I0TA 4WXHA 3DQVC 4EQQA 1ULYA 3EYYA 4WXCA 3SHFA 4O6JA 2BV6A 3G73A 4HAMA 5J8FA 2A69F 3REOA 3TKYA 2UWMA 1J2XA 3P9KA 4LG0A 2HR3A 1YS7A 2RC4A 3TOBA 1TLHB 4R8HA 2PI0A
chains in the Genus database with same CATH superfamily
2Y0SN 1XX5A 3QP5A 1E0EA 3EQLF 1FIAA 1U9NA 5DTDA 4PFPA 3GFIA 4A5MA 1JKQC 1TW2A 2EQRA 2H6CA 4XLNF 4BAYA 3DBHB 2W4SA 4P9FA 3JW4A 2DA1A 1B8IB 4IQ4A 4L5IA 1SD6A 2W7NA 1XTAA 3FX3A 3MAJA 2P0WA 1DP7P 2VJIA 1D0ZA 5F0FA 2IT0A 2FXAA 3ISPA 4PFOA 1W7PB 2HWVA 1ON1A 3D5SC 3PUBA 2R7ZJ 1SD4A 1IV6A 3OYMA 3SZPA 4J00A 1Z7UA 1W5TA 4BACA 2MLGA 2IVMA 2QKMB 1EF4A 2F4MB 4ABZA 5BQTA 1RR8C 1V3FA 2X1CA 5L3EA 1YX3A 2FE3A 2Z3YA 3S32A 2ZSIB 3QWLA 1Z91A 3V7CA 3KP3A 2HOEA 3F0CA 5JLWA 3GF2A 3R0AA 3K4MA 2L4MA 2QGUA 1MDMB 1ACIA 1YX5A 1A6QA 3QPSA 5F1JA 4ZYGA 2DMNA 5IT9Z 2XIGA 2GOMA 3Q0UA 1PDNC 2DW4A 4ZJZA 4G7HF 2LKPA 2CQKA 2O8KA 4IHXA 5B66C 1T6SA 2JPBA 5HS9A 2EZIA 4KISA 3S15J 1BM9A 1WH7A 2DN0A 3BR2A 5FRMA 5CVRA 2O8XA 5BPIA 5E1XA 4L9VA 2CG4A 3H5AA 3C18A 1IZ1A 2M87A 4ZC3A 1LEAA 3HRSA 3TGNA 1MBGA 2DJIA 3HUGB 2KMUA 4C30A 4HW0A 1R22A 4HZFA 1SFKA 3KEOA 4C3IJ 4R79A 2IA0A 1N77A 2XGDA 3WU1B 3IRRA 1RR7A 4EV0A 5D6EA 1XB4A 3LSKA 1H88C 5E3OA 1RKWA 2DQRA 2IS6A 1APLC 2V4JC 1IO2A 2EIKH 1MJ9A 2B0LA 2JA8J 1RZ4A 1XMKA 3HKZA 3TW7A 4WX9A 2TCTA 3MVPA 2PJRB 1EKEA 3L09A 3G2BA 2FQ4A 2DFIA 2Y9YA 3QPTA 4FE4A 4XLCA 1YRNA 3TOAA 3F8MA 3BR3A 1SC7A 2YR2A 3T8RA 1CGPA 4B8XA 1I3AA 4CYCB 2QSFX 1PP7U 3S93A 2ZC2A 3DU5A 3O8GA 4JX5A 4G8XA 4JK1X 2DI3A 1OMIA 3TO9A 3BG6A 3ELKA 5L3CA 3W2AA 4L18B 3HXLA 3RJPA 4XORA 1VQ9I 1YITI 4OMYA 4BJ6C 3DCFA 4UXNA 4HOBA 1FX7A 1WI9A 4E4HA 3EPZA 2VOPA 3E0JB 2EPFA 4GXOA 2PX9A 2R5YA 5LEJA 2HQAA 1IRXA 2BOLA 1QHGA 3IAS2 4M9XA 2XF7A 2GBYA 5GPAA 1USTA 1R49A 2DCEA 2LD5A 4BY7J 4HPQA 5HDNA 1D5YA 2UUZA 4II3A 2H09A 1JTXA 2WBMA 4XLEA 2VPLA 4DIQA 2H1KA 1FP1D 2FA5A 3JTGA 2K3FA 2ZFWA 1A35A 4U7DA 3RQ4A 4EJOA 3IRQA 2R7OA 2VJJA 1IXRC 4C2UA 4IHWA 2V9KA 3CUOA 4L5JA 3ESWB 3HOTA 1F9NA 2GQQA 2VE9A 3BG9A 1V55H 3M1EA 4GCVA 3FXQA 1TWCJ 2WAFA 3H3VK 3HHGA 5BOXA 1S6LA 4HQMA 3E6CC 2QEXI 4X0GA 2BHZA 2EJRA 2LREA 3CP8A 1DPRA 2ZXWH 1D1BA 2X85A 3C2GA 5F04A 1XSDA 4LJZF 2M45A 2JUCA 1PJRA 5KVRA 5L3FA 3P9CA 3TP0A 2Y9ZA 2JJ7A 2VBZA 3NWTA 3HSRA 2EV6A 2KKOA 2QM3A 3BTLA 2XGCA 4ZZDA 4I09A 2XF6A 3ZOBA 4LLNA 3K7AJ 5IYCJ 1T08B 2DA3A 1H9TA 5FKLA 2KPMA 4XKCA 1BOAA 2EFNA 2BW3B 3HHHA 4CDGA 4EGZA 4U0VA 4QWQA 2CQNA 4V19K 1GVJA 1WFXA 3LOCA 4ZYHA 2RQPA 4A3JJ 1G3YA 3M8EA 3ML6A 5J47A 2Z5UA 2O6GE 3LAJA 4U87A 1IRZA 3BJAA 2R7XA 3GTPJ 5KHDA 3ZQIA 1B6AA 4IQJA 4AWXB 3VPRA 5EF6A 2LKXA 1A5JA 4BHCA 1MMNA 1B72B 1YHQI 2ELHA 2ZXJA 2H8RA 4Y3OA 6PAXA 2PFBA 2Q1ZB 3CTAA 2MABA 4BL0B 1JJ8C 5HLGA 4HF2A 1WJBA 4ZDPA 4G7ZF 1MH4A 4UUSA 3GMEA 2XROA 3PJRA 2ZJRF 3FHNA 1ETXA 4E70A 1GLNA 1JHFA 5FRNA 3DKYA 1E3HA 3N4MA 3ERED 2LOOA 5IOYA 1XGOA 3E6BA 3WTWC 4I2OA 2RREA 3AKZA 2IW5A 1D3YA 3KPHA 4OWRB 1WJEA 3S2WA 1D1CA 1D5VA 3J7AY 5BPDA 4M72A 2IGOA 1U0JA 2WAQA 3S16J 2P8TA 3QP6A 1FMWA 3DWLE 4YRVA 4HQEA 4HV6A 4MFDA 4RM3A 1O3SA 2A5YB 4PK4A 1RUOA 1H89C 2L9RA 2KZGA 4WXDA 1LFBA 2IEKA 2M4KA 3W6KB 2O0YA 3NARA 1IG7A 1DP3A 1WI3A 2CYYA 3TL4X 4HX7A 2VBXA 3IWFA 4A0XA 2L4AA 4RA2A 3MEXA 4CICA 3MCZA 4L9NA 3QYFA 2XKPA 3I4MJ 5D8LB 1FSEA 1U9OA 2HZTA 3G1LA 3LSPA 4IKFA 1XDSA 1T95A 1EH6A 3ZRGA 4BNCA 4NQWB 1I5ZA 2YS9A 2UXXA 1QVUA 2V1NA 4MNUA 2K40A 4HNVA 4ZYDA 1RKTA 1QBJA 2E1MB 3HYIA 3ULQB 2M9HA 1B8IA 3D1NI 4H0EA 2FRHA 4B44A 2V6EA 3F21A 3TEDA 2F6CA 3K4KA 1UHSA 4UV9A 5H6RA 4F55A 3HSFA 4DZJA 1O3RA 3FWEA 4XR6A 4RB1A 3HZJA 3AAFA 2X51A 5D6FA 2WAEA 4R1HA 2XGEA 1O4XA 1HW1A 2VB6A 3FK7A 3WTTC 2XSJC 3MFKA 3M4OJ 2W84A 2JMWA 2XASA 1F4KA 2GM4A 3QQAA 1X1AA 2XKOA 3IL2A 3SEQA 2R7WA 1ZHFA 5J6XA 4Y33A 4OAYA 3VODA 2W1OA 3HRUA 3S14J 5E18F 1MDMA 1ZG3A 4EM2A 4E7SA 2VQHA 5J40A 3OYJA 4A3LJ 4BJTA 2D2WA 4I99C 2MH9A 4I0BA 2Z2SB 5H20A 1JHHA 3PNTA 1U5TB 1MMDA 3KP5A 5LGNA 3UNGC 4M6YA 4HSRA 1R00A 4M6VA 5ILUA 2O3FA 2KDZA 1ZG1A 1H8AC 1QHHD 2HYGD 2XHKA 4S0HB 4IRGA 2O7OA 4C9YA 5FGMA 4ZDOA 5FLXZ 3U2RA 1WGXA 1OISA 3OYIA 2MG4A 2KQRA 5LHGA 3KYDB 3PO3J 2DT5A 3QAHA 3K70C 2IPQX 1B59A 1RI7A 3I59A 1OYIA 3MZYA 3E7LA 4N4OB 4JP0A 4MTEA 2CFOA 5C4XJ 3MN2A 3RTRA 1I50J 2L7MP 3HOVJ 3KZZA 3QODA 2E34A 1OCPA 2Z99A 4HNTA 3F22A 2K9LA 2KJBA 3SYTA 2CGPA 3BG7A 3JAMK 2E36A 2RNJA 1RNLA 1YJ9I 5IP9J 2DTRA 1OCOH 4ASNA 4H4KC 2R7FA 3V4GA 1VTNC 1HW2A 3HSEA 3BP8A 2D45A 3PQKA 2BEOA 4KYWA 2COMA 3R0JA 4BKXA 3BOQA 3V7RA 4HDVA 3ZQFA 5M3FJ 3ZQLA 2LDUA 3EYIA 1F36A 2NVYJ 1E3OC 2DT6A 3K4LA 1YRNB 4II2A 3LWFA 3JRCA 3BQYA 4BJ5C 2LKSA 4D5CA 1O3TA 1BI0A 2XPWA 5F64A 2EINH 3ZQ7A 4FETA 5JFRA 1DUXC 1U8RA 4L9TA 3MD2A 3CCUI 1NH3A 3CJTB 4AC0A 3JRHA 2E1NA 5JVGF 3HOUJ 4F93B 2LY9A 1VI0A 3HOYJ 4P9UA 3C1DA 1T38A 2P7CB 2CW0F 3CCMI 4XN0A 4XKVA 3E5UA 4E7LA 3BR1A 2VIXA 3OL3A 3H35A 2LYCA 2KP6A 3Q5FA 5D5XB 3AG2H 4MGRA 3HGYA 1BIBA 2EWNA 3IH2A 4WF2A 4PCQA 2KIFA 3V42A 2HOTA 4IL6C 5TRDA 1X3WB 2CSOA 1GV5A 2Y48A 3AG4H 3EUKL 4U0WA 1IN4A 5CJ9A 1P7JA 5GAGJ 1TNTA 3D5RC 5D4RA 3H9QA 1H9GA 2ADUA 3GFLA 2L0KA 1ZKGA 2HI3A 4U0YA 1SFUA 1JKPC 1QQIA 2HXOA 1V5FA 2YU3A 2M2EA 1P2FA 3GZ6A 4UUVA 1HXDA 4IRIA 2E60A 3RZDJ 3F72A 3BR5A 3MZ8A 4JX4A 2DO7A 5CYVA 2NAZA 5BMZA 1ZK8A 4YIRX 3DEEA 2ELKA 5EDNA 2NS7A 1YG2A 1OCZH 3ONQA 1TWFJ 1F1ZA 3SZGA 2ETHA 1FOWA 4ENNA 1BW5A 1QZZA 4ZYEA 2ECCA 3H0GJ 3ZMSA 1FOKA 4EMSA 5GPCA 4M3BA 5DUKA 1UZCA 1ENHA 1S7OA 2YX4A 1BR2A 2L9VA 3GVAA 3OS1A 5E3NA 5K7FA 2V9PA 3Q0VA 3FXLA 2K3PA 2E2IJ 4BDZA 4C3HJ 4LLLA 2D1VA 4GO1A 1BC7C 1WQ2A 2WV1A 5IP7J 2BXYA 2QQBA 3OYKA 1FTTA 1YLFA 3FMQA 3J7YJ 4FASD 1B72A 3WTZA 4KN4X 1D0YA 2X6YA 3J7ZI 5AIQA 4RAFA 2JA6J 2H6BA 1G6NA 4G6TB 2E35A 3GLXA 1I1GA 2P4WA 3QOEA 2EFOA 3HOXJ 3DTKA 4BYYA 3CCJI 2BY2A 3OYBA 4A3KJ 2K4BA 3IKVA 2YSRA 4A6EA 4DJAA 4YELA 5LBQA 2BGCA 4FTHA 1JJ6C 1WJDA 3LA7A 1OCRH 2GIZA 3J81K 4J01A 1T98A 4IZZA 1RRJA 1Z05A 4Y7NJ 3L7WA 1LUJB 4YIIA 2AQEA 2HS5A 3QYEA 3WTVC 4A93J 2M30A 2XAFA 2MD5A 3OR1C 1IUFA 4BH9A 2LH9A 1VQ8I 3E3VA 1LVAA 5DD4A 5LRRA 1MZBA 3T5XA 2JA7J 2HQNA 1DQUA 3A4CA 2K86A 4LK0F 3ZQGA 4UUSB 2I5UA 3F6VA 3TO7A 4O3MA 2X1EA 4AVPA 4GDFA 4GYIA 5HLIA 4G6QA 1BW6A 2IP2A 1KYWA 3F3XA 3E5QA 2W48A 4E7KA 4YFXF 3I55I 3K70D 3I4PA 1SAUA 4M3GA 3RKXA 1MBHA 3RQIA 3K10A 5IT3A 2XAJA 4LG3A 3QRFF 4NQWA 5KK1A 3WGHA 4UVCA 1U6GA 1KONA 2QQ9A 1MW7A 3WHCA 2NNYA 3GTQJ 1LFPA 4B3XA 2Q2EB 2Q8KA 4XRSG 2P5LC 2DYSH 5KCMA 4RGSA 5EZGA 1HW5A 2PLYA 2X6XA 4NBQA 2HNHA 1ETWA 5IOZA 2R5ZB 3EETA 2LF8A 1O3QA 1AA7A 2B7EA 2OA4A 2DU9A 3VDXA 4W1UA 5LRSA 2RV8A 3VOEA 4LOCA 3MQ0A 3QYBA 1MMGA 1B9NA 2EA2A 3DXJF 2DODA 2JVGA 4UV8A 4C3JJ 4GFBA 2D5VA 3HOZJ 1ZRDA 3ABMH 2TDXA 3GO5A 4RLQA 1EH7A 3LSHA 5EJCA 3KLOA 4CXFA 4RBOA 2B63J 3Q9SA 2FX0A 1QNTA 4RAYA 2RNGA 3WODF 1X4OA 2FU4A 2ZMEA 5D5WB 2NOJB 4OIPF 3BROA 1G4DA 1YE9A 5DM6F 1AWCA 1WWXA 4Y4RA 2R4GA 1T2KA 5EYRA 1TTYA 3OMYA 2E19A 4I98B 1L0OC 4A3EJ 4A5NA 1WSUA 3JRDA 2VN2A 2G0EA 3NAUA 5M5YJ 3KEQA 4QIWN 2GZWA 3BR0A 1U5TA 2ZO4A 3CF2A 3PNYA 3ZMTA 3L2WA 3QPHA 3I58A 2BXZA 2F2EA 2M34A 1S3JA 2AXLA 2E1MC 3NEUA 1LVKA 4P96A 1BN5A 4N4NB 1P9QC 2CFXA 5ILVA 4KMUX 4B3AA 2WY7Q 4HDUA 2A6HF 2HQ5A 1FC3A 2JSCA 3WHBA 3WU2C 3B02A 4EATA 3N97A 1W1WE 2FOWA 1G3TA 1LNWA 5HS7A 1SFEA 4D1QA 4LIVA 5BS6A 1Z3XA 2R7TA 1P4AA 1TZLA 3ZGKA 1HC8A 3FXUA 2HYJA 3QU3A 2F5DA 4UVBA 2EH3A 3PFIA 1UB9A 3RKWA 1YIOA 2OTJI 2DTZA 1SD7A 3VFZA 5LGTA 4RGRA 3I54A 1VQLI 1HSTA 1R5GA 2LRDA 1VQ4I 3B73A 1HA8A 4KT5C 1R4NB 2HFHA 2DPDA 4ZDLA 2R3SA 4UNOA 3PSIA 1VQ5I 1RETA 3JRFA 2DMPA 1R71A 1U5TC 4A0ZA 2VKVA 3MKZA 4E7IA 4BGDA 4CCKA 4A3CJ 1R1UA 5J4VA 2LY1A 2V79A 1J59A 1B9MA 3ASOH 2IBDA 3I59B 3R61A 3GTJJ 2VXDA 1PYVA 2KIQA 2VQLA 5FKKA 4MQVA 3HG9A 1ZARA 5JLXA 3FBNB 2DDAA 2GIVA 2GOXB 1IN8A 3ZQCA 2VASA 5CPRB 3QPLA 3M1CA 4YFNF 3DTEA 1SANA 4MFEA 1T39A 3IKTA 1BJZA 3I53A 3NWSA 4BE0A 3S8PA 1IUYA 2ICWG 1K6YA 3F8NA 3RYRA 3CCSI 3K4JA 3LSMA 4HG2A 2V1UA 5FD6A 4ENKA 3GTGJ 1QA6A 3AG3H 4N0BA 3CUQA 3OYHA 2M7BA 2ZNZA 3C2BA 1ORKA 2EZKA 3E1SA 4PJ0C 1R9TJ 2AXTC 2ZCWA 5IP6A 4YG2F 3GX4X 5D5UB 4C2TA 2UV1A 2MD0A 2KIMA 4KN7X 1U78A 1J75A 3IH3A 4AIKA 4DNCA 1FYLA 4QSHA 5EEHA 4IX7A 1R5HA 2C6YA 1RPWA 2PMZA 3BWGA 1VQMI 3BJ6A 4XLAA 3WTUC 3CP2A 3N05A 4EGYA 1MJBA 3KX2A 1KA8A 3KFWX 4CCLA 2BHYA 3A1YA 3J80K 3B6CA 2L01A 1A36A 3LSTA 4AYBN 4ZH4F 1YW8A 1XSVA 1K83J 2EIMH 3LSJA 2IS4A 3G3ZA 3OYAA 3S3NA 1DU0A 2OCEA 3K1NA 1Y8RB 3JRGA 3H3UA 1K7AA 4HF1A 5DCMA 2E1CA 3Q3SA 2FOKA 3I56I 3WGIA 5F1RA 5ICEA 4XN3A 4XOTA 3VYRB 3OSFA 4PZJA 5JI6A 3S3MA 1TWGJ 3I5UA 3CJRB 5E8IA 4BS9A 3CUQC 3DFGA 3DLAA 2PMZN 2ZSHB 4BY1J 1YO5C 4S05A 2QSGX 1GUUA 1E17A 1STZA 5J4YA 3LQRA 2E2HJ 4M3FA 4XM3A 5AONA 2JSPA 3OV8A 2GA2A 1QRYA 1GVDA 4NDLA 3JCUC 3F6OA 1H0MA 4F3QA 1Z67A 2DK8A 1NHAA 3ECHA 1Z77A 3GW2A 2NVUB 1E3PA 3C3WA 1HKTA 4B1RA 5J1UA 1L3LA 2KRFA 1HQCA 1UAAA 2DLLA 1XG1A 3FXKA 3O3KA 3R4KA 5IPAA 4KDPA 2E7WA 2CW8A 2ID6A 1E2XA 2IA1A 2ZKZA 3LMMA 4A0YA 3ECOA 1Z1DA 2H8WA 1VF9A 4AD9A 5EGOB 4EJWA 5TISC 1W36D 1R5ID 2EK5A 3U1DA 4B43A 4G7OF 2CUEA 5IYDJ 3V7SA 2Y0MA 2HZDA 3DKWA 5GADJ 2JTVA 3GFJA 4LB6B 4KNYA 5K5OA 3K1MA 2OTLI 2IXSA 4RM2A 4DOZA 3H1CA 1XSXA 2L7ZA 2V9VA 2A61A 3PNVA 5HS8A 4WK8F 3KZYA 2DPUA 4HA8A 3HEFA 2PEXA 2QVOA 1P7IA 1POGA 1IRGA 1QPMA 1TT0A 1GXPA 4PJLA 4QTRA 5GTHC 4XL9A 2E5ZA 3JTHA 2JN6A 3LFKA 3E6DA 1JXSA 3K4BA 3KLNA 4HRIA 2M8EA 3BZ6A 3TP3A 5J1RA 4S04A 2LR8A 2CH0A 2Q2EA 2ZB9A 4HX4A 1R1TA 2ZJQF 1PUFB 1MNMC 3OOUA 1WJCA 2PBIA 2QENA 3K69A 4IOAF 4KIGA 2JRMA 3FKJA 2K85A 2XPVA 3W3CA 3DBRB 4V2GA 4IHSA 3OYEA 4W97A 2HOAA 2LG4A 3F23A 2R5ZA 1REPC 2HDWA 2ZXHA 2LFBA 3GCMA 4XRFA 1XGMA 3CO7C 5EZHA 1WZ2A 1MGTA 4OAZA 1J0RA 2V1XA 2VXZA 3HTSB 3NQOA 5KAIC 1A04A 3DPLC 2AS5F 2RVCA 3CF5F 3DP7A 1Z9CA 1OYYA 2OZUA 1MBKA 4D7MA 3T0YA 3CDHA 3L2QA 1HF0A 3BPXA 4A69C 3L1PA 2HU9A 4G94A 2XF5A 3PIOF 1K61A 3R60A 2GXAA 4AUXA 1LEBA 2HDDA 1DDNA 2CRGA 1YYVA 4IHTA 1ZTRA 2VT3A 3BY6A 1CF7B 1K6OA 5LFAA 2H27A 1SVLA 2KZVA 1X19A 4JQFA 4DGWB 1K4SA 3BJOA 3FXRA 1LQ1A 3RPQA 1ZAOA 2OUMA 1S7AA 4M73A 3FM3A 3I3LA 4XRMA 4BXXJ 1M1EB 1AHDP 1V4RA 2BY1A 3PIPF 1YW7A 2CUJA 3G4SI 3GLLA 1ETKA 1FY7A 5LD2C 3VSKA 1MMAA 4JYKA 2ZMEB 2M3AA 2DYRH 2RDPA 1JT0A 1X1DA 5GAHJ 2PQ8A 2IGNA 1J5YA 2X48A 1WH5A 1FPQA 1T8IA 2CV0A 3A0BC 2QYOA 2KLOA 3BTCA 3R6SA 3JSPA 2HEOA 5J1YA 5IT9K 4OINF 3JRBA 4FQGA 2K9MA 4QPOA 3OYDA 4L0YB 3FM5A 1KQ8A 1VQPI 2CS3A 2VC1A 3VYSB 4KFCA 1N78A 1ETVA 1XS9A 2EFWA 2KRHA 2M0MA 2F4IA 1YTYA 2FEZA 5A2QZ 2Y69H 1FSHA 2Z33A 4N9HA 1UJ8A 1XPXA 1T56A 1PP8F 1XDUA 5LHIA 3P7NA 2OCCH 3TDUC 4FCYA 2M1BA 3U1KA 5GTIC 1NK3P 4EEFG 5IY5H 3GXOA 4IF4A 2DA6A 3ABKH 