1UFMA

Solution structure of the pci domain
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
84
structure length
84
Chain Sequence
GSSGSSGGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETREASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the PCI domain
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords COP9 complex subunit 4
total genus 16
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2003-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ufmA00
3F6VA 3JTGA 1ZN2A 2Z99A 5E18F 3MZHA 2VE8A 2HS5A 2R3SA 2Y75A 3H3ZA 5D5VB 3DPTA 2OAZA 5JFRA 1I1SA 2OBPA 4ENNA 1T6SA 4BHBA 2RNJA 4RGUA 3SZTA 1YTYA 2LF8A 2YSRA 1J0RA 3H92A 2UWMA 2VT2A 5J6XA 1SFUA 3V7CA 2XKOA 3L00A 1EH8A 5DCMB 5JVTA 5IT9K 2FOKA 2DW4A 1W7PA 2DQRA 3W6KB 1MDMA 3MFKA 2L4MA 1G3YA 1HXDA 3RYPA 1BI0A 4CDGA 1GXPA 2VN2A 4JK1X 1L0OC 1IZ1A 1DPUA 2RKHA 4MEXF 2EA2A 3OV8A 3WTWC 3SQNA 3ZN0A 3ULQB 1GXQA 2B0LA 4A0YA 5FB2A 1ON1A 4HF2A 3WTTC 1R22A 1C0WA 1D8JA 1AOYA 2GAUA 4A0XA 1KYWA 2FMYA 2STTA 5FD6A 3C1DA 4LMYA 1WKMA 2EA4A 3ML6A 2G7HA 1FBUA 5KVRA 2HFHA 2O6GE 3VODA 3FXRA 4LJZF 4A5MA 3KETA 2FBIA 1BI1A 1E2XA 4B8XA 2Q2EA 1BIAA 3GFMA 2P4WA 5HOOA 2MLGA 1Z1DA 4WXCA 2A69F 2PQ8A 2RDPA 3J81Z 2DTRA 2P5LC 3E3VA 3L9FA 2LSOA 4MGRA 2NNNA 5D5UB 5A2QZ 2ZJ2A 4E70A 3QOPA 4L18B 2P7VB 1PUEE 2L4AA 2P6TA 5LGNA 2VOPA 3HUGA 1B4AA 3OOPA 1LDJA 3F8CA 4IPAA 3J7AO 2A3SA 5ICEA 2W25A 5IT3A 3ZMVA 4IF4A 3WGHA 1WI9A 2VOOA 2YR2A 2H6CA 1G3SA 2IA1A 4EMSA 4L9NA 3K9TA 4EGYA 2D45A 1HSJA 3VB2A 4ENKA 3ROUA 4I0AA 1E17A 2D1VA 4LB6B 1HKSA 3V8KA 1Y0UA 3E6DA 1OKRA 4OIQF 2M30A 2XUBA 4Q48A 2XROA 2ZKZA 4BAYA 1HW1A 1SD4A 3EETA 1O3QA 5AIQA 1XB4A 4G94A 4G6DA 3F8BA 4ENJA 2QBYA 1XDSA 4HX4A 1QPMA 3HYIA 4ZZLA 1CF7B 3HIFA 4ASNA 1U3EM 3ABTA 2IW5A 3TDUC 1YLFA 3I4PA 1TW2A 4UVAA 1MDMB 4ZZDA 4U0WA 3EDPA 2DO7A 3F8FA 4IRIA 4A2UA 3BY6A 2K7LA 1BBYA 3DQVC 5D5XB 1O3SA 2XVCA 3GFLA 5LEJA 3RDIA 3RPUA 3ABUA 1SD5A 3CUOA 2MC3A 1MJAA 3HRSA 4M71A 4H0EA 3GO5A 4UV8A 2LNBA 4Q5SF 1LEBA 4KN7X 3M1EA 5E8GA 3R61A 4HX8A 2LF7A 2VXZA 1Z6TA 3F21A 6PAXA 1MJBA 3N4MA 3BJAA 1J2XA 3QP6A 2HTJA 3JSPA 3COAC 3H3UA 2A61A 1MKMA 1BIBA 1DUXC 2C6YA 2K27A 2KKOA 2IP2A 2FSWA 3QU3A 2EJRA 3ZMTA 3T0YA 1KQ9A 2M45A 1FNNA 1XGMA 1DPRA 1O7FA 2NRAC 1U78A 1GHCA 4EM1A 3W6JB 3V4GA 3U1DA 2STWA 4QWQA 2RN7A 1JHFA 2FNAA 4KIGA 4O6JA 4I01A 5FLXZ 4M6XA 2XAJA 1XMKA 4A6EA 3MAJA 5CVVA 1R36A 1USTA 3LAJA 3NEUA 4ENMA 3ELKA 5DDGA 2ISYA 4KFCA 5D6FA 2H94A 1OPCA 3I64A 4I09A 2QQBA 4PGGA 1BM9A 1G6NA 1O57A 2R7DA 5DV5A 4D0PA 4OMYA 4Q47A 1T39A 3L2CA 3WODF 2KIMA 2JTVA 2FEZA 3IWFA 2UXNA 4GCVA 2GWRA 2UXXA 1RI7A 4BYYA 3WGIA 1G4DA 2VODA 2RVCA 3RPQA 1OYIA 2GZWA 2XGXA 3ERED 1WWXA 3V8LA 2ISZA 3LQQA 1LQ1A 1T0FA 1FP2A 3G3ZA 2K02A 5FLXK 3L09A 1RIOH 1IN7A 2R7FA 1IW7F 2K4BA 2V1DA 2W84A 3IRRA 4S04A 1SMTA 2ZXJA 4M9XA 2COMA 2L3DA 2FE3A 2MD5A 1HBXG 4CHUA 1KU3A 5HLHA 4KIBA 4EJTA 4HV5A 3IWZA 4EV0A 3RYRA 4P9FA 4ESJA 1BJAA 1P4AA 4UVCA 4G7OF 5L3CA 3LWFA 3CJNA 3VEPA 1ZAOA 5HS7A 4L9JA 4M6YA 1U6GA 4IRHA 4HZFA 2ZFWA 3DKWA 1LJ9A 2V79A 3RKYA 4CZZA 4BQAA 1BI3A 3BPXA 5HDGA 2A6EF 1F4KA 4U7BA 5F6FA 1S3JA 4Y13A 4R1HA 2G7UA 3WG9A 3FM3A 3KFWX 4R79A 2Q0OA 2PBIA 2KRFA 1W4MA 2MBFA 1LDDA 1P4XA 4KNYA 1LVAA 1GVJA 5D4RA 3DPLC 4I7HA 2H6BA 1JXSA 3QPTA 3IL2A 5TRDA 3C18A 2J5PA 3LFKA 1S29A 2BBYA 1BN5A 1HQCA 2OA4A 3R4KA 4JQFA 4UNOA 3RI4A 3IKVA 2FNPA 1KU2A 2F5CA 5F1RA 5ILUA 4DQ2A 1ON2A 2JSCA 2QENA 5BQTA 3KEQA 4U88A 1SD7A 