1UFMA

Solution structure of the pci domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
84
Chain Sequence
b'GSSGSSGGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COP9 complex subunit 4
publication title Solution structure of the PCI domain
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 16
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2003-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ufmA00
2ESNA 4RB1A 3IWFA 1QNTA 5AIPA 2HYGD 1OKRA 1XGSA 2JTVA 1UCRA 1OYIA 1IAWA 5LEKA 3V7CA 2MH2A 1L0OC 3M7GA 4EGYA 2Q2EA 4CYDA 5BPDA 2DPUA 2L4MA 1WKMA 2G7HA 1Z6TA 3LWFA 1R1VA 3Q9VA 3F3XA 2KKOA 5DUIA 5H6QA 1EH7A 1XGMA 4LLLA 5JHUA 3E97A 1RZ4A 4EMSA 3DQVC 3MQ0A 4ENMA 4G6QA 4KICA 3ZMDA 1H0MA 3QPHA 1LDDA 3RJPA 1S29A 3R60A 2ISZA 1XDUA 3WTSC 5D6EA 1SD6A 5HVQC 3VOEA 5L3GA 4EM0B 3F8MA 1LEAA 4M71A 4Q5SF 4ENNA 5D8KB 2H09A 1W7PD 4LMYA 2L02A 2P4WA 4G8XA 1U5TC 2EJRA 3K1PA 2ADUA 1FBUA 1TNSA 5LHGA 4HOBA 3BDDA 2K86A 5K5RA 3LFKA 2O03A 3L00A 1F9NA 2GXGA 3TOAA 3D5LA 1P4XA 4HAMA 4OIQF 2Y0MA 1ZRCA 4LFUA 1W4MA 5D8LB 3FMQA 4XRFA 4L0ZB 1X3UA 1B6AA 4P9FA 1FP1D 3J81Z 1V3FA 2D1HA 4BAYA 2GQQA 1DDNA 5DD4A 4MTDA 3BP8A 5ILUA 2CYYA 4ASNA 2ESHA 2DQLA 5HLHA 2BBYA 5LRRA 2W24A 3EUHA 2P6TA 4KFCA 5LEJA 4R79A 5H6RA 2VN2A 3K1MA 4QLCU 2IA2A 1XCVA 4XBFA 3H92A 1XCBA 1FSHA 3ZMSA 2K02A 3E5QA 4AVPA 2ZKZA 4A0YA 2O8XA 3L9FA 4EGZA 3F21A 2DLLA 4LG0B 1HBXG 3V8LA 4RB0A 1SAXA 1HKQA 2MD5A 3RPQA 2P7CB 1U8RA 2GXBA 1R36A 3DV8A 1I1SA 1E17A 1TW2A 4AIKA 1UFMA 5JI6A 2QYOA 1RI7A 2NS0A 1W5SA 1P4AA 2IJLA 4IJAA 3WE3A 2VODA 2AS5F 5CJ9A 3QP5A 5BOXA 1TQIA 2H27A 2EFOA 3WTXC 1YFHA 1J0RA 2MA3A 5D6FA 3QAHA 3K69A 4ZYEA 2ZMEB 3TGNA 2ELHA 2FBKA 2FMYA 1DP7P 4MQVA 3FF5A 1MDMB 2L01A 2QQBA 1P4WA 1G3WA 3VODA 3WGGA 4RB3C 2EFNA 2LF8A 4G9YA 2ZJ2A 5E8GA 1KU3A 1Z9CA 4I98B 2XASA 3FXRA 4IF4A 2LSOA 5HS8A 5BPIA 1H9GA 3GZ6A 4Y15A 3RKYA 1DPRA 4HDVA 1BC8C 1LDKB 4BNCA 2QQAA 2B0LA 3I71A 3ISPA 3CUQA 1BC7C 3O3KA 2WV0A 4KIBA 3ZMUA 1XD7A 4L18B 3HTUA 3DP7A 1KYWA 3U1DA 1G3SA 2HQNA 2GAUA 2JRTA 3HRSA 3P9CA 3IL2A 4HLXA 4Y17A 4KIFA 3MWMA 3W6KB 2IRFG 2CGPA 5LGUA 2RVCA 2DPDA 3IHUA 3KETA 1GXPA 4YFXF 3SHFA 3ZN0A 3M8EA 2HDCA 5E17F 2KIFA 2A07F 5J8FA 4M73A 4UV8A 5ED4A 2OD5A 3ULQB 3K2ZA 2NNNA 1T98A 2VONA 3ZPLA 4M72A 4RAYA 5LGNA 2L3DA 4D0PA 4JBAA 2BV6A 4I7HA 5ICGA 3C7JA 2RC4A 4L5JA 4L9TA 3WTWC 4BQAA 3FWEA 3VEPA 2IA1A 3TO6A 3FM3A 5ICCA 2AXLA 1TQPA 2RDPA 1FYLA 3KZYA 5FFXA 3I0TA 2P5VA 3C3WA 3CDHA 2TDXA 2GIVA 1KQ0A 4IRGA 4M9XA 4KIGA 2PMHA 1QZZA 1R22A 3LAJA 1FC3A 4UVCA 1BM9A 2YX4A 1Z05A 4FT8A 2A6EF 1YS7A 2OZ6A 2M45A 1U3EM 2W25A 4HF1A 4R8HA 1FOKA 2Y48A 2FQ3A 1FZPB 1I6XA 3F72A 2O6GE 1VTNC 2XHKA 2A6HF 3BROA 3EDPA 5FLXZ 3GVAA 2XKPA 3RPUA 3GX4X 4IVNA 3TO9A 1AWCA 1DUXC 1P92A 3EETA 2DK5A 3N97A 2FE3A 4HZFA 1IRGA 1MJ9A 2JPBA 3F6OA 1O7FA 1I1GA 5EEHA 4KNYA 3BZ6A 5ERIA 3LA3A 2Z33A 2OBPA 3ZMVA 4HLYA 2VOOA 3R0JA 2IT0A 5D5WB 2XVCA 2HZTA 3BPVA 2FBHA 2IP2A 5HS7A 1FY7A 2VXZA 4MGRA 4PCQA 4YFKF 3O2PE 1ZN2A 4L9VA 1D8KA 1HXDA 3ECHA 5DV5A 1ZGAA 1O3TA 2Z9OA 5E8IA 3HYIA 2YSRA 4EM2A 3CO6C 4UVAA 2DBBA 1W7PA 2HKOA 4HA8A 2ACJA 1KYZA 2W85A 2L54A 2EV5A 1EH6A 3BY6A 2KJBA 1ZRDA 1K6OA 5L3FA 2DW4A 4RS8A 5F64A 3K1NA 4ZH4F 4YIFA 4XSXF 1T2KA 1R5GA 5IT9Z 2OU2A 4MNUA 2K4BA 3I64A 1PP7U 1G4DA 3CUQC 3FXUA 4MEXF 5A2QZ 4LD5A 3D0SA 2QWWA 3SZPA 2OQGA 3WTVC 3RYRA 3LQRA 2VBZA 4EVIA 1IXSB 3ERED 2M30A 1ZARA 2Y75A 2P6SA 1BI1A 1KA8A 1NHAA 3E5XA 1IUYA 4CICA 4A2UA 2F5DA 4YG2F 4IXAA 3GWZA 3ROUA 4UV9A 3F8NA 1MKMA 1K78B 4KA4A 1CF7B 2HTJA 4OIOF 1IXRC 5HDNA 4LJZF 2OAZA 2EB7A 3RTRA 2GA2A 2HQRA 2XUBA 3JSOA 3REOA 3HSRA 2VE9A 3KP5A 2V1XA 4M9SA 2M87A 2DT5A 4FHTA 1UB9A 3P7NA 2QLZA 3HHHA 1ZLKA 3M8FA 3CJNA 1FP2A 5FGMA 5HOOA 1R7JA 1TW3A 4QWQA 1MZBA 3QP6A 4ZYDA 1IN5A 3C18A 3JTHA 1FBSA 2M8EA 2E7XA 3OOPA 1B1BA 1U5TB 5LHIA 4IPAA 2LNBA 1J9IA 3V4GA 2Z99A 3CUOA 2DI3A 3SFZA 1B9NA 5F6FA 4BHBA 1S7OA 1BI0A 3TQNA 4WX9A 4LK0F 2RN7A 4L5IA 1RNLA 3HUGA 5BS6A 1R23A 2GWRA 3BJAA 1USSA 3K0LA 4KT5C 2EV0A 3RIRA 2RGVA 1YS6A 3BPXA 3E6DA 1IRFA 4NHJA 3HRUA 3JW4A 1R00A 5FO5A 3R0AA 2UXNA 1YW7A 3GFLA 2E7WA 3RKXA 3T1BA 3VFZA 1T39A 3C1DA 1SMYF 4MHGA 4EJOA 1USTA 2MC3A 1YW9A 3ML6A 2H6BA 2E1NA 4Q47A 4IHSA 3MAJA 3JAMK 4UVBA 1MGTA 2O0YA 1F5TA 2MLGA 4MTEA 2VBYA 2R7DA 2WWYA 1KQ9A 2X4HA 3R4KA 5L3DA 1S8NA 3O6BB 1JE8A 1ZG1A 2ZNZA 3J7AO 1LEBA 1LVAA 2STTA 3HOTA 1SD7A 5IT3A 2QBYA 1YTYA 2XKOA 2F5EA 1FNNA 4L9JA 4KN7X 4CO8A 3L2CA 2BGCA 1LJ9A 3U9GA 3TDZC 5ICEA 3KCCA 5JFRA 2D45A 3BJ6A 1ZYRF 1P6RA 3GF2A 3RYPA 3BOQA 3BWGA 2YU3A 1CGPA 5DCMB 1Q1HA 2XAQA 4RAZA 1FLIA 4NB5A 1L3LA 1FYMA 2HKXA 3FMRA 3KEOA 1R5HA 1PP8F 2HWVA 4CDGA 3B02A 4A5NA 1JGSA 4EJVA 4TV7A 1PDNC 1T0FA 3KZZA 1XGNA 4PZJA 2EK5A 3ZQ7A 2H6CA 3I59A 3KP7A 3T8TA 5L3CA 5K5OA 3J81K 3FHZA 1YLFA 3RDIA 5ICFA 3DXJF 1TBXA 3E6CC 3MCZA 5DCFA 4JQFA 2YPRA 1O57A 4YIIA 1BOAA 2V6CA 1XMAA 4KUMA 1HW1A 4AD9A 1XDSA 3HSFA 3E3VA 1W5TA 4DNCA 4I0AA 2R7FA 1YIOA 1R1UA 4E70A 3WG9A 2H94A 4M9ZA 2ETHA 3FMSA 1LQ1A 3E5UA 3F23A 2EA2A 2A3SA 4Z2YA 2HS5A 3T8RA 4HF2A 4HQMA 1JXSA 2VOPA 1WWXA 1S7AA 3CLOA 3H3ZA 2XAFA 1BI3A 1D8JA 1KU2A 4G7ZF 4CZZA 1ON2A 3KP2A 2JZYA 3KE2A 3MZYA 2A68F 4HX7A 5AONA 2EFPA 4P9UA 4P5OA 4WXHA 4N0BA 5J8CA 2A61A 3NQOA 2DK8A 1U2WA 1ZGJA 2HEOA 4Q48A 1ZG3A 4DQ2A 1LNWA 4U0WA 2IA0A 2GA1A 2NAZA 5BQTA 2CW0F 1SD4A 4L0YB 2LF7A 3TOBA 1UHMA 3Q9SA 4LLNA 2F5CA 3V8KA 5FB2A 1G3YA 5DDGA 3GLXA 5EEGA 1FWZA 2EA4A 3ECOA 5H20A 1IN8A 4PGGA 3HRMA 4P55A 1C0WA 1K7AA 4GYIA 5JR3A 2DAOA 2FF4A 2JSCA 4OU0A 3T0YA 4I09A 4BYYA 2ZO4A 2UWMA 1UHWA 3KLNA 4HW0A 1OPCA 2Z3YA 1EV7A 1YYVA 3EQLF 3R61A 3M1EA 2VC1A 5KK1A 4M74A 3VB2A 4A6DA 1GVJA 2XGXA 3ABTA 3IRQA 2PQ8A 3K9TA 3I53A 3GO5A 4U7DA 3JSPA 2HGCA 3WU0A 1J7KA 3CTAA 4ESJA 1O3SA 6PAXA 2QVOA 3J80K 3ABUA 3R6SA 4Y13A 1B59A 1T38A 2QQ9A 1XB4A 1V4RA 4UNOA 3MZHA 4G94A 1J59A 3H3UA 5D4SA 3JTGA 1DPUA 2L4AA 2JT1A 3LQQA 2CO5A 3QPTA 4RGXA 4EM1A 1D5VA 4G7OF 4IHTA 1O7LA 3LA7A 4K2EA 4B09A 4AIHA 1GXQA 3WTZA 1HSJA 4RB2C 3G3ZA 4ZYHA 1XN7A 3E6MA 4IRHA 3TKYA 3RKWA 4HBLA 3PFIA 2PEXA 4LG0A 5HS9A 1FYKA 1XSXA 2XV4S 4M6XA 3ZMZA 1OMIA 4OMYA 3EYIA 2V1DA 2O61A 3QU6A 5FD6A 3LA2A 2IVMA 1REPC 4A5MA 3N4MA 2STWA 4B8XA 3WTUC 4I01A 4UUVA 1TNTA 1JHFA 3LSTA 3F8CA 3KP6A 2FRHA 1FT9A 3TO7A 1ON1A 3B73A 1ZHFA 4HV6A 4A0XA 4S05A 2LKPA 2PBIA 4WCGA 3KLOA 1KGSA 3CUQB 1ZAOA 3ELKA 3GFJA 3FM5A 3T5XA 1J5YA 4UXNA 5D4RA 2ZMEA 3OV8A 2G7UA 2DFIA 2W84A 3V7SA 4ZYGA 1I27A 4OOIA 2NNYA 1Z7UA 5K5QA 5ILVA 2BYVE 1TTYA 1MDMA 1BIAA 2V9VA 2VBWA 3EYYA 2HOEA 2PN6A 1ZRFA 1MJAA 5CYVA 4OIRF 5HLIA 3E6BA 4M6YA 5FFZA 2XROA 2MBFA 3QRFF 3JAMZ 1G3TA 4RGSA 5E1ZB 2C6YA 1BIBA 4O3MA 1QZYA 1Y0UA 5FLXK 1R1TA 3CO7C 4GGGA 5DYMA 2EWNA 3LAPA 2EFWA 5HLGA 2V79A 5J6XA 4HX4A 1XMKA 2ISYA 1ONVA 3SQNA 4GCVA 1RUOA 3V8JA 1QBJA 2KJCA 4BHPA 1LDJA 2PMUA 2D1VA 4OINF 5L3EA 3COAC 4RGUA 4O5VA 3DPLC 5DUKA 1S6LA 3DPTA 4G6DA 4AWXB 5HDKA 5LHHA 2FNAA 4GXOA 2UZKA 4EJWA 2XRNA 1ZREA 1QO0D 3TDUC 2DQRA 3PQJA 2O3FA 3BJOA 3WU1B 2PI0A 2A5YB 3GFMA 2FOKA 2PJPA 2F2EA 1KU9A 2M5WA 2NYXA 1RUNA 2VE8A 3ZN1A 2ZCWA 5F1RA 1XGOA 1HW5A 1U78A 5BMZA 5LGTA 1JHHA 4LB5A 4PGHA 3DKWA 1IZ1A 4AIJA 2VC0A 5IT9K 3QOPA 2EV6A 4ESBA 4OMZA 2CSOA 3M9AA 5AIQA 3I54A 2HYFA 4KMFA 2VT3A 2CFXA 5A2QK 1IW7F 1OYWA 1H9TA 2CQKA 2JPCA 1RIOH 1Z1DA 4HF0A 1T6SA 1QGPA 1HQCA 2NRAC 2HFHA 2CWEA 2UXXA 4HYEA 2QZ8A 2EFQA 2ZFWA 2RKHA 3QU3A 2MH9A 1MD0A 5TRDA 3WGIA 5HDGA 2FNPA 3NRVA 1FSEA 3MEXA 4YFNF 5E1WA 5D5VB 4KN4X 4L9NA 5CLSA 3RI4A 2QENA 2QM3A 3G73A 1OYYA 4EJUA 2IPQX 3HIFA 3GYHX 3ZP5A 2K7LA 4ESFA 1G6NA 1J2XA 1SD5A 1SFEA 5CVIA 3L7WA 1YO5C 1BI2A 3DF8A 2CG4A 4XLPF 2MLKA 1W7PB 5CVVA 2Q0OA 1R58A 1YW8A 3ZMTA 1FX7A 3I5UA 4ETSA 1WI9A 1TLHB 2DO7A 2COMA 4U7BA 4F7ZA 3F8BA 2IW5A 4CXFA 3S2WA 1WRJA 5E18F 3WGHA 4PDKA 3FZVA 2A69F 3AAFA 1MJBA 1WSUA 2XAHA 3F22A 1XSVA 2FU4A 5E20A 1Z6RA 2XIGA 1HSTA 2ZNYA 2PG4A 1J75A 3PQKA 4HV5A 2OZUA 3KEQA 2BE5F 3HOSA 3IWZA 4A6EA 5LLQA 2BEOA 1B9MA 3GEZA 4WXDA 3KFWX 4I02A 1TQMA 3P9KA 3GFIA 2QUFA 2ZBKA 2P5KA 2J5OA 4WF2A 1QQIA 2HR3A 1P2FA 4NQWA 3HTSB 1LB2A 4EJTA 2FSWA 2RQPA 2OA4A 4I0BA 2LDUA 2P7VB 3WE2A 2FEZA 2DTRA 5KVRA 3KP3A 4GO1A 3DEUA 4BHCA 2WTEA 4MQ9F 1AOYA 4U0VA 3GUDA 1SFUA 2KRFA 4JK1X 2V1UA 4HDUA 3J80Z 1S3JA 1HW2A 3W6JB 5LRSA 2R3SA 1E2XA 3IKVA 4H0EA 1BBYA 2PLYA 3GW2A 4KMUX 3WTTC 1K78A 3FXQA 1CF7A 2X0LA 4P96A 2KIUA 3HSEA 2K4JA 3NEUA 1F1ZA 1F4KA 4S04A 3IKTA 4KYWA 3SZTA 3HRTA 4LK1F 5DEQA 5CVUA 1SFXA 1O3RA 3IC7A 1I5ZA 3F8FA 5ILSA 1OR7A 2OQRA 2E1CA 1ZH5A 1HKTA 1Z91A 2WC2A 4U0YA 5D5UB 3SXYA 3HHGA 1KU7A 5TJJA 4FX0A 2P8TA 5DD8A 4HQEA 1U5TA 1YG2A 4LGWA 5CVJA 2XAJA 2FA5A 4ON0A 2VBXA 4OIPF 3MFKA 4BH9A 3Q5FA 5E1XA 4U88A 2M1BA 1FPQA 4A0ZA 2K27A 4XSZF 2FBIA 4LLGF 2G9WA 2ZXJA 1BJAA 2Q8KA 1STZA 3KP4A 1D3YA 2QBYB 4IRIA 4KDPA 4CGZA 2P5LC 1ZLJA 5FD5A 4MEYF 4WK8F 1KQ8A 5L3BA 4WWCA 1K79A 4ENJA 2D2WA 1BN5A 3GZ5A 4FX4A 1ODDA 2YR2A 1B4AA 1O3QA 3U2RA 3WTYC 2GZWA 1IXCA 2PFBA 4ENKA 3FX3A 2XAGA 4RGRA 1YQAA 4EQQA 4ZZDA 2W57A 4CHUA 3WODF 2VT2A 4ZZLA 1IN6A 1HKSA 1SMTA 3F6VA 2KIMA 4A12A 1WQ2A 1PUEE 5D5XB 3I58A 1FBQA 1U6GA 2DU9A 1IN7A 1A04A 1GHCA 2RNJA 4HX8A 3V7RA 4N9IA 4N9HA 4EV0A 3I59B 1IN4A 4WXCA 4UHTA 2RV8A 2FXAA 2J5PA 3IRRA 3P9IA 3L09A 1ZG5A 4I2OA 1QPMA 4Q4ZF 2HTSA 2F5FA 5LBQA 4R1HA 4G7HF 4XLNF 1XSDA 5JVTA 3DFGA 4BXUA 4O6JA 2YX7A 3GXOA 5DCMA 2Z5UA 4LB6B 1ULYA 1IF1A 5K1YA 2FMLA 3I4PA 4GYGA 5CVRA 1EH8A
chains in the Genus database with same CATH superfamily
1MNMC 4XICA 2ESNA 4RB1A 5DM6F 5JVGF 3J7AY 3IWFA 1ZR4A 3DWLE 1W0UA 1JT6A 3RPUD 3KIOA 2TCTA 1QNTA 5AIPA 1A36A 2HYGD 3K4NA 1OKRA 1XGSA 2JTVA 3CCLI 3SZGA 1UCRA 3CC7I 1OYIA 1IAWA 5LEKA 1B72B 1VQ9I 2Y9YA 2MH2A 1L0OC 3V7CA 4CSWA 3OOUA 3M7GA 3P5JA 4EGYA 2Q2EA 4CYDA 5BPDA 2DPUA 1V55H 3L1PA 1JUSA 1EF4A 2L4MA 1WJAA 1WKMA 5EYRA 4BE0A 4AYBN 2G7HA 1SC7A 1Z6TA 3LWFA 1R1VA 1E3PA 3Q9VA 2ZB9A 2I8DA 3F3XA 1S7EA 2KKOA 1VQ6I 2M7BA 5DUIA 1WGXA 1MBFA 5H6QA 1EH7A 1IV8A 1XGMA 3ZCOA 5J1YA 4LLLA 1ZKGA 2DJNA 5JHUA 3E97A 1OR7C 4ZDLA 1RZ4A 4EMSA 3DQVC 3MQ0A 4ENMA 4G6QA 4KICA 3ZMDA 1YIJI 1H0MA 3QPHA 1LDDA 3RJPA 1MNDA 3AKZA 2KZVA 2BVLA 1SVLA 1S29A 1Y8RB 2IXSA 4RDUA 4JX5A 3R60A 2ISZA 1XDUA 1KONA 3WTSC 5D6EA 2A05A 1X1CA 5M3MJ 1SD6A 2CMPA 4N4OB 3VOEA 5HVQC 5L3GA 4EM0B 2K9SA 3F8MA 2X51A 1LEAA 2CQQA 4M71A 3HOYJ 4Q5SF 4FETA 4ENNA 4IL6C 5D8KB 2H09A 1B8IA 1W7PD 4LMYA 2L02A 1U9OA 3MMYB 2P4WA 4G8XA 1U5TC 2EJRA 2W82A 4F93B 3OYGA 2LY2A 3K1PA 2ADUA 1FBUA 1TNSA 5LHGA 4HOBA 1K61A 3BDDA 2K86A 5K5RA 3K70C 2BW3B 3LFKA 3PJRA 2L0KA 2O03A 1UHSA 3L00A 1F9NA 2GXGA 4B3AA 4BDYA 2LVSA 3TOAA 1WJFA 1P4XA 3D5LA 4HAMA 4OIQF 2QA4I 2Y0MA 1AA7A 4LFUA 1ZRCA 1W4MA 5D8LB 3FMQA 4XRFA 5EJCA 4L0ZB 1X3UA 1B6AA 1MW7A 4P9FA 5EZGA 2ZC2A 1FP1D 3CJTB 4LIVA 4OWRB 2DT7B 1GT0C 1V3FA 2D1HA 3J81Z 4BAYA 2GQQA 1DDNA 3CQZJ 4XKWA 5DD4A 4MTDA 2DMNA 2R0QC 3BP8A 4ANJA 1DU6A 2KPMA 5ILUA 2CYYA 2KQRA 4ASNA 2ESHA 2L7ZA 5H2FC 2DQLA 5HLHA 2BBYA 5LRRA 3CMAI 1A35A 1VQ7I 1BW6A 2W24A 3EUHA 2P6TA 5GTIC 4KFCA 3PUBA 5LEJA 2UV1A 4R79A 5H6RA 3GCMA 2VN2A 3K1MA 4QLCU 2PJRA 1QA6A 4XMYA 2IA2A 1XCVA 3BG7A 3PNVA 4XBFA 4IX7A 3GLLA 3AG2H 3NARA 4RMNA 2JUCA 3C2GA 3H92A 5E3MA 1XCBA 4RM2A 2MGQA 1FSHA 4YRVA 3ZMSA 2K02A 3E5QA 4AVPA 2ZKZA 1OJLA 4A0YA 2OCCH 2O8XA 3L9FA 2NVXJ 1I6HJ 4EGZA 3F21A 4NC7A 2L9VA 2HOSA 2DLLA 2VUMJ 3JR9A 4LG0B 1HBXG 2PMZN 1UMQA 3V8LA 1WZ2A 1WJCA 2DMUA 2KFDA 4RB0A 1SAXA 4RLFA 1HKQA 2MD5A 3RPQA 5GTHC 1YHQI 2P7CB 2NS8A 1U8RA 2GXBA 1R36A 3DV8A 1I1SA 2M2EA 1E17A 4A3JJ 1TW2A 5KNLA 4AIKA 3H5NA 1ETWA 1UFMA 3CCEI 2KT0A 5JI6A 2LKSA 2QYOA 4XKCA 1RI7A 1Y1VJ 2NS0A 2DMTA 1W5SA 1P4AA 4I76A 4DW6A 2IJLA 4UB6C 2VXDA 3RKQA 4IJAA 4B3XA 3WE3A 1SANA 1CQTA 3GTJJ 2VODA 4PSWA 1YOVB 2AS5F 