1ETQA 1Z21A 4BU2A 1W0UA 1IGNA 1WVRA 2QA4I 3WG9A 3CO6C 3CMAI 4A12A 1XCVA 3BTJA 4DW6A 5BNGA 1X3ZB 5DDGA 3GTLJ 3E5XA 5EEAA 4I01A 5CKTA 4HSTA 3BG5A 2X6OA 1OR7A 2M0CA 4BHBA 1RC9A 1AKHB 1Y0UA 4E7JA 1KU2A 2J5PA 5FROA 4A3FJ 3AG1H 1QPIA 2HVRA 2L9NA 1R23A 2M8GX 5K7HA 2XUBA 2VODA 1FLIA 2NYXA 1V5EA 2GXBA 1X3UA 3I64A 3HGGA 5E3MA 3L2UA 3VYTB 1VQ7I 3DPTA 4Z2YA 1I27A 2WADA 1CQTA 3W2VA 5E20A 2COBA 2OD5A 5D4SA 3KP7A 1IN6A 3VEPA 1YOVB 4GGGA 3BPVA 1LE8B 1FIPA 3IHUA 3UR3C 4M3DA 2PG4A 4Z6YA 2IAIA 2XAQA 1ZGAA 3CUQB 1P4XA 4B48A 3DKXA 2KJCA 3K4NA 1ZG5A 4I0AA 2QQ8A 3LNQA 2K4JA 2O61A 3IC7A 4XLPF 2KFDA 4XONA 3M8FA 3EUAA 4L5EA 4NC7A 3M3YJ 4LD5A 5HOOA 2XPUA 2DA7A 5DD8A 4ESBA 5TJJA 2P5VA 3ERMA 5FD5A 5J3LA 1OR7C 3LQQA 1AOYA 3PL8A 3OYGA 4Y13A 3CQZJ 1QGPA 2NVTJ 4HX8A 3KETA 1X2MA 3ASNH 3F9KA 3SQNA 1MNDA 4DYCA 1ZREA 2MSYA 3O8HA 3ZCOA 1YS6A 4A3DJ 2V6CA 3A0HC 1JTYA 1FP2A 1KYZA 2Q0OA 2LY2A 3TO6A 2F5FA 4PJNA 3UKGA 3VYUB 1EH8A 2VL8A 2KT0A 2R93J 2P6SA 5DCMB 1A6IA 1FNNA 1VQOI 2DMTA 4BDYA 2WB1A 4CA0A 3PSFA 2B9SA 1ZR4A 1MMSA 2V1DA 4P55A 1ZGWA 4RDUA 2IJLA 4O5VA 1LB2A 3GTOJ 2IGMA 1N75A 4HV5A 2N8GA 2P81A 1EA3A 2QSHX 2LK2A 2ISZA 3OSGA 4GYGA 4WWCA 2MGQA 4EM0B 5EGOA 4BXFA 4DZPA 2Y75A 2EZHA 3WG7H 4DQ2A 3SFZA 1QO0D 3PQJA 4JBAA 4OIRF 4IVNA 1K78B 1AU7A 4TV7A 3B6AA 3K1PA 3GTKJ 2BY0A 4MO7A 5CVIA 1ERDA 1MSFC 5DUIA 2X6WA 4CO8A 5HDKA 3FF5A 4CHUA 5HLHA 1MSEC 4B4CA 2QUFA 4JOMA 3IH4A 2WB1N 5ICGA 4HNUA 1ZELA 1BBYA 1MBFA 3CDLA 1IDZA 2XVCA 2HPMA 2RN7A 4XICA 3BR6A 2CW7A 4ON0A 1YJNI 2L7FP 2K9SA 2K27A 2K02A 1BC8C 1PUFA 3S2DJ 4IPAA 2NXNB 3D0SA 4BE2A 1LKXA 4DYQA 4U7BA 1HDPA 3H0DA 1ETYA 2HYFA 1S7EA 4XK4A 2DOAA 1LJ9A 1YW9A 5FO5A 2GA1A 3IWZA 2AO9A 1Y6IA 1SVOA 2HKXA 1LDKB 1J09A 1MJAA 1NTCA 3WTSC 4BQOA 5K7ZA 2ISYA 5E8GA 1DU6A 2JT1A 3A01B 5FB2A 2JWTA 2VC0A 2XAHA 5K1YA 1NK2P 1WJFA 2P5KA 3RZOJ 3GUDA 4XLFA 2QF7A 2EB7A 4XMYA 5DCFA 3BQZA 2Z9OA 1JUPA 1SD5A 2FUG2 3DEUA 3DBLB 1OQYA 4ZYAA 2CWEA 2R7VA 2BZTA 2XV4S 4B47A 1W0TA 1MBEA 3EDPA 4U88A 1ZLJA 2IS1A 4OU0A 2CUZA 5HDGA 1SEUA 1BR1A 1CF7A 1IV8A 3GEZA 2KDOA 2Y2ZA 2A05A 2NVQJ 3CCVI 1IRFA 2M4GA 3ZQHA 3HOWJ 3SXYA 2DK5A 1XN7A 1LFUP 2KISA 3CCYA 3DEWA 4PSXA 1HKSA 1OLTA 2W25A 4YIFA 5HNFA 3OS0A 3WGGA 4A2UA 5GAEJ 3TQNA 2QWWA 5ICFA 4HBLA 4E7ZA 2IS2A 5C44J 1JGSA 3DPUA 1ZR2A 2K9NA 3DTIA 1FWZA 1Z0XA 4WCGA 2W00A 2X4HA 3WE3A 4OMZA 2DXIA 3IAM2 3V8LA 3KP6A 1LDJA 1B1BA 3FZVA 1HCRA 1SAXA 3L00A 2XC7A 3H92A 2OQRA 1TNSA 2G7HA 3KEYA 2HPIA 4Y17A 5F27A 3CCRI 2HVQA 1UFMA 3K9TA 4IOCF 2RAEA 1UELB 2R7UA 2V7FA 3CC4I 1WPKA 2RQQA 2F5EA 3C7JA 3TBIA 2ESNA 2F5CA 2QKLB 4KA4A 2YU9J 1DGWY 4OIOF 2DJNA 2WTEA 5HNHA 2VE8A 3CCEI 1G3SA 1R7JA 3CESA 1W36C 2QBYB 2LP0A 3WU0A 2X0LA 1TWAJ 3P9IA 5JVTA 4KIFA 2JRTA 1JE8A 2FD5A 3KCCA 1UMQA 4LLGF 1R36A 3RKQA 1B4AA 1FBQA 4CUGA 1C0WA 3I9V2 4BEHB 5FLXK 3OIPA 2JA2A 2RKHA 3BT9A 1G2HA 4M9SA 1W4MA 5A2QK 2V26A 1IF1A 5E17F 5H6QA 1TWHJ 1YQAA 2IGKA 3H9JA 2L7KA 2VOOA 4A3IJ 1FBUA 4AIHA 1GDTA 2WWYA 5E1WA 2CQXA 1O57A 2ZMEC 5C3EJ 3JRIA 1T33A 2WY8Q 4YEJA 1ZN2A 3MWMA 3KP4A 4M71A 1BR4A 1G8XA 2JVHA 4IXAA 5EG0B 2QQAA 2OJED 2UXNA 3DU6A 4UVAA 2ACJA 3ZN0A 1V54H 2H94A 2O03A 3BCBA 1HLVA 3K4CA 4Y15A 4XBFA 2EBIA 2NVXJ 5LGUA 2NRAC 3ZPLA 2STTA 2HGCA 4OIQF 1KQ9A 1AKHA 2ESHA 2MFZA 3LFUA 1XCBA 1MBJA 5F0CA 4PSWA 2XAGA 2JA5J 3K6GA 4UY8I 3MKWB 2FNPA 2NS0A 1JKOC 3CJNA 4BQAA 4NHJA 1NG7A 3OIOA 1Z3YA 3RDIA 3DF8A 4KJZA 4F52A 1ITYA 2MC4A 2K9QA 1KU9A 1BI3A 4M3EA 4PGGA 1ON2A 1ETOA 2GLOA 2VBYA 1ZH5A 1RESA 3G1MA 1VNDA 2R7DA 2HDCA 2KRCA 1LE8A 2FF4A 1W5CC 4AYBA 2OBPA 2BBYA 1ZRFA 3LSRA 1IXSB 3GWZA 1NG6A 4A3GJ 4Y52J 3CMYA 1Z6RA 2K5CA 3OYCA 3JAMZ 1W5SA 3LL7A 5ED4A 1FZPB 1HBXG 5JHUA 3FIWA 3K2ZA 5DEQA 2ME6A 2EFQA 2YUSA 3LSGA 2BY3A 4LGWA 4ETSA 3BLYA 3KP2A 4DYRA 2CQQA 4MQ9F 4HYEA 4QPQA 5E1ZB 2G7UA 2STWA 5CLSA 3RKYA 2XAUA 4A6DA 2VQCA 1D8KA 3HM5A 1U8BA 5EEGA 3ZP5A 2YX7A 4EJTA 2DMQA 1X1PA 1FYKA 4I6ZA 3RYPA 1IC8A 4ENMA 2E1OA 3OOPA 1S29A 5FKMA 4CZCA 1EJ9A 3OS2A 4I76A 4FT8A 2VLAA 3HKZN 1MKMA 2TRTA 4HF0A 4AIJA 1FTZA 4IJAA 1MH3A 1QZEA 1JT6A 2O5RA 4F7ZA 4P5OA 2DT7B 2ZJPF 2PMHA 1ONVA 3ZQQA 2I10A 4G9YA 2NS8A 3F8FA 2XSDC 5JR3A 1JGGA 3IV5A 1JUSA 2FMYA 3SZTA 4L9JA 4CH7A 5CVJA 1UCRA 3HRMA 2F4OB 3TW6A 4V2FA 3I4NJ 1U3EM 5DS9A 3OL4A 2EILH 3QOPA 1JI8A 3HL2A 1G3WA 2F48A 4BHPA 2D1HA 3JREA 4J19A 3KE2A 3VB2A 2L3DA 1YIJI 4RS8A 1LDDA 1VZ0A 3IP4B 1K78A 3ROUA 2R0QC 2XRLA 3ZMUA 2RGVA 2GXGA 3GYHX 1D0XA 1VQKI 5JHFA 1XMXA 2I8DA 1S72I 1Z7LA 1D1AA 1BL0A 2FMLA 2F5VA 2VKHA 5H2FC 2ZJ2A 1VFCA 1YJWI 1HSJA 3TDZC 3BG3A 5FLVA 3SFIA 1Y56A 4GRIA 4OOIA 3KIOA 2FNAA 2MH2A 1TQIA 1USSA 3CCQI 3HB9A 1XMAA 4PUSA 4NNJA 5L3DA 4RAGA 2BE5F 2WC2A 4NB5A 1JUMA 1ZRCA 1UHMA 1SFOJ 5LHHA 4XKBA 5ERIA 1X4PA 4FHTA 3SDBA 2M7AA 3WTYC 3AFHA 2VQGA 2Y30A 3FBIB 1GHCA 2VI6A 2ID3A 3A01A 1P4WA 2FBHA 2Z16A 3C2HA 1KGSA 5ILSA 4PGHA 3AL0B 2MLKA 2VPRA 3K0LA 3BTIA 1OYWA 2CUFA 2HTJA 4LITA 4AIDA 1ODDA 3W2WA 3A02A 3PO2J 1SVMA 1P6RA 4BBSJ 3M7GA 2DOEA 3J81Z 4C2MJ 2JK3A 1TQPA 3CLQA 4JX6A 2FBKA 4NUBA 2BYVE 2XRNA 3FKIJ 1S8NA 2PMUA 4FE7A 3FMRA 4UB6C 2IA2A 1RIOH 4CGZA 3QU6A 4LFUA 4LK1F 2AQFA 2VKEA 1R4MB 2L02A 4UB8C 4PDKA 3OWTA 4ESJA 1X1BA 2EIJH 2HXIA 3ZN1A 3P5JA 1PVEA 2PJPA 2L9SA 3RPUA 1FT9A 2ZFUA 4RLFA 3BC8A 4FX0A 3BZKA 2KIUA 2LBFB 1WJAA 4EVIA 3LA2A 5CQGA 3VSLA 1S9HA 4MHGA 2UZKA 4IHVA 1UHWA 4X1EA 2R92J 4BUPA 1I3QJ 1D8JA 4B09A 1KQ0A 1YI2I 1KZHA 4NC6A 2H1LA 1XGSA 2LLKA 2GAUA 1EV7A 2VKDA 3FHZA 3S1QJ 3BCAA 2NNNA 5D5VB 1F5TA 2JZYA 5HVQC 1J9IA 5K5RA 3KZIC 4D5FA 4FISA 4MLOA 2PN6A 5E79C 4CZZA 1BJAA 5B3SH 4HLXA 4NC8A 4Q47A 1BI2A 9ANTA 2FBIA 1ZGJA 3H36A 4G12A 3U9GA 3SJMA 4M74A 2ELJA 2VJ4A 4KITB 5DM7F 4XLHA 2WV0A 2WAQN 3F8CA 2LF7A 4M9ZA 1BOBA 2BVLA 4XQFA 2QBYA 1FEXA 5D8KB 3F8BA 2L5QA 1I39A 1GT0C 2G9WA 3V8JA 2LC2A 1OPCA 5F0HA 3SDGA 1GV2A 1P92A 4LG0B 1WJ5A 4BEHA 3OIQA 2R7SA 1XC5A 2CJJA 4DBRA 1OCCH 5K5QA 2M5WA 1XD7A 2FSWA 2FQ3A 3OR2C 3LSIA 5DV5A 3ZXSA 1SMYF 4ANJA 4IO9F 4RB3C 5HODA 1W7PA 3X2QH 1Y1VJ 3GFMA 1X58A 5HLTA 1TQMA 5B1BH 3ZMDA 2MA3A 5FKOA 3H9GA 1MNEA 4CCNA 2DMUA 1I6XA 4F92B 1ZLKA 3HPGA 3HDDA 2DQLA 4BQQA 1DPUA 1VQNI 4XSZF 2EV5A 4BXUA 4M6XA 5EG0A 1Y1WJ 2DFEA 3V8KA 2OAZA 5F08A 4K2EA 1K4TA 2NOGA 4D9JA 3HC7A 3K2AA 3RCOA 4ZTFA 3DLLF 2EZLA 2OZ6A 2HOSA 2IRFG 3FISA 3G71I 4XSXF 4CSWA 4MTDA 4ZZLA 1TP4A 3HPHA 1FYMA 3FMSA 5KNLA 1SFXA 5FKNA 2R7QA 3EUHA 3ABLH 1RUNA 2ME0A 3NRVA 4HEA2 4BE1A 4LB5A 2ECBA 4DBQA 3HUGA 4LIUA 3E6MA 2DFFA 3FK6A 5J8CA 1TL8A 5L3GA 1OJLA 1WKMA 3H5NA 1XGNA 4IHYA 1JKRC 2OQGA 2OU2A 2VONA 4HLYA 5L3BA 5LLQA 2MW8A 1BI1A 2JUGA 3SEZA 4A3BJ 4XKWA 1R1VA 1MD0A 3GZ5A 4E7HA 2CQ7A 3L9FA 3MMYB 2MC3A 3S3OA 2PJRA 2QLZA 1O7LA 2DBBA 4EM1A 2JPCA 3I71A 1A31A 2ZNYA 4ESFA 1TW3A 3VWBA 5ICCA 5M3MJ 5B5EC 2Y31A 2OC6A 1U2WA 4RGXA 1Z6TA 4CYCA 3HRTA 2XB5A 1ZQ3P 1KU3A 2DDBA 5TGTA 1GXQA 2EV0A 2X1DA 3GZNB 1HDDC 2KHMA 1IN7A 1WCMJ 5FLMJ 2LNBA 3EUHC 3O2PE 2VT2A 3RIRA 3LAPA 3L2CA 2J5OA 3S1NJ 3TMOA 1FBSA 5E3LA 2HKOA 2XB0X 3GBGA 3CDIA 1HOMA 4X6AJ 2DFHA 4CCOA 3OYLA 2QCOA 4KICA 3JSOA 2EA4A 3RSNA 1TBXA 1UG2A 2E71A 2ZXIA 2L2OA 2W82A 5FFZA 4KUMA 1YFHA 2WA0A 1R6RA 3HIFA 5CQEA 1KU7A 3T8TA 1BA5A 4KIBA 4KMFA 3PUFA 4XIDA 1UG0A 3J7AO 3W6JB 3M9AA 2OF7A 1VQ6I 4MEYF 3O6BB 1Y0NA 5KAFC 4P1WA 1J7KA 1Q1HA 3W6VA 2DAOA 1I6HJ 3FXOA 3LA3A 4RB0A 5AIPA 3HOSA 4N9IA 1FOYA 3M8JA 3HBLA 4PJMA 1WHUA 4PJJA 1HKQA 5CVVA 3RI4A 1MIJA 2XGXA 3CMEI 1IXCA 2R5YB 3WE2A 3CCLI 1WRJA 4G6DA 2XDVA 3G6EI 4LMYA 3L2VA 2LSOA 3CD6I 3IUOA 4CYDA 3ZMZA 3DV8A 2HQRA 3ABUA 2JQ7A 4IRHA 1X1CA 3J80Z 2P7VB 4BQNA 2E2JJ 5CVUA 3CZ6A 2VJ5A 2EFPA 1QVTA 4CCMA 3KYCB 5GP9A 3HTUA 4YFKF 4UUTA 2GWRA 4MIMA 5LEKA 2P6TA 1TT5B 3FXMA 1IDYA 3JRAA 2BW3A 2DA5A 3BZCA 1SMTA 2DA2A 1X2NA 2ZBKA 5F6FA 4XNFA 2MYSA 3T1BA 3GTMJ 2BVMA 3FXJA 4D7NA 2YPRA 3PM1A 4XRSA 2HTSA 2W24A 1I1SA 3Q0WA 3CJQB 1PUEE 2FJ1A 4Q4ZF 5FFXA 4Q48A 4ENJA 4RGUA 3FDYA 3MZHA 1F43A 1Q1VA 3S1RJ 1IAWA 4ITVA 3RPUD 1K79A 4Q5SF 1QZYA 2A6TA 4L0ZB 1FJLA 5M5WJ 3MKLA 5DYMA 2A07F 1O7FA 2W85A 4I02A 4I7HA 2MBFA 3ZMVA 4AU7A 2HVSA 1G59A 2LTPA 2A3SA 4RAZA 1R58A 3Q9VA 2CV1A 2X9DA 2A68F 1QU3A 2KL4A 4XOPA 5B1AH 1T0FA 1BIAA 3CLOA 3WTXC 1ZYRF 1DGRM 2LVSA 1LPQA 3COAC 4D0PA 1IW7F 1Y8QB 2QZ8A 2DOFA 4EJVA 1OKRA 3OYNA 3JR9A 2Z1DA 1N25A 2VBWA 5M5XJ 3BDDA 4F91B 4EJUA 2CV2A 2A6EF 4QLCU 3E97A 3S17J 3H3ZA 4CCJA 2L54A 2O9LA 3ABTA 4UHTA 2LBFA 4FX4A 2DA4A 3M07A 4RB2C 2K7LA 3U21A 2R7RA 1OCTC 2CO5A 4MEXF 3H5RA 4BBRJ 3AL0C 1IN5A 3D5LA 1IJWC 1W7PD 3G1OA 2E7XA 2OPTA 2W57A 2Y0SA 3OY9A 1OFCX 3I0TA 3S1MJ 5IYBJ 4E6KG 1Y39A 4WXHA 4A3MJ 3DQVC 4RMNA 4EQQA 1ULYA 2CU7A 3A03A 1T0FC 3EYYA 3KYLA 3CC7I 4WXCA 3CC2I 3SHFA 4AVZA 2OV7A 3ZR8X 3OYFA 1S5LC 2BV6A 4O6JA 3G73A 5C4JJ 4HAMA 5FJ8J 5J8FA 2A69F 1V5GA 3REOA 1FOXA 4ZTJA 4AM3A 3S2HJ 3PFYA 3TKYA 3L2RA 2CMPA 3MKYB 2UWMA 2VUMJ 4KT6A 1J2XA 2A5WA 2E5NA 3HJEA 3P9KA 4LG0A 1FMVA 2HR3A 1YS7A 4IEJA 2RC4A 3TOBA 2AHQA 1TLHB 3CMMA 3A2KA 4R8HA 2LMDA 2PI0A 1TC3C
chains in the Genus database with same CATH topology