3WTZA 4AD9A 1R58A 4ZH4F 3HTSB 2RQPA 3B02A 3GEZA 2XRNA 2M5WA 5FGMA 1KA8A 5LGTA 1B9NA 3MWMA 3BP8A 4A12A 3C7JA 4FT8A 3M7GA 1IN5A 3SHFA 1FOKA 5DCFA 2BEOA 4YIFA 1R1TA 4KMFA 2DK5A 2XAQA 2O03A 4ETSA 2P8TA 5D8LB 4HA8A 2DPUA 4EJUA 2DK8A 2BV6A 5A2QK 2YX7A 1JE8A 1W5SA 5E8IA 2EFWA 4KYWA 3J81K 4L5IA 2E1NA 3GW2A 1Q1HA 2RV8A 1EH6A 4GYIA 4GO1A 4I0BA 3TKYA 5JI6A 5LRSA 2GIVA 2AS5F 1SFEA 3GVAA 3V7SA 4QLCU 5E1XA 1HW2A 2V1UA 1FY7A 1XCBA 3ZPLA 1B1BA 1ZRCA 5F64A 3SFZA 2XV4S 3BDDA 2JPCA 3BOQA 3EQLF 5DD8A 1O3TA 3TOAA 1T38A 3P9CA 2HQNA 4P5OA 3WTXC 3C3WA 2NAZA 4N0BA 3FMRA 4RGRA 4PDKA 1XSDA 1IXSB 1MJ9A 3K0LA 1D5VA 5L3DA 2BYVE 2LDUA 2Y48A 2QM3A 1MGTA 4DNCA 2EFQA 3FF5A 1R1VA 2CQKA 3T1BA 2WC2A 3BWGA 1R1UA 3WTVC 3VFZA 1FT9A 1XSXA 4EM2A 4G7ZF 2PJPA 5E1WA 3GYHX 4CXFA 4I02A 2ZMEA 2M1BA 3U9GA 2OQRA 1S8NA 1U5TC 4ESFA 3L7WA 1PP7U 2IRFG 1TNTA 3HSRA 3O3KA 1I1GA 2PG4A 2VBYA 4O3MA 1U2WA 1KGSA 3FWEA 2F5DA 3E5UA 1R5HA 3O2PE 4AVPA 2FBHA 4YG2F 1QO0D 3SXYA 3F3XA 3ZMDA 3FHZA 5BPDA 1IXRC 4LLGF 3ZN1A 4M72A 5LHGA 1BOAA 2WTEA 5FFXA 3HRMA 3DFGA 1Z7UA 3HSFA 3FX3A 3HRUA 5DEQA 5L3GA 3KE2A 2ACJA 1PDNC 2E7XA 1SFXA 3BJ6A 4GXOA 4L0ZB 1MD0A 3T8TA 3WE3A 4OINF 4JBAA 1XCVA 3KP6A 1XD7A 2CSOA 4KN4X 3WE2A 3REOA 4HW0A 4BHPA 1FWZA 3F23A 3NQOA 1S7OA 1IXCA 1R23A 5K1YA 4LFUA 4G9YA 4IHSA 3HHGA 4LD5A 1Z91A 4LK0F 5BOXA 3PQJA 3GLXA 3FMSA 2IA0A 2Z5UA 1YQAA 4XSXF 4F7ZA 4XLNF 2P5KA 3GZ6A 2O61A 1S6LA 4WXDA 5E1ZB 1I27A 4RGXA 2IVMA 3LQRA 5D8KB 3TQNA 1IRGA 4LG0B 3EUHA 2EK5A 1FC3A 1HKTA 1LEAA 5ILSA 5FD5A 4ESBA 1W5TA 4KUMA 4CO8A 2MH2A 2OQGA 3BROA 5LLQA 4NB5A 1ZH5A 3JSOA 2EV0A 5LBQA 2HKXA 5HDKA 2F5EA 1W7PB 4EQQA 2GQQA 2WV0A 1UB9A 4M74A 1Z6RA 1FP1D 3B73A 1HSTA 1XSVA 5DUIA 5ICFA 4RB0A 1SMYF 2W24A 4A5NA 2QQ9A 1J5YA 1W7PD 3E6BA 3BJOA 4CYDA 2EV5A 1BC7C 1PP8F 1ULYA 2UZKA 4KICA 3VOEA 5HS8A 1J7KA 3R6SA 3F72A 1U5TB 3P7NA 5BPIA 3Q9SA 1JGSA 5DCMA 4M9ZA 3WTUC 1USSA 4G7HF 3U2RA 2XAFA 3HRTA 1P6RA 4M73A 5JHUA 2CG4A 2XHKA 1YS6A 4OOIA 2JT1A 4IJAA 3HOSA 3K1PA 4GGGA 2X0LA 2E1CA 3J80K 1KU7A 4NQWA 2Z9OA 4AIKA 2ADUA 3PQKA 4RS8A 3DEUA 5L3BA 2DBBA 2RC4A 2IA2A 2DFIA 1YW8A 2XAGA 3FXQA 2XAHA 2Z33A 3GWZA 2A68F 3LA7A 4WCGA 3F22A 1RZ4A 4L9TA 1R7JA 5H6QA 2JZYA 3AAFA 4XSZF 3QP5A 1CGPA 4AIHA 2GA2A 3M9AA 2IPQX 3KLNA 3ZP5A 5JR3A 1LNWA 1HW5A 2EV6A 2EFPA 4LB5A 2VONA 3KP3A 2EFOA 4GYGA 4HV6A 5LHIA 1A04A 3RKXA 3MEXA 4MHGA 1QZZA 3RJPA 3TO7A 1F9NA 2PFBA 5J8FA 3FMQA 4I2OA 4HYEA 3ZMUA 2ZNYA 2K4JA 1ZLKA 4HOBA 1HKQA 4NHJA 1IN8A 4IRGA 2MH9A 2K86A 2P7CB 4XBFA 2HKOA 4MQ9F 4G8XA 4HF1A 2O8XA 1CF7A 4G6QA 3I5UA 4ZYGA 1SAXA 1S7AA 2DLLA 3CO7C 1DP7P 2FU4A 1F5TA 1ZRDA 1FZPB 1H9GA 3CO6C 4L9VA 2KIFA 1Z05A 2BE5F 1H0MA 3D5LA 1UHWA 5DD4A 4HBLA 1YIOA 3KCCA 2E7WA 3EYYA 2FMLA 4L0YB 5CVRA 4MTEA 2KJCA 4YIIA 2A5YB 1B9MA 2IT0A 2FA5A 4Q4ZF 2OD5A 1XDUA 4U0YA 3KP5A 2HR3A 3RTRA 1ZHFA 3IRQA 4LGWA 5ED4A 3I53A 3ZMZA 1ZG3A 3I59A 3QU6A 1H9TA 4LG0A 3CUQA 3HSEA 4KT5C 1OR7A 3HHHA 2ETHA 2L54A 1U5TA 5L3FA 1QQIA 2O3FA 4KA4A 1T98A 1FYKA 1YG2A 5LEKA 5DUKA 5BS6A 1LB2A 4AIJA 1IN4A 3PFIA 4HQEA 3DXJF 2M87A 4BXUA 3ZQ7A 2EWNA 2DI3A 1V3FA 3QRFF 3E97A 3FZVA 3KP2A 3R0AA 3GF2A 3Q9VA 3I54A 5CVIA 3ZMSA 3HTUA 2QWWA 1EV7A 3I71A 2PEXA 1IN6A 2A6HF 3LA2A 3MCZA 3GFJA 4PZJA 3EYIA 4EVIA 2NNYA 4KIFA 4FX4A 4LLNA 2NS0A 3JW4A 1B6AA 1ZG5A 4Y17A 5EEHA 4AWXB 3JAMZ 1ZREA 2PI0A 4HX7A 3KP7A 1OMIA 5CVUA 2Y0MA 4RAYA 2ZBKA 4IHTA 4O5VA 2GA1A 3K1NA 4M9SA 3CDHA 5DYMA 4HDUA 5ERIA 3GFIA 5J8CA 3E6CC 1K7AA 4P55A 