3BG9A 1TWAJ 5CJ9A 3QP5A 5F0HA 2O5RA 5BOXA 4PK4A 1TQIA 4BY1J 2H27A 3S8PA 2EFOA 3WTXC 3OS2A 3W2WA 4IQJA 3ZXSA 4BE1A 2JA2A 1YFHA 3S1MJ 1J0RA 2MA3A 2DXIA 5D6FA 3QAHA 2EPFA 3K69A 2DN0A 4ZYEA 4ZTJA 2ZMEB 1T08B 3AL0C 4F52A 1R5ID 3TGNA 2ELHA 2FBKA 1WJBA 2FMYA 2FJ1A 2CUZA 4MQVA 1DP7P 3FF5A 1Z7LA 1X19A 1FMVA 2DJIA 1HDPA 5M5YJ 4D5FA 3OYAA 1MDMB 1ACIA 2L01A 3JRGA 3RZOJ 2QQBA 4A3EJ 3CDLA 3DEEA 2R7RA 4CCKA 5IY5H 1P4WA 1VQ4I 3CP2A 2Z2SB 4HEA2 1G3WA 2HXIA 3VODA 3WGGA 4RB3C 2JA5J 2EFNA 2LF8A 4G9YA 2ZJ2A 5E8GA 4M3BA 4ITVA 1KU3A 3G6EI 1AHDP 1Z9CA 1I3AA 4I98B 2XASA 3FXRA 4IF4A 2LSOA 1JUMA 3RCOA 5HS8A 3CJRB 1XMXA 4BY7J 2VJ5A 5BPIA 3PSFA 1AKHB 1H9GA 3GZ6A 2KL4A 4Y15A 3RKYA 1BR4A 1DPRA 4HDVA 1QVUA 3DCFA 4H4KC 1LDKB 1BC8C 4BNCA 3CMMA 2QQAA 2DOFA 2B0LA 1F36A 2DA1A 3I71A 2F4IA 3L2RA 3ISPA 3CUQA 2XAUA 1BC7C 3O3KA 2WV0A 2V6EA 1ZQ3P 3OWTA 1K83J 1FOYA 4YELA 1JKOC 4KIBA 4NC8A 3O8HA 3ZMUA 2CW7A 1XD7A 3ZRGA 4IQ4A 3ABKH 5J47A 1HLVA 4L18B 4D9JA 3HTUA 3PL8A 1A5JA 3G1MA 2LYCA 2HU9A 1FIPA 2XPWA 5B1AH 3DP7A 1KYWA 1SFOJ 3SFIA 1DQUA 3U1DA 1YJNI 1G3SA 2E1OA 3FXJA 1S5LC 2B63J 2HQNA 2GAUA 2JRTA 5F27A 3HRSA 3P9CA 3IL2A 4HLXA 4Y17A 2W00A 3E1SA 3D5RC 1VQNI 4KIFA 4A3BJ 1VFCA 2HVSA 1OQYA 3OYKA 2X6YA 3U21A 2DFEA 2DA4A 4A3LJ 3MWMA 4E4HA 4UUTA 3W6KB 2DYSH 2IRFG 2CGPA 5LGUA 1MH3A 4BKXA 2RVCA 2DPDA 3A1YA 3IHUA 5DM7F 2XPVA 3VYTB 2GOMA 3KETA 1GXPA 4YFXF 3SHFA 2HNHA 3ZN0A 1IG7A 3KEYA 2WAEA 3M8EA 2HDCA 5E17F 2KIFA 1RKWA 2A07F 3CD6I 4II2A 1WJEA 1ENHA 5J8FA 4M73A 2LLKA 4B4CA 2E2IJ 2DTZA 4UV8A 5ED4A 2OD5A 3ULQB 3K2ZA 2XPUA 1LFBA 3HXLA 3ZQCA 2NNNA 4D7MA 1FIAA 1T98A 4IHYA 3ABLH 2VONA 3ASNH 3ZPLA 4M72A 4RAYA 4C3HJ 5LGNA 2L3DA 4NBQA 3K2AA 4D0PA 3GTGJ 4XR6A 4JBAA 2H8RA 2BV6A 3HOZJ 4I7HA 5ICGA 3PM1A 3IV5A 3C7JA 2CS3A 2LTPA 3AG3H 4BJ5C 2RC4A 2YU9J 4L5JA 4PJJA 3ZQLA 1UJ8A 4MFDA 2F5VA 1SAUA 2WY8Q 4PJ0C 2VI6A 1X1DA 4L9TA 3WTWC 4BQAA 4XL9A 2FX0A 2JVHA 2NVYJ 3FWEA 2IS2A 2LC2A 2HVRA 4XORA 2NOGA 4J01A 3VEPA 1GUUA 2IA1A 3A01A 3TO6A 3FM3A 5ICCA 2AXLA 2N8GA 3AG1H 1TQPA 2RDPA 1FYLA 1ZGWA 1G2HA 5C44J 2VIXA 1IRXA 3KZYA 5FFXA 3I0TA 2P5VA 3C3WA 3CDHA 1T95A 2TDXA 2GIVA 4LITA 1KQ0A 4PJLA 4IRGA 4M9XA 4KIGA 2PMHA 2E71A 1QZZA 2R7QA 4V2GA 2VKHA 1R22A 2X48A 2R5ZB 3LAJA 2BY0A 4ZJZA 1FC3A 4UVCA 1BM9A 2W4SA 2YX4A 3FKJA 1ORKA 1Z05A 1D1BA 3I55I 4FT8A 2A6EF 2DOAA 4J19A 1YS7A 2OZ6A 2M45A 2QEXI 4C2TA 1U3EM 3LL7A 2W25A 1IDYA 4HF1A 2M4KA 4R8HA 1FOKA 2Z1DA 3UNGC 2OTLI 2Y48A 2FQ3A 3QYEA 1WJ5A 2V1NA 5TISC 1WJDA 1FZPB 1I6XA 3F72A 2O6GE 1VTNC 1Z67A 2XHKA 4G12A 1V5EA 3H35A 1LFUP 2CV0A 1Y56A 2A6HF 1ZR2A 1F43A 3BROA 3LSRA 1HA8A 5J1UA 1J09A 3EDPA 5FLXZ 3GVAA 2XKPA 3RPUA 3GX4X 4QTRA 4ZTFA 1E0EA 4IVNA 2Y30A 3TO9A 1AWCA 4M3FA 5J4YA 1DUXC 1P92A 3EETA 2DK5A 3N97A 3S3OA 2FE3A 1T56A 3GMEA 4HZFA 3JRIA 1IRGA 4NUBA 4BS9A 3ERMA 1MJ9A 2JPBA 3F6OA 2PX9A 1O7FA 2KDZA 2K9QA 1I1GA 5EEHA 4KNYA 9ANTA 2IGMA 3BZ6A 4RA2A 2A5WA 2RQQA 5ERIA 1I39A 4QPOA 1ZK8A 3JREA 1NH3A 4CYCB 1HF0A 3LA3A 2Q1ZB 4XOTA 2Z33A 1OCPA 2CW8A 2CH0A 1ETXA 1W1WE 3OYBA 4E7IA 4BQNA 2OBPA 3ZMVA 2ZJRF 4HLYA 2VOOA 3R0JA 3OYJA 2IT0A 5D5WB 1X3ZB 2XVCA 5FKMA 2V4JC 1GLNA 3DU6A 2HZTA 3BPVA 1BA5A 2FBHA 4ZYAA 2IP2A 5HS7A 2WB1A 1FY7A 2VXZA 1MSEC 4MGRA 3E7LA 4PCQA 2Y31A 3LSHA 4YFKF 3PIOF 3O2PE 1ZN2A 4L9VA 1MBHA 2ELKA 1DGWY 1D8KA 1HXDA 3ECHA 5DV5A 1YJWI 1ZGAA 1O3TA 2Z9OA 5E8IA 4A3KJ 3HYIA 2YSRA 5GP9A 1TT0A 2F48A 2DDAA 3S93A 4EM2A 5B66C 3CO6C 1R49A 4UVAA 1X1PA 2DBBA 3KYLA 1D1AA 1W7PA 2HKOA 4HA8A 2ACJA 1KYZA 2W85A 4RLQA 4LIUA 2K85A 3A02A 2L54A 2EV5A 5GAGJ 2P0WA 1EH6A 3RZDJ 3BY6A 4F91B 2KJBA 1ZRDA 4NQWB 1K6OA 4UY8I 5L3FA 1U0JA 1UG2A 3O8GA 2OV7A 5FLVA 1UZCA 2R7VA 2DW4A 4RS8A 2CRGA 5F64A 3K1NA 4ZH4F 4HRIA 4YIFA 4XSXF 1T2KA 1IV6A 1JI8A 1R5GA 5IT9Z 4F3QA 2OU2A 2KHMA 4MNUA 1XPXA 2OPTA 3SDBA 2K4BA 1TZLA 3I64A 2DFFA 1PP7U 3HGGA 1GDTA 2M4GA 5GADJ 2M3AA 1G4DA 3CUQC 3FXUA 2I10A 4MEXF 5A2QZ 4LD5A 3K4KA 2OCEA 1LPQA 1YRNB 2LR8A 3D0SA 2QWWA 3SZPA 2OQGA 3WTVC 3RYRA 3LQRA 2VBZA 4EVIA 1PUFB 1IXSB 3ERED 2KRCA 3X2QH 2M30A 1ETQA 1ZARA 2DFHA 3DTKA 3OIQA 4A3DJ 2Y75A 4M6VA 4UUSB 4BEHB 3CP8A 1NG6A 2P6SA 1BI1A 1OFCX 1KA8A 1NHAA 3E5XA 1IUYA 3UKGA 3VYSB 4CICA 4FCYA 5EGOA 4A2UA 2F5DA 4II3A 1JJ6C 4IXAA 4YG2F 5FLMJ 3GWZA 3ROUA 4UV9A 4M3EA 3F8NA 1MKMA 1K78B 4KA4A 1CF7B 5E3OA 2HTJA 4OIOF 1G8XA 1MBEA 2L9RA 2KISA 1IXRC 4IEJA 5HDNA 3CMYA 5B1BH 5FKOA 4LJZF 2OAZA 2EB7A 3RTRA 2GA2A 2VASA 2HQRA 3BR5A 1VI0A 2WADA 3S32A 4W1UA 2XUBA 1JKRC 3JSOA 3LSGA 3REOA 2OF7A 4D5CA 3HSRA 3KZIC 2VE9A 1BOBA 3KP5A 2V1XA 4V2FA 4GDFA 3ZQHA 2L9SA 4M9SA 2M87A 5FRMA 2DT5A 3E0JB 4FHTA 1UB9A 2MD0A 3HPHA 1VQLI 3A0BC 3P7NA 2CU7A 2QLZA 4CH7A 3HHHA 1ZLKA 3M8FA 3CJNA 1FP2A 5FGMA 2ZXWH 1R7JA 2FD5A 5HOOA 3ZQQA 1YJ9I 1TW3A 4QWQA 3CCYA 3OR1C 1MZBA 2Y69H 3QP6A 4ZYDA 1UAAA 4KISA 2R7SA 1IN5A 3C18A 3LSIA 3JTHA 3PNYA 1FBSA 3AG4H 4KITB 3Q0WA 1FTTA 2CFOA 2GXAA 2M8EA 2E7XA 3I3LA 3OOPA 4AC0A 1B1BA 1U5TB 2XB5A 2O9LA 3IP4B 5LHIA 4IPAA 2IAIA 2LNBA 3CLQA 1J9IA 3V4GA 2Z99A 3CUOA 4B43A 2XF7A 2DI3A 3SFZA 1B9NA 5F6FA 4BHBA 2BY3A 1XX5A 4BGDA 1S9HA 5HNHA 1S7OA 3FIWA 4BBSJ 5F0CA 1BI0A 3TQNA 4WX9A 1RESA 2V7FA 5M3FJ 1HOMA 4LK0F 2RN7A 2KLOA 2HI3A 3NAUA 3A4CA 2RNGA 3PFYA 4L5IA 1RNLA 3ZQIA 3G71I 1X2NA 3HUGA 5BS6A 1R23A 2GWRA 2LFBA 3BJAA 2VKDA 1USSA 3K0LA 5HODA 4FE4A 4KT5C 3JCUC 2EV0A 3RIRA 2RGVA 1YS6A 2BHZA 3BPXA 3HL2A 3E6DA 1IRFA 4YEJA 4NHJA 1ETKA 3HRUA 1UELB 3JW4A 5C3EJ 1R00A 2CV1A 5FO5A 2IS6A 3R0AA 4RAGA 1PYVA 1NTCA 4IHXA 2UXNA 1YW7A 3GFLA 4DGWB 4DYCA 3BR3A 2JQ7A 2E7WA 1KZHA 1EJ9A 3RKXA 1IDZA 3T1BA 2HPMA 3VFZA 1MMDA 1T39A 3H5AA 1D0ZA 3C1DA 2WAQN 1SMYF 4MHGA 5GAEJ 4EJOA 1USTA 2MC3A 2R5YB 3F9KA 3WG7H 2AHQA 1YW9A 3ML6A 2H6BA 2WV1A 1Y6IA 2E1NA 1M1EB 2MC4A 4Q47A 4XLCA 4IHSA 1IRZA 3MAJA 3MKLA 3JAMK 4LG3A 4UVBA 2EILH 1MGTA 2O0YA 5B5EC 1TP4A 1F5TA 2ELJA 2MLGA 3FK7A 2FUG2 4MTEA 2VBYA 2R7DA 2WWYA 3OYEA 3VDXA 1KQ9A 2X4HA 1VQKI 1YE9A 3S3MA 3R4KA 2BHYA 3DBHB 5L3DA 1WPKA 1S8NA 3FBIB 2LY9A 4PUSA 5FKNA 3O6BB 1BR1A 1JE8A 1ZG1A 5IPAA 3KYCB 2ZNZA 2ZXIA 3J7AO 1N25A 1LEBA 2K9LA 1LVAA 2BVMA 5J3LA 3HOTA 1SD7A 5IT3A 2STTA 2QBYA 4QSHA 1K4SA 1YTYA 2XKOA 2F5EA 3JRHA 1LE8B 1FNNA 3HC7A 3H9QA 4L9JA 4BDZA 4KN7X 4CO8A 3L2CA 2BGCA 2AQEA 4A3MJ 1LJ9A 1VQMI 1V54H 1YI2I 3U9GA 3HOVJ 3TDZC 5ICEA 3C2BA 2K9NA 4DZJA 1ETOA 3KCCA 5JFRA 4CCMA 2D45A 3BJ6A 3FXLA 1ZYRF 2V9PA 1P6RA 5GPAA 4A69C 3GF2A 3RYPA 2VKVA 3QOEA 3BOQA 3BWGA 4GFBA 2YU3A 1CGPA 5DS9A 4D1QA 5DCMB 1Q1HA 2XAQA 4RAZA 2DA7A 1FLIA 4NB5A 1L3LA 2VJIA 1FYMA 2HKXA 3ZQGA 1S72I 3FMRA 1SVMA 3KEOA 3KPHA 1R5HA 3L2VA 1PP8F 3SJMA 2Y0SA 2IS4A 5F0FA 5C4JJ 4XLAA 5EG0B 1ERDA 2HWVA 4CDGA 1ZELA 3B02A 4A5NA 1R4NB 1JGSA 4EJVA 4EEFG 4TV7A 1MMAA 1PDNC 1T0FA 3BG6A 3KZZA 2BXZA 2AXTC 2R7TA 1XGNA 3C2HA 1WHUA 4PZJA 2B9SA 1RR7A 2EK5A 3ZQ7A 2RREA 2H6CA 1GV5A 3GZNB 3I59A 3KP7A 3T8TA 5L3CA 3BZKA 3I4MJ 5JLXA 3Q3SA 5M5WJ 5K5OA 2Q2EB 3J81K 3FHZA 1YLFA 2BOLA 3RDIA 3BR6A 2JA6J 5ICFA 3DXJF 3BR2A 1TBXA 3K6GA 1H88C 3EPZA 3E6CC 1A6QA 3MCZA 1POGA 4BJTA 4FQGA 3BG5A 2XSDC 1VZ0A 5DCFA 4JQFA 2K9MA 2YPRA 1O57A 1W5CC 3DKXA 3MKZA 4YIIA 1BOAA 2V6CA 2O8KA 3IH4A 2E60A 2R93J 1XMAA 4KUMA 1VQOI 5JLWA 2CV2A 3M4OJ 1HW1A 4BU2A 4AD9A 2EIMH 1XDSA 3G1LA 3OYLA 3HSFA 3E3VA 2CUJA 3FHNA 3JRAA 1W5TA 4DNCA 5IOYA 1E3HA 4Y7NJ 4I0AA 5C4XJ 5J40A 1TL8A 1MBGA 3OL3A 1V5FA 1R6RA 2R7FA 1TC3C 1YIOA 3GTLJ 2QSGX 3M8JA 1R1UA 3S17J 1VF9A 2IBDA 4E70A 3WG9A 2H94A 4M9ZA 2ETHA 4XRSA 3FMSA 1LQ1A 3SYTA 3E5UA 4UUSA 3F23A 4BEHA 2EA2A 3HJEA 2A3SA 4Z2YA 2HS5A 1B8IB 3S2HJ 2LH9A 3T8RA 2LY1A 4HF2A 4HQMA 3G4SI 1JXSA 2QQ8A 2VOPA 1WWXA 1S7AA 3CLOA 3H3ZA 4E7JA 2E2HJ 3DLLF 3V42A 1D0YA 2W1OA 2XAFA 4CCOA 1BI3A 3HEFA 3HOXJ 1B72A 5EEAA 1BJZA 1KU2A 2JRMA 1D8JA 4G7ZF 4CZZA 1ON2A 3KP2A 2EZIA 3HKZA 4CZCA 2IGKA 2CQ7A 2DMPA 2JZYA 3KE2A 3MZYA 3S1RJ 2HOTA 2A68F 4HX7A 5AONA 2EFPA 4P9UA 4P5OA 4WXHA 4N0BA 4C9YA 4A3GJ 5J8CA 2A61A 3DTEA 3NQOA 1P7JA 1Z77A 2DK8A 2K5CA 3LNQA 3OSFA 2L5QA 1U2WA 1K6YA 1ZGJA 2L7FP 2HEOA 4Q48A 1ZG3A 4DQ2A 4DBRA 1LNWA 4U0WA 2IA0A 2GA1A 2NAZA 5BQTA 2CW0F 4E6KG 2R92J 4DBQA 1SD4A 1MMNA 2IGOA 3SEQA 3OS1A 4L0YB 2LF7A 3TOBA 1UHMA 2XRLA 3Q9SA 4LLNA 3DU5A 2F5CA 3V8KA 2EQRA 5FB2A 1G3YA 2QGUA 5DDGA 3S3NA 1IC8A 3GLXA 5EEGA 1FWZA 2EA4A 3ECOA 5BNGA 5H20A 2Y9ZA 3AFHA 3OYDA 4AVZA 2DA2A 1IN8A 2PJRB 4PGGA 2HVQA 1W36D 5K7ZA 3HRMA 1YX3A 4P55A 2XC7A 3B6AA 1IGNA 1RRJA 1C0WA 3Q0VA 1K7AA 3CDIA 4GYIA 5JR3A 2DAOA 2FF4A 2JSCA 2Z16A 3PO2J 4OU0A 3HGYA 3BTCA 3T0YA 4BXXJ 4I09A 4BYYA 1G59A 3ZR8X 3S16J 4E7LA 2ZO4A 3S15J 2UWMA 4HPQA 1UHWA 3KLNA 4HW0A 1OPCA 3JRFA 2BW3A 2Z3YA 1EV7A 3OYMA 1YYVA 3EQLF 5LFAA 4CCLA 3R61A 3DBRB 3BG3A 3M1EA 2VC1A 4XOPA 5KK1A 2W48A 4M74A 3VSKA 3VB2A 2VPLA 4A6DA 2CQXA 1GVJA 2XGXA 3ABTA 4B44A 1OCCH 1Y0NA 1X1AA 2X1EA 3IRQA 2ZSHB 1HC8A 2PQ8A 3K9TA 3H0GJ 3I53A 1K4TA 3GO5A 3HB9A 3K4BA 4U7DA 3JSPA 1N78A 2HGCA 3WU2C 4XLHA 3WU0A 1J7KA 3CTAA 2FOWA 4XN0A 2KZGA 4ESJA 1O3SA 2EBIA 6PAXA 2KP6A 2QVOA 3J80K 4IOCF 3ABUA 4XN3A 3R6SA 4Y13A 1B59A 3I9V2 1T38A 2KIQA 2QQ9A 2JN6A 1XB4A 1V4RA 1R71A 3HG9A 4UNOA 3MZHA 4G94A 2EIJH 1J59A 2BZTA 3H3UA 5D4SA 3M1CA 3JTGA 2E1MB 1DPUA 1MMSA 1WCMJ 2DYRH 5EF6A 5KAIC 2L4AA 2JT1A 3LQQA 1LUJB 2CO5A 3QPTA 4RGXA 4IOAF 1V5GA 1QPIA 4XKVA 4EM1A 1D5VA 2ECBA 4G7OF 5F08A 4IHTA 3CF2A 1O7LA 1DU0A 2DA3A 3LA7A 4XIDA 4K2EA 4B09A 3CC2I 4AIHA 1GXQA 3WTZA 5HLTA 1RR8C 1HSJA 4RB2C 1T8IA 3G3ZA 4ZYHA 1XN7A 3E6MA 1D1CA 4IRHA 3TKYA 4E7SA 4AM3A 1QVTA 1FMWA 2IGNA 4OAZA 1MNEA 4MFEA 4HBLA 3RKWA 3PFIA 2PEXA 3FK6A 4FE7A 4LG0A 3U1KA 5HS9A 1FYKA 4KJZA 1XSXA 1OLTA 4BACA 3BZCA 4C2UA 2XV4S 4M6XA 4PSXA 1OMIA 3ZMZA 2Y2ZA 4OMYA 3EYIA 3MKWB 2V1DA 2O61A 3QU6A 2JK3A 5E3LA 5FD6A 3LA2A 1EA3A 2R7UA 2IVMA 2E5ZA 1WFXA 2K3FA 4RAFA 1REPC 4M3DA 1T0FC 4A5MA 2WB1N 3N4MA 2STWA 2W7NA 4NC6A 4B8XA 3WTUC 2BY1A 4I01A 3W3CA 3OS0A 4IHVA 4UUVA 1TNTA 1JHFA 3LSTA 2HYJA 3F8CA 3S14J 4X6AJ 3KP6A 1JGGA 2FRHA 1FT9A 3TO7A 1D0XA 4ZDOA 1ON1A 3B73A 4IO9F 2K3PA 3BC8A 1ZHFA 2LRDA 4HV6A 1JKPC 4A0XA 4S05A 4C3IJ 1QZEA 2LKPA 3ESWB 4Y33A 2PBIA 4WCGA 3KLOA 1KGSA 3CUQB 3SDGA 1ZAOA 3ELKA 3GFJA 2HZDA 3FM5A 3LSKA 3J7YJ 3QODA 3T5XA 1J5YA 4UXNA 5D4RA 2ZMEA 2QSFX 3OV8A 2AO9A 2G7UA 1UG0A 2DFIA 4U87A 2W84A 3V7SA 4ZYGA 4XLFA 1I27A 3ONQA 3LSPA 4OOIA 4X0GA 2NNYA 1JT0A 1Z7UA 5K5QA 5ILVA 2BYVE 4BL0B 1VNDA 1TTYA 1MDMA 4JX4A 2LOOA 5KCMA 3L2UA 1BIAA 2GIZA 2E36A 2V9VA 2VBWA 3OYIA 4I6ZA 3EYYA 3NWSA 2NVTJ 2HOEA 2PN6A 3GTMJ 1ZRFA 1XC5A 1MJAA 2OC6A 5CYVA 4OIRF 3MN2A 3H1CA 4S0HB 5HLIA 3E6BA 4M6YA 2E35A 5FFZA 2XROA 3H9JA 3CCSI 1PJRA 1N77A 5CKTA 3FDYA 2O7OA 1ETVA 2I5UA 3CCQI 2MBFA 3QRFF 3JAMZ 4AYBA 1G3TA 1Y1WJ 1QRYA 2E19A 3K7AJ 4RGSA 5E1ZB 4RBOA 2C6YA 1BIBA 1WH7A 3Q0UA 3IAS2 1QZYA 4O3MA 1Y0UA 5FLXK 1AKHA 1T33A 1R1TA 3CO7C 4GGGA 2EH3A 2JVGA 2ZSIB 1VQPI 5DYMA 2EWNA 1Z21A 3LAPA 2EFWA 3L2WA 2JUGA 5HLGA 2V79A 3IAM2 4AU7A 4PJNA 1QHGA 5J6XA 3CC4I 4HX4A 4QIWN 3QQAA 2BXYA 2ME6A 4HNTA 1XMKA 4OAYA 2ISYA 1ONVA 3SQNA 4GCVA 4XQFA 2R7OA 1RUOA 2GM4A 3V8JA 1QBJA 2KJCA 4BHPA 1LDJA 2PMUA 2LKXA 2D1VA 4Y3OA 4RM3A 4OINF 5L3EA 1QHHD 3COAC 3ZGKA 2XSJC 1U9NA 3K10A 3LSJA 4O5VA 3DPLC 4RGUA 5DUKA 5F1JA 5B3SH 1OCZH 2HPIA 2B7EA 2EZKA 1S6LA 5E79C 2NXNB 1X1BA 3DPTA 4G6DA 2L9NA 4AWXB 5HDKA 4I99C 5LHHA 2FNAA 3ASOH 3TP0A 3A01B 4GXOA 2UZKA 3BCAA 3PO3J 1H8AC 4EJWA 2H1KA 2H1LA 2NVQJ 1TT5B 1OCTC 3EUAA 2E5NA 2HXOA 2XRNA 1ZREA 1QO0D 1YX5A 2TRTA 2F4OB 1MMGA 2XGDA 3LSMA 3TDUC 2KDOA 5IP6A 1Y8QB 2DQRA 3PQJA 2O3FA 1LVKA 3CJQB 1XG1A 1VQ8I 5FKKA 3GTQJ 2F4MB 3BJOA 3GTKJ 3WU1B 1W0TA 2PI0A 2A5YB 2WY7Q 3GFMA 1FTZA 1NG7A 4YIRX 4E7KA 3BLYA 4XKBA 5GPCA 2FOKA 5FKLA 2PJPA 1NK3P 5M5XJ 2F2EA 1KU9A 2LBFB 3D5SC 2VJ4A 1AU7A 3FXOA 3LFUA 2M5WA 2NYXA 1RUNA 2VE8A 3FXMA 3ZN1A 