3QP5A 3EQLF 3GFIA 4A5MA 1TW2A 4XLNF 2H6CA 4BAYA 4P9FA 3JW4A 4L5IA 1SD6A 3FX3A 3MAJA 1DP7P 2IT0A 2FXAA 3ISPA 1W7PB 2HWVA 1ON1A 1SD4A 3SZPA 1Z7UA 1W5TA 2MLGA 2IVMA 5BQTA 1V3FA 5L3EA 2FE3A 2Z3YA 1Z91A 3V7CA 3KP3A 2HOEA 3GF2A 3R0AA 2L4MA 1MDMB 4ZYGA 5IT9Z 2XIGA 1PDNC 2DW4A 4G7HF 2LKPA 2CQKA 1T6SA 2JPBA 5HS9A 1BM9A 5CVRA 2O8XA 5BPIA 5E1XA 4L9VA 2CG4A 3C18A 1IZ1A 2M87A 1LEAA 3HRSA 3TGNA 4HW0A 1R22A 4HZFA 4R79A 3KEOA 2IA0A 3WU1B 3IRRA 4EV0A 5D6EA 1XB4A 2DQRA 1MJ9A 2B0LA 1RZ4A 1XMKA 4WX9A 3L09A 2DFIA 3QPTA 3TOAA 3F8MA 2YR2A 3T8RA 1CGPA 4B8XA 1PP7U 4G8XA 4JK1X 2DI3A 1OMIA 3TO9A 3ELKA 5L3CA 4L18B 3RJPA 4OMYA 4UXNA 4HOBA 1FX7A 1WI9A 2VOPA 4GXOA 5LEJA 4M9XA 1USTA 5HDNA 2H09A 1FP1D 2FA5A 3JTGA 2ZFWA 4U7DA 4EJOA 3IRQA 1IXRC 3CUOA 4L5JA 3HOTA 1F9NA 2GQQA 2VE9A 3M1EA 4GCVA 3FXQA 3HHGA 5BOXA 1S6LA 3E6CC 4HQMA 2EJRA 1DPRA 1XSDA 4LJZF 2M45A 5KVRA 5L3FA 3P9CA 2VBZA 3HSRA 2EV6A 2KKOA 2QM3A 4ZZDA 4I09A 4LLNA 1H9TA 1BOAA 2EFNA 3HHHA 4EGZA 4CDGA 4U0VA 4QWQA 1GVJA 4ZYHA 2RQPA 1G3YA 3M8EA 3ML6A 2Z5UA 2O6GE 3LAJA 3BJAA 1B6AA 4AWXB 4BHCA 2ELHA 2ZXJA 6PAXA 2PFBA 3CTAA 5HLGA 4HF2A 4G7ZF 2XROA 4E70A 1JHFA 3N4MA 3ERED 1XGOA 3E6BA 3WTWC 4I2OA 2IW5A 1D3YA 3S2WA 1D5VA 5BPDA 4M72A 2P8TA 3QP6A 4HQEA 4HV6A 1O3SA 2A5YB 1RUOA 4WXDA 3W6KB 2O0YA 2CYYA 4HX7A 2VBXA 3IWFA 4A0XA 2L4AA 3MEXA 4CICA 3MCZA 4L9NA 2XKPA 5D8LB 1FSEA 2HZTA 1XDSA 1EH6A 4BNCA 1I5ZA 2UXXA 4MNUA 4ZYDA 1QBJA 3HYIA 3ULQB 4H0EA 2FRHA 3F21A 5H6RA 4UV9A 3HSFA 1O3RA 3FWEA 4RB1A 3AAFA 5D6FA 4R1HA 1HW1A 3WTTC 3MFKA 2W84A 2XASA 1F4KA 2XKOA 3IL2A 1ZHFA 5J6XA 3VODA 3HRUA 5E18F 1MDMA 1ZG3A 4EM2A 2D2WA 2MH9A 4I0BA 5H20A 1JHHA 1U5TB 3KP5A 5LGNA 4M6YA 1R00A 5ILUA 2O3FA 1ZG1A 2HYGD 2XHKA 4IRGA 5FGMA 5FLXZ 3U2RA 5LHGA 2DT5A 3QAHA 2IPQX 1B59A 1RI7A 3I59A 1OYIA 3MZYA 4MTEA 3RTRA 3KZZA 2Z99A 3F22A 2KJBA 2CGPA 3JAMK 2RNJA 1RNLA 2DTRA 4ASNA 2R7FA 3V4GA 1VTNC 1HW2A 3HSEA 3BP8A 2D45A 3PQKA 2BEOA 4KYWA 2COMA 3R0JA 3BOQA 3V7RA 4HDVA 2LDUA 3EYIA 3LWFA 1O3TA 1BI0A 5F64A 3ZQ7A 5JFRA 1DUXC 1U8RA 4L9TA 2E1NA 4P9UA 3C1DA 1T38A 2P7CB 2CW0F 3E5UA 3Q5FA 5D5XB 4MGRA 1BIBA 2EWNA 4WF2A 4PCQA 2KIFA 5TRDA 2CSOA 2Y48A 4U0WA 5CJ9A 1IN4A 1TNTA 5D4RA 1H9GA 2ADUA 3GFLA 4U0YA 1SFUA 1QQIA 2YU3A 1P2FA 3GZ6A 4UUVA 1HXDA 4IRIA 3F72A 2DO7A 5CYVA 2NAZA 5BMZA 1YG2A 1F1ZA 2ETHA 4ENNA 1QZZA 4ZYEA 3ZMSA 1FOKA 4EMSA 5DUKA 1S7OA 2YX4A 3GVAA 4LLLA 2D1VA 4GO1A 1BC7C 1WQ2A 2QQBA 1YLFA 3FMQA 3WTZA 4KN4X 5AIQA 2H6BA 1G6NA 3GLXA 1I1GA 2P4WA 2EFOA 4BYYA 2K4BA 3IKVA 2YSRA 4A6EA 5LBQA 2BGCA 3LA7A 3J81K 1T98A 1Z05A 3L7WA 4YIIA 2HS5A 3WTVC 2M30A 2XAFA 2MD5A 4BH9A 3E3VA 1LVAA 5DD4A 5LRRA 1MZBA 3T5XA 2HQNA 2K86A 4LK0F 3F6VA 3TO7A 4O3MA 4AVPA 4GYIA 5HLIA 4G6QA 2IP2A 1KYWA 3F3XA 3E5QA 4YFXF 3I4PA 3RKXA 5IT3A 2XAJA 3QRFF 4NQWA 5KK1A 3WGHA 4UVCA 1U6GA 2QQ9A 2NNYA 2Q8KA 2P5LC 4RGSA 1HW5A 2PLYA 3EETA 2LF8A 1O3QA 2OA4A 2DU9A 5LRSA 2RV8A 3VOEA 3MQ0A 1B9NA 2EA2A 3DXJF 4UV8A 1ZRDA 2TDXA 3GO5A 1EH7A 3KLOA 4CXFA 3Q9SA 1QNTA 4RAYA 3WODF 2FU4A 2ZMEA 5D5WB 4OIPF 3BROA 1G4DA 1AWCA 1WWXA 1T2KA 1TTYA 4I98B 1L0OC 4A5NA 1WSUA 2VN2A 3KEQA 2GZWA 1U5TA 2ZO4A 3ZMTA 3QPHA 3I58A 2F2EA 1S3JA 3NEUA 2AXLA 4P96A 1BN5A 2CFXA 5ILVA 4KMUX 4HDUA 2A6HF 1FC3A 2JSCA 3N97A 3B02A 1G3TA 1LNWA 5HS7A 1SFEA 5BS6A 1P4AA 3FXUA 3QU3A 2F5DA 4UVBA 3PFIA 1UB9A 3RKWA 1YIOA 1SD7A 3VFZA 5LGTA 4RGRA 3I54A 1HSTA 1R5GA 3B73A 4KT5C 2HFHA 2DPDA 2R3SA 4UNOA 1U5TC 4A0ZA 1R1UA 2V79A 1J59A 1B9MA 3I59B 3R61A 4MQVA 1ZARA 2GIVA 1IN8A 4YFNF 1T39A 3IKTA 3I53A 1IUYA 3F8NA 3RYRA 2V1UA 5FD6A 4ENKA 4N0BA 3CUQA 2ZNZA 2ZCWA 4YG2F 3GX4X 5D5UB 2KIMA 4KN7X 1U78A 1J75A 4AIKA 4DNCA 1FYLA 2C6YA 5EEHA 1R5HA 3BWGA 3BJ6A 3WTUC 4EGYA 1MJBA 1KA8A 3KFWX 3J80K 2L01A 3LSTA 4ZH4F 1YW8A 1XSVA 3G3ZA 3K1NA 3H3UA 1K7AA 4HF1A 5DCMA 2E1CA 2FOKA 3WGIA 5F1RA 5ICEA 4PZJA 5JI6A 3I5UA 5E8IA 3CUQC 3DFGA 1YO5C 4S05A 1E17A 1STZA 3LQRA 5AONA 3OV8A 2GA2A 3F6OA 1H0MA 2DK8A 1NHAA 3ECHA 3GW2A 3C3WA 1HKTA 1L3LA 2KRFA 1HQCA 2DLLA 3O3KA 3R4KA 4KDPA 2E7WA 1E2XA 2IA1A 2ZKZA 4A0YA 3ECOA 1Z1DA 4AD9A 4EJWA 2EK5A 3U1DA 4G7OF 3V7SA 2Y0MA 3DKWA 2JTVA 3GFJA 4LB6B 4KNYA 5K5OA 3K1MA 1XSXA 2V9VA 2A61A 5HS8A 4WK8F 3KZYA 2DPUA 4HA8A 2PEXA 2QVOA 1IRGA 1QPMA 1GXPA 3JTHA 3LFKA 3E6DA 1JXSA 3KLNA 2M8EA 3BZ6A 4S04A 2Q2EA 4HX4A 1R1TA 2PBIA 2QENA 3K69A 4KIGA 4IHSA 3F23A 1REPC 4XRFA 3CO7C 1XGMA 1MGTA 1J0RA 2V1XA 2VXZA 3HTSB 3NQOA 1A04A 3DPLC 2AS5F 2RVCA 1Z9CA 3DP7A 1OYYA 2OZUA 3T0YA 3CDHA 3BPXA 4G94A 3R60A 1LEBA 1DDNA 1YYVA 4IHTA 2VT3A 3BY6A 1CF7B 1K6OA 2H27A 4JQFA 3BJOA 3FXRA 1LQ1A 3RPQA 1ZAOA 1S7AA 4M73A 3FM3A 1V4RA 1YW7A 1FY7A 2ZMEB 2RDPA 2PQ8A 1J5YA 1FPQA 2QYOA 3R6SA 3JSPA 2HEOA 5IT9K 4OINF 4L0YB 3FM5A 1KQ8A 2VC1A 4KFCA 2EFWA 1YTYA 2FEZA 5A2QZ 1FSHA 2Z33A 4N9HA 1PP8F 1XDUA 5LHIA 3P7NA 3TDUC 2M1BA 3GXOA 4IF4A 3WG9A 3CO6C 4A12A 1XCVA 5DDGA 3E5XA 4I01A 1OR7A 4BHBA 1Y0UA 1KU2A 2J5PA 1R23A 2XUBA 2VODA 1FLIA 2NYXA 2GXBA 1X3UA 3I64A 3DPTA 4Z2YA 1I27A 5E20A 2OD5A 5D4SA 3KP7A 1IN6A 3VEPA 4GGGA 3BPVA 3IHUA 2PG4A 2XAQA 1ZGAA 3CUQB 1P4XA 2KJCA 1ZG5A 4I0AA 2K4JA 2O61A 3IC7A 4XLPF 3M8FA 4LD5A 5HOOA 5DD8A 4ESBA 5TJJA 2P5VA 5FD5A 3LQQA 1AOYA 4Y13A 1QGPA 4HX8A 3KETA 3SQNA 1ZREA 1YS6A 2V6CA 1FP2A 1KYZA 2Q0OA 3TO6A 2F5FA 1EH8A 2P6SA 5DCMB 1FNNA 2V1DA 4P55A 2IJLA 4O5VA 1LB2A 4HV5A 2ISZA 4GYGA 4WWCA 4EM0B 2Y75A 4DQ2A 3SFZA 1QO0D 3PQJA 4JBAA 4OIRF 4IVNA 1K78B 4TV7A 3K1PA 5CVIA 5DUIA 4CO8A 5HDKA 3FF5A 4CHUA 5HLHA 2QUFA 5ICGA 1BBYA 2XVCA 2RN7A 4ON0A 2K27A 2K02A 1BC8C 4IPAA 3D0SA 4U7BA 2HYFA 1LJ9A 1YW9A 5FO5A 2GA1A 3IWZA 2HKXA 1LDKB 1MJAA 3WTSC 2ISYA 5E8GA 2JT1A 5FB2A 5K1YA 2VC0A 2XAHA 2P5KA 3GUDA 2EB7A 5DCFA 2Z9OA 1SD5A 3DEUA 2CWEA 2XV4S 3EDPA 4U88A 1ZLJA 4OU0A 5HDGA 1CF7A 3GEZA 1IRFA 3SXYA 2DK5A 1XN7A 1HKSA 2W25A 4YIFA 3WGGA 4A2UA 3TQNA 2QWWA 5ICFA 4HBLA 1JGSA 1FWZA 4WCGA 2X4HA 3WE3A 4OMZA 3V8LA 3KP6A 1LDJA 1B1BA 3FZVA 1SAXA 3L00A 3H92A 2OQRA 1TNSA 2G7HA 4Y17A 1UFMA 3K9TA 2F5EA 3C7JA 2ESNA 2F5CA 4KA4A 4OIOF 2WTEA 2VE8A 1G3SA 1R7JA 2QBYB 3WU0A 2X0LA 3P9IA 5JVTA 4KIFA 2JRTA 1JE8A 3KCCA 4LLGF 1R36A 1B4AA 1FBQA 1C0WA 5FLXK 2RKHA 4M9SA 1W4MA 5A2QK 1IF1A 5E17F 5H6QA 1YQAA 2VOOA 1FBUA 4AIHA 2WWYA 5E1WA 1O57A 1ZN2A 3MWMA 3KP4A 4M71A 4IXAA 2QQAA 2UXNA 4UVAA 2ACJA 3ZN0A 2H94A 2O03A 4Y15A 4XBFA 5LGUA 2NRAC 3ZPLA 2STTA 2HGCA 4OIQF 1KQ9A 2ESHA 1XCBA 2XAGA 2FNPA 2NS0A 3CJNA 4BQAA 4NHJA 3RDIA 3DF8A 1KU9A 1BI3A 4PGGA 1ON2A 2VBYA 1ZH5A 2R7DA 2HDCA 2FF4A 2OBPA 2BBYA 1ZRFA 1IXSB 3GWZA 1Z6RA 3JAMZ 1W5SA 5ED4A 1FZPB 1HBXG 5JHUA 3K2ZA 5DEQA 2EFQA 4LGWA 4ETSA 3KP2A 4MQ9F 4HYEA 5E1ZB 2G7UA 2STWA 5CLSA 3RKYA 4A6DA 1D8KA 5EEGA 3ZP5A 2YX7A 4EJTA 1FYKA 3RYPA 4ENMA 3OOPA 1S29A 4FT8A 1MKMA 4HF0A 4AIJA 4IJAA 4F7ZA 4P5OA 2PMHA 1ONVA 4G9YA 3F8FA 5JR3A 2FMYA 3SZTA 4L9JA 5CVJA 1UCRA 3HRMA 1U3EM 3QOPA 1G3WA 4BHPA 2D1HA 3KE2A 3VB2A 2L3DA 4RS8A 1LDDA 1K78A 3ROUA 3ZMUA 2RGVA 2GXGA 3GYHX 2FMLA 2ZJ2A 1HSJA 3TDZC 4OOIA 2FNAA 2MH2A 1TQIA 1USSA 1XMAA 5L3DA 2BE5F 2WC2A 4NB5A 1ZRCA 1UHMA 5LHHA 5ERIA 4FHTA 3WTYC 1GHCA 1P4WA 2FBHA 1KGSA 5ILSA 4PGHA 2MLKA 3K0LA 1OYWA 2HTJA 1ODDA 1P6RA 3M7GA 3J81Z 1TQPA 2FBKA 2BYVE 2XRNA 1S8NA 2PMUA 3FMRA 4CGZA 2IA2A 1RIOH 3QU6A 4LFUA 4LK1F 2L02A 4PDKA 4ESJA 3ZN1A 2PJPA 3RPUA 1FT9A 4FX0A 2KIUA 4EVIA 3LA2A 4MHGA 2UZKA 1UHWA 1D8JA 4B09A 1KQ0A 1XGSA 2GAUA 1EV7A 3FHZA 5D5VB 2NNNA 1F5TA 1J9IA 2JZYA 5HVQC 5K5RA 2PN6A 4CZZA 1BJAA 4HLXA 4Q47A 1BI2A 2FBIA 1ZGJA 3U9GA 4M74A 2WV0A 3F8CA 2LF7A 4M9ZA 2QBYA 5D8KB 3F8BA 2G9WA 3V8JA 1OPCA 1P92A 4LG0B 5K5QA 2M5WA 1XD7A 2FSWA 2FQ3A 5DV5A 1SMYF 4RB3C 1W7PA 3GFMA 1TQMA 3ZMDA 2MA3A 1I6XA 1ZLKA 2DQLA 1DPUA 4XSZF 2EV5A 4BXUA 4M6XA 3V8KA 2OAZA 4K2EA 2IRFG 2OZ6A 4XSXF 4MTDA 4ZZLA 1FYMA 3FMSA 1SFXA 3EUHA 1RUNA 3NRVA 4LB5A 3HUGA 3E6MA 5J8CA 5L3GA 1WKMA 1XGNA 2OQGA 2OU2A 2VONA 4HLYA 5L3BA 5LLQA 1BI1A 1R1VA 1MD0A 3GZ5A 3L9FA 2MC3A 2QLZA 1O7LA 2DBBA 4EM1A 2JPCA 3I71A 2ZNYA 4ESFA 1TW3A 5ICCA 1U2WA 4RGXA 1Z6TA 3HRTA 1KU3A 1GXQA 2EV0A 1IN7A 2LNBA 3O2PE 2VT2A 3RIRA 3LAPA 3L2CA 2J5OA 1FBSA 2HKOA 4KICA 3JSOA 2EA4A 1TBXA 5FFZA 4KUMA 1YFHA 3HIFA 1KU7A 3T8TA 4KIBA 4KMFA 3J7AO 3W6JB 3M9AA 4MEYF 3O6BB 1J7KA 1Q1HA 2DAOA 3LA3A 4RB0A 5AIPA 3HOSA 4N9IA 1HKQA 5CVVA 3RI4A 2XGXA 1IXCA 3WE2A 1WRJA 4G6DA 4LMYA 2LSOA 4CYDA 3ZMZA 3DV8A 2HQRA 3ABUA 4IRHA 3J80Z 2P7VB 5CVUA 2EFPA 3HTUA 4YFKF 2GWRA 5LEKA 2P6TA 1SMTA 2ZBKA 5F6FA 3T1BA 2YPRA 1I1SA 2HTSA 2W24A 1PUEE 4Q4ZF 5FFXA 4Q48A 4ENJA 4RGUA 3MZHA 1IAWA 4Q5SF 1K79A 1QZYA 4L0ZB 2A07F 5DYMA 1O7FA 2W85A 4I02A 4I7HA 2MBFA 3ZMVA 2A3SA 4RAZA 1R58A 3Q9VA 2A68F 1T0FA 1BIAA 3CLOA 3WTXC 1ZYRF 3COAC 4D0PA 1IW7F 2QZ8A 4EJVA 1OKRA 2VBWA 3BDDA 4EJUA 2A6EF 4QLCU 3E97A 3H3ZA 2L54A 3ABTA 4UHTA 4FX4A 4RB2C 2K7LA 2CO5A 4MEXF 1IN5A 3D5LA 1W7PD 2E7XA 2W57A 3I0TA 4WXHA 3DQVC 4EQQA 1ULYA 3EYYA 4WXCA 3SHFA 4O6JA 2BV6A 3G73A 4HAMA 5J8FA 2A69F 3REOA 3TKYA 2UWMA 1J2XA 3P9KA 4LG0A 2HR3A 1YS7A 2RC4A 3TOBA 1TLHB 4R8HA 2PI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QP5 A;  3EQL F;  3GFI A;  4A5M A;  1TW2 A;  4XLN F;  2H6C A;  4BAY A;  4P9F A;  3JW4 A;  4L5I A;  1SD6 A;  3FX3 A;  3MAJ A;  1DP7 P;  2IT0 A;  2FXA A;  3ISP A;  1W7P B;  2HWV A;  1ON1 A;  1SD4 A;  3SZP A;  1Z7U A;  1W5T A;  2MLG A;  2IVM A;  5BQT A;  1V3F A;  5L3E A;  2FE3 A;  2Z3Y A;  1Z91 A;  3V7C A;  3KP3 A;  2HOE A;  3GF2 A;  3R0A A;  2L4M A;  1MDM B;  4ZYG A;  5IT9 Z;  2XIG A;  1PDN C;  2DW4 A;  4G7H F;  2LKP A;  2CQK A;  1T6S A;  2JPB A;  5HS9 A;  1BM9 A;  5CVR A;  2O8X A;  5BPI A;  5E1X A;  4L9V A;  2CG4 A;  3C18 A;  1IZ1 A;  2M87 A;  1LEA A;  3HRS A;  3TGN A;  4HW0 A;  1R22 A;  4HZF A;  4R79 A;  3KEO A;  2IA0 A;  3WU1 B;  3IRR A;  4EV0 A;  5D6E A;  1XB4 A;  2DQR A;  1MJ9 A;  2B0L A;  1RZ4 A;  1XMK A;  4WX9 A;  3L09 A;  2DFI A;  3QPT A;  3TOA A;  3F8M A;  2YR2 A;  3T8R A;  1CGP A;  4B8X A;  1PP7 U;  4G8X A;  4JK1 X;  2DI3 A;  1OMI A;  3TO9 A;  3ELK A;  5L3C A;  4L18 B;  3RJP A;  4OMY A;  4UXN A;  4HOB A;  1FX7 A;  1WI9 A;  2VOP A;  4GXO A;  5LEJ A;  4M9X A;  1UST A;  5HDN A;  2H09 A;  1FP1 D;  2FA5 A;  3JTG A;  2ZFW A;  4U7D A;  4EJO A;  3IRQ A;  1IXR C;  3CUO A;  4L5J A;  3HOT A;  1F9N A;  2GQQ A;  2VE9 A;  3M1E A;  4GCV A;  3FXQ A;  3HHG A;  5BOX A;  1S6L A;  3E6C C;  4HQM A;  2EJR A;  1DPR A;  1XSD A;  4LJZ F;  2M45 A;  5KVR A;  5L3F A;  3P9C A;  2VBZ A;  3HSR A;  2EV6 A;  2KKO A;  2QM3 A;  4ZZD A;  4I09 A;  4LLN A;  1H9T A;  1BOA A;  2EFN A;  3HHH A;  4EGZ A;  4CDG A;  4U0V A;  4QWQ A;  1GVJ A;  4ZYH A;  2RQP A;  1G3Y A;  3M8E A;  3ML6 A;  2Z5U A;  2O6G E;  3LAJ A;  3BJA A;  1B6A A;  4AWX B;  4BHC A;  2ELH A;  2ZXJ A;  6PAX A;  2PFB A;  3CTA A;  5HLG A;  4HF2 A;  4G7Z F;  2XRO A;  4E70 A;  1JHF A;  3N4M A;  3ERE D;  1XGO A;  3E6B A;  3WTW C;  4I2O A;  2IW5 A;  1D3Y A;  3S2W A;  1D5V A;  5BPD A;  4M72 A;  2P8T A;  3QP6 A;  4HQE A;  4HV6 A;  1O3S A;  2A5Y B;  1RUO A;  4WXD A;  3W6K B;  2O0Y A;  2CYY A;  4HX7 A;  2VBX A;  3IWF A;  4A0X A;  2L4A A;  3MEX A;  4CIC A;  3MCZ A;  4L9N A;  2XKP A;  5D8L B;  1FSE A;  2HZT A;  1XDS A;  1EH6 A;  4BNC A;  1I5Z A;  2UXX A;  4MNU A;  4ZYD A;  1QBJ A;  3HYI A;  3ULQ B;  4H0E A;  2FRH A;  3F21 A;  5H6R A;  4UV9 A;  3HSF A;  1O3R A;  3FWE A;  4RB1 A;  3AAF A;  5D6F A;  4R1H A;  1HW1 A;  3WTT C;  3MFK A;  2W84 A;  2XAS A;  1F4K A;  2XKO A;  3IL2 A;  1ZHF A;  5J6X A;  3VOD A;  3HRU A;  5E18 F;  1MDM A;  1ZG3 A;  4EM2 A;  2D2W A;  2MH9 A;  4I0B A;  5H20 A;  1JHH A;  1U5T B;  3KP5 A;  5LGN A;  4M6Y A;  1R00 A;  5ILU A;  2O3F A;  1ZG1 A;  2HYG D;  2XHK A;  4IRG A;  5FGM A;  5FLX Z;  3U2R A;  5LHG A;  2DT5 A;  3QAH A;  2IPQ X;  1B59 A;  1RI7 A;  3I59 A;  1OYI A;  3MZY A;  4MTE A;  3RTR A;  3KZZ A;  2Z99 A;  3F22 A;  2KJB A;  2CGP A;  3JAM K;  2RNJ A;  1RNL A;  2DTR A;  4ASN A;  2R7F A;  3V4G A;  1VTN C;  1HW2 A;  3HSE A;  3BP8 A;  2D45 A;  3PQK A;  2BEO A;  4KYW A;  2COM A;  3R0J A;  3BOQ A;  3V7R A;  4HDV A;  2LDU A;  3EYI A;  3LWF A;  1O3T A;  1BI0 A;  5F64 A;  3ZQ7 A;  5JFR A;  1DUX C;  1U8R A;  4L9T A;  2E1N A;  4P9U A;  3C1D A;  1T38 