1IF1A 4MTDA 3RIRA 1TLHB 3DV8A 2W85A 2ZNZA 3RKWA 4UVBA 1TBXA 2M8EA 5CLSA 2FBKA 2VC1A 5K5OA 2HDCA 4CICA 3JAMK 2QLZA 3P9KA 2V6CA 4MNUA 2PMHA 2ZMEB 5HLGA 3ECOA 3GX4X 1MZBA 2V9VA 1QBJA 2YPRA 1Z9CA 1G3WA 1B59A 1P2FA 2V1XA 1TQMA 4A6DA 1XGSA 4WF2A 4ZYHA 2D1HA 2WWYA 2AXLA 3KZZA 3E6MA 3K69A 3TDZC 1YFHA 1BI2A 3DF8A 3I59B 4IVNA 1FLIA 1TQIA 3E5XA 4S05A 1FSHA 3I0TA 4PCQA 5CYVA 2XKPA 2CO5A 2ESNA 2PMUA 2L01A 2MLKA 2GXGA 4OU0A 2LKPA 1ZARA 1OYWA 1R5GA 3O6BB 1FYLA 2Q8KA 1J9IA 3V8JA 2X4HA 1KQ0A 4UV9A 2IJLA 1IUYA 3WU0A 4N9HA 4ZYEA 1ZGJA 1ZRFA 4EJOA 3WGGA 2GXBA 5BMZA 1EH7A 4IXAA 3BPVA 5FFZA 1D8KA 4LK1F 3WU1B 2FRHA 3T8RA 3KZYA 3CLOA 1TW3A 1ZYRF 2OZ6A 3TO9A 1YW9A 3TOBA 3CTAA 4EJVA 3N97A 4FHTA 3GZ5A 2F2EA 4YFNF 4OIOF 4HAMA 5HDNA 1I5ZA 4K2EA 5AONA 2CW0F 2YU3A 3KEOA 1XGOA 3LSTA 1YS7A 5D4SA 1FBQA 2QUFA 4HLYA 3E5QA 2QVOA 5EEGA 2PLYA 1SD6A 2L02A 1LDKB 3V7RA 4RB1A 1DDNA 1FX7A 3KLOA 4U0VA 5AIPA 1J75A 4FX0A 3HOTA 2DU9A 2YX4A 3DP7A 1QNTA 2HYFA 1KQ8A 5LRRA 4UUVA 1L3LA 1OYYA 3K1MA 2BGCA 2ESHA 3P9IA 4HF0A 5HLIA 1FYMA 5KK1A 2OZUA 3ISPA 1K79A 1BC8C 4EJWA 3MZYA 3TGNA 2VT3A 5D6EA 3LAPA 1TNSA 3MQ0A 4YFKF 2H27A 4KMUX 4RGSA 3QPHA 1FPQA 1REPC 5K5RA 1STZA 5ILVA 4B09A 2VBXA 1UHMA 2TDXA 3I58A 2VC0A 1ONVA 1P92A 2FQ3A 5D5WB 4Z2YA 4Y15A 1K6OA 3J80Z 3CUQC 1RUNA 2PN6A 2FXAA 1RNLA 2NYXA 4OIRF 1XMAA 5E20A 2HGCA 5IT9Z 1O7LA 2CYYA 2P5VA 2EFNA 3FXUA 1K78B 5ICGA 4N9IA 2MA3A 3JTHA 3QAHA 1ZGAA 3F8MA 3T5XA 2ELHA 4HDVA 5CJ9A 3IC7A 3S2WA 2D2WA 4EGZA 1VTNC 1D3YA 3Q5FA 2HWVA 2HZTA 2Z3YA 1FSEA 3GUDA 1JHHA 2HQRA 3M8EA 1T2KA 4RAZA 2EB7A 1TTYA 1R00A 4ZYDA 1IAWA 1V4RA 1ZG1A 3BZ6A 1NHAA 1YYVA 3TO6A 5HS9A 5L3EA 2CGPA 4UHTA 3FM5A 5LHHA 1QGPA 4RB3C 3R60A 3M8FA 1FBSA 5LGUA 3KP4A 3GXOA 4P96A 1WQ2A 4BH9A 1J59A 2VBZA 2VE9A 1YW7A 2FF4A 4U7DA 1UFMA 2QQAA 1O3RA 1XGNA 2RGVA 5E17F 3K2ZA 1QZYA 2KIUA 4HLXA 2G9WA 2CFXA 1F1ZA 2CWEA 4MQVA 2P6SA 3F6OA 5FO5A 1ZLJA 1IRFA 3WTSC 2O0YA 4P9UA 2QZ8A 4CGZA 4OMZA 3R0JA 4EM0B 1KYZA 2JPBA 1KU9A 2OU2A 2A07F 1U8RA 4WX9A 5TJJA 2H09A 4KDPA 4UXNA 5H20A 4XLPF 2DAOA 4OIPF 2HEOA 1AWCA 4PGHA 2DT5A 3WTYC 1G3TA 2J5OA 4HQMA 1K78A 4WXHA 3SZPA 1WSUA 2HOEA 3LA3A 3D0SA 4LLLA 4WK8F 2HTSA 3IKTA 1I6XA 1ODDA 3ECHA 4I98B 2XASA 5CVJA 4TV7A 4RB2C 5H6RA 4ON0A 2HYGD 3G73A 2KJBA 1UCRA 1X3UA 3CUQB 4WWCA 4MEYF 2JRTA 4YFXF 5HVQC 2F5FA 3IHUA 1XN7A 2QYOA 4XRFA 4BNCA 5K5QA 2VBWA 1YO5C 4L5JA 4R8HA 2W57A 1TQPA 3NRVA 5ICCA 2XIGA 4BHCA 2ZCWA 2DPDA 1P4WA 3F8NA 2ZO4A 2QBYB 1WRJA 1RUOA 4A0ZA 2DQLA
chains in the Genus database with same CATH superfamily
1POGA 3F6VA 3F0CA 5E79C 2WY8Q 3JTGA 1ZN2A 3F9KA 2Z99A 3VYUB 5E18F 3MZHA 2VE8A 2M7AA 2HS5A 2R3SA 1VQPI 2Y75A 3H3ZA 3PNTA 5F04A 5D5VB 3DPTA 2OAZA 5JFRA 3A01B 1BJZA 1I1SA 5J40A 2OBPA 4E7KA 2E19A 4ENNA 1T6SA 4Y4RA 4BHBA 2JA6J 2RNJA 4RGUA 1LVKA 3SZTA 3JRCA 1YTYA 2LF8A 1A35A 2YSRA 2K5CA 1J0RA 1QRYA 2JJ7A 3UNGC 3H92A 4HG2A 2K9MA 4XKBA 1TWCJ 1ORKA 5J3LA 3H0DA 4XK4A 3ZQIA 2UWMA 2CMPA 1K4TA 2VT2A 5J6XA 1SFUA 3V7CA 5DM7F 2XKOA 2NVTJ 3CP2A 5IP9J 3L00A 3GTPJ 1EH8A 1VF9A 5DCMB 1MNMC 5JVTA 5IT9K 2FOKA 1OR7C 3O8GA 2DW4A 1W7PA 2DQRA 3W6KB 1MDMA 3MFKA 2WB1N 2F4OB 2GXAA 2ME0A 2L4MA 1G3YA 1HXDA 3PFYA 3BTLA 3RYPA 1BI0A 4CDGA 2IS1A 1GXPA 2VN2A 4JK1X 1L0OC 3S2HJ 1IZ1A 4D5CA 4MFEA 1DPUA 2RKHA 3PIPF 4MEXF 5HODA 1X3ZB 2EA2A 2VJ5A 3BR0A 3K4KA 1UG2A 4CCMA 3FKIJ 3OV8A 3WTWC 1OCTC 3SQNA 3ZN0A 3ULQB 1GXQA 2B0LA 4A0YA 2LLKA 1ON1A 5FB2A 1MSEC 4HF2A 3MVPA 3LOCA 3WTTC 1R22A 