2ZCWA 4F92B 3I56I 5F1RA 2M0CA 1XGOA 5CQEA 1RKTA 1HW5A 1U78A 5BMZA 1HDDC 2DDBA 5LGTA 1N75A 1JHHA 1IJWC 4LB5A 4PGHA 1WI3A 1R9TJ 2VPRA 2OJED 3DKWA 1IZ1A 2R4GA 4AIJA 2VC0A 5K7FA 5IT9K 2P81A 3QOPA 3S1QJ 3IH2A 3H9GA 3BTIA 3VYRB 2HQAA 2EV6A 1BL0A 4ESBA 4OMZA 3ZQFA 3K4CA 4XRSG 2LK2A 2CSOA 3H36A 3M9AA 5AIQA 4HNVA 5JHFA 3I54A 1ETYA 2HYFA 4KMFA 3HOUJ 2VT3A 1X4OA 2CFXA 5A2QK 1IW7F 1OYWA 2DA5A 1H9TA 2CQKA 3LMMA 2JPCA 2R7ZJ 2WAQA 1RIOH 2GLOA 1Z1DA 4HF0A 4BUPA 4FASD 1E3OC 1T6SA 1QGPA 1HQCA 2NRAC 2HFHA 2CWEA 3DKYA 2UXXA 4HYEA 3H3VK 2MW8A 4E7ZA 3D1NI 1X58A 3A2KA 3GBGA 2QZ8A 2WAFA 2EFQA 2ZFWA 3QPSA 2RKHA 3QU3A 3CMEI 4A3FJ 2MSYA 2MH9A 2M34A 4NDLA 3JRBA 1HCRA 1MD0A 4JP0A 5TRDA 2HQ5A 4ZC3A 2FQ4A 3WGIA 5HDGA 2IS1A 2VL8A 2R5ZA 2FNPA 2PMZA 1P7IA 3NRVA 4NNJA 2JA8J 1FSEA 3MEXA 4YFNF 1ITYA 5K7HA 2OTJI 4PFPA 5E1WA 5D5VB 1XS9A 1OISA 1JTXA 4KN4X 3B6CA 4L9NA 1FJLA 3MZ8A 1Z3YA 5CLSA 2LD5A 3RI4A 1IUFA 2QENA 4XONA 2EIKH 2QM3A 3KX2A 3G73A 3S1NJ 1TWCJ 1OYYA 1O4XA 5KAFC 4D7NA 2IPQX 2MG4A 3HIFA 4EJUA 3GYHX 3ZP5A 1JKQC 3HPGA 2K7LA 3WHCA 4N4NB 2X85A 4ESFA 1G6NA 1J2XA 1SD5A 1SFEA 5CVIA 5DTDA 3L7WA 5E3NA 1YO5C 2ZFUA 1BI2A 3SEZA 1TWGJ 3DF8A 2CG4A 1YITI 4XLPF 4A3CJ 3S2DJ 5IYDJ 3OIPA 3PIPF 2MLKA 1W7PB 1OCOH 5CVVA 2Q0OA 4XM3A 3K4MA 1R58A 1R4MB 1YW8A 3ZMTA 4CUGA 4AUXA 1FX7A 1GV2A 3EUKL 3I5UA 3HZJA 2XDVA 3QPLA 4EATA 4ETSA 3F0CA 3AL0B 1WI9A 3TW7A 2VKEA 1TLHB 2DO7A 2MYSA 2COMA 4U7BA 3GTOJ 4F7ZA 3F8BA 4ZDPA 4L5EA 2IW5A 4CXFA 4XNFA 3CCMI 3S2WA 3H0DA 4CYCA 1WRJA 3LOCA 5E18F 3WGHA 3A0HC 4PDKA 1A31A 3OMYA 3FZVA 1BW5A 2A69F 4W97A 3AAFA 1MJBA 2DT6A 2HOAA 1WSUA 1QU3A 2ZMEC 3JRDA 2XAHA 3F22A 1XSVA 1LFPA 2VQCA 3HDDA 2FU4A 5E20A 1Z6RA 3BQZA 2XIGA 1HSTA 2ZNYA 5EGOB 4PJMA 2PG4A 2F6CA 3DTIA 3PQKA 1J75A 4HV5A 4Z6YA 2DCEA 5EDNA 3A03A 4M3GA 3M3YJ 2OZUA 3CZ6A 3KEQA 2BE5F 4J00A 3HOSA 1MSFC 3IWZA 4A6EA 5LLQA 2BEOA 2Y0SN 1B9MA 4KT6A 2QCOA 3GEZA 4WXDA 3H5RA 3KFWX 2ID6A 4I02A 1TQMA 3P9KA 3GFIA 2QUFA 2ZBKA 2P5KA 2UUZA 1MBJA 3TBIA 2J5OA 2JJ7A 4WF2A 1DP3A 1QQIA 2HR3A 4V19K 1P2FA 5J1RA 4NQWA 3HTSB 1LB2A 4EJTA 2FSWA 2V9KA 2RQPA 2OA4A 4F55A 1JUPA 3CCUI 4I0BA 2QSHX 2LDUA 2P7VB 3WE2A 2QKMB 3I4NJ 4MLOA 3BCBA 5EZHA 2FEZA 3HOWJ 2DTRA 2ICWG 2X6WA 3KP3A 4GO1A 5KVRA 3K4LA 1Z3XA 3DEUA 4BHCA 2OUMA 1FOXA 3BR0A 2X9DA 2WTEA 4MQ9F 1I50J 1AOYA 2ZXHA 3GUDA 4U0VA 4CA0A 5IOZA 3W2VA 4QPQA 1SFUA 2H8WA 1D5YA 1YRNA 4DJAA 4IHWA 2KRFA 4JK1X 2V1UA 2R7WA 4HDUA 4P1WA 3DPUA 4HG2A 4BXFA 5IP9J 3VSLA 3J80Z 1PUFA 1S3JA 3RQ4A 4JYKA 2ECCA 2XF6A 1HW2A 3W6JB 5LRSA 2R3SA 2EZHA 1E2XA 3IKVA 2NOJB 2QKLB 2VQLA 2HDWA 4B47A 2ID3A 5J4VA 4H0EA 3OYNA 1BBYA 4HSTA 1NK2P 2PLYA 3GW2A 4ABZA 2R7XA 3NWTA 2EZLA 4KMUX 1WVRA 1MIJA 1A6IA 3PNTA 3QYBA 2XGCA 4C30A 2CUFA 3RQIA 3WTTC 1X2MA 1K78A 3MVPA 3FXQA 4JOMA 1Y39A 1CF7A 2X0LA 4GRIA 4P96A 4BQOA 2KIUA 3HSEA 2HDDA 2K4JA 3NEUA 1F1ZA 4MIMA 1F4KA 4S04A 3IKTA 1X4PA 3CCRI 3ABMH 1VQ5I 2VB6A 4CCNA 2VLAA 4DYRA 4KYWA 3SZTA 3TEDA 3QYFA 3HRTA 4LK1F 5DEQA 5CVUA 2XB0X 1SFXA 3TP3A 2XF5A 2KMUA 2X6XA 1O3RA 4B1RA 1APLC 3FXKA 5LD2C 3IC7A 3HUGB 2JSPA 5HNFA 1I5ZA 3F8FA 2JA7J 5ILSA 1OR7A 1MH4A 1XTAA 3CCJI 2OQRA 4IZZA 3BTLA 2GBYA 3HKZN 2E1CA 2G0EA 1ZH5A 1DGRM 2LMDA 2LP0A 3K4JA 2L7MP 2YUSA 1HKTA 3DEWA 1Z91A 3BQYA 4XRMA 2WC2A 3CESA 1BR2A 3BR1A 5IP7J 1Q1VA 1LKXA 4U0YA 2A6TA 2QF7A 5D5UB 3OYCA 3SXYA 3HHGA 1KU7A 3OY9A 5TJJA 1H89C 4FX0A 2M7AA 4BJ6C 2P8TA 5DD8A 4IKFA 4HQEA 1U5TA 1YG2A 1X3WB 3L2QA 2WBMA 4LGWA 5CVJA 1GVDA 5CQGA 2XAJA 2FA5A 3MD2A 4ON0A 2JWTA 2VBXA 4OIPF 3MFKA 3ZOBA 3MKYB 2M0MA 2M9HA 4BH9A 3WHBA 3Q5FA 4BBRJ 3EUHC 3RSNA 2MABA 2E34A 2YS9A 5E1XA 1JTYA 5TGTA 4CCJA 1TWFJ 4U88A 2M1BA 1FPQA 4A0ZA 1I3QJ 3TL4X 2K27A 3OR2C 2D5VA 2CJJA 4XSZF 5GAHJ 3DLAA 2DA6A 3OYFA 4X1EA 2LBFA 2FBIA 3IUOA 4Y4RA 4LLGF 1JJ8C 3JRCA 2G9WA 4A3IJ 2ZXJA 1BJAA 1RETA 3M07A 2Q8KA 1STZA 3G1OA 3KP4A 1D3YA 2QBYB 4C2MJ 4IRIA 4KDPA 4CGZA 2P5LC 4BQQA 1ZLJA 5FD5A 2DODA 4MEYF 2VQGA 4WK8F 3HM5A 3HBLA 2GOXB 1RPWA 1KQ8A 5FROA 5L3BA 4WWCA 1K79A 1OCRH 4ENJA 3KYDB 2ZJQF 2D2WA 4DYQA 1BN5A 3GZ5A 2VJJA 2LG4A 4FX4A 1ODDA 3J7ZI 1RC9A 2YR2A 1B4AA 1O3QA 3U2RA 3WTYC 3VPRA 1ZTRA 2RAEA 2GZWA 2L2OA 2NS7A 4DOZA 2R5YA 5FRNA 1IXCA 2KRHA 2PFBA 4ENKA 4JX6A 3FX3A 2XAGA 1FOWA 4E7HA 4RGRA 1YQAA 4EQQA 2E1MC 3TMOA 4ZZDA 2DMQA 2W57A 2WA0A 3BT9A 4LOCA 4CHUA 4A93J 3OL4A 3WODF 2VT2A 2EINH 2CQNA 2IEKA 4ZZLA 4G6TB 2COBA 3IH3A 1IN6A 1HKSA 1SMTA 3F6VA 3OIOA 4C3JJ 4DIQA 2VQHA 3OYHA 3FKIJ 2KIMA 4A12A 4FTHA 1WQ2A 1PUEE 4PFOA 5D5XB 1TWHJ 3I58A 1FBQA 1U6GA 2DU9A 1SVOA 1A04A 1IN7A 1GHCA 2RNJA 1WH5A 4HX8A 3V7RA 4N9IA 2K40A 4N9HA 4EV0A 1FEXA 1SEUA 1SFKA 1LE8A 3I59B 1IN4A 2JMWA 4WXCA 1PVEA 2AQFA 5F04A 5KHDA 2ZJPF 2ME0A 4UHTA 2XGEA 1W36C 2RV8A 2FXAA 2J5PA 3IRRA 5FJ8J 3P9IA 3W2AA 3FISA 2V26A 5IYBJ 4B48A 3L09A 3VYUB 2X1DA 1ZG5A 3K70D 3W6VA 4I2OA 4DZPA 1QPMA 4Q4ZF 2NVUB 1EKEA 2HTSA 3PUFA 3GTPJ 3QWLA 3CCVI 4XLEA 3OSGA 1IO2A 3BTJA 2F5FA 3FBNB 5LBQA 5IYCJ 4R1HA 2M8GX 4FISA 4G7HF 4XLNF 1XSDA 3N05A 3TW6A 5CPRB 3UR3C 5JVTA 3DFGA 4AIDA 4BXUA 4XK4A 2BY2A 4BE2A 4O6JA 2YX7A 3GXOA 2E2JJ 3PSIA 4HNUA 5DCMA 3G2BA 1Z0XA 4HSRA 3VWBA 4Y52J 2Z5UA 2CUEA 4LB6B 1MBKA 1U8BA 3CF5F 1ULYA 1IF1A 2X1CA 5K1YA 2DOEA 2FMLA 3I4PA 4GYGA 5CVRA 1EH8A 3DBLB 4UB8C 1P9QC 5EG0A 2MFZA 2X6OA 2L7KA 4MO7A 2LREA
chains in the Genus database with same CATH topology
2ESNA 4RB1A 3IWFA 1QNTA 5AIPA 2HYGD 1OKRA 1XGSA 2JTVA 1UCRA 1OYIA 1IAWA 5LEKA 3V7CA 2MH2A 1L0OC 3M7GA 4EGYA 2Q2EA 4CYDA 5BPDA 2DPUA 2L4MA 1WKMA 2G7HA 1Z6TA 3LWFA 1R1VA 3Q9VA 3F3XA 2KKOA 5DUIA 5H6QA 1EH7A 1XGMA 4LLLA 5JHUA 3E97A 1RZ4A 4EMSA 3DQVC 3MQ0A 4ENMA 4G6QA 4KICA 3ZMDA 1H0MA 3QPHA 1LDDA 3RJPA 1S29A 3R60A 2ISZA 1XDUA 3WTSC 5D6EA 1SD6A 5HVQC 3VOEA 5L3GA 4EM0B 3F8MA 1LEAA 4M71A 4Q5SF 4ENNA 5D8KB 2H09A 1W7PD 4LMYA 2L02A 2P4WA 4G8XA 1U5TC 2EJRA 3K1PA 2ADUA 1FBUA 1TNSA 5LHGA 4HOBA 3BDDA 2K86A 5K5RA 3LFKA 2O03A 3L00A 1F9NA 2GXGA 3TOAA 3D5LA 1P4XA 4HAMA 4OIQF 2Y0MA 1ZRCA 4LFUA 1W4MA 5D8LB 3FMQA 4XRFA 4L0ZB 1X3UA 1B6AA 4P9FA 1FP1D 3J81Z 1V3FA 2D1HA 4BAYA 2GQQA 1DDNA 5DD4A 4MTDA 3BP8A 5ILUA 2CYYA 4ASNA 2ESHA 2DQLA 5HLHA 2BBYA 5LRRA 2W24A 3EUHA 2P6TA 4KFCA 5LEJA 4R79A 5H6RA 2VN2A 3K1MA 4QLCU 2IA2A 1XCVA 4XBFA 3H92A 1XCBA 1FSHA 3ZMSA 2K02A 3E5QA 4AVPA 2ZKZA 4A0YA 2O8XA 3L9FA 4EGZA 3F21A 2DLLA 4LG0B 1HBXG 3V8LA 4RB0A 1SAXA 1HKQA 2MD5A 3RPQA 2P7CB 1U8RA 2GXBA 1R36A 3DV8A 1I1SA 1E17A 1TW2A 4AIKA 1UFMA 5JI6A 2QYOA 1RI7A 2NS0A 1W5SA 1P4AA 2IJLA 4IJAA 3WE3A 2VODA 2AS5F 5CJ9A 3QP5A 5BOXA 1TQIA 2H27A 2EFOA 3WTXC 1YFHA 1J0RA 2MA3A 5D6FA 3QAHA 3K69A 4ZYEA 2ZMEB 3TGNA 2ELHA 2FBKA 2FMYA 1DP7P 4MQVA 3FF5A 1MDMB 2L01A 2QQBA 1P4WA 1G3WA 3VODA 3WGGA 4RB3C 2EFNA 2LF8A 4G9YA 2ZJ2A 5E8GA 1KU3A 1Z9CA 4I98B 2XASA 3FXRA 4IF4A 2LSOA 5HS8A 5BPIA 1H9GA 3GZ6A 4Y15A 3RKYA 1DPRA 4HDVA 1BC8C 1LDKB 4BNCA 2QQAA 2B0LA 3I71A 3ISPA 3CUQA 1BC7C 3O3KA 2WV0A 4KIBA 3ZMUA 1XD7A 4L18B 3HTUA 3DP7A 1KYWA 3U1DA 1G3SA 2HQNA 2GAUA 2JRTA 3HRSA 3P9CA 3IL2A 4HLXA 4Y17A 4KIFA 3MWMA 3W6KB 2IRFG 2CGPA 5LGUA 2RVCA 2DPDA 3IHUA 3KETA 1GXPA 4YFXF 3SHFA 3ZN0A 3M8EA 2HDCA 5E17F 2KIFA 2A07F 5J8FA 4M73A 4UV8A 5ED4A 2OD5A 3ULQB 3K2ZA 2NNNA 1T98A 2VONA 3ZPLA 4M72A 4RAYA 5LGNA 2L3DA 4D0PA 4JBAA 2BV6A 4I7HA 5ICGA 3C7JA 2RC4A 4L5JA 4L9TA 3WTWC 4BQAA 3FWEA 3VEPA 2IA1A 3TO6A 3FM3A 5ICCA 2AXLA 1TQPA 2RDPA 1FYLA 3KZYA 5FFXA 3I0TA 2P5VA 3C3WA 3CDHA 2TDXA 2GIVA 1KQ0A 4IRGA 4M9XA 4KIGA 2PMHA 1QZZA 1R22A 3LAJA 1FC3A 4UVCA 1BM9A 2YX4A 1Z05A 4FT8A 2A6EF 1YS7A 2OZ6A 2M45A 1U3EM 2W25A 4HF1A 4R8HA 1FOKA 2Y48A 2FQ3A 1FZPB 1I6XA 3F72A 2O6GE 1VTNC 2XHKA 2A6HF 3BROA 3EDPA 5FLXZ 3GVAA 2XKPA 3RPUA 3GX4X 4IVNA 3TO9A 1AWCA 1DUXC 1P92A 3EETA 2DK5A 3N97A 2FE3A 4HZFA 1IRGA 1MJ9A 2JPBA 3F6OA 1O7FA 1I1GA 5EEHA 4KNYA 3BZ6A 5ERIA 3LA3A 2Z33A 2OBPA 3ZMVA 4HLYA 2VOOA 3R0JA 2IT0A 5D5WB 2XVCA 2HZTA 3BPVA 2FBHA 2IP2A 5HS7A 1FY7A 2VXZA 4MGRA 4PCQA 4YFKF 3O2PE 1ZN2A 4L9VA 1D8KA 1HXDA 3ECHA 5DV5A 1ZGAA 1O3TA 2Z9OA 5E8IA 3HYIA 2YSRA 4EM2A 3CO6C 4UVAA 2DBBA 1W7PA 2HKOA 4HA8A 2ACJA 1KYZA 2W85A 2L54A 2EV5A 1EH6A 3BY6A 2KJBA 1ZRDA 1K6OA 5L3FA 2DW4A 4RS8A 5F64A 3K1NA 4ZH4F 4YIFA 4XSXF 1T2KA 1R5GA 5IT9Z 2OU2A 4MNUA 2K4BA 3I64A 1PP7U 1G4DA 3CUQC 3FXUA 4MEXF 5A2QZ 4LD5A 3D0SA 2QWWA 3SZPA 2OQGA 3WTVC 3RYRA 3LQRA 2VBZA 4EVIA 1IXSB 3ERED 2M30A 1ZARA 2Y75A 2P6SA 1BI1A 1KA8A 1NHAA 3E5XA 1IUYA 4CICA 4A2UA 2F5DA 4YG2F 4IXAA 3GWZA 3ROUA 4UV9A 3F8NA 1MKMA 1K78B 4KA4A 1CF7B 2HTJA 4OIOF 1IXRC 5HDNA 4LJZF 2OAZA 2EB7A 3RTRA 2GA2A 2HQRA 2XUBA 3JSOA 3REOA 3HSRA 2VE9A 3KP5A 2V1XA 4M9SA 2M87A 2DT5A 4FHTA 1UB9A 3P7NA 2QLZA 3HHHA 1ZLKA 3M8FA 3CJNA 1FP2A 5FGMA 5HOOA 1R7JA 1TW3A 4QWQA 1MZBA 3QP6A 4ZYDA 1IN5A 3C18A 3JTHA 1FBSA 2M8EA 2E7XA 3OOPA 1B1BA 1U5TB 5LHIA 4IPAA 2LNBA 1J9IA 3V4GA 2Z99A 3CUOA 2DI3A 3SFZA 1B9NA 5F6FA 4BHBA 1S7OA 1BI0A 3TQNA 4WX9A 4LK0F 2RN7A 4L5IA 1RNLA 3HUGA 5BS6A 1R23A 2GWRA 3BJAA 1USSA 3K0LA 4KT5C 2EV0A 3RIRA 2RGVA 1YS6A 3BPXA 3E6DA 1IRFA 4NHJA 3HRUA 3JW4A 1R00A 5FO5A 3R0AA 2UXNA 1YW7A 3GFLA 2E7WA 3RKXA 3T1BA 3VFZA 1T39A 3C1DA 1SMYF 4MHGA 4EJOA 1USTA 2MC3A 1YW9A 3ML6A 2H6BA 2E1NA 4Q47A 4IHSA 3MAJA 3JAMK 4UVBA 1MGTA 2O0YA 1F5TA 2MLGA 4MTEA 2VBYA 2R7DA 2WWYA 1KQ9A 2X4HA 3R4KA 5L3DA 1S8NA 3O6BB 1JE8A 1ZG1A 2ZNZA 3J7AO 1LEBA 1LVAA 2STTA 3HOTA 1SD7A 5IT3A 2QBYA 1YTYA 2XKOA 2F5EA 1FNNA 4L9JA 4KN7X 4CO8A 3L2CA 2BGCA 1LJ9A 3U9GA 3TDZC 5ICEA 3KCCA 5JFRA 2D45A 3BJ6A 1ZYRF 1P6RA 3GF2A 3RYPA 3BOQA 3BWGA 2YU3A 1CGPA 5DCMB 1Q1HA 2XAQA 4RAZA 1FLIA 4NB5A 1L3LA 1FYMA 2HKXA 3FMRA 3KEOA 1R5HA 1PP8F 2HWVA 4CDGA 3B02A 4A5NA 1JGSA 4EJVA 4TV7A 1PDNC 1T0FA 3KZZA 1XGNA 4PZJA 2EK5A 3ZQ7A 2H6CA 3I59A 3KP7A 3T8TA 5L3CA 5K5OA 3J81K 3FHZA 1YLFA 3RDIA 5ICFA 3DXJF 1TBXA 3E6CC 3MCZA 5DCFA 4JQFA 2YPRA 1O57A 4YIIA 1BOAA 2V6CA 1XMAA 4KUMA 1HW1A 4AD9A 1XDSA 3HSFA 3E3VA 1W5TA 4DNCA 4I0AA 2R7FA 1YIOA 1R1UA 4E70A 3WG9A 2H94A 4M9ZA 2ETHA 3FMSA 1LQ1A 3E5UA 3F23A 2EA2A 2A3SA 4Z2YA 2HS5A 3T8RA 4HF2A 4HQMA 1JXSA 2VOPA 1WWXA 1S7AA 3CLOA 3H3ZA 2XAFA 1BI3A 1D8JA 1KU2A 4G7ZF 4CZZA 1ON2A 3KP2A 2JZYA 3KE2A 3MZYA 2A68F 4HX7A 5AONA 2EFPA 4P9UA 4P5OA 4WXHA 4N0BA 5J8CA 2A61A 3NQOA 2DK8A 1U2WA 1ZGJA 2HEOA 4Q48A 1ZG3A 4DQ2A 1LNWA 4U0WA 2IA0A 2GA1A 2NAZA 5BQTA 2CW0F 1SD4A 4L0YB 2LF7A 3TOBA 1UHMA 3Q9SA 4LLNA 2F5CA 3V8KA 5FB2A 1G3YA 5DDGA 3GLXA 5EEGA 1FWZA 2EA4A 3ECOA 5H20A 1IN8A 4PGGA 3HRMA 4P55A 1C0WA 1K7AA 4GYIA 5JR3A 2DAOA 2FF4A 2JSCA 4OU0A 3T0YA 4I09A 4BYYA 2ZO4A 2UWMA 1UHWA 3KLNA 4HW0A 1OPCA 2Z3YA 1EV7A 1YYVA 3EQLF 3R61A 3M1EA 2VC1A 5KK1A 4M74A 3VB2A 4A6DA 1GVJA 2XGXA 3ABTA 3IRQA 2PQ8A 3K9TA 3I53A 3GO5A 4U7DA 3JSPA 2HGCA 3WU0A 1J7KA 3CTAA 4ESJA 1O3SA 6PAXA 2QVOA 3J80K 3ABUA 3R6SA 4Y13A 1B59A 1T38A 2QQ9A 1XB4A 1V4RA 4UNOA 3MZHA 4G94A 1J59A 3H3UA 5D4SA 3JTGA 1DPUA 2L4AA 2JT1A 3LQQA 2CO5A 3QPTA 4RGXA 4EM1A 1D5VA 4G7OF 4IHTA 1O7LA 3LA7A 4K2EA 4B09A 4AIHA 1GXQA 3WTZA 1HSJA 4RB2C 3G3ZA 4ZYHA 1XN7A 3E6MA 4IRHA 3TKYA 3RKWA 4HBLA 3PFIA 2PEXA 4LG0A 5HS9A 1FYKA 1XSXA 2XV4S 4M6XA 3ZMZA 1OMIA 4OMYA 3EYIA 2V1DA 2O61A 3QU6A 5FD6A 3LA2A 2IVMA 1REPC 4A5MA 3N4MA 2STWA 4B8XA 3WTUC 4I01A 4UUVA 1TNTA 1JHFA 3LSTA 3F8CA 3KP6A 2FRHA 1FT9A 3TO7A 1ON1A 3B73A 1ZHFA 4HV6A 4A0XA 4S05A 2LKPA 2PBIA 4WCGA 3KLOA 1KGSA 3CUQB 1ZAOA 3ELKA 3GFJA 3FM5A 3T5XA 1J5YA 4UXNA 5D4RA 2ZMEA 3OV8A 2G7UA 2DFIA 2W84A 3V7SA 4ZYGA 1I27A 4OOIA 2NNYA 1Z7UA 5K5QA 5ILVA 2BYVE 1TTYA 1MDMA 1BIAA 2V9VA 2VBWA 3EYYA 2HOEA 2PN6A 1ZRFA 1MJAA 5CYVA 4OIRF 5HLIA 3E6BA 4M6YA 5FFZA 2XROA 2MBFA 3QRFF 3JAMZ 1G3TA 4RGSA 5E1ZB 2C6YA 1BIBA 4O3MA 1QZYA 1Y0UA 5FLXK 1R1TA 3CO7C 4GGGA 5DYMA 2EWNA 3LAPA 2EFWA 5HLGA 2V79A 5J6XA 4HX4A 1XMKA 2ISYA 1ONVA 3SQNA 4GCVA 1RUOA 3V8JA 1QBJA 2KJCA 