A;  2P7C B;  2CW0 F;  3E5U A;  3Q5F A;  5D5X B;  4MGR A;  1BIB A;  2EWN A;  4WF2 A;  4PCQ A;  2KIF A;  5TRD A;  2CSO A;  2Y48 A;  4U0W A;  5CJ9 A;  1IN4 A;  1TNT A;  5D4R A;  1H9G A;  2ADU A;  3GFL A;  4U0Y A;  1SFU A;  1QQI A;  2YU3 A;  1P2F A;  3GZ6 A;  4UUV A;  1HXD A;  4IRI A;  3F72 A;  2DO7 A;  5CYV A;  2NAZ A;  5BMZ A;  1YG2 A;  1F1Z A;  2ETH A;  4ENN A;  1QZZ A;  4ZYE A;  3ZMS A;  1FOK A;  4EMS A;  5DUK A;  1S7O A;  2YX4 A;  3GVA A;  4LLL A;  2D1V A;  4GO1 A;  1BC7 C;  1WQ2 A;  2QQB A;  1YLF A;  3FMQ A;  3WTZ A;  4KN4 X;  5AIQ A;  2H6B A;  1G6N A;  3GLX A;  1I1G A;  2P4W A;  2EFO A;  4BYY A;  2K4B A;  3IKV A;  2YSR A;  4A6E A;  5LBQ A;  2BGC A;  3LA7 A;  3J81 K;  1T98 A;  1Z05 A;  3L7W A;  4YII A;  2HS5 A;  3WTV C;  2M30 A;  2XAF A;  2MD5 A;  4BH9 A;  3E3V A;  1LVA A;  5DD4 A;  5LRR A;  1MZB A;  3T5X A;  2HQN A;  2K86 A;  4LK0 F;  3F6V A;  3TO7 A;  4O3M A;  4AVP A;  4GYI A;  5HLI A;  4G6Q A;  2IP2 A;  1KYW A;  3F3X A;  3E5Q A;  4YFX F;  3I4P A;  3RKX A;  5IT3 A;  2XAJ A;  3QRF F;  4NQW A;  5KK1 A;  3WGH A;  4UVC A;  1U6G A;  2QQ9 A;  2NNY A;  2Q8K A;  2P5L C;  4RGS A;  1HW5 A;  2PLY A;  3EET A;  2LF8 A;  1O3Q A;  2OA4 A;  2DU9 A;  5LRS A;  2RV8 A;  3VOE A;  3MQ0 A;  1B9N A;  2EA2 A;  3DXJ F;  4UV8 A;  1ZRD A;  2TDX A;  3GO5 A;  1EH7 A;  3KLO A;  4CXF A;  3Q9S A;  1QNT A;  4RAY A;  3WOD F;  2FU4 A;  2ZME A;  5D5W B;  4OIP F;  3BRO A;  1G4D A;  1AWC A;  1WWX A;  1T2K A;  1TTY A;  4I98 B;  1L0O C;  4A5N A;  1WSU A;  2VN2 A;  3KEQ A;  2GZW A;  1U5T A;  2ZO4 A;  3ZMT A;  3QPH A;  3I58 A;  2F2E A;  1S3J A;  3NEU A;  2AXL A;  4P96 A;  1BN5 A;  2CFX A;  5ILV A;  4KMU X;  4HDU A;  2A6H F;  1FC3 A;  2JSC A;  3N97 A;  3B02 A;  1G3T A;  1LNW A;  5HS7 A;  1SFE A;  5BS6 A;  1P4A A;  3FXU A;  3QU3 A;  2F5D A;  4UVB A;  3PFI A;  1UB9 A;  3RKW A;  1YIO A;  1SD7 A;  3VFZ A;  5LGT A;  4RGR A;  3I54 A;  1HST A;  1R5G A;  3B73 A;  4KT5 C;  2HFH A;  2DPD A;  2R3S A;  4UNO A;  1U5T C;  4A0Z A;  1R1U A;  2V79 A;  1J59 A;  1B9M A;  3I59 B;  3R61 A;  4MQV A;  1ZAR A;  2GIV A;  1IN8 A;  4YFN F;  1T39 A;  3IKT A;  3I53 A;  1IUY A;  3F8N A;  3RYR A;  2V1U A;  5FD6 A;  4ENK A;  4N0B A;  3CUQ A;  2ZNZ A;  2ZCW A;  4YG2 F;  3GX4 X;  5D5U B;  2KIM A;  4KN7 X;  1U78 A;  1J75 A;  4AIK A;  4DNC A;  1FYL A;  2C6Y A;  5EEH A;  1R5H A;  3BWG A;  3BJ6 A;  3WTU C;  4EGY A;  1MJB A;  1KA8 A;  3KFW X;  3J80 K;  2L01 A;  3LST A;  4ZH4 F;  1YW8 A;  1XSV A;  3G3Z A;  3K1N A;  3H3U A;  1K7A A;  4HF1 A;  5DCM A;  2E1C A;  2FOK A;  3WGI A;  5F1R A;  5ICE A;  4PZJ A;  5JI6 A;  3I5U A;  5E8I A;  3CUQ C;  3DFG A;  1YO5 C;  4S05 A;  1E17 A;  1STZ A;  3LQR A;  5AON A;  3OV8 A;  2GA2 A;  3F6O A;  1H0M A;  2DK8 A;  1NHA A;  3ECH A;  3GW2 A;  3C3W A;  1HKT A;  1L3L A;  2KRF A;  1HQC A;  2DLL A;  3O3K A;  3R4K A;  4KDP A;  2E7W A;  1E2X A;  2IA1 A;  2ZKZ A;  4A0Y A;  3ECO A;  1Z1D A;  4AD9 A;  4EJW A;  2EK5 A;  3U1D A;  4G7O F;  3V7S A;  2Y0M A;  3DKW A;  2JTV A;  3GFJ A;  4LB6 B;  4KNY A;  5K5O A;  3K1M A;  1XSX A;  2V9V A;  2A61 A;  5HS8 A;  4WK8 F;  3KZY A;  2DPU A;  4HA8 A;  2PEX A;  2QVO A;  1IRG A;  1QPM A;  1GXP A;  3JTH A;  3LFK A;  3E6D A;  1JXS A;  3KLN A;  2M8E A;  3BZ6 A;  4S04 A;  2Q2E A;  4HX4 A;  1R1T A;  2PBI A;  2QEN A;  3K69 A;  4KIG A;  4IHS A;  3F23 A;  1REP C;  4XRF A;  3CO7 C;  1XGM A;  1MGT A;  1J0R A;  2V1X A;  2VXZ A;  3HTS B;  3NQO A;  1A04 A;  3DPL C;  2AS5 F;  2RVC A;  1Z9C A;  3DP7 A;  1OYY A;  2OZU A;  3T0Y A;  3CDH A;  3BPX A;  4G94 A;  3R60 A;  1LEB A;  1DDN A;  1YYV A;  4IHT A;  2VT3 A;  3BY6 A;  1CF7 B;  1K6O A;  2H27 A;  4JQF A;  3BJO A;  3FXR A;  1LQ1 A;  3RPQ A;  1ZAO A;  1S7A A;  4M73 A;  3FM3 A;  1V4R A;  1YW7 A;  1FY7 A;  2ZME B;  2RDP A;  2PQ8 A;  1J5Y A;  1FPQ A;  2QYO A;  3R6S A;  3JSP A;  2HEO A;  5IT9 K;  4OIN F;  4L0Y B;  3FM5 A;  1KQ8 A;  2VC1 A;  4KFC A;  2EFW A;  1YTY A;  2FEZ A;  5A2Q Z;  1FSH A;  2Z33 A;  4N9H A;  1PP8 F;  1XDU A;  5LHI A;  3P7N A;  3TDU C;  2M1B A;  3GXO A;  4IF4 A;  3WG9 A;  3CO6 C;  4A12 A;  1XCV A;  5DDG A;  3E5X A;  4I01 A;  1OR7 A;  4BHB A;  1Y0U A;  1KU2 A;  2J5P A;  1R23 A;  2XUB A;  2VOD A;  1FLI A;  2NYX A;  2GXB A;  1X3U A;  3I64 A;  3DPT A;  4Z2Y A;  1I27 A;  5E20 A;  2OD5 A;  5D4S A;  3KP7 A;  1IN6 A;  3VEP A;  4GGG A;  3BPV A;  3IHU A;  2PG4 A;  2XAQ A;  1ZGA A;  3CUQ B;  1P4X A;  2KJC A;  1ZG5 A;  4I0A A;  2K4J A;  2O61 A;  3IC7 A;  4XLP F;  3M8F A;  4LD5 A;  5HOO A;  5DD8 A;  4ESB A;  5TJJ A;  2P5V A;  5FD5 A;  3LQQ A;  1AOY A;  4Y13 A;  1QGP A;  4HX8 A;  3KET A;  3SQN A;  1ZRE A;  1YS6 A;  2V6C A;  1FP2 A;  1KYZ A;  2Q0O A;  3TO6 A;  2F5F A;  1EH8 A;  2P6S A;  5DCM B;  1FNN A;  2V1D A;  4P55 A;  2IJL A;  4O5V A;  1LB2 A;  4HV5 A;  2ISZ A;  4GYG A;  4WWC A;  4EM0 B;  2Y75 A;  4DQ2 A;  3SFZ A;  1QO0 D;  3PQJ A;  4JBA A;  4OIR F;  4IVN A;  1K78 B;  4TV7 A;  3K1P A;  5CVI A;  5DUI A;  4CO8 A;  5HDK A;  3FF5 A;  4CHU A;  5HLH A;  2QUF A;  5ICG A;  1BBY A;  2XVC A;  2RN7 A;  4ON0 A;  2K27 A;  2K02 A;  1BC8 C;  4IPA A;  3D0S A;  4U7B A;  2HYF A;  1LJ9 A;  1YW9 A;  5FO5 A;  2GA1 A;  3IWZ A;  2HKX A;  1LDK B;  1MJA A;  3WTS C;  2ISY A;  5E8G A;  2JT1 A;  5FB2 A;  5K1Y A;  2VC0 A;  2XAH A;  2P5K A;  3GUD A;  2EB7 A;  5DCF A;  2Z9O A;  1SD5 A;  3DEU A;  2CWE A;  2XV4 S;  3EDP A;  4U88 A;  1ZLJ A;  4OU0 A;  5HDG A;  1CF7 A;  3GEZ A;  1IRF A;  3SXY A;  2DK5 A;  1XN7 A;  1HKS A;  2W25 A;  4YIF A;  3WGG A;  4A2U A;  3TQN A;  2QWW A;  5ICF A;  4HBL A;  1JGS A;  1FWZ A;  4WCG A;  2X4H A;  3WE3 A;  4OMZ A;  3V8L A;  3KP6 A;  1LDJ A;  1B1B A;  3FZV A;  1SAX A;  3L00 A;  3H92 A;  2OQR A;  1TNS A;  2G7H A;  4Y17 A;  1UFM A;  3K9T A;  2F5E A;  3C7J A;  2ESN A;  2F5C A;  4KA4 A;  4OIO F;  2WTE A;  2VE8 A;  1G3S A;  1R7J A;  2QBY B;  3WU0 A;  2X0L A;  3P9I A;  5JVT A;  4KIF A;  2JRT A;  1JE8 A;  3KCC A;  4LLG F;  1R36 A;  1B4A A;  1FBQ A;  1C0W A;  5FLX K;  2RKH A;  4M9S A;  1W4M A;  5A2Q K;  1IF1 A;  5E17 F;  5H6Q A;  1YQA A;  2VOO A;  1FBU A;  4AIH A;  2WWY A;  5E1W A;  1O57 A;  1ZN2 A;  3MWM A;  3KP4 A;  4M71 A;  4IXA A;  2QQA A;  2UXN A;  4UVA A;  2ACJ A;  3ZN0 A;  2H94 A;  2O03 A;  4Y15 A;  4XBF A;  5LGU A;  2NRA C;  3ZPL A;  2STT A;  2HGC A;  4OIQ F;  1KQ9 A;  2ESH A;  1XCB A;  2XAG A;  2FNP A;  2NS0 A;  3CJN A;  4BQA A;  4NHJ A;  3RDI A;  3DF8 A;  1KU9 A;  1BI3 A;  4PGG A;  1ON2 A;  2VBY A;  1ZH5 A;  2R7D A;  2HDC A;  2FF4 A;  2OBP A;  2BBY A;  1ZRF A;  1IXS B;  3GWZ A;  1Z6R A;  3JAM Z;  1W5S A;  5ED4 A;  1FZP B;  1HBX G;  5JHU A;  3K2Z A;  5DEQ A;  2EFQ A;  4LGW A;  4ETS A;  3KP2 A;  4MQ9 F;  4HYE A;  5E1Z B;  2G7U A;  2STW A;  5CLS A;  3RKY A;  4A6D A;  1D8K A;  5EEG A;  3ZP5 A;  2YX7 A;  4EJT A;  1FYK A;  3RYP A;  4ENM A;  3OOP A;  1S29 A;  4FT8 A;  1MKM A;  4HF0 A;  4AIJ A;  4IJA A;  4F7Z A;  4P5O A;  2PMH A;  1ONV A;  4G9Y A;  3F8F A;  5JR3 A;  2FMY A;  3SZT A;  4L9J A;  5CVJ A;  1UCR A;  3HRM A;  1U3E M;  3QOP A;  1G3W A;  4BHP A;  2D1H A;  3KE2 A;  3VB2 A;  2L3D A;  4RS8 A;  1LDD A;  1K78 A;  3ROU A;  3ZMU A;  2RGV A;  2GXG A;  3GYH X;  2FML A;  2ZJ2 A;  1HSJ A;  3TDZ C;  4OOI A;  2FNA A;  2MH2 A;  1TQI A;  1USS A;  1XMA A;  5L3D A;  2BE5 F;  2WC2 A;  4NB5 A;  1ZRC A;  1UHM A;  5LHH A;  5ERI A;  4FHT A;  3WTY C;  1GHC A;  1P4W A;  2FBH A;  1KGS A;  5ILS A;  4PGH A;  2MLK A;  3K0L A;  1OYW A;  2HTJ A;  1ODD A;  1P6R A;  3M7G A;  3J81 Z;  1TQP A;  2FBK A;  2BYV E;  2XRN A;  1S8N A;  2PMU A;  3FMR A;  4CGZ A;  2IA2 A;  1RIO H;  3QU6 A;  4LFU A;  4LK1 F;  2L02 A;  4PDK A;  4ESJ A;  3ZN1 A;  2PJP A;  3RPU A;  1FT9 A;  4FX0 A;  2KIU A;  4EVI A;  3LA2 A;  4MHG A;  2UZK A;  1UHW A;  1D8J A;  4B09 A;  1KQ0 A;  1XGS A;  2GAU A;  1EV7 A;  3FHZ A;  5D5V B;  2NNN A;  1F5T A;  1J9I A;  2JZY A;  5HVQ C;  5K5R A;  2PN6 A;  4CZZ A;  1BJA A;  4HLX A;  4Q47 A;  1BI2 A;  2FBI A;  1ZGJ A;  3U9G A;  4M74 A;  2WV0 A;  3F8C A;  2LF7 A;  4M9Z A;  2QBY A;  5D8K B;  3F8B A;  2G9W A;  3V8J A;  1OPC A;  1P92 A;  4LG0 B;  5K5Q A;  2M5W A;  1XD7 A;  2FSW A;  2FQ3 A;  5DV5 A;  1SMY F;  4RB3 C;  1W7P A;  3GFM A;  1TQM A;  3ZMD A;  2MA3 A;  1I6X A;  1ZLK A;  2DQL A;  1DPU A;  4XSZ F;  2EV5 A;  4BXU A;  4M6X A;  3V8K A;  2OAZ A;  4K2E A;  2IRF G;  2OZ6 A;  4XSX F;  4MTD A;  4ZZL A;  1FYM A;  3FMS A;  1SFX A;  3EUH A;  1RUN A;  3NRV A;  4LB5 A;  3HUG A;  3E6M A;  5J8C A;  5L3G A;  1WKM A;  1XGN A;  2OQG A;  2OU2 A;  2VON A;  4HLY A;  5L3B A;  5LLQ A;  1BI1 A;  1R1V A;  1MD0 A;  3GZ5 A;  3L9F A;  2MC3 A;  2QLZ A;  1O7L A;  2DBB A;  4EM1 A;  2JPC A;  3I71 A;  2ZNY A;  4ESF A;  1TW3 A;  5ICC A;  1U2W A;  4RGX A;  1Z6T A;  3HRT A;  1KU3 A;  1GXQ A;  2EV0 A;  1IN7 A;  2LNB A;  3O2P E;  2VT2 A;  3RIR A;  3LAP A;  3L2C A;  2J5O A;  1FBS A;  2HKO A;  4KIC A;  3JSO A;  2EA4 A;  1TBX A;  5FFZ A;  4KUM A;  1YFH A;  3HIF A;  1KU7 A;  3T8T A;  4KIB A;  4KMF A;  3J7A O;  3W6J B;  3M9A A;  4MEY F;  3O6B B;  1J7K A;  1Q1H A;  2DAO A;  3LA3 A;  4RB0 A;  5AIP A;  3HOS A;  4N9I A;  1HKQ A;  5CVV A;  3RI4 A;  2XGX A;  1IXC A;  3WE2 A;  1WRJ A;  4G6D A;  4LMY A;  2LSO A;  4CYD A;  3ZMZ A;  3DV8 A;  2HQR A;  3ABU A;  4IRH A;  3J80 Z;  2P7V B;  5CVU A;  2EFP A;  3HTU A;  4YFK F;  2GWR A;  5LEK A;  2P6T A;  1SMT A;  2ZBK A;  5F6F A;  3T1B A;  2YPR A;  1I1S A;  2HTS A;  2W24 A;  1PUE E;  4Q4Z F;  5FFX A;  4Q48 A;  4ENJ A;  4RGU A;  3MZH A;  1IAW A;  4Q5S F;  1K79 A;  1QZY A;  4L0Z B;  2A07 F;  5DYM A;  1O7F A;  2W85 A;  4I02 A;  4I7H A;  2MBF A;  3ZMV A;  2A3S A;  4RAZ A;  1R58 A;  3Q9V A;  2A68 F;  1T0F A;  1BIA A;  3CLO A;  3WTX C;  1ZYR F;  3COA C;  4D0P A;  1IW7 F;  2QZ8 A;  4EJV A;  1OKR A;  2VBW A;  3BDD A;  4EJU A;  2A6E F;  4QLC U;  3E97 A;  3H3Z A;  2L54 A;  3ABT A;  4UHT A;  4FX4 A;  4RB2 C;  2K7L A;  2CO5 A;  4MEX F;  1IN5 A;  3D5L A;  1W7P D;  2E7X A;  2W57 A;  3I0T A;  4WXH A;  3DQV C;  4EQQ A;  1ULY A;  3EYY A;  4WXC A;  3SHF A;  4O6J A;  2BV6 A;  3G73 A;  4HAM A;  5J8F A;  2A69 F;  3REO A;  3TKY A;  2UWM A;  1J2X A;  3P9K A;  4LG0 A;  2HR3 A;  1YS7 A;  2RC4 A;  3TOB A;  1TLH B;  4R8H A;  2PI0 A; 
#chains in the Genus database with same CATH topology