1C0WA 1D8JA 2Y0SN 2MABA 1AOYA 2GAUA 2IS2A 4A0XA 1KYWA 3H1CA 3LSRA 2FMYA 2STTA 1X1PA 3LSPA 1B72B 3H9QA 5FD6A 3C1DA 3I55I 4A3MJ 2FQ4A 4LMYA 1WKMA 2EA4A 2BOLA 2ZFUA 2IAIA 2G7HA 1FBUA 3ML6A 4BUPA 3PIOF 5KVRA 2H1KA 2E1MB 2HFHA 1YJ9I 2BY0A 3W2WA 2O6GE 3VODA 3RSNA 2MG4A 3FXRA 2F4IA 4LJZF 3GTOJ 4L5EA 2YS9A 4A5MA 3KETA 2JRMA 2FBIA 1K83J 4XN3A 1BI1A 1E2XA 4B8XA 3OYNA 2Q2EA 1BIAA 1SC7A 3GFMA 2P4WA 3QYBA 2MLGA 5HOOA 1Z1DA 2OCEA 4WXCA 4B43A 2A69F 2PQ8A 2RDPA 2XAUA 3QYEA 5IYCJ 4QTRA 1GVDA 2E71A 3QWLA 4B1RA 3J81Z 2DJNA 2CW7A 2DTRA 2P5LC 1XPXA 3E3VA 3L9FA 3QYFA 2LSOA 4MGRA 2NNNA 1V54H 5D5UB 1BOBA 5A2QZ 2ZJ2A 4E7HA 4E70A 3QOPA 2BY1A 4L18B 2P7VB 1YX5A 1PUEE 2L4AA 1N77A 2P6TA 4UUTA 3AG4H 5LGNA 1GT0C 1APLC 5EZGA 3LNQA 2VOPA 3HUGA 3GTQJ 2UV1A 3SDBA 3JRGA 1B4AA 3OOPA 1LDJA 1A5JA 5JHFA 3F8CA 4IPAA 5JLWA 1I39A 3M3YJ 1W5CC 2A3SA 5ICEA 3LFUA 3J7AO 2EZLA 2W25A 3ZMVA 5IT3A 1T95A 2DDAA 4IF4A 4CYCA 2LYCA 3HL2A 2L9NA 1OQYA 3WGHA 3FXOA 1WI9A 3SYTA 4BJTA 4XOTA 2VOOA 2WV1A 2YR2A 2H6CA 1G3SA 2IA1A 4EMSA 4XLCA 4L9NA 3K9TA 4EGYA 2D45A 1RR7A 3G2BA 1HSJA 3PUBA 3VB2A 4ENKA 3GTJJ 4JYKA 2V1NA 3ROUA 4I0AA 1E17A 1V5GA 2D1VA 4LB6B 4XOPA 5M3MJ 1HKSA 3V8KA 1Y0UA 3KZIC 5GAGJ 4XLHA 4CH7A 3E6DA 1ZGWA 1OKRA 1IV8A 3A4CA 2HI3A 2IGMA 4CCJA 4OIQF 1J09A 2M30A 2XUBA 4Q48A 2XROA 2ZKZA 2W7NA 4BAYA 2EILH 3CP8A 3ABLH 1HC8A 1HW1A 1SD4A 1NK2P 3EETA 1TWAJ 1A6IA 1QHGA 3HBLA 3SZGA 1O3QA 5AIQA 3NWTA 1LKXA 1XB4A 4G94A 4G6DA 4DOZA 3K4CA 3F8BA 3AG3H 3OSFA 1O4XA 4ENJA 2QBYA 4FASD 1D1BA 2OJED 3JREA 1XDSA 4HX4A 4IQ4A 5FJ8J 1QPMA 3HYIA 4C2TA 4ZZLA 2L9SA 3ZQCA 1CF7B 3HIFA 1MMDA 2DT7B 3RQIA 2LC2A 4HPQA 4ASNA 4YRVA 1U3EM 3ABTA 2IW5A 2OC6A 3TDUC 1YLFA 3I4PA 2EBIA 1W36C 1TW2A 1IV6A 3IH3A 4UVAA 3K6GA 1MDMB 2COBA 4ZZDA 4YEJA 1S72I 4U0WA 3EDPA 1TP4A 2VQGA 2IEKA 2DO7A 3F8FA 2CQXA 3DTIA 5KCMA 4A2UA 1MBEA 4IRIA 1HCRA 2RREA 3BY6A 2K7LA 1ITYA 1BBYA 3DQVC 3BR1A 5D5XB 4KT6A 1O3SA 2XVCA 3GFLA 3K10A 5LEJA 2JVGA 3RDIA 3RPUA 3ABUA 3X2QH 1SD5A 4JOMA 3CUOA 2MC3A 2UUZA 1MJAA 3HRSA 4M71A 4H0EA 2BXYA 2XSJC 5F1JA 3GO5A 4UV8A 2LNBA 4XRSA 2LMDA 4Q5SF 1LEBA 1LFUP 4KN7X 3M1EA 4UUSB 2CS3A 5E8GA 3R61A 2WB1A 2M34A 3HKZN 4HX8A 2LF7A 1UMQA 2BVMA 2VXZA 3NARA 1Z6TA 3F21A 1BR2A 3KYDB 6PAXA 1MJBA 3BQZA 3QQAA 3N4MA 3BJAA 4PJJA 1J2XA 3QP6A 2HTJA 3JSPA 3COAC 3OSGA 3K4BA 1HF0A 2LY9A 1Y0NA 3H3UA 2A61A 4Y33A 5FKKA 1MKMA 2QGUA 1H89C 4XKWA 2XRLA 1BIBA 5J1YA 3ZQFA 1DUXC 3CMAI 1VFCA 2C6YA 2QSHX 2X6XA 1R49A 2KP6A 2K27A 3PNVA 1A6QA 2R7QA 2KKOA 3PSFA 2OUMA 2LR8A 4AYBA 2IP2A 2FSWA 2VKDA 2XF6A 1X19A 2AHQA 1MBKA 3QU3A 2EJRA 3TBIA 2NVXJ 2ECBA 3H0GJ 2L7ZA 3ZMTA 2HDDA 3ZGKA 1YITI 4X6AJ 3T0YA 1KQ9A 2M45A 1FNNA 3S8PA 1XGMA 1DPRA 1O7FA 2R7ZJ 2WADA 2NRAC 4C2MJ 1U78A 5JVGF 1GHCA 2NVQJ 1OCCH 2KQRA 2BZTA 4EM1A 3W6JB 3HOWJ 3V4GA 4PK4A 3U1DA 3WU2C 2HPIA 4I76A 3KX2A 1JT0A 2STWA 1IO2A 4QWQA 3OYKA 3OYJA 2RN7A 1JHFA 3G1LA 1FIAA 4E6KG 1QHHD 2LH9A 1A36A 3K4LA 2FNAA 4KIGA 4O6JA 3ZQGA 3FXJA 4OWRB 1P9QC 4I01A 5FLXZ 4M6XA 2XAJA 2VQCA 1I50J 1XMKA 3H3VK 4A6EA 5F0FA 3MAJA 1LUJB 3I56I 2KL4A 5CVVA 1R36A 3S17J 4RA2A 3JCUC 1USTA 2JA8J 3IH4A 3LAJA 2WBMA 3OYIA 4I99C 3NEUA 2R0QC 1S5LC 2Y2ZA 1DP3A 2E60A 1HA8A 4ENMA 3ELKA 5CKTA 2DA3A 3PNYA 5DDGA 4F92B 2ISYA 1GDTA 3D5RC 4KFCA 4PSWA 5J47A 1NG6A 5D6FA 2K3PA 2H94A 4BBSJ 1OPCA 3I64A 4I09A 3DEWA 1QPIA 1D5YA 3M07A 4W97A 3E7LA 2A6TA 2QQBA 4PGGA 1RC9A 1BM9A 1G6NA 1O57A 2R7DA 4IHVA 3MZ8A 5DV5A 2B7EA 4D0PA 4OMYA 4Q47A 1T39A 