4BHPA 1LDJA 2PMUA 2D1VA 4OINF 5L3EA 3COAC 4RGUA 4O5VA 3DPLC 5DUKA 1S6LA 3DPTA 4G6DA 4AWXB 5HDKA 5LHHA 2FNAA 4GXOA 2UZKA 4EJWA 2XRNA 1ZREA 1QO0D 3TDUC 2DQRA 3PQJA 2O3FA 3BJOA 3WU1B 2PI0A 2A5YB 3GFMA 2FOKA 2PJPA 2F2EA 1KU9A 2M5WA 2NYXA 1RUNA 2VE8A 3ZN1A 2ZCWA 5F1RA 1XGOA 1HW5A 1U78A 5BMZA 5LGTA 1JHHA 4LB5A 4PGHA 3DKWA 1IZ1A 4AIJA 2VC0A 5IT9K 3QOPA 2EV6A 4ESBA 4OMZA 2CSOA 3M9AA 5AIQA 3I54A 2HYFA 4KMFA 2VT3A 2CFXA 5A2QK 1IW7F 1OYWA 1H9TA 2CQKA 2JPCA 1RIOH 1Z1DA 4HF0A 1T6SA 1QGPA 1HQCA 2NRAC 2HFHA 2CWEA 2UXXA 4HYEA 2QZ8A 2EFQA 2ZFWA 2RKHA 3QU3A 2MH9A 1MD0A 5TRDA 3WGIA 5HDGA 2FNPA 3NRVA 1FSEA 3MEXA 4YFNF 5E1WA 5D5VB 4KN4X 4L9NA 5CLSA 3RI4A 2QENA 2QM3A 3G73A 1OYYA 4EJUA 2IPQX 3HIFA 3GYHX 3ZP5A 2K7LA 4ESFA 1G6NA 1J2XA 1SD5A 1SFEA 5CVIA 3L7WA 1YO5C 1BI2A 3DF8A 2CG4A 4XLPF 2MLKA 1W7PB 5CVVA 2Q0OA 1R58A 1YW8A 3ZMTA 1FX7A 3I5UA 4ETSA 1WI9A 1TLHB 2DO7A 2COMA 4U7BA 4F7ZA 3F8BA 2IW5A 4CXFA 3S2WA 1WRJA 5E18F 3WGHA 4PDKA 3FZVA 2A69F 3AAFA 1MJBA 1WSUA 2XAHA 3F22A 1XSVA 2FU4A 5E20A 1Z6RA 2XIGA 1HSTA 2ZNYA 2PG4A 1J75A 3PQKA 4HV5A 2OZUA 3KEQA 2BE5F 3HOSA 3IWZA 4A6EA 5LLQA 2BEOA 1B9MA 3GEZA 4WXDA 3KFWX 4I02A 1TQMA 3P9KA 3GFIA 2QUFA 2ZBKA 2P5KA 2J5OA 4WF2A 1QQIA 2HR3A 1P2FA 4NQWA 3HTSB 1LB2A 4EJTA 2FSWA 2RQPA 2OA4A 4I0BA 2LDUA 2P7VB 3WE2A 2FEZA 2DTRA 5KVRA 3KP3A 4GO1A 3DEUA 4BHCA 2WTEA 4MQ9F 1AOYA 4U0VA 3GUDA 1SFUA 2KRFA 4JK1X 2V1UA 4HDUA 3J80Z 1S3JA 1HW2A 3W6JB 5LRSA 2R3SA 1E2XA 3IKVA 4H0EA 1BBYA 2PLYA 3GW2A 4KMUX 3WTTC 1K78A 3FXQA 1CF7A 2X0LA 4P96A 2KIUA 3HSEA 2K4JA 3NEUA 1F1ZA 1F4KA 4S04A 3IKTA 4KYWA 3SZTA 3HRTA 4LK1F 5DEQA 5CVUA 1SFXA 1O3RA 3IC7A 1I5ZA 3F8FA 5ILSA 1OR7A 2OQRA 2E1CA 1ZH5A 1HKTA 1Z91A 2WC2A 4U0YA 5D5UB 3SXYA 3HHGA 1KU7A 5TJJA 4FX0A 2P8TA 5DD8A 4HQEA 1U5TA 1YG2A 4LGWA 5CVJA 2XAJA 2FA5A 4ON0A 2VBXA 4OIPF 3MFKA 4BH9A 3Q5FA 5E1XA 4U88A 2M1BA 1FPQA 4A0ZA 2K27A 4XSZF 2FBIA 4LLGF 2G9WA 2ZXJA 1BJAA 2Q8KA 1STZA 3KP4A 1D3YA 2QBYB 4IRIA 4KDPA 4CGZA 2P5LC 1ZLJA 5FD5A 4MEYF 4WK8F 1KQ8A 5L3BA 4WWCA 1K79A 4ENJA 2D2WA 1BN5A 3GZ5A 4FX4A 1ODDA 2YR2A 1B4AA 1O3QA 3U2RA 3WTYC 2GZWA 1IXCA 2PFBA 4ENKA 3FX3A 2XAGA 4RGRA 1YQAA 4EQQA 4ZZDA 2W57A 4CHUA 3WODF 2VT2A 4ZZLA 1IN6A 1HKSA 1SMTA 3F6VA 2KIMA 4A12A 1WQ2A 1PUEE 5D5XB 3I58A 1FBQA 1U6GA 2DU9A 1IN7A 1A04A 1GHCA 2RNJA 4HX8A 3V7RA 4N9IA 4N9HA 4EV0A 3I59B 1IN4A 4WXCA 4UHTA 2RV8A 2FXAA 2J5PA 3IRRA 3P9IA 3L09A 1ZG5A 4I2OA 1QPMA 4Q4ZF 2HTSA 2F5FA 5LBQA 4R1HA 4G7HF 4XLNF 1XSDA 5JVTA 3DFGA 4BXUA 4O6JA 2YX7A 3GXOA 5DCMA 2Z5UA 4LB6B 1ULYA 1IF1A 5K1YA 2FMLA 3I4PA 4GYGA 5CVRA 1EH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESN A;  4RB1 A;  3IWF A;  1QNT A;  5AIP A;  2HYG D;  1OKR A;  1XGS A;  2JTV A;  1UCR A;  1OYI A;  1IAW A;  5LEK A;  3V7C A;  2MH2 A;  1L0O C;  3M7G A;  4EGY A;  2Q2E A;  4CYD A;  5BPD A;  2DPU A;  2L4M A;  1WKM A;  2G7H A;  1Z6T A;  3LWF A;  1R1V A;  3Q9V A;  3F3X A;  2KKO A;  5DUI A;  5H6Q A;  1EH7 A;  1XGM A;  4LLL A;  5JHU A;  3E97 A;  1RZ4 A;  4EMS A;  3DQV C;  3MQ0 A;  4ENM A;  4G6Q A;  4KIC A;  3ZMD A;  1H0M A;  3QPH A;  1LDD A;  3RJP A;  1S29 A;  3R60 A;  2ISZ A;  1XDU A;  3WTS C;  5D6E A;  1SD6 A;  5HVQ C;  3VOE A;  5L3G A;  4EM0 B;  3F8M A;  1LEA A;  4M71 A;  4Q5S F;  4ENN A;  5D8K B;  2H09 A;  1W7P D;  4LMY A;  2L02 A;  2P4W A;  4G8X A;  1U5T C;  2EJR A;  3K1P A;  2ADU A;  1FBU A;  1TNS A;  5LHG A;  4HOB A;  3BDD A;  2K86 A;  5K5R A;  3LFK A;  2O03 A;  3L00 A;  1F9N A;  2GXG A;  3TOA A;  3D5L A;  1P4X A;  4HAM A;  4OIQ F;  2Y0M A;  1ZRC A;  4LFU A;  1W4M A;  5D8L B;  3FMQ A;  4XRF A;  4L0Z B;  1X3U A;  1B6A A;  4P9F A;  1FP1 D;  3J81 Z;  1V3F A;  2D1H A;  4BAY A;  2GQQ A;  1DDN A;  5DD4 A;  4MTD A;  3BP8 A;  5ILU A;  2CYY A;  4ASN A;  2ESH A;  2DQL A;  5HLH A;  2BBY A;  5LRR A;  2W24 A;  3EUH A;  2P6T A;  4KFC A;  5LEJ A;  4R79 A;  5H6R A;  2VN2 A;  3K1M A;  4QLC U;  2IA2 A;  1XCV A;  4XBF A;  3H92 A;  1XCB A;  1FSH A;  3ZMS A;  2K02 A;  3E5Q A;  4AVP A;  2ZKZ A;  4A0Y A;  2O8X A;  3L9F A;  4EGZ A;  3F21 A;  2DLL A;  4LG0 B;  1HBX G;  3V8L A;  4RB0 A;  1SAX A;  1HKQ A;  2MD5 A;  3RPQ A;  2P7C B;  1U8R A;  2GXB A;  1R36 A;  3DV8 A;  1I1S A;  1E17 A;  1TW2 A;  4AIK A;  1UFM A;  5JI6 A;  2QYO A;  1RI7 A;  2NS0 A;  1W5S A;  1P4A A;  2IJL A;  4IJA A;  3WE3 A;  2VOD A;  2AS5 F;  5CJ9 A;  3QP5 A;  5BOX A;  1TQI A;  2H27 A;  2EFO A;  3WTX C;  1YFH A;  1J0R A;  2MA3 A;  5D6F A;  3QAH A;  3K69 A;  4ZYE A;  2ZME B;  3TGN A;  2ELH A;  2FBK A;  2FMY A;  1DP7 P;  4MQV A;  3FF5 A;  1MDM B;  2L01 A;  2QQB A;  1P4W A;  1G3W A;  3VOD A;  3WGG A;  4RB3 C;  2EFN A;  2LF8 A;  4G9Y A;  2ZJ2 A;  5E8G A;  1KU3 A;  1Z9C A;  4I98 B;  2XAS A;  3FXR A;  4IF4 A;  2LSO A;  5HS8 A;  5BPI A;  1H9G A;  3GZ6 A;  4Y15 A;  3RKY A;  1DPR A;  4HDV A;  1BC8 C;  1LDK B;  4BNC A;  2QQA A;  2B0L A;  3I71 A;  3ISP A;  3CUQ A;  1BC7 C;  3O3K A;  2WV0 A;  4KIB A;  3ZMU A;  1XD7 A;  4L18 B;  3HTU A;  3DP7 A;  1KYW A;  3U1D A;  1G3S A;  2HQN A;  2GAU A;  2JRT A;  3HRS A;  3P9C A;  3IL2 A;  4HLX A;  4Y17 A;  4KIF A;  3MWM A;  3W6K B;  2IRF G;  2CGP A;  5LGU A;  2RVC A;  2DPD A;  3IHU A;  3KET A;  1GXP A;  4YFX F;  3SHF A;  3ZN0 A;  3M8E A;  2HDC A;  5E17 F;  2KIF A;  2A07 F;  5J8F A;  4M73 A;  4UV8 A;  5ED4 A;  2OD5 A;  3ULQ B;  3K2Z A;  2NNN A;  1T98 A;  2VON A;  3ZPL A;  4M72 A;  4RAY A;  5LGN A;  2L3D A;  4D0P A;  4JBA A;  2BV6 A;  4I7H A;  5ICG A;  3C7J A;  2RC4 A;  4L5J A;  4L9T A;  3WTW C;  4BQA A;  3FWE A;  3VEP A;  2IA1 A;  3TO6 A;  3FM3 A;  5ICC A;  2AXL A;  1TQP A;  2RDP A;  1FYL A;  3KZY A;  5FFX A;  3I0T A;  2P5V A;  3C3W A;  3CDH A;  2TDX A;  2GIV A;  1KQ0 A;  4IRG A;  4M9X A;  4KIG A;  2PMH A;  1QZZ A;  1R22 A;  3LAJ A;  1FC3 A;  4UVC A;  1BM9 A;  2YX4 A;  1Z05 A;  4FT8 A;  2A6E F;  1YS7 A;  2OZ6 A;  2M45 A;  1U3E M;  2W25 A;  4HF1 A;  4R8H A;  1FOK A;  2Y48 A;  2FQ3 A;  1FZP B;  1I6X A;  3F72 A;  2O6G E;  1VTN C;  2XHK A;  2A6H F;  3BRO A;  3EDP A;  5FLX Z;  3GVA A;  2XKP A;  3RPU A;  3GX4 X;  4IVN A;  3TO9 A;  1AWC A;  1DUX C;  1P92 A;  3EET A;  2DK5 A;  3N97 A;  2FE3 A;  4HZF A;  1IRG A;  1MJ9 A;  2JPB A;  3F6O A;  1O7F A;  1I1G A;  5EEH A;  4KNY A;  3BZ6 A;  5ERI A;  3LA3 A;  2Z33 A;  2OBP A;  3ZMV A;  4HLY A;  2VOO A;  3R0J A;  2IT0 A;  5D5W B;  2XVC A;  2HZT A;  3BPV A;  2FBH A;  2IP2 A;  5HS7 A;  1FY7 A;  2VXZ A;  4MGR A;  4PCQ A;  4YFK F;  3O2P E;  1ZN2 A;  4L9V A;  1D8K A;  1HXD A;  3ECH A;  5DV5 A;  1ZGA A;  1O3T A;  2Z9O A;  5E8I A;  3HYI A;  2YSR A;  4EM2 A;  3CO6 C;  4UVA A;  2DBB A;  1W7P A;  2HKO A;  4HA8 A;  2ACJ A;  1KYZ A;  2W85 A;  2L54 A;  2EV5 A;  1EH6 A;  3BY6 A;  2KJB A;  1ZRD A;  1K6O A;  5L3F A;  2DW4 A;  4RS8 A;  5F64 A;  3K1N A;  4ZH4 F;  4YIF A;  4XSX F;  1T2K A;  1R5G A;  5IT9 Z;  2OU2 A;  4MNU A;  2K4B A;  3I64 A;  1PP7 U;  1G4D A;  3CUQ C;  3FXU A;  4MEX F;  5A2Q Z;  4LD5 A;  3D0S A;  2QWW A;  3SZP A;  2OQG A;  3WTV C;  3RYR A;  3LQR A;  2VBZ A;  4EVI A;  1IXS B;  3ERE D;  2M30 A;  1ZAR A;  2Y75 A;  2P6S A;  1BI1 A;  1KA8 A;  1NHA A;  3E5X A;  1IUY A;  4CIC A;  4A2U A;  2F5D A;  4YG2 F;  4IXA A;  3GWZ A;  3ROU A;  4UV9 A;  3F8N A;  1MKM A;  1K78 B;  4KA4 A;  1CF7 B;  2HTJ A;  4OIO F;  1IXR C;  5HDN A;  4LJZ F;  2OAZ A;  2EB7 A;  3RTR A;  2GA2 A;  2HQR A;  2XUB A;  3JSO A;  3REO A;  3HSR A;  2VE9 A;  3KP5 A;  2V1X A;  4M9S A;  2M87 A;  2DT5 A;  4FHT A;  1UB9 A;  3P7N A;  2QLZ A;  3HHH A;  1ZLK A;  3M8F A;  3CJN A;  1FP2 A;  5FGM A;  5HOO A;  1R7J A;  1TW3 A;  4QWQ A;  1MZB A;  3QP6 A;  4ZYD A;  1IN5 A;  3C18 A;  3JTH A;  1FBS A;  2M8E A;  2E7X A;  3OOP A;  1B1B A;  1U5T B;  5LHI A;  4IPA A;  2LNB A;  1J9I A;  3V4G A;  2Z99 A;  3CUO A;  2DI3 A;  3SFZ A;  1B9N A;  5F6F A;  4BHB A;  1S7O A;  1BI0 A;  3TQN A;  4WX9 A;  4LK0 F;  2RN7 A;  4L5I A;  1RNL A;  3HUG A;  5BS6 A;  1R23 A;  2GWR A;  3BJA A;  1USS A;  3K0L A;  4KT5 C;  2EV0 A;  3RIR A;  2RGV A;  1YS6 A;  3BPX A;  3E6D A;  1IRF A;  4NHJ A;  3HRU A;  3JW4 A;  1R00 A;  5FO5 A;  3R0A A;  2UXN A;  1YW7 A;  3GFL A;  2E7W A;  3RKX A;  3T1B A;  3VFZ A;  1T39 A;  3C1D A;  1SMY F;  4MHG A;  4EJO A;  1UST A;  2MC3 A;  1YW9 A;  3ML6 A;  2H6B A;  2E1N A;  4Q47 A;  4IHS A;  3MAJ A;  3JAM K;  4UVB A;  1MGT A;  2O0Y A;  1F5T A;  2MLG A;  4MTE A;  2VBY A;  2R7D A;  2WWY A;  1KQ9 A;  2X4H A;  3R4K A;  5L3D A;  1S8N A;  3O6B B;  1JE8 A;  1ZG1 A;  2ZNZ A;  3J7A O;  1LEB A;  1LVA A;  2STT A;  3HOT A;  1SD7 A;  5IT3 A;  2QBY A;  1YTY A;  2XKO A;  2F5E A;  1FNN A;  4L9J A;  4KN7 X;  4CO8 A;  3L2C A;  2BGC A;  1LJ9 A;  3U9G A;  3TDZ C;  5ICE A;  3KCC A;  5JFR A;  2D45 A;  3BJ6 A;  1ZYR F;  1P6R A;  3GF2 A;  3RYP A;  3BOQ A;  3BWG A;  2YU3 A;  1CGP A;  5DCM B;  1Q1H A;  2XAQ A;  4RAZ A;  1FLI A;  4NB5 A;  1L3L A;  1FYM A;  2HKX A;  3FMR A;  3KEO A;  1R5H A;  1PP8 F;  2HWV A;  4CDG A;  3B02 A;  4A5N A;  1JGS A;  4EJV A;  4TV7 A;  1PDN C;  1T0F A;  3KZZ A;  1XGN A;  4PZJ A;  2EK5 A;  3ZQ7 A;  2H6C A;  3I59 A;  3KP7 A;  3T8T A;  5L3C A;  5K5O A;  3J81 K;  3FHZ A;  1YLF A;  3RDI A;  5ICF A;  3DXJ F;  1TBX A;  3E6C C;  3MCZ A;  5DCF A;  4JQF A;  2YPR A;  1O57 A;  4YII A;  1BOA A;  2V6C A;  1XMA A;  4KUM A;  1HW1 A;  4AD9 A;  1XDS A;  3HSF A;  3E3V A;  1W5T A;  4DNC A;  4I0A A;  2R7F A;  1YIO A;  1R1U A;  4E70 A;  3WG9 A;  2H94 A;  4M9Z A;  2ETH A;  3FMS A;  1LQ1 A;  3E5U A;  3F23 A;  2EA2 A;  2A3S A;  4Z2Y A;  2HS5 A;  3T8R A;  4HF2 A;  4HQM A;  1JXS A;  2VOP A;  1WWX A;  1S7A A;  3CLO A;  3H3Z A;  2XAF A;  1BI3 A;  1D8J A;  1KU2 A;  4G7Z F;  4CZZ A;  1ON2 A;  3KP2 A;  2JZY A;  3KE2 A;  3MZY A;  2A68 F;  4HX7 A;  5AON A;  2EFP A;  4P9U A;  4P5O A;  4WXH A;  4N0B A;  5J8C A;  2A61 A;  3NQO A;  2DK8 A;  1U2W A;  1ZGJ A;  2HEO A;  4Q48 A;  1ZG3 A;  4DQ2 A;  1LNW A;  4U0W A;  2IA0 A;  2GA1 A;  2NAZ A;  5BQT A;  2CW0 F;  1SD4 A;  4L0Y B;  2LF7 A;  3TOB A;  1UHM A;  3Q9S A;  4LLN A;  2F5C A;  3V8K A;  5FB2 A;  1G3Y A;  5DDG A;  3GLX A;  5EEG A;  1FWZ A;  2EA4 A;  3ECO A;  5H20 A;  1IN8 A;  4PGG A;  3HRM A;  4P55 A;  1C0W A;  1K7A A;  4GYI A;  5JR3 A;  2DAO A;  2FF4 A;  2JSC A;  4OU0 A;  3T0Y A;  4I09 A;  4BYY A;  2ZO4 A;  2UWM A;  1UHW A;  3KLN A;  4HW0 A;  1OPC A;  2Z3Y A;  1EV7 A;  1YYV A;  3EQL F;  3R61 A;  3M1E A;  2VC1 A;  5KK1 A;  4M74 A;  3VB2 A;  4A6D A;  1GVJ A;  2XGX A;  3ABT A;  3IRQ A;  2PQ8 A;  3K9T A;  3I53 A;  3GO5 A;  4U7D A;  3JSP A;  2HGC A;  3WU0 A;  1J7K A;  3CTA A;  4ESJ A;  1O3S A;  6PAX A;  2QVO A;  3J80 K;  3ABU A;  3R6S A;  4Y13 A;  1B59 A;  1T38 A;  2QQ9 A;  1XB4 A;  1V4R A;  4UNO A;  3MZH A;  4G94 A;  1J59 A;  3H3U A;  5D4S A;  3JTG A;  1DPU A;  2L4A A;  2JT1 A;  3LQQ A;  2CO5 A;  3QPT A;  4RGX A;  4EM1 A;  1D5V A;  4G7O F;  4IHT A;  1O7L A;  3LA7 A;  4K2E A;  4B09 A;  4AIH A;  1GXQ A;  3WTZ A;  1HSJ A;  4RB2 C;  3G3Z A;  4ZYH A;  1XN7 A;  3E6M A;  4IRH A;  3TKY A;  3RKW A;  4HBL A;  3PFI A;  2PEX A;  4LG0 A;  5HS9 A;  1FYK A;  1XSX A;  2XV4 S;  4M6X A;  3ZMZ A;  1OMI A;  4OMY A;  3EYI A;  2V1D A;  2O61 A;  3QU6 A;  5FD6 A;  3LA2 A;  2IVM A;  1REP C;  4A5M A;  3N4M A;  2STW A;  4B8X A;  3WTU C;  4I01 A;  4UUV A;  1TNT A;  1JHF A;  3LST A;  3F8C A;  3KP6 A;  2FRH A;  1FT9 A;  3TO7 A;  1ON1 A;  3B73 A;  1ZHF A;  4HV6 A;  4A0X A;  4S05 A;  2LKP A;  2PBI A;  4WCG A;  3KLO A;  1KGS A;  3CUQ B;  1ZAO A;  3ELK A;  3GFJ A;  3FM5 A;  3T5X A;  1J5Y A;  4UXN A;  5D4R A;  2ZME A;  3OV8 A;  2G7U A;  2DFI A;  2W84 A;  3V7S A;  4ZYG A;  1I27 A;  4OOI A;  2NNY A;  1Z7U A;  5K5Q A;  5ILV A;  2BYV E;  