 2Y0S N;  1XX5 A;  3QP5 A;  1E0E A;  3EQL F;  1FIA A;  1U9N A;  5DTD A;  4PFP A;  3GFI A;  4A5M A;  1JKQ C;  1TW2 A;  2EQR A;  2H6C A;  4XLN F;  4BAY A;  3DBH B;  2W4S A;  4P9F A;  3JW4 A;  2DA1 A;  1B8I B;  4IQ4 A;  4L5I A;  1SD6 A;  2W7N A;  1XTA A;  3FX3 A;  3MAJ A;  2P0W A;  1DP7 P;  2VJI A;  1D0Z A;  5F0F A;  2IT0 A;  2FXA A;  3ISP A;  4PFO A;  1W7P B;  2HWV A;  1ON1 A;  3D5S C;  3PUB A;  2R7Z J;  1SD4 A;  1IV6 A;  3OYM A;  3SZP A;  4J00 A;  1Z7U A;  1W5T A;  4BAC A;  2MLG A;  2IVM A;  2QKM B;  1EF4 A;  2F4M B;  4ABZ A;  5BQT A;  1RR8 C;  1V3F A;  2X1C A;  5L3E A;  1YX3 A;  2FE3 A;  2Z3Y A;  3S32 A;  2ZSI B;  3QWL A;  1Z91 A;  3V7C A;  3KP3 A;  2HOE A;  3F0C A;  5JLW A;  3GF2 A;  3R0A A;  3K4M A;  2L4M A;  2QGU A;  1MDM B;  1ACI A;  1YX5 A;  1A6Q A;  3QPS A;  5F1J A;  4ZYG A;  2DMN A;  5IT9 Z;  2XIG A;  2GOM A;  3Q0U A;  1PDN C;  2DW4 A;  4ZJZ A;  4G7H F;  2LKP A;  2CQK A;  2O8K A;  4IHX A;  5B66 C;  1T6S A;  2JPB A;  5HS9 A;  2EZI A;  4KIS A;  3S15 J;  1BM9 A;  1WH7 A;  2DN0 A;  3BR2 A;  5FRM A;  5CVR A;  2O8X A;  5BPI A;  5E1X A;  4L9V A;  2CG4 A;  3H5A A;  3C18 A;  1IZ1 A;  2M87 A;  4ZC3 A;  1LEA A;  3HRS A;  3TGN A;  1MBG A;  2DJI A;  3HUG B;  2KMU A;  4C30 A;  4HW0 A;  1R22 A;  4HZF A;  1SFK A;  3KEO A;  4C3I J;  4R79 A;  2IA0 A;  1N77 A;  2XGD A;  3WU1 B;  3IRR A;  1RR7 A;  4EV0 A;  5D6E A;  1XB4 A;  3LSK A;  1H88 C;  5E3O A;  1RKW A;  2DQR A;  2IS6 A;  1APL C;  2V4J C;  1IO2 A;  2EIK H;  1MJ9 A;  2B0L A;  2JA8 J;  1RZ4 A;  1XMK A;  3HKZ A;  3TW7 A;  4WX9 A;  2TCT A;  3MVP A;  2PJR B;  1EKE A;  3L09 A;  3G2B A;  2FQ4 A;  2DFI A;  2Y9Y A;  3QPT A;  4FE4 A;  4XLC A;  1YRN A;  3TOA A;  3F8M A;  3BR3 A;  1SC7 A;  2YR2 A;  3T8R A;  1CGP A;  4B8X A;  1I3A A;  4CYC B;  2QSF X;  1PP7 U;  3S93 A;  2ZC2 A;  3DU5 A;  3O8G A;  4JX5 A;  4G8X A;  4JK1 X;  2DI3 A;  1OMI A;  3TO9 A;  3BG6 A;  3ELK A;  5L3C A;  3W2A A;  4L18 B;  3HXL A;  3RJP A;  4XOR A;  1VQ9 I;  1YIT I;  4OMY A;  4BJ6 C;  3DCF A;  4UXN A;  4HOB A;  1FX7 A;  1WI9 A;  4E4H A;  3EPZ A;  2VOP A;  3E0J B;  2EPF A;  4GXO A;  2PX9 A;  2R5Y A;  5LEJ A;  2HQA A;  1IRX A;  2BOL A;  1QHG A;  3IAS 2;  4M9X A;  2XF7 A;  2GBY A;  5GPA A;  1UST A;  1R49 A;  2DCE A;  2LD5 A;  4BY7 J;  4HPQ A;  5HDN A;  1D5Y A;  2UUZ A;  4II3 A;  2H09 A;  1JTX A;  2WBM A;  4XLE A;  2VPL A;  4DIQ A;  2H1K A;  1FP1 D;  2FA5 A;  3JTG A;  2K3F A;  2ZFW A;  1A35 A;  4U7D A;  3RQ4 A;  4EJO A;  3IRQ A;  2R7O A;  2VJJ A;  1IXR C;  4C2U A;  4IHW A;  2V9K A;  3CUO A;  4L5J A;  3ESW B;  3HOT A;  1F9N A;  2GQQ A;  2VE9 A;  3BG9 A;  1V55 H;  3M1E A;  4GCV A;  3FXQ A;  1TWC J;  2WAF A;  3H3V K;  3HHG A;  5BOX A;  1S6L A;  4HQM A;  3E6C C;  2QEX I;  4X0G A;  2BHZ A;  2EJR A;  2LRE A;  3CP8 A;  1DPR A;  2ZXW H;  1D1B A;  2X85 A;  3C2G A;  5F04 A;  1XSD A;  4LJZ F;  2M45 A;  2JUC A;  1PJR A;  5KVR A;  5L3F A;  3P9C A;  3TP0 A;  2Y9Z A;  2JJ7 A;  2VBZ A;  3NWT A;  3HSR A;  2EV6 A;  2KKO A;  2QM3 A;  3BTL A;  2XGC A;  4ZZD A;  4I09 A;  2XF6 A;  3ZOB A;  4LLN A;  3K7A J;  5IYC J;  1T08 B;  2DA3 A;  1H9T A;  5FKL A;  2KPM A;  4XKC A;  1BOA A;  2EFN A;  2BW3 B;  3HHH A;  4CDG A;  4EGZ A;  4U0V A;  4QWQ A;  2CQN A;  4V19 K;  1GVJ A;  1WFX A;  3LOC A;  4ZYH A;  2RQP A;  4A3J J;  1G3Y A;  3M8E A;  3ML6 A;  5J47 A;  2Z5U A;  2O6G E;  3LAJ A;  4U87 A;  1IRZ A;  3BJA A;  2R7X A;  3GTP J;  5KHD A;  3ZQI A;  1B6A A;  4IQJ A;  4AWX B;  3VPR A;  5EF6 A;  2LKX A;  1A5J A;  4BHC A;  1MMN A;  1B72 B;  1YHQ I;  2ELH A;  2ZXJ A;  2H8R A;  4Y3O A;  6PAX A;  2PFB A;  2Q1Z B;  3CTA A;  2MAB A;  4BL0 B;  1JJ8 C;  5HLG A;  4HF2 A;  1WJB A;  4ZDP A;  4G7Z F;  1MH4 A;  4UUS A;  3GME A;  2XRO A;  3PJR A;  2ZJR F;  3FHN A;  1ETX A;  4E70 A;  1GLN A;  1JHF A;  5FRN A;  3DKY A;  1E3H A;  3N4M A;  3ERE D;  2LOO A;  5IOY A;  1XGO A;  3E6B A;  3WTW C;  4I2O A;  2RRE A;  3AKZ A;  2IW5 A;  1D3Y A;  3KPH A;  4OWR B;  1WJE A;  3S2W A;  1D1C A;  1D5V A;  3J7A Y;  5BPD A;  4M72 A;  2IGO A;  1U0J A;  2WAQ A;  3S16 J;  2P8T A;  3QP6 A;  1FMW A;  3DWL E;  4YRV A;  4HQE A;  4HV6 A;  4MFD A;  4RM3 A;  1O3S A;  2A5Y B;  4PK4 A;  1RUO A;  1H89 C;  2L9R A;  2KZG A;  4WXD A;  1LFB A;  2IEK A;  2M4K A;  3W6K B;  2O0Y A;  3NAR A;  1IG7 A;  1DP3 A;  1WI3 A;  2CYY A;  3TL4 X;  4HX7 A;  2VBX A;  3IWF A;  4A0X A;  2L4A A;  4RA2 A;  3MEX A;  4CIC A;  3MCZ A;  4L9N A;  3QYF A;  2XKP A;  3I4M J;  5D8L B;  1FSE A;  1U9O A;  2HZT A;  3G1L A;  3LSP A;  4IKF A;  1XDS A;  1T95 A;  1EH6 A;  3ZRG A;  4BNC A;  4NQW B;  1I5Z A;  2YS9 A;  2UXX A;  1QVU A;  2V1N A;  4MNU A;  2K40 A;  4HNV A;  4ZYD A;  1RKT A;  1QBJ A;  2E1M B;  3HYI A;  3ULQ B;  2M9H A;  1B8I A;  3D1N I;  4H0E A;  2FRH A;  4B44 A;  2V6E A;  3F21 A;  3TED A;  2F6C A;  3K4K A;  1UHS A;  4UV9 A;  5H6R A;  4F55 A;  3HSF A;  4DZJ A;  1O3R A;  3FWE A;  4XR6 A;  4RB1 A;  3HZJ A;  3AAF A;  2X51 A;  5D6F A;  2WAE A;  4R1H A;  2XGE A;  1O4X A;  1HW1 A;  2VB6 A;  3FK7 A;  3WTT C;  2XSJ C;  3MFK A;  3M4O J;  2W84 A;  2JMW A;  2XAS A;  1F4K A;  2GM4 A;  3QQA A;  1X1A A;  2XKO A;  3IL2 A;  3SEQ A;  2R7W A;  1ZHF A;  5J6X A;  4Y33 A;  4OAY A;  3VOD A;  2W1O A;  3HRU A;  3S14 J;  5E18 F;  1MDM A;  1ZG3 A;  4EM2 A;  4E7S A;  2VQH A;  5J40 A;  3OYJ A;  4A3L J;  4BJT A;  2D2W A;  4I99 C;  2MH9 A;  4I0B A;  2Z2S B;  5H20 A;  1JHH A;  3PNT A;  1U5T B;  1MMD A;  3KP5 A;  5LGN A;  3UNG C;  4M6Y A;  4HSR A;  1R00 A;  4M6V A;  5ILU A;  2O3F A;  2KDZ A;  1ZG1 A;  1H8A C;  1QHH D;  2HYG D;  2XHK A;  4S0H B;  4IRG A;  2O7O A;  4C9Y A;  5FGM A;  4ZDO A;  5FLX Z;  3U2R A;  1WGX A;  1OIS A;  3OYI A;  2MG4 A;  2KQR A;  5LHG A;  3KYD B;  3PO3 J;  2DT5 A;  3QAH A;  3K70 C;  2IPQ X;  1B59 A;  1RI7 A;  3I59 A;  1OYI A;  3MZY A;  3E7L A;  4N4O B;  4JP0 A;  4MTE A;  2CFO A;  5C4X J;  3MN2 A;  3RTR A;  1I50 J;  2L7M P;  3HOV J;  3KZZ A;  3QOD A;  2E34 A;  1OCP A;  2Z99 A;  4HNT A;  3F22 A;  2K9L A;  2KJB A;  3SYT A;  2CGP A;  3BG7 A;  3JAM K;  2E36 A;  2RNJ A;  1RNL A;  1YJ9 I;  5IP9 J;  2DTR A;  1OCO H;  4ASN A;  4H4K C;  2R7F A;  3V4G A;  1VTN C;  1HW2 A;  3HSE A;  3BP8 A;  2D45 A;  3PQK A;  2BEO A;  4KYW A;  2COM A;  3R0J A;  4BKX A;  3BOQ A;  3V7R A;  4HDV A;  3ZQF A;  5M3F J;  3ZQL A;  2LDU A;  3EYI A;  1F36 A;  2NVY J;  1E3O C;  2DT6 A;  3K4L A;  1YRN B;  4II2 A;  3LWF A;  3JRC A;  3BQY A;  4BJ5 C;  2LKS A;  4D5C A;  1O3T A;  1BI0 A;  2XPW A;  5F64 A;  2EIN H;  3ZQ7 A;  4FET A;  5JFR A;  1DUX C;  1U8R A;  4L9T A;  3MD2 A;  3CCU I;  1NH3 A;  3CJT B;  4AC0 A;  3JRH A;  2E1N A;  5JVG F;  3HOU J;  4F93 B;  2LY9 A;  1VI0 A;  3HOY J;  4P9U A;  3C1D A;  1T38 A;  2P7C B;  2CW0 F;  3CCM I;  4XN0 A;  4XKV A;  3E5U A;  4E7L A;  3BR1 A;  2VIX A;  3OL3 A;  3H35 A;  2LYC A;  2KP6 A;  3Q5F A;  5D5X B;  3AG2 H;  4MGR A;  3HGY A;  1BIB A;  2EWN A;  3IH2 A;  4WF2 A;  4PCQ A;  2KIF A;  3V42 A;  2HOT A;  4IL6 C;  5TRD A;  1X3W B;  2CSO A;  1GV5 A;  2Y48 A;  3AG4 H;  3EUK L;  4U0W A;  1IN4 A;  5CJ9 A;  1P7J A;  5GAG J;  1TNT A;  3D5R C;  5D4R A;  3H9Q A;  1H9G A;  2ADU A;  3GFL A;  2L0K A;  1ZKG A;  2HI3 A;  4U0Y A;  1SFU A;  1JKP C;  1QQI A;  2HXO A;  1V5F A;  2YU3 A;  2M2E A;  1P2F A;  3GZ6 A;  4UUV A;  1HXD A;  4IRI A;  2E60 A;  3RZD J;  3F72 A;  3BR5 A;  3MZ8 A;  4JX4 A;  2DO7 A;  5CYV A;  2NAZ A;  5BMZ A;  1ZK8 A;  4YIR X;  3DEE A;  2ELK A;  5EDN A;  2NS7 A;  1YG2 A;  1OCZ H;  3ONQ A;  1TWF J;  1F1Z A;  3SZG A;  2ETH A;  1FOW A;  4ENN A;  1BW5 A;  1QZZ A;  4ZYE A;  2ECC A;  3H0G J;  3ZMS A;  1FOK A;  4EMS A;  5GPC A;  4M3B A;  5DUK A;  1UZC A;  1ENH A;  1S7O A;  2YX4 A;  1BR2 A;  2L9V A;  3GVA A;  3OS1 A;  5E3N A;  5K7F A;  2V9P A;  3Q0V A;  3FXL A;  2K3P A;  2E2I J;  4BDZ A;  4C3H J;  4LLL A;  2D1V A;  4GO1 A;  1BC7 C;  1WQ2 A;  2WV1 A;  5IP7 J;  2BXY A;  2QQB A;  3OYK A;  1FTT A;  1YLF A;  3FMQ A;  3J7Y J;  4FAS D;  1B72 A;  3WTZ A;  4KN4 X;  1D0Y A;  2X6Y A;  3J7Z I;  5AIQ A;  4RAF A;  2JA6 J;  2H6B A;  1G6N A;  4G6T B;  2E35 A;  3GLX A;  1I1G A;  2P4W A;  3QOE A;  2EFO A;  3HOX J;  3DTK A;  4BYY A;  3CCJ I;  2BY2 A;  3OYB A;  4A3K J;  2K4B A;  3IKV A;  2YSR A;  4A6E A;  4DJA A;  4YEL A;  5LBQ A;  2BGC A;  4FTH A;  1JJ6 C;  1WJD A;  3LA7 A;  1OCR H;  2GIZ A;  3J81 K;  4J01 A;  1T98 A;  4IZZ A;  1RRJ A;  1Z05 A;  4Y7N J;  3L7W A;  1LUJ B;  4YII A;  2AQE A;  2HS5 A;  3QYE A;  3WTV C;  4A93 J;  2M30 A;  2XAF A;  2MD5 A;  3OR1 C;  1IUF A;  4BH9 A;  2LH9 A;  1VQ8 I;  3E3V A;  1LVA A;  5DD4 A;  5LRR A;  1MZB A;  3T5X A;  2JA7 J;  2HQN A;  1DQU A;  3A4C A;  2K86 A;  4LK0 F;  3ZQG A;  4UUS B;  2I5U A;  3F6V A;  3TO7 A;  4O3M A;  2X1E A;  4AVP A;  4GDF A;  4GYI A;  5HLI A;  4G6Q A;  1BW6 A;  2IP2 A;  1KYW A;  3F3X A;  3E5Q A;  2W48 A;  4E7K A;  4YFX F;  3I55 I;  3K70 D;  3I4P A;  1SAU A;  4M3G A;  3RKX A;  1MBH A;  3RQI A;  3K10 A;  5IT3 A;  2XAJ A;  4LG3 A;  3QRF F;  4NQW A;  5KK1 A;  3WGH A;  4UVC A;  1U6G A;  1KON A;  2QQ9 A;  1MW7 A;  3WHC A;  2NNY A;  3GTQ J;  1LFP A;  4B3X A;  2Q2E B;  2Q8K A;  4XRS G;  2P5L C;  2DYS H;  5KCM A;  4RGS A;  5EZG A;  1HW5 A;  2PLY A;  2X6X A;  4NBQ A;  2HNH A;  1ETW A;  5IOZ A;  2R5Z B;  3EET A;  2LF8 A;  1O3Q A;  1AA7 A;  2B7E A;  2OA4 A;  2DU9 A;  3VDX A;  4W1U A;  5LRS A;  2RV8 A;  3VOE A;  4LOC A;  3MQ0 A;  3QYB A;  1MMG A;  1B9N A;  2EA2 A;  3DXJ F;  2DOD A;  2JVG A;  4UV8 A;  4C3J J;  4GFB A;  2D5V A;  3HOZ J;  1ZRD A;  3ABM H;  2TDX A;  3GO5 A;  4RLQ A;  1EH7 A;  3LSH A;  5EJC A;  3KLO A;  4CXF A;  4RBO A;  2B63 J;  3Q9S A;  2FX0 A;  1QNT A;  4RAY A;  2RNG A;  3WOD F;  1X4O A;  2FU4 A;  2ZME A;  5D5W B;  2NOJ B;  4OIP F;  3BRO A;  1G4D A;  1YE9 A;  5DM6 F;  1AWC A;  1WWX A;  4Y4R A;  2R4G A;  1T2K A;  5EYR A;  1TTY A;  3OMY A;  2E19 A;  4I98 B;  1L0O C;  4A3E J;  4A5N A;  1WSU A;  3JRD A;  2VN2 A;  2G0E A;  3NAU A;  5M5Y J;  3KEQ A;  4QIW N;  2GZW A;  3BR0 A;  1U5T A;  2ZO4 A;  3CF2 A;  3PNY A;  3ZMT A;  3L2W A;  3QPH A;  3I58 A;  2BXZ A;  2F2E A;  2M34 A;  1S3J A;  2AXL A;  2E1M C;  3NEU A;  1LVK A;  4P96 A;  1BN5 A;  4N4N B;  1P9Q C;  2CFX A;  5ILV A;  4KMU X;  4B3A A;  2WY7 Q;  4HDU A;  2A6H F;  2HQ5 A;  1FC3 A;  2JSC A;  3WHB A;  3WU2 C;  3B02 A;  4EAT A;  3N97 A;  1W1W E;  2FOW A;  1G3T A;  1LNW A;  5HS7 A;  1SFE A;  4D1Q A;  4LIV A;  5BS6 A;  1Z3X A;  2R7T A;  1P4A A;  1TZL A;  3ZGK A;  1HC8 A;  3FXU A;  2HYJ A;  3QU3 A;  2F5D A;  4UVB A;  2EH3 A;  3PFI A;  1UB9 A;  3RKW A;  1YIO A;  2OTJ I;  2DTZ A;  1SD7 A;  3VFZ A;  5LGT A;  4RGR A;  3I54 A;  1VQL I;  1HST A;  1R5G A;  2LRD A;  