3L2CA 2OF7A 3WODF 3HB9A 2KIMA 2JTVA 2FEZA 1Z67A 3KYCB 1UELB 3K2AA 2A05A 3IWFA 2UXNA 4GCVA 2GWRA 2UXXA 1RI7A 1SANA 4BYYA 4YIRX 2LFBA 4FTHA 3WGIA 3O8HA 4B4CA 1G4DA 2VODA 1NH3A 3KYLA 3JRFA 1WJ5A 3EUKL 3ZRGA 2RVCA 4XM3A 1OYIA 2GZWA 3RPQA 3MKWB 1TT5B 2XGXA 5KHDA 1WJDA 3AL0C 3ERED 1WWXA 4IL6C 1F43A 4B48A 3RZDJ 3V8LA 2ISZA 3FK6A 1Y6IA 3OMYA 2Q1ZB 3LQQA 1AHDP 3VYTB 1LQ1A 1T0FA 1FOWA 3S1RJ 1FP2A 3G3ZA 2K02A 3BR2A 5FLXK 1ZTRA 3L09A 1RIOH 1IN7A 4CCLA 2W82A 2E2IJ 2R7FA 1F36A 1IW7F 1GV5A 3GLLA 2K4BA 2AXTC 2V1DA 2W84A 1KZHA 4C3HJ 3IRRA 4S04A 2X9DA 3ABKH 1SMTA 4IOCF 2ZXJA 1D1AA 4M9XA 2COMA 4XONA 2L3DA 1FTZA 2FE3A 3BTIA 2R5YA 5HNHA 2KIQA 3ZOBA 3S3OA 1WZ2A 2MD5A 1HBXG 2Y0SA 4CHUA 1WVRA 3I9V2 2PJRB 1KU3A 3S16J 2HVQA 2AQEA 5HLHA 4KIBA 3EUHC 3ZQLA 1MBJA 4HV5A 3IWZA 4EJTA 3C2BA 3HOUJ 2JSPA 4D5FA 4EV0A 4LG3A 3RYRA 4P9FA 1Z0XA 4ESJA 4Y3OA 1BJAA 1T0FC 2CQ7A 1P4AA 4UVCA 4G7OF 5L3CA 3LWFA 3CJNA 2I5UA 4FISA 2W4SA 1P7IA 1X1AA 3L2UA 1YJNI 5FRMA 3VEPA 1ZAOA 5HLTA 4A3LJ 3K4MA 5HS7A 4NC8A 4L9JA 4M6YA 4V2GA 1U6GA 4IRHA 1M1EB 1HLVA 4E7IA 2IGOA 1SEUA 4LOCA 4HZFA 2ELKA 2ZFWA 3CDIA 3DKWA 4F91B 1LJ9A 2OV7A 3TMOA 1EA3A 4A3BJ 2V79A 3RKYA 4CZZA 4BQAA 3DBLB 2DYRH 2JA2A 2R7RA 1BI3A 3BQYA 1RPWA 3CDLA 5KNLA 1ETOA 3BPXA 4RMNA 5HDGA 1MNDA 5H2FC 2AO9A 3W3CA 2A6EF 1F4KA 4U7BA 5F6FA 4PJLA 1S3JA 3TL4X 2LY2A 5EDNA 1YJWI 1OCRH 4AYBN 3BG5A 4A3FJ 4Y13A 4M3EA 2V9KA 4R1HA 2CRGA 2QA4I 2G7UA 3WG9A 1PJRA 3FM3A 3KFWX 2BHYA 4R79A 5E3OA 4BU2A 2Q0OA 4RLQA 4XRMA 2BXZA 2PBIA 2KRFA 1W4MA 2MBFA 4A3GJ 1VNDA 2Y30A 3KPHA 1K6YA 1LDDA 4FCYA 2VPRA 2LKXA 1RESA 1P4XA 4KNYA 1LVAA 1GVJA 5D4RA 4UUSA 2DA6A 5FKLA 3DPLC 2VQHA 5EG0B 2PMZN 4I7HA 2H6BA 2V9PA 5FKOA 2EZIA 4IQJA 4M6VA 3B6AA 1JXSA 3HPGA 5IOYA 3G6EI 2LG4A 1TWHJ 2DOEA 3QPTA 3DWLE 3CCLI 3IL2A 5TRDA 3C18A 3DLLF 2J5PA 4Y52J 3LFKA 1S29A 2IGNA 3ZXSA 1QU3A 3OWTA 4BJ6C 2ID3A 2BBYA 1BN5A 1K61A 1HQCA 4IX7A 2OA4A 3R4KA 4JQFA 4UNOA 4CUGA 3RI4A 3IKVA 4OAYA 2EIKH 2FNPA 3VYRB 5EF6A 1KU2A 3OIOA 2F5CA 1V55H 5F1RA 5ILUA 1WJAA 5FKMA 4DQ2A 5J4YA 1ON2A 5E3MA 2JSCA 3WHCA 4RBOA 1AKHB 2QENA 2RAEA 3FBNB 3KEQA 4U88A 1SD7A 3WTZA 5BQTA 4AD9A 1R58A 1K4SA 2L9RA 4E7SA 1OLTA 4ZH4F 3HTSB 2R7SA 2CV2A 2CU7A 2RQPA 3B02A 3RQ4A 2GOXB 3GEZA 1JKQC 2XRNA 2M5WA 4D1QA 3TEDA 5FGMA 2XSDC 2VJJA 1KA8A 3RCOA 4GDFA 5GPCA 5LGTA 4U87A 4UB8C 3OR2C 1IGNA 1B9NA 2XC7A 2IS4A 3MWMA 3BP8A 2K3FA 4A12A 1U9NA 3C7JA 2MW8A 4D7NA 1YOVB 1IUFA 4FT8A 3M7GA 1U0JA 3EPZA 3AFHA 1IN5A 2DFHA 3CLQA 3SHFA 5DS9A 1WPKA 1FOKA 2VKEA 5DCFA 2BEOA 1ENHA 3IAS2 1R1TA 4YIFA 4KMFA 3ZQHA 3BG6A 2DK5A 2XAQA 3CCMI 1I3QJ 4ZTFA 5IPAA 2O03A 4ETSA 2P8TA 5D8LB 4HA8A 4AVZA 5B66C 2DPUA 1MMGA 2DK8A 4EJUA 2BV6A 1JUSA 1AA7A 2YX7A 5A2QK 1MH4A 1VQKI 1JE8A 1YRNB 3BTJA 1W5SA 5E8IA 2EFWA 4KYWA 3Q3SA 3DTEA 3TP3A 1VQMI 3CJQB 3ASOH 1B8IB 3J81K 4L5IA 4BE1A 2E1NA 3GW2A 3DPUA 1Q1HA 2PJRA 2RV8A 1EH6A 4GYIA 2R4GA 4GO1A 4BBRJ 3ZR8X 4B47A 2KRHA 2L7FP 5LD2C 4I0BA 1ZELA 1IDZA 4ZDOA 3TKYA 5JI6A 5LRSA 1IRZA 2GIVA 2AS5F 1XS9A 1XG1A 5F08A 1SFEA 3GVAA 3V7SA 5IYBJ 2CJJA 2R5YB 2PX9A 4QLCU 2VUMJ 2XPUA 1BL0A 1NTCA 5E1XA 2VL8A 1HW2A 5TISC 2V1UA 2WAFA 1BW6A 1ETXA 1FY7A 1XCBA 3ZPLA 1B1BA 3NWSA 3GTMJ 2KHMA 1ZRCA 5F64A 3SFZA 2XV4S 3L2QA 3BDDA 1GV2A 2JPCA 2H1LA 1X1CA 3BOQA 2DYSH 3EQLF 5DD8A 3TOAA 1T38A 3P9CA 1O3TA 2HQNA 4P5OA 2XF7A 4IOAF 3WTXC 1JKRC 4QPOA 2QSFX 3C3WA 2BW3B 2BVLA 5GPAA 2NAZA 4N0BA 3FMRA 4RGRA 1MMSA 4PDKA 2QKLB 2L0KA 3H36A 2X1DA 1ERDA 1X4PA 