1TTY A;  1MDM A;  1BIA A;  2V9V A;  2VBW A;  3EYY A;  2HOE A;  2PN6 A;  1ZRF A;  1MJA A;  5CYV A;  4OIR F;  5HLI A;  3E6B A;  4M6Y A;  5FFZ A;  2XRO A;  2MBF A;  3QRF F;  3JAM Z;  1G3T A;  4RGS A;  5E1Z B;  2C6Y A;  1BIB A;  4O3M A;  1QZY A;  1Y0U A;  5FLX K;  1R1T A;  3CO7 C;  4GGG A;  5DYM A;  2EWN A;  3LAP A;  2EFW A;  5HLG A;  2V79 A;  5J6X A;  4HX4 A;  1XMK A;  2ISY A;  1ONV A;  3SQN A;  4GCV A;  1RUO A;  3V8J A;  1QBJ A;  2KJC A;  4BHP A;  1LDJ A;  2PMU A;  2D1V A;  4OIN F;  5L3E A;  3COA C;  4RGU A;  4O5V A;  3DPL C;  5DUK A;  1S6L A;  3DPT A;  4G6D A;  4AWX B;  5HDK A;  5LHH A;  2FNA A;  4GXO A;  2UZK A;  4EJW A;  2XRN A;  1ZRE A;  1QO0 D;  3TDU C;  2DQR A;  3PQJ A;  2O3F A;  3BJO A;  3WU1 B;  2PI0 A;  2A5Y B;  3GFM A;  2FOK A;  2PJP A;  2F2E A;  1KU9 A;  2M5W A;  2NYX A;  1RUN A;  2VE8 A;  3ZN1 A;  2ZCW A;  5F1R A;  1XGO A;  1HW5 A;  1U78 A;  5BMZ A;  5LGT A;  1JHH A;  4LB5 A;  4PGH A;  3DKW A;  1IZ1 A;  4AIJ A;  2VC0 A;  5IT9 K;  3QOP A;  2EV6 A;  4ESB A;  4OMZ A;  2CSO A;  3M9A A;  5AIQ A;  3I54 A;  2HYF A;  4KMF A;  2VT3 A;  2CFX A;  5A2Q K;  1IW7 F;  1OYW A;  1H9T A;  2CQK A;  2JPC A;  1RIO H;  1Z1D A;  4HF0 A;  1T6S A;  1QGP A;  1HQC A;  2NRA C;  2HFH A;  2CWE A;  2UXX A;  4HYE A;  2QZ8 A;  2EFQ A;  2ZFW A;  2RKH A;  3QU3 A;  2MH9 A;  1MD0 A;  5TRD A;  3WGI A;  5HDG A;  2FNP A;  3NRV A;  1FSE A;  3MEX A;  4YFN F;  5E1W A;  5D5V B;  4KN4 X;  4L9N A;  5CLS A;  3RI4 A;  2QEN A;  2QM3 A;  3G73 A;  1OYY A;  4EJU A;  2IPQ X;  3HIF A;  3GYH X;  3ZP5 A;  2K7L A;  4ESF A;  1G6N A;  1J2X A;  1SD5 A;  1SFE A;  5CVI A;  3L7W A;  1YO5 C;  1BI2 A;  3DF8 A;  2CG4 A;  4XLP F;  2MLK A;  1W7P B;  5CVV A;  2Q0O A;  1R58 A;  1YW8 A;  3ZMT A;  1FX7 A;  3I5U A;  4ETS A;  1WI9 A;  1TLH B;  2DO7 A;  2COM A;  4U7B A;  4F7Z A;  3F8B A;  2IW5 A;  4CXF A;  3S2W A;  1WRJ A;  5E18 F;  3WGH A;  4PDK A;  3FZV A;  2A69 F;  3AAF A;  1MJB A;  1WSU A;  2XAH A;  3F22 A;  1XSV A;  2FU4 A;  5E20 A;  1Z6R A;  2XIG A;  1HST A;  2ZNY A;  2PG4 A;  1J75 A;  3PQK A;  4HV5 A;  2OZU A;  3KEQ A;  2BE5 F;  3HOS A;  3IWZ A;  4A6E A;  5LLQ A;  2BEO A;  1B9M A;  3GEZ A;  4WXD A;  3KFW X;  4I02 A;  1TQM A;  3P9K A;  3GFI A;  2QUF A;  2ZBK A;  2P5K A;  2J5O A;  4WF2 A;  1QQI A;  2HR3 A;  1P2F A;  4NQW A;  3HTS B;  1LB2 A;  4EJT A;  2FSW A;  2RQP A;  2OA4 A;  4I0B A;  2LDU A;  2P7V B;  3WE2 A;  2FEZ A;  2DTR A;  5KVR A;  3KP3 A;  4GO1 A;  3DEU A;  4BHC A;  2WTE A;  4MQ9 F;  1AOY A;  4U0V A;  3GUD A;  1SFU A;  2KRF A;  4JK1 X;  2V1U A;  4HDU A;  3J80 Z;  1S3J A;  1HW2 A;  3W6J B;  5LRS A;  2R3S A;  1E2X A;  3IKV A;  4H0E A;  1BBY A;  2PLY A;  3GW2 A;  4KMU X;  3WTT C;  1K78 A;  3FXQ A;  1CF7 A;  2X0L A;  4P96 A;  2KIU A;  3HSE A;  2K4J A;  3NEU A;  1F1Z A;  1F4K A;  4S04 A;  3IKT A;  4KYW A;  3SZT A;  3HRT A;  4LK1 F;  5DEQ A;  5CVU A;  1SFX A;  1O3R A;  3IC7 A;  1I5Z A;  3F8F A;  5ILS A;  1OR7 A;  2OQR A;  2E1C A;  1ZH5 A;  1HKT A;  1Z91 A;  2WC2 A;  4U0Y A;  5D5U B;  3SXY A;  3HHG A;  1KU7 A;  5TJJ A;  4FX0 A;  2P8T A;  5DD8 A;  4HQE A;  1U5T A;  1YG2 A;  4LGW A;  5CVJ A;  2XAJ A;  2FA5 A;  4ON0 A;  2VBX A;  4OIP F;  3MFK A;  4BH9 A;  3Q5F A;  5E1X A;  4U88 A;  2M1B A;  1FPQ A;  4A0Z A;  2K27 A;  4XSZ F;  2FBI A;  4LLG F;  2G9W A;  2ZXJ A;  1BJA A;  2Q8K A;  1STZ A;  3KP4 A;  1D3Y A;  2QBY B;  4IRI A;  4KDP A;  4CGZ A;  2P5L C;  1ZLJ A;  5FD5 A;  4MEY F;  4WK8 F;  1KQ8 A;  5L3B A;  4WWC A;  1K79 A;  4ENJ A;  2D2W A;  1BN5 A;  3GZ5 A;  4FX4 A;  1ODD A;  2YR2 A;  1B4A A;  1O3Q A;  3U2R A;  3WTY C;  2GZW A;  1IXC A;  2PFB A;  4ENK A;  3FX3 A;  2XAG A;  4RGR A;  1YQA A;  4EQQ A;  4ZZD A;  2W57 A;  4CHU A;  3WOD F;  2VT2 A;  4ZZL A;  1IN6 A;  1HKS A;  1SMT A;  3F6V A;  2KIM A;  4A12 A;  1WQ2 A;  1PUE E;  5D5X B;  3I58 A;  1FBQ A;  1U6G A;  2DU9 A;  1IN7 A;  1A04 A;  1GHC A;  2RNJ A;  4HX8 A;  3V7R A;  4N9I A;  4N9H A;  4EV0 A;  3I59 B;  1IN4 A;  4WXC A;  4UHT A;  2RV8 A;  2FXA A;  2J5P A;  3IRR A;  3P9I A;  3L09 A;  1ZG5 A;  4I2O A;  1QPM A;  4Q4Z F;  2HTS A;  2F5F A;  5LBQ A;  4R1H A;  4G7H F;  4XLN F;  1XSD A;  5JVT A;  3DFG A;  4BXU A;  4O6J A;  2YX7 A;  3GXO A;  5DCM A;  2Z5U A;  4LB6 B;  1ULY A;  1IF1 A;  5K1Y A;  2FML A;  3I4P A;  4GYG A;  5CVR A;  1EH8 A; 
#chains in the Genus database with same CATH topology
 1MNM C;  4XIC A;  2ESN A;  4RB1 A;  5DM6 F;  5JVG F;  3J7A Y;  3IWF A;  1ZR4 A;  3DWL E;  1W0U A;  1JT6 A;  3RPU D;  3KIO A;  2TCT A;  1QNT A;  5AIP A;  1A36 A;  2HYG D;  3K4N A;  1OKR A;  1XGS A;  2JTV A;  3CCL I;  3SZG A;  1UCR A;  3CC7 I;  1OYI A;  1IAW A;  5LEK A;  1B72 B;  1VQ9 I;  2Y9Y A;  2MH2 A;  1L0O C;  3V7C A;  4CSW A;  3OOU A;  3M7G A;  3P5J A;  4EGY A;  2Q2E A;  4CYD A;  5BPD A;  2DPU A;  1V55 H;  3L1P A;  1JUS A;  1EF4 A;  2L4M A;  1WJA A;  1WKM A;  5EYR A;  4BE0 A;  4AYB N;  2G7H A;  1SC7 A;  1Z6T A;  3LWF A;  1R1V A;  1E3P A;  3Q9V A;  2ZB9 A;  2I8D A;  3F3X A;  1S7E A;  2KKO A;  1VQ6 I;  2M7B A;  5DUI A;  1WGX A;  1MBF A;  5H6Q A;  1EH7 A;  1IV8 A;  1XGM A;  3ZCO A;  5J1Y A;  4LLL A;  1ZKG A;  2DJN A;  5JHU A;  3E97 A;  1OR7 C;  4ZDL A;  1RZ4 A;  4EMS A;  3DQV C;  3MQ0 A;  4ENM A;  4G6Q A;  4KIC A;  3ZMD A;  1YIJ I;  1H0M A;  3QPH A;  1LDD A;  3RJP A;  1MND A;  3AKZ A;  2KZV A;  2BVL A;  1SVL A;  1S29 A;  1Y8R B;  2IXS A;  4RDU A;  4JX5 A;  3R60 A;  2ISZ A;  1XDU A;  1KON A;  3WTS C;  5D6E A;  2A05 A;  1X1C A;  5M3M J;  1SD6 A;  2CMP A;  4N4O B;  3VOE A;  5HVQ C;  5L3G A;  4EM0 B;  2K9S A;  3F8M A;  2X51 A;  1LEA A;  2CQQ A;  4M71 A;  3HOY J;  4Q5S F;  4FET A;  4ENN A;  4IL6 C;  5D8K B;  2H09 A;  1B8I A;  1W7P D;  4LMY A;  2L02 A;  1U9O A;  3MMY B;  2P4W A;  4G8X A;  1U5T C;  2EJR A;  2W82 A;  4F93 B;  3OYG A;  2LY2 A;  3K1P A;  2ADU A;  1FBU A;  1TNS A;  5LHG A;  4HOB A;  1K61 A;  3BDD A;  2K86 A;  5K5R A;  3K70 C;  2BW3 B;  3LFK A;  3PJR A;  2L0K A;  2O03 A;  1UHS A;  3L00 A;  1F9N A;  2GXG A;  4B3A A;  4BDY A;  2LVS A;  3TOA A;  1WJF A;  1P4X A;  3D5L A;  4HAM A;  4OIQ F;  2QA4 I;  2Y0M A;  1AA7 A;  4LFU A;  1ZRC A;  1W4M A;  5D8L B;  3FMQ A;  4XRF A;  5EJC A;  4L0Z B;  1X3U A;  1B6A A;  1MW7 A;  4P9F A;  5EZG A;  2ZC2 A;  1FP1 D;  3CJT B;  4LIV A;  4OWR B;  2DT7 B;  1GT0 C;  1V3F A;  2D1H A;  3J81 Z;  4BAY A;  2GQQ A;  1DDN A;  3CQZ J;  4XKW A;  5DD4 A;  4MTD A;  2DMN A;  2R0Q C;  3BP8 A;  4ANJ A;  1DU6 A;  2KPM A;  5ILU A;  2CYY A;  2KQR A;  4ASN A;  2ESH A;  2L7Z A;  5H2F C;  2DQL A;  5HLH A;  2BBY A;  5LRR A;  3CMA I;  1A35 A;  1VQ7 I;  1BW6 A;  2W24 A;  3EUH A;  2P6T A;  5GTI C;  4KFC A;  3PUB A;  5LEJ A;  2UV1 A;  4R79 A;  5H6R A;  3GCM A;  2VN2 A;  3K1M A;  4QLC U;  2PJR A;  1QA6 A;  4XMY A;  2IA2 A;  1XCV A;  3BG7 A;  3PNV A;  4XBF A;  4IX7 A;  3GLL A;  3AG2 H;  3NAR A;  4RMN A;  2JUC A;  3C2G A;  3H92 A;  5E3M A;  1XCB A;  4RM2 A;  2MGQ A;  1FSH A;  4YRV A;  3ZMS A;  2K02 A;  3E5Q A;  4AVP A;  2ZKZ A;  1OJL A;  4A0Y A;  2OCC H;  2O8X A;  3L9F A;  2NVX J;  1I6H J;  4EGZ A;  3F21 A;  4NC7 A;  2L9V A;  2HOS A;  2DLL A;  2VUM J;  3JR9 A;  4LG0 B;  1HBX G;  2PMZ N;  1UMQ A;  3V8L A;  1WZ2 A;  1WJC A;  2DMU A;  2KFD A;  4RB0 A;  1SAX A;  4RLF A;  1HKQ A;  2MD5 A;  3RPQ A;  5GTH C;  1YHQ I;  2P7C B;  2NS8 A;  1U8R A;  2GXB A;  1R36 A;  3DV8 A;  1I1S A;  2M2E A;  1E17 A;  4A3J J;  1TW2 A;  5KNL A;  4AIK A;  3H5N A;  1ETW A;  1UFM A;  3CCE I;  2KT0 A;  5JI6 A;  2LKS A;  2QYO A;  4XKC A;  1RI7 A;  1Y1V J;  2NS0 A;  2DMT A;  1W5S A;  1P4A A;  4I76 A;  4DW6 A;  2IJL A;  4UB6 C;  2VXD A;  3RKQ A;  4IJA A;  4B3X A;  3WE3 A;  1SAN A;  1CQT A;  3GTJ J;  2VOD A;  4PSW A;  1YOV B;  2AS5 F;  3BG9 A;  1TWA J;  5CJ9 A;  3QP5 A;  5F0H A;  2O5R A;  5BOX A;  4PK4 A;  1TQI A;  4BY1 J;  2H27 A;  3S8P A;  2EFO A;  3WTX C;  3OS2 A;  3W2W A;  4IQJ A;  3ZXS A;  4BE1 A;  2JA2 A;  1YFH A;  3S1M J;  1J0R A;  2MA3 A;  2DXI A;  5D6F A;  3QAH A;  2EPF A;  3K69 A;  2DN0 A;  4ZYE A;  4ZTJ A;  2ZME B;  1T08 B;  3AL0 C;  4F52 A;  1R5I D;  3TGN A;  2ELH A;  2FBK A;  1WJB A;  2FMY A;  2FJ1 A;  2CUZ A;  4MQV A;  1DP7 P;  3FF5 A;  1Z7L A;  1X19 A;  1FMV A;  2DJI A;  1HDP A;  5M5Y J;  4D5F A;  3OYA A;  1MDM B;  1ACI A;  2L01 A;  3JRG A;  3RZO J;  2QQB A;  4A3E J;  3CDL A;  3DEE A;  2R7R A;  4CCK A;  5IY5 H;  1P4W A;  1VQ4 I;  3CP2 A;  2Z2S B;  4HEA 2;  1G3W A;  2HXI A;  3VOD A;  3WGG A;  4RB3 C;  2JA5 J;  2EFN A;  2LF8 A;  4G9Y A;  2ZJ2 A;  5E8G A;  4M3B A;  4ITV A;  1KU3 A;  3G6E I;  1AHD P;  1Z9C A;  1I3A A;  4I98 B;  2XAS A;  3FXR A;  4IF4 A;  2LSO A;  1JUM A;  3RCO A;  5HS8 A;  3CJR B;  1XMX A;  4BY7 J;  2VJ5 A;  5BPI A;  3PSF A;  1AKH B;  1H9G A;  3GZ6 A;  2KL4 A;  4Y15 A;  3RKY A;  1BR4 A;  1DPR A;  4HDV A;  1QVU A;  3DCF A;  4H4K C;  1LDK B;  1BC8 C;  4BNC A;  3CMM A;  2QQA A;  2DOF A;  2B0L A;  1F36 A;  2DA1 A;  3I71 A;  2F4I A;  3L2R A;  3ISP A;  3CUQ A;  2XAU A;  1BC7 C;  3O3K A;  2WV0 A;  2V6E A;  1ZQ3 P;  3OWT A;  1K83 J;  1FOY A;  4YEL A;  1JKO C;  4KIB A;  4NC8 A;  3O8H A;  3ZMU A;  2CW7 A;  1XD7 A;  3ZRG A;  4IQ4 A;  3ABK H;  5J47 A;  1HLV A;  4L18 B;  4D9J A;  3HTU A;  3PL8 A;  1A5J A;  3G1M A;  2LYC A;  2HU9 A;  1FIP A;  2XPW A;  5B1A H;  3DP7 A;  1KYW A;  1SFO J;  3SFI A;  1DQU A;  3U1D A;  1YJN I;  1G3S A;  2E1O A;  3FXJ A;  1S5L C;  2B63 J;  2HQN A;  2GAU A;  2JRT A;  5F27 A;  3HRS A;  3P9C A;  3IL2 A;  4HLX A;  4Y17 A;  2W00 A;  3E1S A;  3D5R C;  1VQN I;  4KIF A;  4A3B J;  1VFC A;  2HVS A;  1OQY A;  3OYK A;  2X6Y A;  3U21 A;  2DFE A;  2DA4 A;  4A3L J;  3MWM A;  4E4H A;  4UUT A;  3W6K B;  2DYS H;  2IRF G;  2CGP A;  5LGU A;  1MH3 A;  4BKX A;  2RVC A;  2DPD A;  3A1Y A;  3IHU A;  5DM7 F;  2XPV A;  3VYT B;  2GOM A;  3KET A;  1GXP A;  4YFX F;  3SHF A;  2HNH A;  3ZN0 A;  1IG7 A;  3KEY A;  2WAE A;  3M8E A;  2HDC A;  5E17 F;  2KIF A;  1RKW A;  2A07 F;  3CD6 I;  4II2 A;  1WJE A;  1ENH A;  5J8F A;  4M73 A;  2LLK A;  4B4C A;  2E2I J;  2DTZ A;  4UV8 A;  5ED4 A;  2OD5 A;  3ULQ B;  3K2Z A;  2XPU A;  1LFB A;  3HXL A;  3ZQC A;  2NNN A;  4D7M A;  1FIA A;  1T98 A;  4IHY A;  3ABL H;  2VON A;  3ASN H;  3ZPL A;  4M72 A;  4RAY A;  4C3H J;  5LGN A;  2L3D A;  4NBQ A;  3K2A A;  4D0P A;  3GTG J;  4XR6 A;  4JBA A;  2H8R A;  2BV6 A;  3HOZ J;  4I7H A;  5ICG A;  3PM1 A;  3IV5 A;  3C7J A;  2CS3 A;  2LTP A;  3AG3 H;  4BJ5 C;  2RC4 A;  2YU9 J;  4L5J A;  4PJJ A;  3ZQL A;  1UJ8 A;  4MFD A;  2F5V A;  1SAU A;  2WY8 Q;  4PJ0 C;  2VI6 A;  1X1D A;  4L9T A;  3WTW C;  4BQA A;  4XL9 A;  2FX0 A;  2JVH A;  2NVY J;  3FWE A;  2IS2 A;  2LC2 A;  2HVR A;  4XOR A;  2NOG A;  4J01 A;  3VEP A;  1GUU A;  2IA1 A;  3A01 A;  3TO6 A;  3FM3 A;  5ICC A;  2AXL A;  2N8G A;  3AG1 H;  1TQP A;  2RDP A;  1FYL A;  1ZGW A;  1G2H A;  5C44 J;  2VIX A;  1IRX A;  3KZY A;  5FFX A;  3I0T A;  2P5V A;  3C3W A;  3CDH A;  1T95 A;  2TDX A;  2GIV A;  4LIT A;  1KQ0 A;  4PJL A;  4IRG A;  4M9X A;  4KIG A;  2PMH A;  2E71 A;  1QZZ A;  2R7Q A;  4V2G A;  2VKH A;  1R22 A;  2X48 A;  2R5Z B;  3LAJ A;  2BY0 A;  4ZJZ A;  1FC3 A;  4UVC A;  1BM9 A;  2W4S A;  2YX4 A;  3FKJ A;  1ORK A;  1Z05 A;  1D1B A;  3I55 I;  4FT8 A;  2A6E F;  2DOA A;  4J19 A;  1YS7 A;  2OZ6 A;  2M45 A;  2QEX I;  4C2T A;  1U3E M;  3LL7 A;  2W25 A;  1IDY A;  4HF1 A;  2M4K A;  4R8H A;  1FOK A;  2Z1D A;  3UNG C;  2OTL I;  2Y48 A;  2FQ3 A;  3QYE A;  1WJ5 A;  2V1N A;  5TIS C;  1WJD A;  1FZP B;  1I6X A;  3F72 A;  2O6G E;  1VTN C;  1Z67 A;  2XHK A;  4G12 A;  1V5E A;  3H35 A;  1LFU P;  2CV0 A;  1Y56 A;  2A6H F;  1ZR2 A;  1F43 A;  