1VQ4 I;  3B73 A;  1HA8 A;  4KT5 C;  1R4N B;  2HFH A;  2DPD A;  4ZDL A;  2R3S A;  4UNO A;  3PSI A;  1VQ5 I;  1RET A;  3JRF A;  2DMP A;  1R71 A;  1U5T C;  4A0Z A;  2VKV A;  3MKZ A;  4E7I A;  4BGD A;  4CCK A;  4A3C J;  1R1U A;  5J4V A;  2LY1 A;  2V79 A;  1J59 A;  1B9M A;  3ASO H;  2IBD A;  3I59 B;  3R61 A;  3GTJ J;  2VXD A;  1PYV A;  2KIQ A;  2VQL A;  5FKK A;  4MQV A;  3HG9 A;  1ZAR A;  5JLX A;  3FBN B;  2DDA A;  2GIV A;  2GOX B;  1IN8 A;  3ZQC A;  2VAS A;  5CPR B;  3QPL A;  3M1C A;  4YFN F;  3DTE A;  1SAN A;  4MFE A;  1T39 A;  3IKT A;  1BJZ A;  3I53 A;  3NWS A;  4BE0 A;  3S8P A;  1IUY A;  2ICW G;  1K6Y A;  3F8N A;  3RYR A;  3CCS I;  3K4J A;  3LSM A;  4HG2 A;  2V1U A;  5FD6 A;  4ENK A;  3GTG J;  1QA6 A;  3AG3 H;  4N0B A;  3CUQ A;  3OYH A;  2M7B A;  2ZNZ A;  3C2B A;  1ORK A;  2EZK A;  3E1S A;  4PJ0 C;  1R9T J;  2AXT C;  2ZCW A;  5IP6 A;  4YG2 F;  3GX4 X;  5D5U B;  4C2T A;  2UV1 A;  2MD0 A;  2KIM A;  4KN7 X;  1U78 A;  1J75 A;  3IH3 A;  4AIK A;  4DNC A;  1FYL A;  4QSH A;  5EEH A;  4IX7 A;  1R5H A;  2C6Y A;  1RPW A;  2PMZ A;  3BWG A;  1VQM I;  3BJ6 A;  4XLA A;  3WTU C;  3CP2 A;  3N05 A;  4EGY A;  1MJB A;  3KX2 A;  1KA8 A;  3KFW X;  4CCL A;  2BHY A;  3A1Y A;  3J80 K;  3B6C A;  2L01 A;  1A36 A;  3LST A;  4AYB N;  4ZH4 F;  1YW8 A;  1XSV A;  1K83 J;  2EIM H;  3LSJ A;  2IS4 A;  3G3Z A;  3OYA A;  3S3N A;  1DU0 A;  2OCE A;  3K1N A;  1Y8R B;  3JRG A;  3H3U A;  1K7A A;  4HF1 A;  5DCM A;  2E1C A;  3Q3S A;  2FOK A;  3I56 I;  3WGI A;  5F1R A;  5ICE A;  4XN3 A;  4XOT A;  3VYR B;  3OSF A;  4PZJ A;  5JI6 A;  3S3M A;  1TWG J;  3I5U A;  3CJR B;  5E8I A;  4BS9 A;  3CUQ C;  3DFG A;  3DLA A;  2PMZ N;  2ZSH B;  4BY1 J;  1YO5 C;  4S05 A;  2QSG X;  1GUU A;  1E17 A;  1STZ A;  5J4Y A;  3LQR A;  2E2H J;  4M3F A;  4XM3 A;  5AON A;  2JSP A;  3OV8 A;  2GA2 A;  1QRY A;  1GVD A;  4NDL A;  3JCU C;  3F6O A;  1H0M A;  4F3Q A;  1Z67 A;  2DK8 A;  1NHA A;  3ECH A;  1Z77 A;  3GW2 A;  2NVU B;  1E3P A;  3C3W A;  1HKT A;  4B1R A;  5J1U A;  1L3L A;  2KRF A;  1HQC A;  1UAA A;  2DLL A;  1XG1 A;  3FXK A;  3O3K A;  3R4K A;  5IPA A;  4KDP A;  2E7W A;  2CW8 A;  2ID6 A;  1E2X A;  2IA1 A;  2ZKZ A;  3LMM A;  4A0Y A;  3ECO A;  1Z1D A;  2H8W A;  1VF9 A;  4AD9 A;  5EGO B;  4EJW A;  5TIS C;  1W36 D;  1R5I D;  2EK5 A;  3U1D A;  4B43 A;  4G7O F;  2CUE A;  5IYD J;  3V7S A;  2Y0M A;  2HZD A;  3DKW A;  5GAD J;  2JTV A;  3GFJ A;  4LB6 B;  4KNY A;  5K5O A;  3K1M A;  2OTL I;  2IXS A;  4RM2 A;  4DOZ A;  3H1C A;  1XSX A;  2L7Z A;  2V9V A;  2A61 A;  3PNV A;  5HS8 A;  4WK8 F;  3KZY A;  2DPU A;  4HA8 A;  3HEF A;  2PEX A;  2QVO A;  1P7I A;  1POG A;  1IRG A;  1QPM A;  1TT0 A;  1GXP A;  4PJL A;  4QTR A;  5GTH C;  4XL9 A;  2E5Z A;  3JTH A;  2JN6 A;  3LFK A;  3E6D A;  1JXS A;  3K4B A;  3KLN A;  4HRI A;  2M8E A;  3BZ6 A;  3TP3 A;  5J1R A;  4S04 A;  2LR8 A;  2CH0 A;  2Q2E A;  2ZB9 A;  4HX4 A;  1R1T A;  2ZJQ F;  1PUF B;  1MNM C;  3OOU A;  1WJC A;  2PBI A;  2QEN A;  3K69 A;  4IOA F;  4KIG A;  2JRM A;  3FKJ A;  2K85 A;  2XPV A;  3W3C A;  3DBR B;  4V2G A;  4IHS A;  3OYE A;  4W97 A;  2HOA A;  2LG4 A;  3F23 A;  2R5Z A;  1REP C;  2HDW A;  2ZXH A;  2LFB A;  3GCM A;  4XRF A;  1XGM A;  3CO7 C;  5EZH A;  1WZ2 A;  1MGT A;  4OAZ A;  1J0R A;  2V1X A;  2VXZ A;  3HTS B;  3NQO A;  5KAI C;  1A04 A;  3DPL C;  2AS5 F;  2RVC A;  3CF5 F;  3DP7 A;  1Z9C A;  1OYY A;  2OZU A;  1MBK A;  4D7M A;  3T0Y A;  3CDH A;  3L2Q A;  1HF0 A;  3BPX A;  4A69 C;  3L1P A;  2HU9 A;  4G94 A;  2XF5 A;  3PIO F;  1K61 A;  3R60 A;  2GXA A;  4AUX A;  1LEB A;  2HDD A;  1DDN A;  2CRG A;  1YYV A;  4IHT A;  1ZTR A;  2VT3 A;  3BY6 A;  1CF7 B;  1K6O A;  5LFA A;  2H27 A;  1SVL A;  2KZV A;  1X19 A;  4JQF A;  4DGW B;  1K4S A;  3BJO A;  3FXR A;  1LQ1 A;  3RPQ A;  1ZAO A;  2OUM A;  1S7A A;  4M73 A;  3FM3 A;  3I3L A;  4XRM A;  4BXX J;  1M1E B;  1AHD P;  1V4R A;  2BY1 A;  3PIP F;  1YW7 A;  2CUJ A;  3G4S I;  3GLL A;  1ETK A;  1FY7 A;  5LD2 C;  3VSK A;  1MMA A;  4JYK A;  2ZME B;  2M3A A;  2DYR H;  2RDP A;  1JT0 A;  1X1D A;  5GAH J;  2PQ8 A;  2IGN A;  1J5Y A;  2X48 A;  1WH5 A;  1FPQ A;  1T8I A;  2CV0 A;  3A0B C;  2QYO A;  2KLO A;  3BTC A;  3R6S A;  3JSP A;  2HEO A;  5J1Y A;  5IT9 K;  4OIN F;  3JRB A;  4FQG A;  2K9M A;  4QPO A;  3OYD A;  4L0Y B;  3FM5 A;  1KQ8 A;  1VQP I;  2CS3 A;  2VC1 A;  3VYS B;  4KFC A;  1N78 A;  1ETV A;  1XS9 A;  2EFW A;  2KRH A;  2M0M A;  2F4I A;  1YTY A;  2FEZ A;  5A2Q Z;  2Y69 H;  1FSH A;  2Z33 A;  4N9H A;  1UJ8 A;  1XPX A;  1T56 A;  1PP8 F;  1XDU A;  5LHI A;  3P7N A;  2OCC H;  3TDU C;  4FCY A;  2M1B A;  3U1K A;  5GTI C;  1NK3 P;  4EEF G;  5IY5 H;  3GXO A;  4IF4 A;  2DA6 A;  3ABK H;  1ETQ A;  1Z21 A;  4BU2 A;  1W0U A;  1IGN A;  1WVR A;  2QA4 I;  3WG9 A;  3CO6 C;  3CMA I;  4A12 A;  1XCV A;  3BTJ A;  4DW6 A;  5BNG A;  1X3Z B;  5DDG A;  3GTL J;  3E5X A;  5EEA A;  4I01 A;  5CKT A;  4HST A;  3BG5 A;  2X6O A;  1OR7 A;  2M0C A;  4BHB A;  1RC9 A;  1AKH B;  1Y0U A;  4E7J A;  1KU2 A;  2J5P A;  5FRO A;  4A3F J;  3AG1 H;  1QPI A;  2HVR A;  2L9N A;  1R23 A;  2M8G X;  5K7H A;  2XUB A;  2VOD A;  1FLI A;  2NYX A;  1V5E A;  2GXB A;  1X3U A;  3I64 A;  3HGG A;  5E3M A;  3L2U A;  3VYT B;  1VQ7 I;  3DPT A;  4Z2Y A;  1I27 A;  2WAD A;  1CQT A;  3W2V A;  5E20 A;  2COB A;  2OD5 A;  5D4S A;  3KP7 A;  1IN6 A;  3VEP A;  1YOV B;  4GGG A;  3BPV A;  1LE8 B;  1FIP A;  3IHU A;  3UR3 C;  4M3D A;  2PG4 A;  4Z6Y A;  2IAI A;  2XAQ A;  1ZGA A;  3CUQ B;  1P4X A;  4B48 A;  3DKX A;  2KJC A;  3K4N A;  1ZG5 A;  4I0A A;  2QQ8 A;  3LNQ A;  2K4J A;  2O61 A;  3IC7 A;  4XLP F;  2KFD A;  4XON A;  3M8F A;  3EUA A;  4L5E A;  4NC7 A;  3M3Y J;  4LD5 A;  5HOO A;  2XPU A;  2DA7 A;  5DD8 A;  4ESB A;  5TJJ A;  2P5V A;  3ERM A;  5FD5 A;  5J3L A;  1OR7 C;  3LQQ A;  1AOY A;  3PL8 A;  3OYG A;  4Y13 A;  3CQZ J;  1QGP A;  2NVT J;  4HX8 A;  3KET A;  1X2M A;  3ASN H;  3F9K A;  3SQN A;  1MND A;  4DYC A;  1ZRE A;  2MSY A;  3O8H A;  3ZCO A;  1YS6 A;  4A3D J;  2V6C A;  3A0H C;  1JTY A;  1FP2 A;  1KYZ A;  2Q0O A;  2LY2 A;  3TO6 A;  2F5F A;  4PJN A;  3UKG A;  3VYU B;  1EH8 A;  2VL8 A;  2KT0 A;  2R93 J;  2P6S A;  5DCM B;  1A6I A;  1FNN A;  1VQO I;  2DMT A;  4BDY A;  2WB1 A;  4CA0 A;  3PSF A;  2B9S A;  1ZR4 A;  1MMS A;  2V1D A;  4P55 A;  1ZGW A;  4RDU A;  2IJL A;  4O5V A;  1LB2 A;  3GTO J;  2IGM A;  1N75 A;  4HV5 A;  2N8G A;  2P81 A;  1EA3 A;  2QSH X;  2LK2 A;  2ISZ A;  3OSG A;  4GYG A;  4WWC A;  2MGQ A;  4EM0 B;  5EGO A;  4BXF A;  4DZP A;  2Y75 A;  2EZH A;  3WG7 H;  4DQ2 A;  3SFZ A;  1QO0 D;  3PQJ A;  4JBA A;  4OIR F;  4IVN A;  1K78 B;  1AU7 A;  4TV7 A;  3B6A A;  3K1P A;  3GTK J;  2BY0 A;  4MO7 A;  5CVI A;  1ERD A;  1MSF C;  5DUI A;  2X6W A;  4CO8 A;  5HDK A;  3FF5 A;  4CHU A;  5HLH A;  1MSE C;  4B4C A;  2QUF A;  4JOM A;  3IH4 A;  2WB1 N;  5ICG A;  4HNU A;  1ZEL A;  1BBY A;  1MBF A;  3CDL A;  1IDZ A;  2XVC A;  2HPM A;  2RN7 A;  4XIC A;  3BR6 A;  2CW7 A;  4ON0 A;  1YJN I;  2L7F P;  2K9S A;  2K27 A;  2K02 A;  1BC8 C;  1PUF A;  3S2D J;  4IPA A;  2NXN B;  3D0S A;  4BE2 A;  1LKX A;  4DYQ A;  4U7B A;  1HDP A;  3H0D A;  1ETY A;  2HYF A;  1S7E A;  4XK4 A;  2DOA A;  1LJ9 A;  1YW9 A;  5FO5 A;  2GA1 A;  3IWZ A;  2AO9 A;  1Y6I A;  1SVO A;  2HKX A;  1LDK B;  1J09 A;  1MJA A;  1NTC A;  3WTS C;  4BQO A;  5K7Z A;  2ISY A;  5E8G A;  1DU6 A;  2JT1 A;  3A01 B;  5FB2 A;  2JWT A;  2VC0 A;  2XAH A;  5K1Y A;  1NK2 P;  1WJF A;  2P5K A;  3RZO J;  3GUD A;  4XLF A;  2QF7 A;  2EB7 A;  4XMY A;  5DCF A;  3BQZ A;  2Z9O A;  1JUP A;  1SD5 A;  2FUG 2;  3DEU A;  3DBL B;  1OQY A;  4ZYA A;  2CWE A;  2R7V A;  2BZT A;  2XV4 S;  4B47 A;  1W0T A;  1MBE A;  3EDP A;  4U88 A;  1ZLJ A;  2IS1 A;  4OU0 A;  2CUZ A;  5HDG A;  1SEU A;  1BR1 A;  1CF7 A;  1IV8 A;  3GEZ A;  2KDO A;  2Y2Z A;  2A05 A;  2NVQ J;  3CCV I;  1IRF A;  2M4G A;  3ZQH A;  3HOW J;  3SXY A;  2DK5 A;  1XN7 A;  1LFU P;  2KIS A;  3CCY A;  3DEW A;  4PSX A;  1HKS A;  1OLT A;  2W25 A;  4YIF A;  5HNF A;  3OS0 A;  3WGG A;  4A2U A;  5GAE J;  3TQN A;  2QWW A;  5ICF A;  4HBL A;  4E7Z A;  2IS2 A;  5C44 J;  1JGS A;  3DPU A;  1ZR2 A;  2K9N A;  3DTI A;  1FWZ A;  1Z0X A;  4WCG A;  2W00 A;  2X4H A;  3WE3 A;  4OMZ A;  2DXI A;  3IAM 2;  3V8L A;  3KP6 A;  1LDJ A;  1B1B A;  3FZV A;  1HCR A;  1SAX A;  3L00 A;  2XC7 A;  3H92 A;  2OQR A;  1TNS A;  2G7H A;  3KEY A;  2HPI A;  4Y17 A;  5F27 A;  3CCR I;  2HVQ A;  1UFM A;  3K9T A;  4IOC F;  2RAE A;  1UEL B;  2R7U A;  2V7F A;  3CC4 I;  1WPK A;  2RQQ A;  2F5E A;  3C7J A;  3TBI A;  2ESN A;  2F5C A;  2QKL B;  4KA4 A;  2YU9 J;  1DGW Y;  4OIO F;  2DJN A;  2WTE A;  5HNH A;  2VE8 A;  3CCE I;  1G3S A;  1R7J A;  3CES A;  1W36 C;  2QBY B;  2LP0 A;  3WU0 A;  2X0L A;  1TWA J;  3P9I A;  5JVT A;  4KIF A;  2JRT A;  1JE8 A;  2FD5 A;  3KCC A;  1UMQ A;  4LLG F;  1R36 A;  3RKQ A;  1B4A A;  1FBQ A;  4CUG A;  1C0W A;  3I9V 2;  4BEH B;  5FLX K;  3OIP A;  2JA2 A;  2RKH A;  3BT9 A;  1G2H A;  4M9S A;  1W4M A;  5A2Q K;  2V26 A;  1IF1 A;  5E17 F;  5H6Q A;  1TWH J;  1YQA A;  2IGK A;  3H9J A;  2L7K A;  2VOO A;  4A3I J;  1FBU A;  4AIH A;  1GDT A;  2WWY A;  5E1W A;  2CQX A;  1O57 A;  2ZME C;  5C3E J;  3JRI A;  1T33 A;  2WY8 Q;  4YEJ A;  1ZN2 A;  3MWM A;  3KP4 A;  4M71 A;  1BR4 A;  1G8X A;  2JVH A;  4IXA A;  5EG0 B;  2QQA A;  2OJE D;  2UXN A;  3DU6 A;  4UVA A;  2ACJ A;  3ZN0 A;  1V54 H;  2H94 A;  2O03 A;  3BCB A;  1HLV A;  3K4C A;  4Y15 A;  4XBF A;  2EBI A;  2NVX J;  5LGU A;  2NRA C;  3ZPL A;  2STT A;  2HGC A;  4OIQ F;  1KQ9 A;  1AKH A;  2ESH A;  2MFZ A;  3LFU A;  1XCB A;  1MBJ A;  5F0C A;  4PSW A;  2XAG A;  2JA5 J;  3K6G A;  4UY8 I;  3MKW B;  2FNP A;  2NS0 A;  1JKO C;  3CJN A;  4BQA A;  4NHJ A;  1NG7 A;  3OIO A;  1Z3Y A;  3RDI A;  3DF8 A;  4KJZ A;  4F52 A;  1ITY A;  2MC4 A;  2K9Q A;  1KU9 A;  1BI3 A;  4M3E A;  4PGG A;  1ON2 A;  1ETO A;  2GLO A;  2VBY A;  1ZH5 A;  1RES A;  3G1M A;  1VND A;  2R7D A;  2HDC A;  2KRC A;  1LE8 A;  2FF4 A;  1W5C C;  4AYB A;  2OBP A;  2BBY A;  1ZRF A;  3LSR A;  1IXS B;  3GWZ A;  1NG6 A;  4A3G J;  4Y52 J;  3CMY A;  1Z6R A;  2K5C A;  3OYC A;  3JAM Z;  1W5S A;  3LL7 A;  5ED4 A;  1FZP B;  1HBX G;  5JHU A;  3FIW A;  3K2Z A;  5DEQ A;  2ME6 A;  2EFQ A;  2YUS A;  3LSG A;  2BY3 A;  4LGW A;  4ETS A;  3BLY A;  3KP2 A;  4DYR A;  2CQQ A;  4MQ9 F;  4HYE A;  4QPQ A;  5E1Z B;  2G7U A;  2STW A;  5CLS A;  3RKY A;  2XAU A;  4A6D A;  2VQC A;  1D8K A;  3HM5 A;  1U8B A;  5EEG A;  3ZP5 A;  