1E0EA 1XSDA 1XTAA 3C2GA 1IXSB 1MJ9A 2O8KA 3K0LA 1D5VA 1RR8C 4XORA 3BZCA 5L3DA 2L7MP 2VKVA 3IH2A 2BYVE 2LDUA 2Y48A 2QM3A 1MGTA 4DNCA 3GZNB 4XKVA 3L2RA 2EFQA 3GBGA 3FF5A 1TC3C 3S1QJ 1R1VA 3AG1H 2CQKA 3T1BA 5B1AH 2WC2A 3BWGA 1R1UA 5KAIC 1X3WB 3WTVC 3CC7I 2L5QA 3VFZA 1DU6A 1FT9A 1XSXA 4EM2A 4G7ZF 2PJPA 5E1WA 3CCYA 2Y9YA 4ABZA 3GYHX 4CXFA 1R4NB 4I02A 2NXNB 1OCOH 2ZMEA 2M1BA 3U9GA 2E5NA 2OQRA 1S8NA 3OOUA 1PUFA 3CZ6A 2M2EA 2ZSIB 1U5TC 1JTXA 4CCKA 4ESFA 1OJLA 3DU5A 3L7WA 4N4OB 1PP7U 2IRFG 3Q0VA 1TNTA 3HSRA 4ZYAA 4ZJZA 3O3KA 4IHYA 1I1GA 1SAUA 2PG4A 1BR1A 1I3AA 4KJZA 2VBYA 2GM4A 3BG7A 1IDYA 4BQOA 4O3MA 3VWBA 1U2WA 2VKHA 1KGSA 2CUZA 4A93J 3A0BC 3FWEA 2KDZA 1DGWY 2F5DA 1YIJI 2PMZA 3E5UA 3OYDA 2Y9ZA 1R5HA 3O2PE 5C4JJ 2LBFA 4AVPA 3QPSA 2FBHA 2CH0A 4YG2F 1QO0D 4BQNA 3SXYA 3ERMA 4ITVA 4EATA 3F3XA 1Z77A 3ZMDA 3FHZA 3HG9A 5BPDA 1IXRC 4LLGF 4XQFA 3N05A 3JRBA 1OISA 5E3NA 3ZN1A 1KONA 1MNEA 4M72A 1RKWA 5LHGA 1BOAA 2DMNA 2WTEA 5FFXA 4E7ZA 1ZR4A 3LSJA 3CCJI 3HRMA 3DFGA 3LMMA 1Z7UA 2LOOA 3ESWB 3HSFA 1Z3YA 5M5YJ 3FX3A 3HRUA 2JA5J 5DEQA 1BA5A 5L3GA 2Z16A 3KE2A 3CMYA 2ACJA 2LKSA 1PDNC 2KT0A 2DA5A 5HNFA 2E7XA 1SFXA 3BJ6A 4GXOA 4JX5A 3SEQA 4L0ZB 1MD0A 3T8TA 3WE3A 3JRDA 4OINF 2MGQA 1X2MA 3LSIA 3DKXA 2NOGA 3C2HA 2XDVA 4JBAA 1XCVA 5K7ZA 3KP6A 2D5VA 1XD7A 2CSOA 3S1NJ 3I3LA 4KN4X 3WE2A 3REOA 1MH3A 3OS2A 4HW0A 3NAUA 4BHPA 1FWZA 3F23A 2M4KA 1JGGA 3NQOA 2OCCH 1S7OA 1IXCA 1R23A 5C44J 4G6TB 4HSTA 2FUG2 3MKLA 5K1YA 3CC2I 3CD6I 4LFUA 4G9YA 4JP0A 4IHSA 3SDGA 1VQNI 3HHGA 2VPLA 4RDUA 4LD5A 3TW7A 3OYBA 1VZ0A 1Z91A 4LK0F 5BOXA 5FLMJ 3HZJA 3MD2A 3PQJA 3GLXA 3FMSA 3CMEI 2JA7J 2X1CA 3LL7A 4DYQA 2IA0A 2Z5UA 4BS9A 1DQUA 2HOSA 4PUSA 2IS6A 1YQAA 4XSXF 1NG7A 4F7ZA 4XLNF 2HZDA 2P5KA 1WCMJ 3GZ6A 1ZKGA 2O61A 1S6LA 2GIZA 4WXDA 3K4JA 4PSXA 5E1ZB 4RAFA 1I27A 5CPRB 4GFBA 4RGXA 2IVMA 3LQRA 5D8KB 3H5AA 3TQNA 2Y31A 2R7TA 1IRGA 4LG0B 3JRIA 2DA4A 4II2A 1UAAA 1Y8RB 2XGEA 2R7VA 4F93B 1LFPA 3EUHA 2EK5A 3VSLA 4BQQA 2HVRA 4KITB 1VQOI 1FC3A 1ETVA 1HKTA 2O9LA 2LREA 2XPVA 2YU9J 1RRJA 1V5EA 4XKCA 3L2WA 1LEAA 2KFDA 3BG3A 5ILSA 4BXFA 1D0YA 2IGKA 5FD5A 4ESBA 5J4VA 2B63J 1W5TA 4KUMA 2EH3A 2MH2A 4AUXA 1FIPA 4CO8A 2OQGA 3BROA 3CESA 1B72A 2BW3A 1SVOA 5LLQA 4NB5A 1ZH5A 3JSOA 1VQ8I 2EV0A 1H8AC 5LBQA 2K9QA 2HKXA 1Y56A 1JKPC 1YI2I 1IRXA 3SEZA 5HDKA 5FLVA 2F5EA 1N75A 1W7PB 3L2VA 4EQQA 1LE8B 2GQQA 2LTPA 2WV0A 1UB9A 3BZKA 4M74A 2HQAA 1BR4A 1Z6RA 3Q0WA 3J7ZI 1FP1D 4J19A 3B73A 2VJ4A 1HSTA 5FKNA 2L2OA 1XSVA 5DUIA 3OR1C 5ICFA 3CQZJ 4YELA 4M3GA 4RB0A 4A3EJ 5GTHC 1MMAA 3PUFA 1SMYF 3DEEA 2W24A 2R92J 4QPQA 3KIOA 5EZHA 1R5ID 4A5NA 3MKZA 5M3FJ 2QQ9A 1J5YA 3LSKA 1W7PD 4LITA 3E6BA 3BJOA 2NS8A 4A69C 3DU6A 1JJ8C 4CYDA 1WFXA 2EV5A 4JX4A 4D9JA 1BC7C 2VI6A 1PP8F 1ACIA 1ULYA 1GLNA 2UZKA 1D1CA 1HOMA 4KICA 4IHXA 3VOEA 2DJIA 5HS8A 2HXIA 1QA6A 1UG0A 1J7KA 3HJEA 3R6SA 2K9LA 3F72A 1U5TB 4GRIA 4AIDA 3P7NA 5BPIA 1WHUA 3Q9SA 1JGSA 3OS1A 5DCMA 4M9ZA 2XB0X 1SVMA 3WTUC 1X58A 1USSA 4B3AA 4G7HF 3U2RA 3H9JA 2XAFA 3TP0A 2VJIA 3HRTA 2Y69H 2W1OA 1P6RA 4M73A 4AM3A 2EPFA 1QVUA 5JHUA 1G59A 4IO9F 3GCMA 2CG4A 2WAQN 4N4NB 2XHKA 4XIDA 1FMVA 3W6VA 1YS6A 3RKQA 4UB6C 2F6CA 2LVSA 4OOIA 2GOMA 4HRIA 2JMWA 2JT1A 4IJAA 3RPUD 3FXKA 3HOSA 2H8WA 2OTJI 3K1PA 2V6EA 4GGGA 2Z1DA 1ZR2A 4W1UA 2X0LA 3JRHA 1ETYA 2E1CA 3J80K 5IYDJ 1T33A 2AQFA 5C4XJ 3PL8A 1KU7A 4XLFA 3S93A 3FXLA 3Q0UA 4E4HA 4NQWA 2Z9OA 4AIKA 2QEXI 5EG0A 4BGDA 2ADUA 3PQKA 4RS8A 3DEUA 