3BRO A;  3LSR A;  1HA8 A;  5J1U A;  1J09 A;  3EDP A;  5FLX Z;  3GVA A;  2XKP A;  3RPU A;  3GX4 X;  4QTR A;  4ZTF A;  1E0E A;  4IVN A;  2Y30 A;  3TO9 A;  1AWC A;  4M3F A;  5J4Y A;  1DUX C;  1P92 A;  3EET A;  2DK5 A;  3N97 A;  3S3O A;  2FE3 A;  1T56 A;  3GME A;  4HZF A;  3JRI A;  1IRG A;  4NUB A;  4BS9 A;  3ERM A;  1MJ9 A;  2JPB A;  3F6O A;  2PX9 A;  1O7F A;  2KDZ A;  2K9Q A;  1I1G A;  5EEH A;  4KNY A;  9ANT A;  2IGM A;  3BZ6 A;  4RA2 A;  2A5W A;  2RQQ A;  5ERI A;  1I39 A;  4QPO A;  1ZK8 A;  3JRE A;  1NH3 A;  4CYC B;  1HF0 A;  3LA3 A;  2Q1Z B;  4XOT A;  2Z33 A;  1OCP A;  2CW8 A;  2CH0 A;  1ETX A;  1W1W E;  3OYB A;  4E7I A;  4BQN A;  2OBP A;  3ZMV A;  2ZJR F;  4HLY A;  2VOO A;  3R0J A;  3OYJ A;  2IT0 A;  5D5W B;  1X3Z B;  2XVC A;  5FKM A;  2V4J C;  1GLN A;  3DU6 A;  2HZT A;  3BPV A;  1BA5 A;  2FBH A;  4ZYA A;  2IP2 A;  5HS7 A;  2WB1 A;  1FY7 A;  2VXZ A;  1MSE C;  4MGR A;  3E7L A;  4PCQ A;  2Y31 A;  3LSH A;  4YFK F;  3PIO F;  3O2P E;  1ZN2 A;  4L9V A;  1MBH A;  2ELK A;  1DGW Y;  1D8K A;  1HXD A;  3ECH A;  5DV5 A;  1YJW I;  1ZGA A;  1O3T A;  2Z9O A;  5E8I A;  4A3K J;  3HYI A;  2YSR A;  5GP9 A;  1TT0 A;  2F48 A;  2DDA A;  3S93 A;  4EM2 A;  5B66 C;  3CO6 C;  1R49 A;  4UVA A;  1X1P A;  2DBB A;  3KYL A;  1D1A A;  1W7P A;  2HKO A;  4HA8 A;  2ACJ A;  1KYZ A;  2W85 A;  4RLQ A;  4LIU A;  2K85 A;  3A02 A;  2L54 A;  2EV5 A;  5GAG J;  2P0W A;  1EH6 A;  3RZD J;  3BY6 A;  4F91 B;  2KJB A;  1ZRD A;  4NQW B;  1K6O A;  4UY8 I;  5L3F A;  1U0J A;  1UG2 A;  3O8G A;  2OV7 A;  5FLV A;  1UZC A;  2R7V A;  2DW4 A;  4RS8 A;  2CRG A;  5F64 A;  3K1N A;  4ZH4 F;  4HRI A;  4YIF A;  4XSX F;  1T2K A;  1IV6 A;  1JI8 A;  1R5G A;  5IT9 Z;  4F3Q A;  2OU2 A;  2KHM A;  4MNU A;  1XPX A;  2OPT A;  3SDB A;  2K4B A;  1TZL A;  3I64 A;  2DFF A;  1PP7 U;  3HGG A;  1GDT A;  2M4G A;  5GAD J;  2M3A A;  1G4D A;  3CUQ C;  3FXU A;  2I10 A;  4MEX F;  5A2Q Z;  4LD5 A;  3K4K A;  2OCE A;  1LPQ A;  1YRN B;  2LR8 A;  3D0S A;  2QWW A;  3SZP A;  2OQG A;  3WTV C;  3RYR A;  3LQR A;  2VBZ A;  4EVI A;  1PUF B;  1IXS B;  3ERE D;  2KRC A;  3X2Q H;  2M30 A;  1ETQ A;  1ZAR A;  2DFH A;  3DTK A;  3OIQ A;  4A3D J;  2Y75 A;  4M6V A;  4UUS B;  4BEH B;  3CP8 A;  1NG6 A;  2P6S A;  1BI1 A;  1OFC X;  1KA8 A;  1NHA A;  3E5X A;  1IUY A;  3UKG A;  3VYS B;  4CIC A;  4FCY A;  5EGO A;  4A2U A;  2F5D A;  4II3 A;  1JJ6 C;  4IXA A;  4YG2 F;  5FLM J;  3GWZ A;  3ROU A;  4UV9 A;  4M3E A;  3F8N A;  1MKM A;  1K78 B;  4KA4 A;  1CF7 B;  5E3O A;  2HTJ A;  4OIO F;  1G8X A;  1MBE A;  2L9R A;  2KIS A;  1IXR C;  4IEJ A;  5HDN A;  3CMY A;  5B1B H;  5FKO A;  4LJZ F;  2OAZ A;  2EB7 A;  3RTR A;  2GA2 A;  2VAS A;  2HQR A;  3BR5 A;  1VI0 A;  2WAD A;  3S32 A;  4W1U A;  2XUB A;  1JKR C;  3JSO A;  3LSG A;  3REO A;  2OF7 A;  4D5C A;  3HSR A;  3KZI C;  2VE9 A;  1BOB A;  3KP5 A;  2V1X A;  4V2F A;  4GDF A;  3ZQH A;  2L9S A;  4M9S A;  2M87 A;  5FRM A;  2DT5 A;  3E0J B;  4FHT A;  1UB9 A;  2MD0 A;  3HPH A;  1VQL I;  3A0B C;  3P7N A;  2CU7 A;  2QLZ A;  4CH7 A;  3HHH A;  1ZLK A;  3M8F A;  3CJN A;  1FP2 A;  5FGM A;  2ZXW H;  1R7J A;  2FD5 A;  5HOO A;  3ZQQ A;  1YJ9 I;  1TW3 A;  4QWQ A;  3CCY A;  3OR1 C;  1MZB A;  2Y69 H;  3QP6 A;  4ZYD A;  1UAA A;  4KIS A;  2R7S A;  1IN5 A;  3C18 A;  3LSI A;  3JTH A;  3PNY A;  1FBS A;  3AG4 H;  4KIT B;  3Q0W A;  1FTT A;  2CFO A;  2GXA A;  2M8E A;  2E7X A;  3I3L A;  3OOP A;  4AC0 A;  1B1B A;  1U5T B;  2XB5 A;  2O9L A;  3IP4 B;  5LHI A;  4IPA A;  2IAI A;  2LNB A;  3CLQ A;  1J9I A;  3V4G A;  2Z99 A;  3CUO A;  4B43 A;  2XF7 A;  2DI3 A;  3SFZ A;  1B9N A;  5F6F A;  4BHB A;  2BY3 A;  1XX5 A;  4BGD A;  1S9H A;  5HNH A;  1S7O A;  3FIW A;  4BBS J;  5F0C A;  1BI0 A;  3TQN A;  4WX9 A;  1RES A;  2V7F A;  5M3F J;  1HOM A;  4LK0 F;  2RN7 A;  2KLO A;  2HI3 A;  3NAU A;  3A4C A;  2RNG A;  3PFY A;  4L5I A;  1RNL A;  3ZQI A;  3G71 I;  1X2N A;  3HUG A;  5BS6 A;  1R23 A;  2GWR A;  2LFB A;  3BJA A;  2VKD A;  1USS A;  3K0L A;  5HOD A;  4FE4 A;  4KT5 C;  3JCU C;  2EV0 A;  3RIR A;  2RGV A;  1YS6 A;  2BHZ A;  3BPX A;  3HL2 A;  3E6D A;  1IRF A;  4YEJ A;  4NHJ A;  1ETK A;  3HRU A;  1UEL B;  3JW4 A;  5C3E J;  1R00 A;  2CV1 A;  5FO5 A;  2IS6 A;  3R0A A;  4RAG A;  1PYV A;  1NTC A;  4IHX A;  2UXN A;  1YW7 A;  3GFL A;  4DGW B;  4DYC A;  3BR3 A;  2JQ7 A;  2E7W A;  1KZH A;  1EJ9 A;  3RKX A;  1IDZ A;  3T1B A;  2HPM A;  3VFZ A;  1MMD A;  1T39 A;  3H5A A;  1D0Z A;  3C1D A;  2WAQ N;  1SMY F;  4MHG A;  5GAE J;  4EJO A;  1UST A;  2MC3 A;  2R5Y B;  3F9K A;  3WG7 H;  2AHQ A;  1YW9 A;  3ML6 A;  2H6B A;  2WV1 A;  1Y6I A;  2E1N A;  1M1E B;  2MC4 A;  4Q47 A;  4XLC A;  4IHS A;  1IRZ A;  3MAJ A;  3MKL A;  3JAM K;  4LG3 A;  4UVB A;  2EIL H;  1MGT A;  2O0Y A;  5B5E C;  1TP4 A;  1F5T A;  2ELJ A;  2MLG A;  3FK7 A;  2FUG 2;  4MTE A;  2VBY A;  2R7D A;  2WWY A;  3OYE A;  3VDX A;  1KQ9 A;  2X4H A;  1VQK I;  1YE9 A;  3S3M A;  3R4K A;  2BHY A;  3DBH B;  5L3D A;  1WPK A;  1S8N A;  3FBI B;  2LY9 A;  4PUS A;  5FKN A;  3O6B B;  1BR1 A;  1JE8 A;  1ZG1 A;  5IPA A;  3KYC B;  2ZNZ A;  2ZXI A;  3J7A O;  1N25 A;  1LEB A;  2K9L A;  1LVA A;  2BVM A;  5J3L A;  3HOT A;  1SD7 A;  5IT3 A;  2STT A;  2QBY A;  4QSH A;  1K4S A;  1YTY A;  2XKO A;  2F5E A;  3JRH A;  1LE8 B;  1FNN A;  3HC7 A;  3H9Q A;  4L9J A;  4BDZ A;  4KN7 X;  4CO8 A;  3L2C A;  2BGC A;  2AQE A;  4A3M J;  1LJ9 A;  1VQM I;  1V54 H;  1YI2 I;  3U9G A;  3HOV J;  3TDZ C;  5ICE A;  3C2B A;  2K9N A;  4DZJ A;  1ETO A;  3KCC A;  5JFR A;  4CCM A;  2D45 A;  3BJ6 A;  3FXL A;  1ZYR F;  2V9P A;  1P6R A;  5GPA A;  4A69 C;  3GF2 A;  3RYP A;  2VKV A;  3QOE A;  3BOQ A;  3BWG A;  4GFB A;  2YU3 A;  1CGP A;  5DS9 A;  4D1Q A;  5DCM B;  1Q1H A;  2XAQ A;  4RAZ A;  2DA7 A;  1FLI A;  4NB5 A;  1L3L A;  2VJI A;  1FYM A;  2HKX A;  3ZQG A;  1S72 I;  3FMR A;  1SVM A;  3KEO A;  3KPH A;  1R5H A;  3L2V A;  1PP8 F;  3SJM A;  2Y0S A;  2IS4 A;  5F0F A;  5C4J J;  4XLA A;  5EG0 B;  1ERD A;  2HWV A;  4CDG A;  1ZEL A;  3B02 A;  4A5N A;  1R4N B;  1JGS A;  4EJV A;  4EEF G;  4TV7 A;  1MMA A;  1PDN C;  1T0F A;  3BG6 A;  3KZZ A;  2BXZ A;  2AXT C;  2R7T A;  1XGN A;  3C2H A;  1WHU A;  4PZJ A;  2B9S A;  1RR7 A;  2EK5 A;  3ZQ7 A;  2RRE A;  2H6C A;  1GV5 A;  3GZN B;  3I59 A;  3KP7 A;  3T8T A;  5L3C A;  3BZK A;  3I4M J;  5JLX A;  3Q3S A;  5M5W J;  5K5O A;  2Q2E B;  3J81 K;  3FHZ A;  1YLF A;  2BOL A;  3RDI A;  3BR6 A;  2JA6 J;  5ICF A;  3DXJ F;  3BR2 A;  1TBX A;  3K6G A;  1H88 C;  3EPZ A;  3E6C C;  1A6Q A;  3MCZ A;  1POG A;  4BJT A;  4FQG A;  3BG5 A;  2XSD C;  1VZ0 A;  5DCF A;  4JQF A;  2K9M A;  2YPR A;  1O57 A;  1W5C C;  3DKX A;  3MKZ A;  4YII A;  1BOA A;  2V6C A;  2O8K A;  3IH4 A;  2E60 A;  2R93 J;  1XMA A;  4KUM A;  1VQO I;  5JLW A;  2CV2 A;  3M4O J;  1HW1 A;  4BU2 A;  4AD9 A;  2EIM H;  1XDS A;  3G1L A;  3OYL A;  3HSF A;  3E3V A;  2CUJ A;  3FHN A;  3JRA A;  1W5T A;  4DNC A;  5IOY A;  1E3H A;  4Y7N J;  4I0A A;  5C4X J;  5J40 A;  1TL8 A;  1MBG A;  3OL3 A;  1V5F A;  1R6R A;  2R7F A;  1TC3 C;  1YIO A;  3GTL J;  2QSG X;  3M8J A;  1R1U A;  3S17 J;  1VF9 A;  2IBD A;  4E70 A;  3WG9 A;  2H94 A;  4M9Z A;  2ETH A;  4XRS A;  3FMS A;  1LQ1 A;  3SYT A;  3E5U A;  4UUS A;  3F23 A;  4BEH A;  2EA2 A;  3HJE A;  2A3S A;  4Z2Y A;  2HS5 A;  1B8I B;  3S2H J;  2LH9 A;  3T8R A;  2LY1 A;  4HF2 A;  4HQM A;  3G4S I;  1JXS A;  2QQ8 A;  2VOP A;  1WWX A;  1S7A A;  3CLO A;  3H3Z A;  4E7J A;  2E2H J;  3DLL F;  3V42 A;  1D0Y A;  2W1O A;  2XAF A;  4CCO A;  1BI3 A;  3HEF A;  3HOX J;  1B72 A;  5EEA A;  1BJZ A;  1KU2 A;  2JRM A;  1D8J A;  4G7Z F;  4CZZ A;  1ON2 A;  3KP2 A;  2EZI A;  3HKZ A;  4CZC A;  2IGK A;  2CQ7 A;  2DMP A;  2JZY A;  3KE2 A;  3MZY A;  3S1R J;  2HOT A;  2A68 F;  4HX7 A;  5AON A;  2EFP A;  4P9U A;  4P5O A;  4WXH A;  4N0B A;  4C9Y A;  4A3G J;  5J8C A;  2A61 A;  3DTE A;  3NQO A;  1P7J A;  1Z77 A;  2DK8 A;  2K5C A;  3LNQ A;  3OSF A;  2L5Q A;  1U2W A;  1K6Y A;  1ZGJ A;  2L7F P;  2HEO A;  4Q48 A;  1ZG3 A;  4DQ2 A;  4DBR A;  1LNW A;  4U0W A;  2IA0 A;  2GA1 A;  2NAZ A;  5BQT A;  2CW0 F;  4E6K G;  2R92 J;  4DBQ A;  1SD4 A;  1MMN A;  2IGO A;  3SEQ A;  3OS1 A;  4L0Y B;  2LF7 A;  3TOB A;  1UHM A;  2XRL A;  3Q9S A;  4LLN A;  3DU5 A;  2F5C A;  3V8K A;  2EQR A;  5FB2 A;  1G3Y A;  2QGU A;  5DDG A;  3S3N A;  1IC8 A;  3GLX A;  5EEG A;  1FWZ A;  2EA4 A;  3ECO A;  5BNG A;  5H20 A;  2Y9Z A;  3AFH A;  3OYD A;  4AVZ A;  2DA2 A;  1IN8 A;  2PJR B;  4PGG A;  2HVQ A;  1W36 D;  5K7Z A;  3HRM A;  1YX3 A;  4P55 A;  2XC7 A;  3B6A A;  1IGN A;  1RRJ A;  1C0W A;  3Q0V A;  1K7A A;  3CDI A;  4GYI A;  5JR3 A;  2DAO A;  2FF4 A;  2JSC A;  2Z16 A;  3PO2 J;  4OU0 A;  3HGY A;  3BTC A;  3T0Y A;  4BXX J;  4I09 A;  4BYY A;  1G59 A;  3ZR8 X;  3S16 J;  4E7L A;  2ZO4 A;  3S15 J;  2UWM A;  4HPQ A;  1UHW A;  3KLN A;  4HW0 A;  1OPC A;  3JRF A;  2BW3 A;  2Z3Y A;  1EV7 A;  3OYM A;  1YYV A;  3EQL F;  5LFA A;  4CCL A;  3R61 A;  3DBR B;  3BG3 A;  3M1E A;  2VC1 A;  4XOP A;  5KK1 A;  2W48 A;  4M74 A;  3VSK A;  3VB2 A;  2VPL A;  4A6D A;  2CQX A;  1GVJ A;  2XGX A;  3ABT A;  4B44 A;  1OCC H;  1Y0N A;  1X1A A;  2X1E A;  3IRQ A;  2ZSH B;  1HC8 A;  2PQ8 A;  3K9T A;  3H0G J;  3I53 A;  1K4T A;  3GO5 A;  3HB9 A;  3K4B A;  4U7D A;  3JSP A;  1N78 A;  2HGC A;  3WU2 C;  4XLH A;  3WU0 A;  1J7K A;  3CTA A;  2FOW A;  4XN0 A;  2KZG A;  4ESJ A;  1O3S A;  2EBI A;  6PAX A;  2KP6 A;  2QVO A;  3J80 K;  4IOC F;  3ABU A;  4XN3 A;  3R6S A;  4Y13 A;  1B59 A;  3I9V 2;  1T38 A;  2KIQ A;  2QQ9 A;  2JN6 A;  1XB4 A;  1V4R A;  1R71 A;  3HG9 A;  4UNO A;  3MZH A;  4G94 A;  2EIJ H;  1J59 A;  2BZT A;  3H3U A;  5D4S A;  3M1C A;  3JTG A;  2E1M B;  1DPU A;  1MMS A;  1WCM J;  2DYR H;  5EF6 A;  5KAI C;  2L4A A;  2JT1 A;  3LQQ A;  1LUJ B;  2CO5 A;  3QPT A;  4RGX A;  4IOA F;  1V5G A;  1QPI A;  4XKV A;  4EM1 A;  1D5V A;  2ECB A;  4G7O F;  5F08 A;  4IHT A;  3CF2 A;  1O7L A;  1DU0 A;  2DA3 A;  3LA7 A;  4XID A;  4K2E A;  4B09 A;  3CC2 I;  4AIH A;  1GXQ A;  3WTZ A;  5HLT A;  1RR8 C;  1HSJ A;  4RB2 C;  1T8I A;  3G3Z A;  4ZYH A;  1XN7 A;  3E6M A;  1D1C A;  4IRH A;  3TKY A;  4E7S A;  4AM3 A;  1QVT A;  1FMW A;  2IGN A;  4OAZ A;  1MNE A;  4MFE A;  4HBL A;  3RKW A;  3PFI A;  2PEX A;  3FK6 A;  4FE7 A;  4LG0 A;  3U1K A;  5HS9 A;  1FYK A;  4KJZ A;  1XSX A;  1OLT A;  4BAC A;  3BZC A;  4C2U A;  2XV4 S;  4M6X A;  4PSX A;  1OMI A;  3ZMZ A;  2Y2Z A;  4OMY A;  3EYI A;  3MKW B;  2V1D A;  2O61 A;  3QU6 A;  2JK3 A;  5E3L A;  5FD6 A;  3LA2 A;  1EA3 A;  2R7U A;  2IVM A;  2E5Z A;  1WFX A;  2K3F A;  4RAF A;  1REP C;  4M3D A;  1T0F C;  4A5M A;  2WB1 N;  3N4M A;  2STW A;  2W7N A;  4NC6 A;  4B8X A;  3WTU C;  2BY1 A;  4I01 A;  3W3C A;  3OS0 A;  4IHV A;  4UUV A;  1TNT A;  1JHF A;  3LST A;  2HYJ A;  3F8C A;  3S14 J;  4X6A J;  3KP6 A;  1JGG A;  2FRH A;  1FT9 A;  3TO7 A;  1D0X A;  4ZDO A;  1ON1 A;  3B73 A;  4IO9 F;  2K3P A;  3BC8 A;  1ZHF A;  2LRD A;  4HV6 A;  1JKP C;  4A0X A;  4S05 A;  4C3I J;  1QZE A;  2LKP A;  3ESW B;  4Y33 A;  2PBI A;  4WCG A;  3KLO A;  1KGS A;  3CUQ B;  3SDG A;  1ZAO A;  3ELK A;  3GFJ A;  2HZD A;  3FM5 A;  3LSK A;  3J7Y J;  3QOD A;  3T5X A;  1J5Y A;  4UXN A;  5D4R A;  2ZME A;  2QSF X;  3OV8 A;  2AO9 A;  2G7U A;  1UG0 A;  2DFI A;  4U87 A;  2W84 A;  3V7S A;  4ZYG A;  4XLF A;  1I27 A;  3ONQ A;  3LSP A;  4OOI A;  4X0G A;  2NNY A;  1JT0 A;  1Z7U A;  5K5Q A;  5ILV A;  2BYV E;  4BL0 B;  1VND A;  1TTY A;  1MDM A;  4JX4 A;  2LOO A;  5KCM A;  3L2U A;  1BIA A;  2GIZ A;  2E36 A;  2V9V A;  2VBW A;  3OYI A;  4I6Z A;  3EYY A;  3NWS A;  2NVT J;  2HOE A;  2PN6 A;  3GTM