2YX7 A;  4EJT A;  2DMQ A;  1X1P A;  1FYK A;  4I6Z A;  3RYP A;  1IC8 A;  4ENM A;  2E1O A;  3OOP A;  1S29 A;  5FKM A;  4CZC A;  1EJ9 A;  3OS2 A;  4I76 A;  4FT8 A;  2VLA A;  3HKZ N;  1MKM A;  2TRT A;  4HF0 A;  4AIJ A;  1FTZ A;  4IJA A;  1MH3 A;  1QZE A;  1JT6 A;  2O5R A;  4F7Z A;  4P5O A;  2DT7 B;  2ZJP F;  2PMH A;  1ONV A;  3ZQQ A;  2I10 A;  4G9Y A;  2NS8 A;  3F8F A;  2XSD C;  5JR3 A;  1JGG A;  3IV5 A;  1JUS A;  2FMY A;  3SZT A;  4L9J A;  4CH7 A;  5CVJ A;  1UCR A;  3HRM A;  2F4O B;  3TW6 A;  4V2F A;  3I4N J;  1U3E M;  5DS9 A;  3OL4 A;  2EIL H;  3QOP A;  1JI8 A;  3HL2 A;  1G3W A;  2F48 A;  4BHP A;  2D1H A;  3JRE A;  4J19 A;  3KE2 A;  3VB2 A;  2L3D A;  1YIJ I;  4RS8 A;  1LDD A;  1VZ0 A;  3IP4 B;  1K78 A;  3ROU A;  2R0Q C;  2XRL A;  3ZMU A;  2RGV A;  2GXG A;  3GYH X;  1D0X A;  1VQK I;  5JHF A;  1XMX A;  2I8D A;  1S72 I;  1Z7L A;  1D1A A;  1BL0 A;  2FML A;  2F5V A;  2VKH A;  5H2F C;  2ZJ2 A;  1VFC A;  1YJW I;  1HSJ A;  3TDZ C;  3BG3 A;  5FLV A;  3SFI A;  1Y56 A;  4GRI A;  4OOI A;  3KIO A;  2FNA A;  2MH2 A;  1TQI A;  1USS A;  3CCQ I;  3HB9 A;  1XMA A;  4PUS A;  4NNJ A;  5L3D A;  4RAG A;  2BE5 F;  2WC2 A;  4NB5 A;  1JUM A;  1ZRC A;  1UHM A;  1SFO J;  5LHH A;  4XKB A;  5ERI A;  1X4P A;  4FHT A;  3SDB A;  2M7A A;  3WTY C;  3AFH A;  2VQG A;  2Y30 A;  3FBI B;  1GHC A;  2VI6 A;  2ID3 A;  3A01 A;  1P4W A;  2FBH A;  2Z16 A;  3C2H A;  1KGS A;  5ILS A;  4PGH A;  3AL0 B;  2MLK A;  2VPR A;  3K0L A;  3BTI A;  1OYW A;  2CUF A;  2HTJ A;  4LIT A;  4AID A;  1ODD A;  3W2W A;  3A02 A;  3PO2 J;  1SVM A;  1P6R A;  4BBS J;  3M7G A;  2DOE A;  3J81 Z;  4C2M J;  2JK3 A;  1TQP A;  3CLQ A;  4JX6 A;  2FBK A;  4NUB A;  2BYV E;  2XRN A;  3FKI J;  1S8N A;  2PMU A;  4FE7 A;  3FMR A;  4UB6 C;  2IA2 A;  1RIO H;  4CGZ A;  3QU6 A;  4LFU A;  4LK1 F;  2AQF A;  2VKE A;  1R4M B;  2L02 A;  4UB8 C;  4PDK A;  3OWT A;  4ESJ A;  1X1B A;  2EIJ H;  2HXI A;  3ZN1 A;  3P5J A;  1PVE A;  2PJP A;  2L9S A;  3RPU A;  1FT9 A;  2ZFU A;  4RLF A;  3BC8 A;  4FX0 A;  3BZK A;  2KIU A;  2LBF B;  1WJA A;  4EVI A;  3LA2 A;  5CQG A;  3VSL A;  1S9H A;  4MHG A;  2UZK A;  4IHV A;  1UHW A;  4X1E A;  2R92 J;  4BUP A;  1I3Q J;  1D8J A;  4B09 A;  1KQ0 A;  1YI2 I;  1KZH A;  4NC6 A;  2H1L A;  1XGS A;  2LLK A;  2GAU A;  1EV7 A;  2VKD A;  3FHZ A;  3S1Q J;  3BCA A;  2NNN A;  5D5V B;  1F5T A;  2JZY A;  5HVQ C;  1J9I A;  5K5R A;  3KZI C;  4D5F A;  4FIS A;  4MLO A;  2PN6 A;  5E79 C;  4CZZ A;  1BJA A;  5B3S H;  4HLX A;  4NC8 A;  4Q47 A;  1BI2 A;  9ANT A;  2FBI A;  1ZGJ A;  3H36 A;  4G12 A;  3U9G A;  3SJM A;  4M74 A;  2ELJ A;  2VJ4 A;  4KIT B;  5DM7 F;  4XLH A;  2WV0 A;  2WAQ N;  3F8C A;  2LF7 A;  4M9Z A;  1BOB A;  2BVL A;  4XQF A;  2QBY A;  1FEX A;  5D8K B;  3F8B A;  2L5Q A;  1I39 A;  1GT0 C;  2G9W A;  3V8J A;  2LC2 A;  1OPC A;  5F0H A;  3SDG A;  1GV2 A;  1P92 A;  4LG0 B;  1WJ5 A;  4BEH A;  3OIQ A;  2R7S A;  1XC5 A;  2CJJ A;  4DBR A;  1OCC H;  5K5Q A;  2M5W A;  1XD7 A;  2FSW A;  2FQ3 A;  3OR2 C;  3LSI A;  5DV5 A;  3ZXS A;  1SMY F;  4ANJ A;  4IO9 F;  4RB3 C;  5HOD A;  1W7P A;  3X2Q H;  1Y1V J;  3GFM A;  1X58 A;  5HLT A;  1TQM A;  5B1B H;  3ZMD A;  2MA3 A;  5FKO A;  3H9G A;  1MNE A;  4CCN A;  2DMU A;  1I6X A;  4F92 B;  1ZLK A;  3HPG A;  3HDD A;  2DQL A;  4BQQ A;  1DPU A;  1VQN I;  4XSZ F;  2EV5 A;  4BXU A;  4M6X A;  5EG0 A;  1Y1W J;  2DFE A;  3V8K A;  2OAZ A;  5F08 A;  4K2E A;  1K4T A;  2NOG A;  4D9J A;  3HC7 A;  3K2A A;  3RCO A;  4ZTF A;  3DLL F;  2EZL A;  2OZ6 A;  2HOS A;  2IRF G;  3FIS A;  3G71 I;  4XSX F;  4CSW A;  4MTD A;  4ZZL A;  1TP4 A;  3HPH A;  1FYM A;  3FMS A;  5KNL A;  1SFX A;  5FKN A;  2R7Q A;  3EUH A;  3ABL H;  1RUN A;  2ME0 A;  3NRV A;  4HEA 2;  4BE1 A;  4LB5 A;  2ECB A;  4DBQ A;  3HUG A;  4LIU A;  3E6M A;  2DFF A;  3FK6 A;  5J8C A;  1TL8 A;  5L3G A;  1OJL A;  1WKM A;  3H5N A;  1XGN A;  4IHY A;  1JKR C;  2OQG A;  2OU2 A;  2VON A;  4HLY A;  5L3B A;  5LLQ A;  2MW8 A;  1BI1 A;  2JUG A;  3SEZ A;  4A3B J;  4XKW A;  1R1V A;  1MD0 A;  3GZ5 A;  4E7H A;  2CQ7 A;  3L9F A;  3MMY B;  2MC3 A;  3S3O A;  2PJR A;  2QLZ A;  1O7L A;  2DBB A;  4EM1 A;  2JPC A;  3I71 A;  1A31 A;  2ZNY A;  4ESF A;  1TW3 A;  3VWB A;  5ICC A;  5M3M J;  5B5E C;  2Y31 A;  2OC6 A;  1U2W A;  4RGX A;  1Z6T A;  4CYC A;  3HRT A;  2XB5 A;  1ZQ3 P;  1KU3 A;  2DDB A;  5TGT A;  1GXQ A;  2EV0 A;  2X1D A;  3GZN B;  1HDD C;  2KHM A;  1IN7 A;  1WCM J;  5FLM J;  2LNB A;  3EUH C;  3O2P E;  2VT2 A;  3RIR A;  3LAP A;  3L2C A;  2J5O A;  3S1N J;  3TMO A;  1FBS A;  5E3L A;  2HKO A;  2XB0 X;  3GBG A;  3CDI A;  1HOM A;  4X6A J;  2DFH A;  4CCO A;  3OYL A;  2QCO A;  4KIC A;  3JSO A;  2EA4 A;  3RSN A;  1TBX A;  1UG2 A;  2E71 A;  2ZXI A;  2L2O A;  2W82 A;  5FFZ A;  4KUM A;  1YFH A;  2WA0 A;  1R6R A;  3HIF A;  5CQE A;  1KU7 A;  3T8T A;  1BA5 A;  4KIB A;  4KMF A;  3PUF A;  4XID A;  1UG0 A;  3J7A O;  3W6J B;  3M9A A;  2OF7 A;  1VQ6 I;  4MEY F;  3O6B B;  1Y0N A;  5KAF C;  4P1W A;  1J7K A;  1Q1H A;  3W6V A;  2DAO A;  1I6H J;  3FXO A;  3LA3 A;  4RB0 A;  5AIP A;  3HOS A;  4N9I A;  1FOY A;  3M8J A;  3HBL A;  4PJM A;  1WHU A;  4PJJ A;  1HKQ A;  5CVV A;  3RI4 A;  1MIJ A;  2XGX A;  3CME I;  1IXC A;  2R5Y B;  3WE2 A;  3CCL I;  1WRJ A;  4G6D A;  2XDV A;  3G6E I;  4LMY A;  3L2V A;  2LSO A;  3CD6 I;  3IUO A;  4CYD A;  3ZMZ A;  3DV8 A;  2HQR A;  3ABU A;  2JQ7 A;  4IRH A;  1X1C A;  3J80 Z;  2P7V B;  4BQN A;  2E2J J;  5CVU A;  3CZ6 A;  2VJ5 A;  2EFP A;  1QVT A;  4CCM A;  3KYC B;  5GP9 A;  3HTU A;  4YFK F;  4UUT A;  2GWR A;  4MIM A;  5LEK A;  2P6T A;  1TT5 B;  3FXM A;  1IDY A;  3JRA A;  2BW3 A;  2DA5 A;  3BZC A;  1SMT A;  2DA2 A;  1X2N A;  2ZBK A;  5F6F A;  4XNF A;  2MYS A;  3T1B A;  3GTM J;  2BVM A;  3FXJ A;  4D7N A;  2YPR A;  3PM1 A;  4XRS A;  2HTS A;  2W24 A;  1I1S A;  3Q0W A;  3CJQ B;  1PUE E;  2FJ1 A;  4Q4Z F;  5FFX A;  4Q48 A;  4ENJ A;  4RGU A;  3FDY A;  3MZH A;  1F43 A;  1Q1V A;  3S1R J;  1IAW A;  4ITV A;  3RPU D;  1K79 A;  4Q5S F;  1QZY A;  2A6T A;  4L0Z B;  1FJL A;  5M5W J;  3MKL A;  5DYM A;  2A07 F;  1O7F A;  2W85 A;  4I02 A;  4I7H A;  2MBF A;  3ZMV A;  4AU7 A;  2HVS A;  1G59 A;  2LTP A;  2A3S A;  4RAZ A;  1R58 A;  3Q9V A;  2CV1 A;  2X9D A;  2A68 F;  1QU3 A;  2KL4 A;  4XOP A;  5B1A H;  1T0F A;  1BIA A;  3CLO A;  3WTX C;  1ZYR F;  1DGR M;  2LVS A;  1LPQ A;  3COA C;  4D0P A;  1IW7 F;  1Y8Q B;  2QZ8 A;  2DOF A;  4EJV A;  1OKR A;  3OYN A;  3JR9 A;  2Z1D A;  1N25 A;  2VBW A;  5M5X J;  3BDD A;  4F91 B;  4EJU A;  2CV2 A;  2A6E F;  4QLC U;  3E97 A;  3S17 J;  3H3Z A;  4CCJ A;  2L54 A;  2O9L A;  3ABT A;  4UHT A;  2LBF A;  4FX4 A;  2DA4 A;  3M07 A;  4RB2 C;  2K7L A;  3U21 A;  2R7R A;  1OCT C;  2CO5 A;  4MEX F;  3H5R A;  4BBR J;  3AL0 C;  1IN5 A;  3D5L A;  1IJW C;  1W7P D;  3G1O A;  2E7X A;  2OPT A;  2W57 A;  2Y0S A;  3OY9 A;  1OFC X;  3I0T A;  3S1M J;  5IYB J;  4E6K G;  1Y39 A;  4WXH A;  4A3M J;  3DQV C;  4RMN A;  4EQQ A;  1ULY A;  2CU7 A;  3A03 A;  1T0F C;  3EYY A;  3KYL A;  3CC7 I;  4WXC A;  3CC2 I;  3SHF A;  4AVZ A;  2OV7 A;  3ZR8 X;  3OYF A;  1S5L C;  2BV6 A;  4O6J A;  3G73 A;  5C4J J;  4HAM A;  5FJ8 J;  5J8F A;  2A69 F;  1V5G A;  3REO A;  1FOX A;  4ZTJ A;  4AM3 A;  3S2H J;  3PFY A;  3TKY A;  3L2R A;  2CMP A;  3MKY B;  2UWM A;  2VUM J;  4KT6 A;  1J2X A;  2A5W A;  2E5N A;  3HJE A;  3P9K A;  4LG0 A;  1FMV A;  2HR3 A;  1YS7 A;  4IEJ A;  2RC4 A;  3TOB A;  2AHQ A;  1TLH B;  3CMM A;  3A2K A;  4R8H A;  2LMD A;  2PI0 A;  1TC3 C; 
#chains in the Genus database with same CATH homology
 3QP5 A;  3EQL F;  3GFI A;  4A5M A;  1TW2 A;  4XLN F;  2H6C A;  4BAY A;  4P9F A;  3JW4 A;  4L5I A;  1SD6 A;  3FX3 A;  3MAJ A;  1DP7 P;  2IT0 A;  2FXA A;  3ISP A;  1W7P B;  2HWV A;  1ON1 A;  1SD4 A;  3SZP A;  1Z7U A;  1W5T A;  2MLG A;  2IVM A;  5BQT A;  1V3F A;  5L3E A;  2FE3 A;  2Z3Y A;  1Z91 A;  3V7C A;  3KP3 A;  2HOE A;  3GF2 A;  3R0A A;  2L4M A;  1MDM B;  4ZYG A;  5IT9 Z;  2XIG A;  1PDN C;  2DW4 A;  4G7H F;  2LKP A;  2CQK A;  1T6S A;  2JPB A;  5HS9 A;  1BM9 A;  5CVR A;  2O8X A;  5BPI A;  5E1X A;  4L9V A;  2CG4 A;  3C18 A;  1IZ1 A;  2M87 A;  1LEA A;  3HRS A;  3TGN A;  4HW0 A;  1R22 A;  4HZF A;  4R79 A;  3KEO A;  2IA0 A;  3WU1 B;  3IRR A;  4EV0 A;  5D6E A;  1XB4 A;  2DQR A;  1MJ9 A;  2B0L A;  1RZ4 A;  1XMK A;  4WX9 A;  3L09 A;  2DFI A;  3QPT A;  3TOA A;  3F8M A;  2YR2 A;  3T8R A;  1CGP A;  4B8X A;  1PP7 U;  4G8X A;  4JK1 X;  2DI3 A;  1OMI A;  3TO9 A;  3ELK A;  5L3C A;  4L18 B;  3RJP A;  4OMY A;  4UXN A;  4HOB A;  1FX7 A;  1WI9 A;  2VOP A;  4GXO A;  5LEJ A;  4M9X A;  1UST A;  5HDN A;  2H09 A;  1FP1 D;  2FA5 A;  3JTG A;  2ZFW A;  4U7D A;  4EJO A;  3IRQ A;  1IXR C;  3CUO A;  4L5J A;  3HOT A;  1F9N A;  2GQQ A;  2VE9 A;  3M1E A;  4GCV A;  3FXQ A;  3HHG A;  5BOX A;  1S6L A;  3E6C C;  4HQM A;  2EJR A;  1DPR A;  1XSD A;  4LJZ F;  2M45 A;  5KVR A;  5L3F A;  3P9C A;  2VBZ A;  3HSR A;  2EV6 A;  2KKO A;  2QM3 A;  4ZZD A;  4I09 A;  4LLN A;  1H9T A;  1BOA A;  2EFN A;  3HHH A;  4EGZ A;  4CDG A;  4U0V A;  4QWQ A;  1GVJ A;  4ZYH A;  2RQP A;  1G3Y A;  3M8E A;  3ML6 A;  2Z5U A;  2O6G E;  3LAJ A;  3BJA A;  1B6A A;  4AWX B;  4BHC A;  2ELH A;  2ZXJ A;  6PAX A;  2PFB A;  3CTA A;  5HLG A;  4HF2 A;  4G7Z F;  2XRO A;  4E70 A;  1JHF A;  3N4M A;  3ERE D;  1XGO A;  3E6B A;  3WTW C;  4I2O A;  2IW5 A;  1D3Y A;  3S2W A;  1D5V A;  5BPD A;  4M72 A;  2P8T A;  3QP6 A;  4HQE A;  4HV6 A;  1O3S A;  2A5Y B;  1RUO A;  4WXD A;  3W6K B;  2O0Y A;  2CYY A;  4HX7 A;  2VBX A;  3IWF A;  4A0X A;  2L4A A;  3MEX A;  4CIC A;  3MCZ A;  4L9N A;  2XKP A;  5D8L B;  1FSE A;  2HZT A;  1XDS A;  1EH6 A;  4BNC A;  1I5Z A;  2UXX A;  4MNU A;  4ZYD A;  1QBJ A;  3HYI A;  3ULQ B;  4H0E A;  2FRH A;  3F21 A;  5H6R A;  4UV9 A;  3HSF A;  1O3R A;  3FWE A;  4RB1 A;  3AAF A;  5D6F A;  4R1H A;  1HW1 A;  3WTT C;  3MFK A;  2W84 A;  2XAS A;  1F4K A;  2XKO A;  3IL2 A;  1ZHF A;  5J6X A;  3VOD A;  3HRU A;  5E18 F;  1MDM A;  1ZG3 A;  4EM2 A;  2D2W A;  2MH9 A;  4I0B A;  5H20 A;  1JHH A;  1U5T B;  3KP5 A;  5LGN A;  4M6Y A;  1R00 A;  5ILU A;  2O3F A;  1ZG1 A;  2HYG D;  2XHK A;  4IRG A;  5FGM A;  5FLX Z;  3U2R A;  5LHG A;  2DT5 A;  3QAH A;  2IPQ X;  1B59 A;  1RI7 A;  3I59 A;  1OYI A;  3MZY A;  4MTE A;  3RTR A;  3KZZ A;  2Z99 A;  3F22 A;  2KJB A;  2CGP A;  3JAM K;  2RNJ A;  1RNL A;  2DTR A;  4ASN A;  2R7F A;  3V4G A;  1VTN C;  1HW2 A;  3HSE A;  3BP8 A;  2D45 A;  3PQK A;  2BEO