2HDWA 1HDDC 1TL8A 1IC8A 1A31A 5L3BA 2DBBA 2RC4A 4BE0A 2IA2A 3S2DJ 2DFIA 1YW8A 2XAGA 3FXQA 1XC5A 2XAHA 4CYCB 2Z33A 4DYRA 3GWZA 3HEFA 1FJLA 2A68F 3LA7A 3CJRB 4WCGA 3IAM2 3F22A 1RZ4A 1VI0A 4L9TA 1R7JA 5H6QA 1V5FA 2JZYA 3AAFA 2HOTA 3H5RA 3S3MA 2ZC2A 4XICA 4BL0B 4XSZF 3QP5A 3E1SA 1CGPA 4AIHA 2GA2A 3M9AA 2X85A 3HOZJ 3VDXA 2IPQX 1Y1VJ 4BJ5C 1R6RA 5GAHJ 3KLNA 5IP7J 2X6WA 3ZP5A 3CJTB 5JR3A 3IV5A 1LNWA 1JI8A 2KISA 1HW5A 2EV6A 2R7UA 2K9NA 2M0CA 2EFPA 4LB5A 1H88C 2VONA 3KP3A 2EFOA 4GYGA 4HV6A 5LHIA 1A04A 3RKXA 3MEXA 3PO2J 4MHGA 1QZZA 3RJPA 5GADJ 3TO7A 1F9NA 4FQGA 2PFBA 5J8FA 3FMQA 4I2OA 4HYEA 3ZMUA 2ZNYA 4B44A 1BW5A 3H35A 2HQ5A 2M4GA 5GP9A 3GTKJ 2K4JA 1ZLKA 1Y1WJ 4HOBA 4X1EA 1HKQA 4NHJA 1FTTA 1IN8A 4IRGA 1S7EA 2MH9A 2K86A 2DXIA 2P7CB 4XBFA 2HKOA 5JLXA 1ETQA 4MQ9F 3A02A 5B1BH 4J01A 4G8XA 4HF1A 1R71A 4A3DJ 2O8XA 1CF7A 5DM6F 2ICWG 4G6QA 3I5UA 4ZYGA 4HNUA 1SAXA 1S7AA 1RKTA 2M7BA 1MBHA 2DLLA 3BC8A 3CO7C 4IKFA 1DP7P 2RQQA 2FU4A 4ZC3A 2DA7A 1F5TA 1WH5A 3E0JB 1ZRDA 4BDZA 1FZPB 1H9GA 4RLFA 3FDYA 3A1YA 3VSKA 3CO6C 3CC4I 2WA0A 3M1CA 4L9VA 1W1WE 2KIFA 3V42A 4A3IJ 1Z05A 2BE5F 3DBRB 1Y39A 1H0MA 2M9HA 3D5LA 1UHWA 4OAZA 5DD4A 4HBLA 1YIOA 3KCCA 2E7WA 3EYYA 3BT9A 2FMLA 3SFIA 4L0YB 5CVRA 4MTEA 2KJCA 1S9HA 4YIIA 1WH7A 2A5YB 2NOJB 3PSIA 1B9MA 1EKEA 3DKYA 2IT0A 2FA5A 4Q4ZF 2ZJRF 2OD5A 1XDUA 4U0YA 4C2UA 3KP5A 2HR3A 4XNFA 1P7JA 3M4OJ 3RTRA 1B8IA 2KDOA 1ZHFA 3PJRA 3IRQA 2E34A 4LGWA 5ED4A 4II3A 5IP6A 3FXMA 3I53A 3ZMZA 1ZG3A 3I59A 3QU6A 2X1EA 3JR9A 1H9TA 1VQLI 2MYSA 2XGCA 4LG0A 1VQ6I 3K70D 4M3DA 1IJWC 1FOXA 3IP4B 3CUQA 3HSEA 2DMQA 4KT5C 1OR7A 3HHHA 3FK7A 2QKMB 1U9OA 2ETHA 2L54A 2DCEA 4AC0A 1U5TA 3HOXJ 2RNGA 5L3FA 2DFFA 3IUOA 2HYJA 1QQIA 2O3FA 4KA4A 2NS7A 1T98A 2EZKA 2R93J 4NNJA 3OYGA 1XX5A 4PFOA 1FYKA 2X6YA 1YG2A 3G4SI 3PO3J 5M5WJ 1G2HA 5LEKA 5DUKA 5BS6A 1LB2A 4AIJA 2JWTA 1IN4A 2E1MC 3PFIA 4HQEA 3DXJF 3OYAA 1N25A 2M87A 2ZJPF 4BXUA 4HNTA 3ZQ7A 2EWNA 4LIUA 3KEYA 2DI3A 4NC6A 1V3FA 3QRFF 4PFPA 3E97A 3FZVA 4DW6A 2L9VA 3KP2A 3S14J 3R0AA 3GF2A 2V26A 3GTGJ 3Q9VA 3I54A 5CVIA 3ZMSA 3HTUA 2QWWA 1EV7A 3I71A 2P81A 1WJBA 2PEXA 1SFOJ 1IN6A 5EGOB 1MBGA 4CCOA 3VYSB 2K40A 2A6HF 3LA2A 3MCZA 2LRDA 2GBYA 3GFJA 3FBIB 4PZJA 3DBHB 1TWFJ 3EYIA 2ECCA 4EVIA 2NNYA 4KIFA 3HM5A 4FX4A 4LLNA 2NS0A 2P0WA 3JW4A 3CCVI 1PVEA 1B6AA 2X48A 2Z2SB 3HKZA 1ZG5A 4Y17A 5EEHA 1SFKA 2V4JC 4AWXB 3JAMZ 2CUFA 1ETKA 1ZREA 2PI0A 3FKJA 1WJCA 9ANTA 4HX7A 2VXDA 3CCUI 3KP7A 3I4NJ 3WG7H 3BLYA 2E1OA 4EEFG 4G12A 1OMIA 5CVUA 2DOFA 2LBFB 4I6ZA 2Y0MA 4RAYA 2HU9A 2ZBKA 2QF7A 3HOYJ 2DN0A 1SVLA 4IHTA 4O5VA 2QSGX 2GA1A 3K1NA 4DBRA 2KMUA 2K85A 4QIWN 4M9SA 1W0TA 3CDHA 2DDBA 5DYMA 4HDUA 3D5SC 3FIWA 5ERIA 3BTCA 1VQ5I 1HDPA 2KRCA 3GFIA 5J8CA 2DFEA 3E6CC 1ZK8A 5EYRA 1K7AA 4P55A 1IF1A 4MTDA 3RIRA 2DA1A 3K7AJ 3L1PA 2CFOA 1WI3A 4E7JA 3CCRI 4AU7A 1TLHB 1VQ9I 3A03A 3DV8A 2JUGA 2W85A 2ZNZA 3RKWA 4UVBA 1LFBA 1TBXA 2M8EA 5CLSA 2FBKA 2VC1A 1JUMA 5K5OA 3J7YJ 2HDCA 2I10A 4CICA 4BEHA 3JAMK 3UR3C 3A2KA 2QLZA 3P9KA 2V6CA 4MNUA 2PMHA 2ZMEB 2KLOA 5HLGA 3ECOA 2CUJA 5GAEJ 3GX4X 1MZBA 2V9VA 4KISA 1MIJA 1QBJA 2K9SA 4B3XA 3LSHA 1N78A 1FMWA 3BR3A 2YPRA 1Z9CA 1G3WA 1B59A 1IG7A 1P2FA 4DYCA 3G71I 2V1XA 1TQMA 5IOZA 2I8DA 3WHBA 3U1KA 4C9YA 3H5NA 4A6DA 4FETA 1XGSA 3ASNH 4DZJA 3BCAA 4WF2A 1JTYA 4ZYHA 3FISA 2D1HA 2WWYA 2AXLA 3KZZA 3E6MA 3K69A 3HGYA 3TDZC 3PM1A 3HPHA 1CQTA 1YFHA 1BI2A 2BY3A 3W2AA 2FD5A 3DF8A 4PJMA 4A3JJ 4P1WA 4XLAA 3I59B 4IVNA 