J;  1ZRF A;  1XC5 A;  1MJA A;  2OC6 A;  5CYV A;  4OIR F;  3MN2 A;  3H1C A;  4S0H B;  5HLI A;  3E6B A;  4M6Y A;  2E35 A;  5FFZ A;  2XRO A;  3H9J A;  3CCS I;  1PJR A;  1N77 A;  5CKT A;  3FDY A;  2O7O A;  1ETV A;  2I5U A;  3CCQ I;  2MBF A;  3QRF F;  3JAM Z;  4AYB A;  1G3T A;  1Y1W J;  1QRY A;  2E19 A;  3K7A J;  4RGS A;  5E1Z B;  4RBO A;  2C6Y A;  1BIB A;  1WH7 A;  3Q0U A;  3IAS 2;  1QZY A;  4O3M A;  1Y0U A;  5FLX K;  1AKH A;  1T33 A;  1R1T A;  3CO7 C;  4GGG A;  2EH3 A;  2JVG A;  2ZSI B;  1VQP I;  5DYM A;  2EWN A;  1Z21 A;  3LAP A;  2EFW A;  3L2W A;  2JUG A;  5HLG A;  2V79 A;  3IAM 2;  4AU7 A;  4PJN A;  1QHG A;  5J6X A;  3CC4 I;  4HX4 A;  4QIW N;  3QQA A;  2BXY A;  2ME6 A;  4HNT A;  1XMK A;  4OAY A;  2ISY A;  1ONV A;  3SQN A;  4GCV A;  4XQF A;  2R7O A;  1RUO A;  2GM4 A;  3V8J A;  1QBJ A;  2KJC A;  4BHP A;  1LDJ A;  2PMU A;  2LKX A;  2D1V A;  4Y3O A;  4RM3 A;  4OIN F;  5L3E A;  1QHH D;  3COA C;  3ZGK A;  2XSJ C;  1U9N A;  3K10 A;  3LSJ A;  4O5V A;  3DPL C;  4RGU A;  5DUK A;  5F1J A;  5B3S H;  1OCZ H;  2HPI A;  2B7E A;  2EZK A;  1S6L A;  5E79 C;  2NXN B;  1X1B A;  3DPT A;  4G6D A;  2L9N A;  4AWX B;  5HDK A;  4I99 C;  5LHH A;  2FNA A;  3ASO H;  3TP0 A;  3A01 B;  4GXO A;  2UZK A;  3BCA A;  3PO3 J;  1H8A C;  4EJW A;  2H1K A;  2H1L A;  2NVQ J;  1TT5 B;  1OCT C;  3EUA A;  2E5N A;  2HXO A;  2XRN A;  1ZRE A;  1QO0 D;  1YX5 A;  2TRT A;  2F4O B;  1MMG A;  2XGD A;  3LSM A;  3TDU C;  2KDO A;  5IP6 A;  1Y8Q B;  2DQR A;  3PQJ A;  2O3F A;  1LVK A;  3CJQ B;  1XG1 A;  1VQ8 I;  5FKK A;  3GTQ J;  2F4M B;  3BJO A;  3GTK J;  3WU1 B;  1W0T A;  2PI0 A;  2A5Y B;  2WY7 Q;  3GFM A;  1FTZ A;  1NG7 A;  4YIR X;  4E7K A;  3BLY A;  4XKB A;  5GPC A;  2FOK A;  5FKL A;  2PJP A;  1NK3 P;  5M5X J;  2F2E A;  1KU9 A;  2LBF B;  3D5S C;  2VJ4 A;  1AU7 A;  3FXO A;  3LFU A;  2M5W A;  2NYX A;  1RUN A;  2VE8 A;  3FXM A;  3ZN1 A;  2ZCW A;  4F92 B;  3I56 I;  5F1R A;  2M0C A;  1XGO A;  5CQE A;  1RKT A;  1HW5 A;  1U78 A;  5BMZ A;  1HDD C;  2DDB A;  5LGT A;  1N75 A;  1JHH A;  1IJW C;  4LB5 A;  4PGH A;  1WI3 A;  1R9T J;  2VPR A;  2OJE D;  3DKW A;  1IZ1 A;  2R4G A;  4AIJ A;  2VC0 A;  5K7F A;  5IT9 K;  2P81 A;  3QOP A;  3S1Q J;  3IH2 A;  3H9G A;  3BTI A;  3VYR B;  2HQA A;  2EV6 A;  1BL0 A;  4ESB A;  4OMZ A;  3ZQF A;  3K4C A;  4XRS G;  2LK2 A;  2CSO A;  3H36 A;  3M9A A;  5AIQ A;  4HNV A;  5JHF A;  3I54 A;  1ETY A;  2HYF A;  4KMF A;  3HOU J;  2VT3 A;  1X4O A;  2CFX A;  5A2Q K;  1IW7 F;  1OYW A;  2DA5 A;  1H9T A;  2CQK A;  3LMM A;  2JPC A;  2R7Z J;  2WAQ A;  1RIO H;  2GLO A;  1Z1D A;  4HF0 A;  4BUP A;  4FAS D;  1E3O C;  1T6S A;  1QGP A;  1HQC A;  2NRA C;  2HFH A;  2CWE A;  3DKY A;  2UXX A;  4HYE A;  3H3V K;  2MW8 A;  4E7Z A;  3D1N I;  1X58 A;  3A2K A;  3GBG A;  2QZ8 A;  2WAF A;  2EFQ A;  2ZFW A;  3QPS A;  2RKH A;  3QU3 A;  3CME I;  4A3F J;  2MSY A;  2MH9 A;  2M34 A;  4NDL A;  3JRB A;  1HCR A;  1MD0 A;  4JP0 A;  5TRD A;  2HQ5 A;  4ZC3 A;  2FQ4 A;  3WGI A;  5HDG A;  2IS1 A;  2VL8 A;  2R5Z A;  2FNP A;  2PMZ A;  1P7I A;  3NRV A;  4NNJ A;  2JA8 J;  1FSE A;  3MEX A;  4YFN F;  1ITY A;  5K7H A;  2OTJ I;  4PFP A;  5E1W A;  5D5V B;  1XS9 A;  1OIS A;  1JTX A;  4KN4 X;  3B6C A;  4L9N A;  1FJL A;  3MZ8 A;  1Z3Y A;  5CLS A;  2LD5 A;  3RI4 A;  1IUF A;  2QEN A;  4XON A;  2EIK H;  2QM3 A;  3KX2 A;  3G73 A;  3S1N J;  1TWC J;  1OYY A;  1O4X A;  5KAF C;  4D7N A;  2IPQ X;  2MG4 A;  3HIF A;  4EJU A;  3GYH X;  3ZP5 A;  1JKQ C;  3HPG A;  2K7L A;  3WHC A;  4N4N B;  2X85 A;  4ESF A;  1G6N A;  1J2X A;  1SD5 A;  1SFE A;  5CVI A;  5DTD A;  3L7W A;  5E3N A;  1YO5 C;  2ZFU A;  1BI2 A;  3SEZ A;  1TWG J;  3DF8 A;  2CG4 A;  1YIT I;  4XLP F;  4A3C J;  3S2D J;  5IYD J;  3OIP A;  3PIP F;  2MLK A;  1W7P B;  1OCO H;  5CVV A;  2Q0O A;  4XM3 A;  3K4M A;  1R58 A;  1R4M B;  1YW8 A;  3ZMT A;  4CUG A;  4AUX A;  1FX7 A;  1GV2 A;  3EUK L;  3I5U A;  3HZJ A;  2XDV A;  3QPL A;  4EAT A;  4ETS A;  3F0C A;  3AL0 B;  1WI9 A;  3TW7 A;  2VKE A;  1TLH B;  2DO7 A;  2MYS A;  2COM A;  4U7B A;  3GTO J;  4F7Z A;  3F8B A;  4ZDP A;  4L5E A;  2IW5 A;  4CXF A;  4XNF A;  3CCM I;  3S2W A;  3H0D A;  4CYC A;  1WRJ A;  3LOC A;  5E18 F;  3WGH A;  3A0H C;  4PDK A;  1A31 A;  3OMY A;  3FZV A;  1BW5 A;  2A69 F;  4W97 A;  3AAF A;  1MJB A;  2DT6 A;  2HOA A;  1WSU A;  1QU3 A;  2ZME C;  3JRD A;  2XAH A;  3F22 A;  1XSV A;  1LFP A;  2VQC A;  3HDD A;  2FU4 A;  5E20 A;  1Z6R A;  3BQZ A;  2XIG A;  1HST A;  2ZNY A;  5EGO B;  4PJM A;  2PG4 A;  2F6C A;  3DTI A;  3PQK A;  1J75 A;  4HV5 A;  4Z6Y A;  2DCE A;  5EDN A;  3A03 A;  4M3G A;  3M3Y J;  2OZU A;  3CZ6 A;  3KEQ A;  2BE5 F;  4J00 A;  3HOS A;  1MSF C;  3IWZ A;  4A6E A;  5LLQ A;  2BEO A;  2Y0S N;  1B9M A;  4KT6 A;  2QCO A;  3GEZ A;  4WXD A;  3H5R A;  3KFW X;  2ID6 A;  4I02 A;  1TQM A;  3P9K A;  3GFI A;  2QUF A;  2ZBK A;  2P5K A;  2UUZ A;  1MBJ A;  3TBI A;  2J5O A;  2JJ7 A;  4WF2 A;  1DP3 A;  1QQI A;  2HR3 A;  4V19 K;  1P2F A;  5J1R A;  4NQW A;  3HTS B;  1LB2 A;  4EJT A;  2FSW A;  2V9K A;  2RQP A;  2OA4 A;  4F55 A;  1JUP A;  3CCU I;  4I0B A;  2QSH X;  2LDU A;  2P7V B;  3WE2 A;  2QKM B;  3I4N J;  4MLO A;  3BCB A;  5EZH A;  2FEZ A;  3HOW J;  2DTR A;  2ICW G;  2X6W A;  3KP3 A;  4GO1 A;  5KVR A;  3K4L A;  1Z3X A;  3DEU A;  4BHC A;  2OUM A;  1FOX A;  3BR0 A;  2X9D A;  2WTE A;  4MQ9 F;  1I50 J;  1AOY A;  2ZXH A;  3GUD A;  4U0V A;  4CA0 A;  5IOZ A;  3W2V A;  4QPQ A;  1SFU A;  2H8W A;  1D5Y A;  1YRN A;  4DJA A;  4IHW A;  2KRF A;  4JK1 X;  2V1U A;  2R7W A;  4HDU A;  4P1W A;  3DPU A;  4HG2 A;  4BXF A;  5IP9 J;  3VSL A;  3J80 Z;  1PUF A;  1S3J A;  3RQ4 A;  4JYK A;  2ECC A;  2XF6 A;  1HW2 A;  3W6J B;  5LRS A;  2R3S A;  2EZH A;  1E2X A;  3IKV A;  2NOJ B;  2QKL B;  2VQL A;  2HDW A;  4B47 A;  2ID3 A;  5J4V A;  4H0E A;  3OYN A;  1BBY A;  4HST A;  1NK2 P;  2PLY A;  3GW2 A;  4ABZ A;  2R7X A;  3NWT A;  2EZL A;  4KMU X;  1WVR A;  1MIJ A;  1A6I A;  3PNT A;  3QYB A;  2XGC A;  4C30 A;  2CUF A;  3RQI A;  3WTT C;  1X2M A;  1K78 A;  3MVP A;  3FXQ A;  4JOM A;  1Y39 A;  1CF7 A;  2X0L A;  4GRI A;  4P96 A;  4BQO A;  2KIU A;  3HSE A;  2HDD A;  2K4J A;  3NEU A;  1F1Z A;  4MIM A;  1F4K A;  4S04 A;  3IKT A;  1X4P A;  3CCR I;  3ABM H;  1VQ5 I;  2VB6 A;  4CCN A;  2VLA A;  4DYR A;  4KYW A;  3SZT A;  3TED A;  3QYF A;  3HRT A;  4LK1 F;  5DEQ A;  5CVU A;  2XB0 X;  1SFX A;  3TP3 A;  2XF5 A;  2KMU A;  2X6X A;  1O3R A;  4B1R A;  1APL C;  3FXK A;  5LD2 C;  3IC7 A;  3HUG B;  2JSP A;  5HNF A;  1I5Z A;  3F8F A;  2JA7 J;  5ILS A;  1OR7 A;  1MH4 A;  1XTA A;  3CCJ I;  2OQR A;  4IZZ A;  3BTL A;  2GBY A;  3HKZ N;  2E1C A;  2G0E A;  1ZH5 A;  1DGR M;  2LMD A;  2LP0 A;  3K4J A;  2L7M P;  2YUS A;  1HKT A;  3DEW A;  1Z91 A;  3BQY A;  4XRM A;  2WC2 A;  3CES A;  1BR2 A;  3BR1 A;  5IP7 J;  1Q1V A;  1LKX A;  4U0Y A;  2A6T A;  2QF7 A;  5D5U B;  3OYC A;  3SXY A;  3HHG A;  1KU7 A;  3OY9 A;  5TJJ A;  1H89 C;  4FX0 A;  2M7A A;  4BJ6 C;  2P8T A;  5DD8 A;  4IKF A;  4HQE A;  1U5T A;  1YG2 A;  1X3W B;  3L2Q A;  2WBM A;  4LGW A;  5CVJ A;  1GVD A;  5CQG A;  2XAJ A;  2FA5 A;  3MD2 A;  4ON0 A;  2JWT A;  2VBX A;  4OIP F;  3MFK A;  3ZOB A;  3MKY B;  2M0M A;  2M9H A;  4BH9 A;  3WHB A;  3Q5F A;  4BBR J;  3EUH C;  3RSN A;  2MAB A;  2E34 A;  2YS9 A;  5E1X A;  1JTY A;  5TGT A;  4CCJ A;  1TWF J;  4U88 A;  2M1B A;  1FPQ A;  4A0Z A;  1I3Q J;  3TL4 X;  2K27 A;  3OR2 C;  2D5V A;  2CJJ A;  4XSZ F;  5GAH J;  3DLA A;  2DA6 A;  3OYF A;  4X1E A;  2LBF A;  2FBI A;  3IUO A;  4Y4R A;  4LLG F;  1JJ8 C;  3JRC A;  2G9W A;  4A3I J;  2ZXJ A;  1BJA A;  1RET A;  3M07 A;  2Q8K A;  1STZ A;  3G1O A;  3KP4 A;  1D3Y A;  2QBY B;  4C2M J;  4IRI A;  4KDP A;  4CGZ A;  2P5L C;  4BQQ A;  1ZLJ A;  5FD5 A;  2DOD A;  4MEY F;  2VQG A;  4WK8 F;  3HM5 A;  3HBL A;  2GOX B;  1RPW A;  1KQ8 A;  5FRO A;  5L3B A;  4WWC A;  1K79 A;  1OCR H;  4ENJ A;  3KYD B;  2ZJQ F;  2D2W A;  4DYQ A;  1BN5 A;  3GZ5 A;  2VJJ A;  2LG4 A;  4FX4 A;  1ODD A;  3J7Z I;  1RC9 A;  2YR2 A;  1B4A A;  1O3Q A;  3U2R A;  3WTY C;  3VPR A;  1ZTR A;  2RAE A;  2GZW A;  2L2O A;  2NS7 A;  4DOZ A;  2R5Y A;  5FRN A;  1IXC A;  2KRH A;  2PFB A;  4ENK A;  4JX6 A;  3FX3 A;  2XAG A;  1FOW A;  4E7H A;  4RGR A;  1YQA A;  4EQQ A;  2E1M C;  3TMO A;  4ZZD A;  2DMQ A;  2W57 A;  2WA0 A;  3BT9 A;  4LOC A;  4CHU A;  4A93 J;  3OL4 A;  3WOD F;  2VT2 A;  2EIN H;  2CQN A;  2IEK A;  4ZZL A;  4G6T B;  2COB A;  3IH3 A;  1IN6 A;  1HKS A;  1SMT A;  3F6V A;  3OIO A;  4C3J J;  4DIQ A;  2VQH A;  3OYH A;  3FKI J;  2KIM A;  4A12 A;  4FTH A;  1WQ2 A;  1PUE E;  4PFO A;  5D5X B;  1TWH J;  3I58 A;  1FBQ A;  1U6G A;  2DU9 A;  1SVO A;  1A04 A;  1IN7 A;  1GHC A;  2RNJ A;  1WH5 A;  4HX8 A;  3V7R A;  4N9I A;  2K40 A;  4N9H A;  4EV0 A;  1FEX A;  1SEU A;  1SFK A;  1LE8 A;  3I59 B;  1IN4 A;  2JMW A;  4WXC A;  1PVE A;  2AQF A;  5F04 A;  5KHD A;  2ZJP F;  2ME0 A;  4UHT A;  2XGE A;  1W36 C;  2RV8 A;  2FXA A;  2J5P A;  3IRR A;  5FJ8 J;  3P9I A;  3W2A A;  3FIS A;  2V26 A;  5IYB J;  4B48 A;  3L09 A;  3VYU B;  2X1D A;  1ZG5 A;  3K70 D;  3W6V A;  4I2O A;  4DZP A;  1QPM A;  4Q4Z F;  2NVU B;  1EKE A;  2HTS A;  3PUF A;  3GTP J;  3QWL A;  3CCV I;  4XLE A;  3OSG A;  1IO2 A;  3BTJ A;  2F5F A;  3FBN B;  5LBQ A;  5IYC J;  4R1H A;  2M8G X;  4FIS A;  4G7H F;  4XLN F;  1XSD A;  3N05 A;  3TW6 A;  5CPR B;  3UR3 C;  5JVT A;  3DFG A;  4AID A;  4BXU A;  4XK4 A;  2BY2 A;  4BE2 A;  4O6J A;  2YX7 A;  3GXO A;  2E2J J;  3PSI A;  4HNU A;  5DCM A;  3G2B A;  1Z0X A;  4HSR A;  3VWB A;  4Y52 J;  2Z5U A;  2CUE A;  4LB6 B;  1MBK A;  1U8B A;  3CF5 F;  1ULY A;  1IF1 A;  2X1C A;  5K1Y A;  2DOE A;  2FML A;  3I4P A;  4GYG A;  5CVR A;  1EH8 A;  3DBL B;  4UB8 C;  1P9Q C;  5EG0 A;  2MFZ A;  2X6O A;  2L7K A;  4MO7 A;  2LRE A; 
#chains in the Genus database with same CATH homology
 2ESN A;  4RB1 A;  3IWF A;  1QNT A;  5AIP A;  2HYG D;  1OKR A;  1XGS A;  2JTV A;  1UCR A;  1OYI A;  1IAW A;  5LEK A;  3V7C A;  2MH2 A;  1L0O C;  3M7G A;  4EGY A;  2Q2E A;  4CYD A;  5BPD A;  2DPU A;  2L4M A;  1WKM A;  2G7H A;  1Z6T A;  3LWF A;  1R1V A;  3Q9V A;  3F3X A;  2KKO A;  5DUI A;  5H6Q A;  1EH7 A;  1XGM A;  4LLL A;  5JHU A;  3E97 A;  1RZ4 A;  4EMS A;  3DQV C;  3MQ0 A;  4ENM A;  4G6Q A;  4KIC A;  3ZMD A;  1H0M A;  3QPH A;  1LDD A;  3RJP A;  1S29 A;  3R60 A;  2ISZ A;  1XDU A;  3WTS C;  5D6E A;  1SD6 A;  5HVQ C;  3VOE A;  5L3G A;  4EM0 B;  3F8M A;  1LEA A;  4M71 A;  4Q5S F;  4ENN A;  5D8K B;  2H09 A;  1W7P D;  4LMY A;  2L02 A;  2P4W A;  4G8X A;  1U5T C;  2EJR A;  3K1P A;  2ADU A;  1FBU A;  1TNS A;  5LHG A;  4HOB A;  3BDD A;  2K86 A;  5K5R A;  3LFK A;  2O03 A;  3L00 A;  1F9N A;  2GXG A;  3TOA A;  3D5L A;  1P4X A;  4HAM A;  4OIQ F;  2Y0M A;  1ZRC A;  4LFU A;  1W4M A;  5D8L B;  3FMQ A;  4XRF A;  4L0Z B;  1X3U A;  1B6A A;  4P9F A;  1FP1 D;  3J81 Z;  1V3F A;  2D1H A;  4BAY A;  2GQQ A;  1DDN A;  5DD4 A;  4MTD A;  3BP8 A;  5ILU A;  2CYY A;  4ASN A;  2ESH A;  2DQL A;  5HLH A;  2BBY A;  5LRR A;  2W24 A;  3EUH A;  2P6T A;  4KFC A;  5LEJ A;  4R79 A;  5H6R A;  2VN2 A;  3K1M A;  4QLC U;  2IA2 A;  1XCV A;  4XBF A;  3H92 A;  1XCB A;  1FSH A;  3ZMS A;  2K02 A;  3E5Q A;  4AVP A;  2ZKZ A;  4A0Y A;  2O8X A;  3L9F A;  4EGZ A;  3F21 A;  2DLL A;  4LG0 B;  1HBX G;  3V8L A;  4RB0 A;  1SAX A;  1HKQ A;  2MD5 A;  3RPQ A;  2P7C B;  1U8R A;  2GXB A;  1R36 A;  3DV8 A;  1I1S A;  1E17 A;  1TW2 A;  4AIK A;  1UFM A;  5JI6 A;  2QYO A;  1RI7 A;  2NS0 A;  1W5S A;  1P4A A;  2IJL A;  4IJA A;  3WE3 A;  2VOD A;  2AS5 F;  5CJ9 A;  3QP5 A;  5BOX A;  1TQI A;  2H27 A;  2EFO