A;  4KYW A;  2COM A;  3R0J A;  3BOQ A;  3V7R A;  4HDV A;  2LDU A;  3EYI A;  3LWF A;  1O3T A;  1BI0 A;  5F64 A;  3ZQ7 A;  5JFR A;  1DUX C;  1U8R A;  4L9T A;  2E1N A;  4P9U A;  3C1D A;  1T38 A;  2P7C B;  2CW0 F;  3E5U A;  3Q5F A;  5D5X B;  4MGR A;  1BIB A;  2EWN A;  4WF2 A;  4PCQ A;  2KIF A;  5TRD A;  2CSO A;  2Y48 A;  4U0W A;  5CJ9 A;  1IN4 A;  1TNT A;  5D4R A;  1H9G A;  2ADU A;  3GFL A;  4U0Y A;  1SFU A;  1QQI A;  2YU3 A;  1P2F A;  3GZ6 A;  4UUV A;  1HXD A;  4IRI A;  3F72 A;  2DO7 A;  5CYV A;  2NAZ A;  5BMZ A;  1YG2 A;  1F1Z A;  2ETH A;  4ENN A;  1QZZ A;  4ZYE A;  3ZMS A;  1FOK A;  4EMS A;  5DUK A;  1S7O A;  2YX4 A;  3GVA A;  4LLL A;  2D1V A;  4GO1 A;  1BC7 C;  1WQ2 A;  2QQB A;  1YLF A;  3FMQ A;  3WTZ A;  4KN4 X;  5AIQ A;  2H6B A;  1G6N A;  3GLX A;  1I1G A;  2P4W A;  2EFO A;  4BYY A;  2K4B A;  3IKV A;  2YSR A;  4A6E A;  5LBQ A;  2BGC A;  3LA7 A;  3J81 K;  1T98 A;  1Z05 A;  3L7W A;  4YII A;  2HS5 A;  3WTV C;  2M30 A;  2XAF A;  2MD5 A;  4BH9 A;  3E3V A;  1LVA A;  5DD4 A;  5LRR A;  1MZB A;  3T5X A;  2HQN A;  2K86 A;  4LK0 F;  3F6V A;  3TO7 A;  4O3M A;  4AVP A;  4GYI A;  5HLI A;  4G6Q A;  2IP2 A;  1KYW A;  3F3X A;  3E5Q A;  4YFX F;  3I4P A;  3RKX A;  5IT3 A;  2XAJ A;  3QRF F;  4NQW A;  5KK1 A;  3WGH A;  4UVC A;  1U6G A;  2QQ9 A;  2NNY A;  2Q8K A;  2P5L C;  4RGS A;  1HW5 A;  2PLY A;  3EET A;  2LF8 A;  1O3Q A;  2OA4 A;  2DU9 A;  5LRS A;  2RV8 A;  3VOE A;  3MQ0 A;  1B9N A;  2EA2 A;  3DXJ F;  4UV8 A;  1ZRD A;  2TDX A;  3GO5 A;  1EH7 A;  3KLO A;  4CXF A;  3Q9S A;  1QNT A;  4RAY A;  3WOD F;  2FU4 A;  2ZME A;  5D5W B;  4OIP F;  3BRO A;  1G4D A;  1AWC A;  1WWX A;  1T2K A;  1TTY A;  4I98 B;  1L0O C;  4A5N A;  1WSU A;  2VN2 A;  3KEQ A;  2GZW A;  1U5T A;  2ZO4 A;  3ZMT A;  3QPH A;  3I58 A;  2F2E A;  1S3J A;  3NEU A;  2AXL A;  4P96 A;  1BN5 A;  2CFX A;  5ILV A;  4KMU X;  4HDU A;  2A6H F;  1FC3 A;  2JSC A;  3N97 A;  3B02 A;  1G3T A;  1LNW A;  5HS7 A;  1SFE A;  5BS6 A;  1P4A A;  3FXU A;  3QU3 A;  2F5D A;  4UVB A;  3PFI A;  1UB9 A;  3RKW A;  1YIO A;  1SD7 A;  3VFZ A;  5LGT A;  4RGR A;  3I54 A;  1HST A;  1R5G A;  3B73 A;  4KT5 C;  2HFH A;  2DPD A;  2R3S A;  4UNO A;  1U5T C;  4A0Z A;  1R1U A;  2V79 A;  1J59 A;  1B9M A;  3I59 B;  3R61 A;  4MQV A;  1ZAR A;  2GIV A;  1IN8 A;  4YFN F;  1T39 A;  3IKT A;  3I53 A;  1IUY A;  3F8N A;  3RYR A;  2V1U A;  5FD6 A;  4ENK A;  4N0B A;  3CUQ A;  2ZNZ A;  2ZCW A;  4YG2 F;  3GX4 X;  5D5U B;  2KIM A;  4KN7 X;  1U78 A;  1J75 A;  4AIK A;  4DNC A;  1FYL A;  2C6Y A;  5EEH A;  1R5H A;  3BWG A;  3BJ6 A;  3WTU C;  4EGY A;  1MJB A;  1KA8 A;  3KFW X;  3J80 K;  2L01 A;  3LST A;  4ZH4 F;  1YW8 A;  1XSV A;  3G3Z A;  3K1N A;  3H3U A;  1K7A A;  4HF1 A;  5DCM A;  2E1C A;  2FOK A;  3WGI A;  5F1R A;  5ICE A;  4PZJ A;  5JI6 A;  3I5U A;  5E8I A;  3CUQ C;  3DFG A;  1YO5 C;  4S05 A;  1E17 A;  1STZ A;  3LQR A;  5AON A;  3OV8 A;  2GA2 A;  3F6O A;  1H0M A;  2DK8 A;  1NHA A;  3ECH A;  3GW2 A;  3C3W A;  1HKT A;  1L3L A;  2KRF A;  1HQC A;  2DLL A;  3O3K A;  3R4K A;  4KDP A;  2E7W A;  1E2X A;  2IA1 A;  2ZKZ A;  4A0Y A;  3ECO A;  1Z1D A;  4AD9 A;  4EJW A;  2EK5 A;  3U1D A;  4G7O F;  3V7S A;  2Y0M A;  3DKW A;  2JTV A;  3GFJ A;  4LB6 B;  4KNY A;  5K5O A;  3K1M A;  1XSX A;  2V9V A;  2A61 A;  5HS8 A;  4WK8 F;  3KZY A;  2DPU A;  4HA8 A;  2PEX A;  2QVO A;  1IRG A;  1QPM A;  1GXP A;  3JTH A;  3LFK A;  3E6D A;  1JXS A;  3KLN A;  2M8E A;  3BZ6 A;  4S04 A;  2Q2E A;  4HX4 A;  1R1T A;  2PBI A;  2QEN A;  3K69 A;  4KIG A;  4IHS A;  3F23 A;  1REP C;  4XRF A;  3CO7 C;  1XGM A;  1MGT A;  1J0R A;  2V1X A;  2VXZ A;  3HTS B;  3NQO A;  1A04 A;  3DPL C;  2AS5 F;  2RVC A;  1Z9C A;  3DP7 A;  1OYY A;  2OZU A;  3T0Y A;  3CDH A;  3BPX A;  4G94 A;  3R60 A;  1LEB A;  1DDN A;  1YYV A;  4IHT A;  2VT3 A;  3BY6 A;  1CF7 B;  1K6O A;  2H27 A;  4JQF A;  3BJO A;  3FXR A;  1LQ1 A;  3RPQ A;  1ZAO A;  1S7A A;  4M73 A;  3FM3 A;  1V4R A;  1YW7 A;  1FY7 A;  2ZME B;  2RDP A;  2PQ8 A;  1J5Y A;  1FPQ A;  2QYO A;  3R6S A;  3JSP A;  2HEO A;  5IT9 K;  4OIN F;  4L0Y B;  3FM5 A;  1KQ8 A;  2VC1 A;  4KFC A;  2EFW A;  1YTY A;  2FEZ A;  5A2Q Z;  1FSH A;  2Z33 A;  4N9H A;  1PP8 F;  1XDU A;  5LHI A;  3P7N A;  3TDU C;  2M1B A;  3GXO A;  4IF4 A;  3WG9 A;  3CO6 C;  4A12 A;  1XCV A;  5DDG A;  3E5X A;  4I01 A;  1OR7 A;  4BHB A;  1Y0U A;  1KU2 A;  2J5P A;  1R23 A;  2XUB A;  2VOD A;  1FLI A;  2NYX A;  2GXB A;  1X3U A;  3I64 A;  3DPT A;  4Z2Y A;  1I27 A;  5E20 A;  2OD5 A;  5D4S A;  3KP7 A;  1IN6 A;  3VEP A;  4GGG A;  3BPV A;  3IHU A;  2PG4 A;  2XAQ A;  1ZGA A;  3CUQ B;  1P4X A;  2KJC A;  1ZG5 A;  4I0A A;  2K4J A;  2O61 A;  3IC7 A;  4XLP F;  3M8F A;  4LD5 A;  5HOO A;  5DD8 A;  4ESB A;  5TJJ A;  2P5V A;  5FD5 A;  3LQQ A;  1AOY A;  4Y13 A;  1QGP A;  4HX8 A;  3KET A;  3SQN A;  1ZRE A;  1YS6 A;  2V6C A;  1FP2 A;  1KYZ A;  2Q0O A;  3TO6 A;  2F5F A;  1EH8 A;  2P6S A;  5DCM B;  1FNN A;  2V1D A;  4P55 A;  2IJL A;  4O5V A;  1LB2 A;  4HV5 A;  2ISZ A;  4GYG A;  4WWC A;  4EM0 B;  2Y75 A;  4DQ2 A;  3SFZ A;  1QO0 D;  3PQJ A;  4JBA A;  4OIR F;  4IVN A;  1K78 B;  4TV7 A;  3K1P A;  5CVI A;  5DUI A;  4CO8 A;  5HDK A;  3FF5 A;  4CHU A;  5HLH A;  2QUF A;  5ICG A;  1BBY A;  2XVC A;  2RN7 A;  4ON0 A;  2K27 A;  2K02 A;  1BC8 C;  4IPA A;  3D0S A;  4U7B A;  2HYF A;  1LJ9 A;  1YW9 A;  5FO5 A;  2GA1 A;  3IWZ A;  2HKX A;  1LDK B;  1MJA A;  3WTS C;  2ISY A;  5E8G A;  2JT1 A;  5FB2 A;  5K1Y A;  2VC0 A;  2XAH A;  2P5K A;  3GUD A;  2EB7 A;  5DCF A;  2Z9O A;  1SD5 A;  3DEU A;  2CWE A;  2XV4 S;  3EDP A;  4U88 A;  1ZLJ A;  4OU0 A;  5HDG A;  1CF7 A;  3GEZ A;  1IRF A;  3SXY A;  2DK5 A;  1XN7 A;  1HKS A;  2W25 A;  4YIF A;  3WGG A;  4A2U A;  3TQN A;  2QWW A;  5ICF A;  4HBL A;  1JGS A;  1FWZ A;  4WCG A;  2X4H A;  3WE3 A;  4OMZ A;  3V8L A;  3KP6 A;  1LDJ A;  1B1B A;  3FZV A;  1SAX A;  3L00 A;  3H92 A;  2OQR A;  1TNS A;  2G7H A;  4Y17 A;  1UFM A;  3K9T A;  2F5E A;  3C7J A;  2ESN A;  2F5C A;  4KA4 A;  4OIO F;  2WTE A;  2VE8 A;  1G3S A;  1R7J A;  2QBY B;  3WU0 A;  2X0L A;  3P9I A;  5JVT A;  4KIF A;  2JRT A;  1JE8 A;  3KCC A;  4LLG F;  1R36 A;  1B4A A;  1FBQ A;  1C0W A;  5FLX K;  2RKH A;  4M9S A;  1W4M A;  5A2Q K;  1IF1 A;  5E17 F;  5H6Q A;  1YQA A;  2VOO A;  1FBU A;  4AIH A;  2WWY A;  5E1W A;  1O57 A;  1ZN2 A;  3MWM A;  3KP4 A;  4M71 A;  4IXA A;  2QQA A;  2UXN A;  4UVA A;  2ACJ A;  3ZN0 A;  2H94 A;  2O03 A;  4Y15 A;  4XBF A;  5LGU A;  2NRA C;  3ZPL A;  2STT A;  2HGC A;  4OIQ F;  1KQ9 A;  2ESH A;  1XCB A;  2XAG A;  2FNP A;  2NS0 A;  3CJN A;  4BQA A;  4NHJ A;  3RDI A;  3DF8 A;  1KU9 A;  1BI3 A;  4PGG A;  1ON2 A;  2VBY A;  1ZH5 A;  2R7D A;  2HDC A;  2FF4 A;  2OBP A;  2BBY A;  1ZRF A;  1IXS B;  3GWZ A;  1Z6R A;  3JAM Z;  1W5S A;  5ED4 A;  1FZP B;  1HBX G;  5JHU A;  3K2Z A;  5DEQ A;  2EFQ A;  4LGW A;  4ETS A;  3KP2 A;  4MQ9 F;  4HYE A;  5E1Z B;  2G7U A;  2STW A;  5CLS A;  3RKY A;  4A6D A;  1D8K A;  5EEG A;  3ZP5 A;  2YX7 A;  4EJT A;  1FYK A;  3RYP A;  4ENM A;  3OOP A;  1S29 A;  4FT8 A;  1MKM A;  4HF0 A;  4AIJ A;  4IJA A;  4F7Z A;  4P5O A;  2PMH A;  1ONV A;  4G9Y A;  3F8F A;  5JR3 A;  2FMY A;  3SZT A;  4L9J A;  5CVJ A;  1UCR A;  3HRM A;  1U3E M;  3QOP A;  1G3W A;  4BHP A;  2D1H A;  3KE2 A;  3VB2 A;  2L3D A;  4RS8 A;  1LDD A;  1K78 A;  3ROU A;  3ZMU A;  2RGV A;  2GXG A;  3GYH X;  2FML A;  2ZJ2 A;  1HSJ A;  3TDZ C;  4OOI A;  2FNA A;  2MH2 A;  1TQI A;  1USS A;  1XMA A;  5L3D A;  2BE5 F;  2WC2 A;  4NB5 A;  1ZRC A;  1UHM A;  5LHH A;  5ERI A;  4FHT A;  3WTY C;  1GHC A;  1P4W A;  2FBH A;  1KGS A;  5ILS A;  4PGH A;  2MLK A;  3K0L A;  1OYW A;  2HTJ A;  1ODD A;  1P6R A;  3M7G A;  3J81 Z;  1TQP A;  2FBK A;  2BYV E;  2XRN A;  1S8N A;  2PMU A;  3FMR A;  4CGZ A;  2IA2 A;  1RIO H;  3QU6 A;  4LFU A;  4LK1 F;  2L02 A;  4PDK A;  4ESJ A;  3ZN1 A;  2PJP A;  3RPU A;  1FT9 A;  4FX0 A;  2KIU A;  4EVI A;  3LA2 A;  4MHG A;  2UZK A;  1UHW A;  1D8J A;  4B09 A;  1KQ0 A;  1XGS A;  2GAU A;  1EV7 A;  3FHZ A;  5D5V B;  2NNN A;  1F5T A;  1J9I A;  2JZY A;  5HVQ C;  5K5R A;  2PN6 A;  4CZZ A;  1BJA A;  4HLX A;  4Q47 A;  1BI2 A;  2FBI A;  1ZGJ A;  3U9G A;  4M74 A;  2WV0 A;  3F8C A;  2LF7 A;  4M9Z A;  2QBY A;  5D8K B;  3F8B A;  2G9W A;  3V8J A;  1OPC A;  1P92 A;  4LG0 B;  5K5Q A;  2M5W A;  1XD7 A;  2FSW A;  2FQ3 A;  5DV5 A;  1SMY F;  4RB3 C;  1W7P A;  3GFM A;  1TQM A;  3ZMD A;  2MA3 A;  1I6X A;  1ZLK A;  2DQL A;  1DPU A;  4XSZ F;  2EV5 A;  4BXU A;  4M6X A;  3V8K A;  2OAZ A;  4K2E A;  2IRF G;  2OZ6 A;  4XSX F;  4MTD A;  4ZZL A;  1FYM A;  3FMS A;  1SFX A;  3EUH A;  1RUN A;  3NRV A;  4LB5 A;  3HUG A;  3E6M A;  5J8C A;  5L3G A;  1WKM A;  1XGN A;  2OQG A;  2OU2 A;  2VON A;  4HLY A;  5L3B A;  5LLQ A;  1BI1 A;  1R1V A;  1MD0 A;  3GZ5 A;  3L9F A;  2MC3 A;  2QLZ A;  1O7L A;  2DBB A;  4EM1 A;  2JPC A;  3I71 A;  2ZNY A;  4ESF A;  1TW3 A;  5ICC A;  1U2W A;  4RGX A;  1Z6T A;  3HRT A;  1KU3 A;  1GXQ A;  2EV0 A;  1IN7 A;  2LNB A;  3O2P E;  2VT2 A;  3RIR A;  3LAP A;  3L2C A;  2J5O A;  1FBS A;  2HKO A;  4KIC A;  3JSO A;  2EA4 A;  1TBX A;  5FFZ A;  4KUM A;  1YFH A;  3HIF A;  1KU7 A;  3T8T A;  4KIB A;  4KMF A;  3J7A O;  3W6J B;  3M9A A;  4MEY F;  3O6B B;  1J7K A;  1Q1H A;  2DAO A;  3LA3 A;  4RB0 A;  5AIP A;  3HOS A;  4N9I A;  1HKQ A;  5CVV A;  3RI4 A;  2XGX A;  1IXC A;  3WE2 A;  1WRJ A;  4G6D A;  4LMY A;  2LSO A;  4CYD A;  3ZMZ A;  3DV8 A;  2HQR A;  3ABU A;  4IRH A;  3J80 Z;  2P7V B;  5CVU A;  2EFP A;  3HTU A;  4YFK F;  2GWR A;  5LEK A;  2P6T A;  1SMT A;  2ZBK A;  5F6F A;  3T1B A;  2YPR A;  1I1S A;  2HTS A;  2W24 A;  1PUE E;  4Q4Z F;  5FFX A;  4Q48 A;  4ENJ A;  4RGU A;  3MZH A;  1IAW A;  4Q5S F;  1K79 A;  1QZY A;  4L0Z B;  2A07 F;  5DYM A;  1O7F A;  2W85 A;  4I02 A;  4I7H A;  2MBF A;  3ZMV A;  2A3S A;  4RAZ A;  1R58 A;  3Q9V A;  2A68 F;  1T0F A;  1BIA A;  3CLO A;  3WTX C;  1ZYR F;  3COA C;  4D0P A;  1IW7 F;  2QZ8 A;  4EJV A;  1OKR A;  2VBW A;  3BDD A;  4EJU A;  2A6E F;  4QLC U;  3E97 A;  3H3Z A;  2L54 A;  3ABT A;  4UHT A;  4FX4 A;  4RB2 C;  2K7L A;  2CO5 A;  4MEX F;  1IN5 A;  3D5L A;  1W7P D;  2E7X A;  2W57 A;  3I0T A;  4WXH A;  3DQV C;  4EQQ A;  1ULY A;  3EYY A;  4WXC A;  3SHF A;  4O6J A;  2BV6 A;  3G73 A;  4HAM A;  5J8F A;  2A69 F;  3REO A;  3TKY A;  2UWM A;  1J2X A;  3P9K A;  4LG0 A;  2HR3 A;  1YS7 A;  2RC4 A;  3TOB A;  1TLH B;  4R8H A;  2PI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...