A;  3WTX C;  1YFH A;  1J0R A;  2MA3 A;  5D6F A;  3QAH A;  3K69 A;  4ZYE A;  2ZME B;  3TGN A;  2ELH A;  2FBK A;  2FMY A;  1DP7 P;  4MQV A;  3FF5 A;  1MDM B;  2L01 A;  2QQB A;  1P4W A;  1G3W A;  3VOD A;  3WGG A;  4RB3 C;  2EFN A;  2LF8 A;  4G9Y A;  2ZJ2 A;  5E8G A;  1KU3 A;  1Z9C A;  4I98 B;  2XAS A;  3FXR A;  4IF4 A;  2LSO A;  5HS8 A;  5BPI A;  1H9G A;  3GZ6 A;  4Y15 A;  3RKY A;  1DPR A;  4HDV A;  1BC8 C;  1LDK B;  4BNC A;  2QQA A;  2B0L A;  3I71 A;  3ISP A;  3CUQ A;  1BC7 C;  3O3K A;  2WV0 A;  4KIB A;  3ZMU A;  1XD7 A;  4L18 B;  3HTU A;  3DP7 A;  1KYW A;  3U1D A;  1G3S A;  2HQN A;  2GAU A;  2JRT A;  3HRS A;  3P9C A;  3IL2 A;  4HLX A;  4Y17 A;  4KIF A;  3MWM A;  3W6K B;  2IRF G;  2CGP A;  5LGU A;  2RVC A;  2DPD A;  3IHU A;  3KET A;  1GXP A;  4YFX F;  3SHF A;  3ZN0 A;  3M8E A;  2HDC A;  5E17 F;  2KIF A;  2A07 F;  5J8F A;  4M73 A;  4UV8 A;  5ED4 A;  2OD5 A;  3ULQ B;  3K2Z A;  2NNN A;  1T98 A;  2VON A;  3ZPL A;  4M72 A;  4RAY A;  5LGN A;  2L3D A;  4D0P A;  4JBA A;  2BV6 A;  4I7H A;  5ICG A;  3C7J A;  2RC4 A;  4L5J A;  4L9T A;  3WTW C;  4BQA A;  3FWE A;  3VEP A;  2IA1 A;  3TO6 A;  3FM3 A;  5ICC A;  2AXL A;  1TQP A;  2RDP A;  1FYL A;  3KZY A;  5FFX A;  3I0T A;  2P5V A;  3C3W A;  3CDH A;  2TDX A;  2GIV A;  1KQ0 A;  4IRG A;  4M9X A;  4KIG A;  2PMH A;  1QZZ A;  1R22 A;  3LAJ A;  1FC3 A;  4UVC A;  1BM9 A;  2YX4 A;  1Z05 A;  4FT8 A;  2A6E F;  1YS7 A;  2OZ6 A;  2M45 A;  1U3E M;  2W25 A;  4HF1 A;  4R8H A;  1FOK A;  2Y48 A;  2FQ3 A;  1FZP B;  1I6X A;  3F72 A;  2O6G E;  1VTN C;  2XHK A;  2A6H F;  3BRO A;  3EDP A;  5FLX Z;  3GVA A;  2XKP A;  3RPU A;  3GX4 X;  4IVN A;  3TO9 A;  1AWC A;  1DUX C;  1P92 A;  3EET A;  2DK5 A;  3N97 A;  2FE3 A;  4HZF A;  1IRG A;  1MJ9 A;  2JPB A;  3F6O A;  1O7F A;  1I1G A;  5EEH A;  4KNY A;  3BZ6 A;  5ERI A;  3LA3 A;  2Z33 A;  2OBP A;  3ZMV A;  4HLY A;  2VOO A;  3R0J A;  2IT0 A;  5D5W B;  2XVC A;  2HZT A;  3BPV A;  2FBH A;  2IP2 A;  5HS7 A;  1FY7 A;  2VXZ A;  4MGR A;  4PCQ A;  4YFK F;  3O2P E;  1ZN2 A;  4L9V A;  1D8K A;  1HXD A;  3ECH A;  5DV5 A;  1ZGA A;  1O3T A;  2Z9O A;  5E8I A;  3HYI A;  2YSR A;  4EM2 A;  3CO6 C;  4UVA A;  2DBB A;  1W7P A;  2HKO A;  4HA8 A;  2ACJ A;  1KYZ A;  2W85 A;  2L54 A;  2EV5 A;  1EH6 A;  3BY6 A;  2KJB A;  1ZRD A;  1K6O A;  5L3F A;  2DW4 A;  4RS8 A;  5F64 A;  3K1N A;  4ZH4 F;  4YIF A;  4XSX F;  1T2K A;  1R5G A;  5IT9 Z;  2OU2 A;  4MNU A;  2K4B A;  3I64 A;  1PP7 U;  1G4D A;  3CUQ C;  3FXU A;  4MEX F;  5A2Q Z;  4LD5 A;  3D0S A;  2QWW A;  3SZP A;  2OQG A;  3WTV C;  3RYR A;  3LQR A;  2VBZ A;  4EVI A;  1IXS B;  3ERE D;  2M30 A;  1ZAR A;  2Y75 A;  2P6S A;  1BI1 A;  1KA8 A;  1NHA A;  3E5X A;  1IUY A;  4CIC A;  4A2U A;  2F5D A;  4YG2 F;  4IXA A;  3GWZ A;  3ROU A;  4UV9 A;  3F8N A;  1MKM A;  1K78 B;  4KA4 A;  1CF7 B;  2HTJ A;  4OIO F;  1IXR C;  5HDN A;  4LJZ F;  2OAZ A;  2EB7 A;  3RTR A;  2GA2 A;  2HQR A;  2XUB A;  3JSO A;  3REO A;  3HSR A;  2VE9 A;  3KP5 A;  2V1X A;  4M9S A;  2M87 A;  2DT5 A;  4FHT A;  1UB9 A;  3P7N A;  2QLZ A;  3HHH A;  1ZLK A;  3M8F A;  3CJN A;  1FP2 A;  5FGM A;  5HOO A;  1R7J A;  1TW3 A;  4QWQ A;  1MZB A;  3QP6 A;  4ZYD A;  1IN5 A;  3C18 A;  3JTH A;  1FBS A;  2M8E A;  2E7X A;  3OOP A;  1B1B A;  1U5T B;  5LHI A;  4IPA A;  2LNB A;  1J9I A;  3V4G A;  2Z99 A;  3CUO A;  2DI3 A;  3SFZ A;  1B9N A;  5F6F A;  4BHB A;  1S7O A;  1BI0 A;  3TQN A;  4WX9 A;  4LK0 F;  2RN7 A;  4L5I A;  1RNL A;  3HUG A;  5BS6 A;  1R23 A;  2GWR A;  3BJA A;  1USS A;  3K0L A;  4KT5 C;  2EV0 A;  3RIR A;  2RGV A;  1YS6 A;  3BPX A;  3E6D A;  1IRF A;  4NHJ A;  3HRU A;  3JW4 A;  1R00 A;  5FO5 A;  3R0A A;  2UXN A;  1YW7 A;  3GFL A;  2E7W A;  3RKX A;  3T1B A;  3VFZ A;  1T39 A;  3C1D A;  1SMY F;  4MHG A;  4EJO A;  1UST A;  2MC3 A;  1YW9 A;  3ML6 A;  2H6B A;  2E1N A;  4Q47 A;  4IHS A;  3MAJ A;  3JAM K;  4UVB A;  1MGT A;  2O0Y A;  1F5T A;  2MLG A;  4MTE A;  2VBY A;  2R7D A;  2WWY A;  1KQ9 A;  2X4H A;  3R4K A;  5L3D A;  1S8N A;  3O6B B;  1JE8 A;  1ZG1 A;  2ZNZ A;  3J7A O;  1LEB A;  1LVA A;  2STT A;  3HOT A;  1SD7 A;  5IT3 A;  2QBY A;  1YTY A;  2XKO A;  2F5E A;  1FNN A;  4L9J A;  4KN7 X;  4CO8 A;  3L2C A;  2BGC A;  1LJ9 A;  3U9G A;  3TDZ C;  5ICE A;  3KCC A;  5JFR A;  2D45 A;  3BJ6 A;  1ZYR F;  1P6R A;  3GF2 A;  3RYP A;  3BOQ A;  3BWG A;  2YU3 A;  1CGP A;  5DCM B;  1Q1H A;  2XAQ A;  4RAZ A;  1FLI A;  4NB5 A;  1L3L A;  1FYM A;  2HKX A;  3FMR A;  3KEO A;  1R5H A;  1PP8 F;  2HWV A;  4CDG A;  3B02 A;  4A5N A;  1JGS A;  4EJV A;  4TV7 A;  1PDN C;  1T0F A;  3KZZ A;  1XGN A;  4PZJ A;  2EK5 A;  3ZQ7 A;  2H6C A;  3I59 A;  3KP7 A;  3T8T A;  5L3C A;  5K5O A;  3J81 K;  3FHZ A;  1YLF A;  3RDI A;  5ICF A;  3DXJ F;  1TBX A;  3E6C C;  3MCZ A;  5DCF A;  4JQF A;  2YPR A;  1O57 A;  4YII A;  1BOA A;  2V6C A;  1XMA A;  4KUM A;  1HW1 A;  4AD9 A;  1XDS A;  3HSF A;  3E3V A;  1W5T A;  4DNC A;  4I0A A;  2R7F A;  1YIO A;  1R1U A;  4E70 A;  3WG9 A;  2H94 A;  4M9Z A;  2ETH A;  3FMS A;  1LQ1 A;  3E5U A;  3F23 A;  2EA2 A;  2A3S A;  4Z2Y A;  2HS5 A;  3T8R A;  4HF2 A;  4HQM A;  1JXS A;  2VOP A;  1WWX A;  1S7A A;  3CLO A;  3H3Z A;  2XAF A;  1BI3 A;  1D8J A;  1KU2 A;  4G7Z F;  4CZZ A;  1ON2 A;  3KP2 A;  2JZY A;  3KE2 A;  3MZY A;  2A68 F;  4HX7 A;  5AON A;  2EFP A;  4P9U A;  4P5O A;  4WXH A;  4N0B A;  5J8C A;  2A61 A;  3NQO A;  2DK8 A;  1U2W A;  1ZGJ A;  2HEO A;  4Q48 A;  1ZG3 A;  4DQ2 A;  1LNW A;  4U0W A;  2IA0 A;  2GA1 A;  2NAZ A;  5BQT A;  2CW0 F;  1SD4 A;  4L0Y B;  2LF7 A;  3TOB A;  1UHM A;  3Q9S A;  4LLN A;  2F5C A;  3V8K A;  5FB2 A;  1G3Y A;  5DDG A;  3GLX A;  5EEG A;  1FWZ A;  2EA4 A;  3ECO A;  5H20 A;  1IN8 A;  4PGG A;  3HRM A;  4P55 A;  1C0W A;  1K7A A;  4GYI A;  5JR3 A;  2DAO A;  2FF4 A;  2JSC A;  4OU0 A;  3T0Y A;  4I09 A;  4BYY A;  2ZO4 A;  2UWM A;  1UHW A;  3KLN A;  4HW0 A;  1OPC A;  2Z3Y A;  1EV7 A;  1YYV A;  3EQL F;  3R61 A;  3M1E A;  2VC1 A;  5KK1 A;  4M74 A;  3VB2 A;  4A6D A;  1GVJ A;  2XGX A;  3ABT A;  3IRQ A;  2PQ8 A;  3K9T A;  3I53 A;  3GO5 A;  4U7D A;  3JSP A;  2HGC A;  3WU0 A;  1J7K A;  3CTA A;  4ESJ A;  1O3S A;  6PAX A;  2QVO A;  3J80 K;  3ABU A;  3R6S A;  4Y13 A;  1B59 A;  1T38 A;  2QQ9 A;  1XB4 A;  1V4R A;  4UNO A;  3MZH A;  4G94 A;  1J59 A;  3H3U A;  5D4S A;  3JTG A;  1DPU A;  2L4A A;  2JT1 A;  3LQQ A;  2CO5 A;  3QPT A;  4RGX A;  4EM1 A;  1D5V A;  4G7O F;  4IHT A;  1O7L A;  3LA7 A;  4K2E A;  4B09 A;  4AIH A;  1GXQ A;  3WTZ A;  1HSJ A;  4RB2 C;  3G3Z A;  4ZYH A;  1XN7 A;  3E6M A;  4IRH A;  3TKY A;  3RKW A;  4HBL A;  3PFI A;  2PEX A;  4LG0 A;  5HS9 A;  1FYK A;  1XSX A;  2XV4 S;  4M6X A;  3ZMZ A;  1OMI A;  4OMY A;  3EYI A;  2V1D A;  2O61 A;  3QU6 A;  5FD6 A;  3LA2 A;  2IVM A;  1REP C;  4A5M A;  3N4M A;  2STW A;  4B8X A;  3WTU C;  4I01 A;  4UUV A;  1TNT A;  1JHF A;  3LST A;  3F8C A;  3KP6 A;  2FRH A;  1FT9 A;  3TO7 A;  1ON1 A;  3B73 A;  1ZHF A;  4HV6 A;  4A0X A;  4S05 A;  2LKP A;  2PBI A;  4WCG A;  3KLO A;  1KGS A;  3CUQ B;  1ZAO A;  3ELK A;  3GFJ A;  3FM5 A;  3T5X A;  1J5Y A;  4UXN A;  5D4R A;  2ZME A;  3OV8 A;  2G7U A;  2DFI A;  2W84 A;  3V7S A;  4ZYG A;  1I27 A;  4OOI A;  2NNY A;  1Z7U A;  5K5Q A;  5ILV A;  2BYV E;  1TTY A;  1MDM A;  1BIA A;  2V9V A;  2VBW A;  3EYY A;  2HOE A;  2PN6 A;  1ZRF A;  1MJA A;  5CYV A;  4OIR F;  5HLI A;  3E6B A;  4M6Y A;  5FFZ A;  2XRO A;  2MBF A;  3QRF F;  3JAM Z;  1G3T A;  4RGS A;  5E1Z B;  2C6Y A;  1BIB A;  4O3M A;  1QZY A;  1Y0U A;  5FLX K;  1R1T A;  3CO7 C;  4GGG A;  5DYM A;  2EWN A;  3LAP A;  2EFW A;  5HLG A;  2V79 A;  5J6X A;  4HX4 A;  1XMK A;  2ISY A;  1ONV A;  3SQN A;  4GCV A;  1RUO A;  3V8J A;  1QBJ A;  2KJC A;  4BHP A;  1LDJ A;  2PMU A;  2D1V A;  4OIN F;  5L3E A;  3COA C;  4RGU A;  4O5V A;  3DPL C;  5DUK A;  1S6L A;  3DPT A;  4G6D A;  4AWX B;  5HDK A;  5LHH A;  2FNA A;  4GXO A;  2UZK A;  4EJW A;  2XRN A;  1ZRE A;  1QO0 D;  3TDU C;  2DQR A;  3PQJ A;  2O3F A;  3BJO A;  3WU1 B;  2PI0 A;  2A5Y B;  3GFM A;  2FOK A;  2PJP A;  2F2E A;  1KU9 A;  2M5W A;  2NYX A;  1RUN A;  2VE8 A;  3ZN1 A;  2ZCW A;  5F1R A;  1XGO A;  1HW5 A;  1U78 A;  5BMZ A;  5LGT A;  1JHH A;  4LB5 A;  4PGH A;  3DKW A;  1IZ1 A;  4AIJ A;  2VC0 A;  5IT9 K;  3QOP A;  2EV6 A;  4ESB A;  4OMZ A;  2CSO A;  3M9A A;  5AIQ A;  3I54 A;  2HYF A;  4KMF A;  2VT3 A;  2CFX A;  5A2Q K;  1IW7 F;  1OYW A;  1H9T A;  2CQK A;  2JPC A;  1RIO H;  1Z1D A;  4HF0 A;  1T6S A;  1QGP A;  1HQC A;  2NRA C;  2HFH A;  2CWE A;  2UXX A;  4HYE A;  2QZ8 A;  2EFQ A;  2ZFW A;  2RKH A;  3QU3 A;  2MH9 A;  1MD0 A;  5TRD A;  3WGI A;  5HDG A;  2FNP A;  3NRV A;  1FSE A;  3MEX A;  4YFN F;  5E1W A;  5D5V B;  4KN4 X;  4L9N A;  5CLS A;  3RI4 A;  2QEN A;  2QM3 A;  3G73 A;  1OYY A;  4EJU A;  2IPQ X;  3HIF A;  3GYH X;  3ZP5 A;  2K7L A;  4ESF A;  1G6N A;  1J2X A;  1SD5 A;  1SFE A;  5CVI A;  3L7W A;  1YO5 C;  1BI2 A;  3DF8 A;  2CG4 A;  4XLP F;  2MLK A;  1W7P B;  5CVV A;  2Q0O A;  1R58 A;  1YW8 A;  3ZMT A;  1FX7 A;  3I5U A;  4ETS A;  1WI9 A;  1TLH B;  2DO7 A;  2COM A;  4U7B A;  4F7Z A;  3F8B A;  2IW5 A;  4CXF A;  3S2W A;  1WRJ A;  5E18 F;  3WGH A;  4PDK A;  3FZV A;  2A69 F;  3AAF A;  1MJB A;  1WSU A;  2XAH A;  3F22 A;  1XSV A;  2FU4 A;  5E20 A;  1Z6R A;  2XIG A;  1HST A;  2ZNY A;  2PG4 A;  1J75 A;  3PQK A;  4HV5 A;  2OZU A;  3KEQ A;  2BE5 F;  3HOS A;  3IWZ A;  4A6E A;  5LLQ A;  2BEO A;  1B9M A;  3GEZ A;  4WXD A;  3KFW X;  4I02 A;  1TQM A;  3P9K A;  3GFI A;  2QUF A;  2ZBK A;  2P5K A;  2J5O A;  4WF2 A;  1QQI A;  2HR3 A;  1P2F A;  4NQW A;  3HTS B;  1LB2 A;  4EJT A;  2FSW A;  2RQP A;  2OA4 A;  4I0B A;  2LDU A;  2P7V B;  3WE2 A;  2FEZ A;  2DTR A;  5KVR A;  3KP3 A;  4GO1 A;  3DEU A;  4BHC A;  2WTE A;  4MQ9 F;  1AOY A;  4U0V A;  3GUD A;  1SFU A;  2KRF A;  4JK1 X;  2V1U A;  4HDU A;  3J80 Z;  1S3J A;  1HW2 A;  3W6J B;  5LRS A;  2R3S A;  1E2X A;  3IKV A;  4H0E A;  1BBY A;  2PLY A;  3GW2 A;  4KMU X;  3WTT C;  1K78 A;  3FXQ A;  1CF7 A;  2X0L A;  4P96 A;  2KIU A;  3HSE A;  2K4J A;  3NEU A;  1F1Z A;  1F4K A;  4S04 A;  3IKT A;  4KYW A;  3SZT A;  3HRT A;  4LK1 F;  5DEQ A;  5CVU A;  1SFX A;  1O3R A;  3IC7 A;  1I5Z A;  3F8F A;  5ILS A;  1OR7 A;  2OQR A;  2E1C A;  1ZH5 A;  1HKT A;  1Z91 A;  2WC2 A;  4U0Y A;  5D5U B;  3SXY A;  3HHG A;  1KU7 A;  5TJJ A;  4FX0 A;  2P8T A;  5DD8 A;  4HQE A;  1U5T A;  1YG2 A;  4LGW A;  5CVJ A;  2XAJ A;  2FA5 A;  4ON0 A;  2VBX A;  4OIP F;  3MFK A;  4BH9 A;  3Q5F A;  5E1X A;  4U88 A;  2M1B A;  1FPQ A;  4A0Z A;  2K27 A;  4XSZ F;  2FBI A;  4LLG F;  2G9W A;  2ZXJ A;  1BJA A;  2Q8K A;  1STZ A;  3KP4 A;  1D3Y A;  2QBY B;  4IRI A;  4KDP A;  4CGZ A;  2P5L C;  1ZLJ A;  5FD5 A;  4MEY F;  4WK8 F;  1KQ8 A;  5L3B A;  4WWC A;  1K79 A;  4ENJ A;  2D2W A;  1BN5 A;  3GZ5 A;  4FX4 A;  1ODD A;  2YR2 A;  1B4A A;  1O3Q A;  3U2R A;  3WTY C;  2GZW A;  1IXC A;  2PFB A;  4ENK A;  3FX3 A;  2XAG A;  4RGR A;  1YQA A;  4EQQ A;  4ZZD A;  2W57 A;  4CHU A;  3WOD F;  2VT2 A;  4ZZL A;  1IN6 A;  1HKS A;  1SMT A;  3F6V A;  2KIM A;  4A12 A;  1WQ2 A;  1PUE E;  5D5X B;  3I58 A;  1FBQ A;  1U6G A;  2DU9 A;  1IN7 A;  1A04 A;  1GHC A;  2RNJ A;  4HX8 A;  3V7R A;  4N9I A;  4N9H A;  4EV0 A;  3I59 B;  1IN4 A;  4WXC A;  4UHT A;  2RV8 A;  2FXA A;  2J5P A;  3IRR A;  3P9I A;  3L09 A;  1ZG5 A;  4I2O A;  1QPM A;  4Q4Z F;  2HTS A;  2F5F A;  5LBQ A;  4R1H A;  4G7H F;  4XLN F;  1XSD A;  5JVT A;  3DFG A;  4BXU A;  4O6J A;  2YX7 A;  3GXO A;  5DCM A;  2Z5U A;  4LB6 B;  1ULY A;  1IF1 A;  5K1Y A;  2FML A;  3I4P A;  4GYG A;  5CVR A;  1EH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...