3W2VA 1FLIA 3I4MJ 1TQIA 2F4MB 2KZVA 3E5XA 4HNVA 4FE4A 4S05A 3DTKA 3CCSI 4XN0A 1RETA 2DOAA 1PYVA 1FSHA 1PUFB 3I0TA 2WY7Q 3OIQA 1QVTA 4PCQA 5CYVA 2XKPA 4DJAA 2CO5A 2ESNA 1YX3A 2PMUA 2KPMA 3JRAA 2L01A 3J7AY 2MLKA 2GXGA 4OU0A 2LKPA 3CCEI 1ZARA 3S15J 1OYWA 1R5GA 1MMNA 2LY1A 2VIXA 4BXXJ 4F3QA 1GUUA 3O6BB 2B9SA 4BKXA 1FYLA 2OPTA 3OL3A 2R5ZB 2R7XA 3GTLJ 2Q8KA 1J9IA 5EEAA 3V8JA 2WAQA 4A3CJ 2X4HA 1KQ0A 4DBQA 4UV9A 1TWGJ 2IJLA 1IUYA 2JN6A 3WU0A 4XLEA 4N9HA 1MSFC 2E35A 2EINH 2W00A 2JQ7A 4ZYEA 1ZGJA 2DA2A 5F0CA 1ZRFA 3HDDA 4EJOA 3WGGA 2FOWA 2GXBA 1Z21A 3LSMA 2ID6A 5BMZA 4F55A 4NDLA 4CSWA 2OTLI 2MSYA 2O7OA 1EH7A 3CCQI 1LE8A 1WGXA 4IXAA 3BPVA 5FFZA 1D8KA 2TRTA 4LK1F 1DU0A 4PJ0C 3WU1B 2FRHA 3T8RA 3KZYA 3QPLA 4S0HB 4D7MA 3CLOA 1TW3A 1ZYRF 2OZ6A 3TO9A 2XPWA 1YW9A 3TOBA 2CW8A 3CTAA 4EJVA 4A3KJ 3MN2A 3N97A 4FHTA 3GZ5A 2F2EA 2JVHA 3M8JA 2DMPA 4YFNF 2ME6A 2EIMH 4M3BA 1OFCX 4OIOF 4HAMA 4RAGA 5HDNA 1I5ZA 3OYMA 4K2EA 5EGOA 5AONA 2CW0F 5K7FA 1D0XA 3S3NA 2YU3A 4IHWA 4BACA 4NC7A 3KEOA 2JK3A 1XGOA 4RM3A 1E3PA 3LSTA 1YS7A 4NBQA 5IY5H 5D4SA 1FBQA 2QUFA 2KZGA 3P5JA 3OYEA 3EUAA 2HNHA 3QODA 4HLYA 3SJMA 2ZSHB 3E5QA 2FJ1A 2BY2A 3B6CA 2QVOA 2X51A 5EEGA 4BY7J 4X0GA 2PLYA 4CCNA 1SD6A 1X2NA 1FOYA 2L02A 1AKHA 1LDKB 3V7RA 2LK2A 2H8RA 3HXLA 3ONQA 4RB1A 2E5ZA 3ABMH 1DDNA 1FX7A 3ZQQA 3BCBA 3KLOA 4U0VA 5AIPA 4FX0A 1W0UA 1J75A 3HOTA 2DU9A 5J1RA 1MBFA 2YX4A 1MW7A 3DP7A 1QNTA 2HYFA 2JUCA 3H9GA 1KQ8A 3AL0B 4LIVA 5LRRA 4UUVA 2XGDA 2F48A 3OIPA 1L3LA 1OYYA 3K1MA 2BGCA 2CUEA 4NUBA 4F52A 2ESHA 3P9IA 4HF0A 5HLIA 3OYCA 5DTDA 1FYMA 5KK1A 2OZUA 3ISPA 1K79A 4QSHA 1BC8C 4EJWA 3MZYA 3TGNA 2YUSA 2VT3A 5D6EA 3LAPA 1TNSA 5FROA 5E3LA 3MQ0A 3OYHA 2QCOA 2ZB9A 4YFKF 2H27A 1UHSA 2A5WA 3G1MA 4KMUX 4RGSA 5F0HA 1OCPA 1NK3P 5J1UA 2MC4A 3QPHA 2MFZA 2R7OA 1FPQA 1EJ9A 2MD0A 1REPC 5K5RA 1STZA 5ILVA 3K70C 5LFAA 4B09A 2DODA 4MIMA 2R5ZA 2VBXA 1UHMA 2TDXA 3I58A 2VC0A 1ONVA 2M3AA 1P92A 3RZOJ 2VASA 2FQ3A 5D5WB 1X1BA 3ZCOA 4V2FA 4Z2YA 4Y15A 1K6OA 1E3HA 3J80Z 3CUQC 4ANJA 1ETWA 2N8GA 1RUNA 2PN6A 1X4OA 4C3JJ 2FXAA 1RNLA 2NYXA 4OIRF 1XMAA 5E20A 2HGCA 5IT9Z 1JKOC 4IEJA 1O7LA 2CYYA 5CQGA 2P5VA 2R7WA 2EFNA 3FXUA 5M5XJ 1K78B 3CMMA 5ICGA 3OS0A 4N9IA 2CQNA 3LSGA 2MA3A 4DIQA 3JTHA 1XMXA 2CV1A 2V7FA 3QAHA 2CQQA 5B3SH 1ZGAA 3F8MA 1VQ4I 3T5XA 1JUPA 2ELHA 4HDVA 2ELJA 1TT0A 2XB5A 2EQRA 1T56A 1DGRM 3IC7A 1X1DA 2X6OA 5CJ9A 2D2WA 3S2WA 5BNGA 2VB6A 4EGZA 4NQWB 1VTNC 1QZEA 1D3YA 3Q5FA 2CV0A 2W48A 2HWVA 2HZTA 2Z3YA 3BR5A 1FSEA 3GUDA 5CQEA 1JHHA 2HQRA 4V19K 3MKYB 3M8EA 4RM2A 1Q1VA 1YE9A 5K7HA 4RAZA 4BE2A 1T2KA 3A01A 1UJ8A 3G1OA 2EB7A 1TTYA 1E3OC 3OY9A 1R00A 4HSRA 4ZYDA 1IAWA 3AG2H 1V4RA 4XR6A 1ZG1A 1YRNA 3BZ6A 1NHAA 1JT6A 1YYVA 2DMTA 3TO6A 1AU7A 1UZCA 4ZDLA 2E2JJ 5HS9A 4M3FA 5L3EA 2CGPA 2DTZA 4UHTA 3OL4A 4DZPA 3FM5A 5LHHA 1QGPA 4RB3C 3R60A 4PJNA 3M8FA 1FBSA 5LGUA 1T8IA 3KP4A 2O5RA 4H4KC 2F5VA 3GXOA 4P96A 2E2HJ 1R4MB 1EF4A 1WQ2A 4BH9A 1J59A 3GMEA 1FEXA 2VBZA 2VE9A 2EIJH 4IZZA 1YW7A 4HEA2 2FF4A 4U7DA 1UFMA 2QQAA 4Y7NJ 1XGNA 1O3RA 2RGVA 5E17F 3K2ZA 1QZYA 4FE7A 2KIUA 4HLXA 1ZQ3P 2G9WA 4C30A 2CFXA 2GLOA 5B5EC 3DLAA 1F1ZA 1LPQA 2CWEA 4MQVA 2NVUB 2P6SA 2ZXIA 4Z6YA 3F6OA 4JX6A 5FO5A 1ZLJA 3A0HC 1IRFA 3WTSC 2HPMA 2ZMEC 2Q2EB 2WAEA 2IBDA 2O0YA 1Z3XA 2QZ8A 2LP0A 4P9UA 4OMZA 4CGZA 3R0JA 4XMYA 3CF2A 4EM0B 4BY1J 1KYZA 2ZXWH 4XL9A 2JPBA 1WJFA 2HXOA 1KU9A 2OU2A 2A07F 1G8XA 1W36D 4E7LA 1U8RA 1T08B 4WX9A 2DT6A 2M0MA 3BR6A 2HOAA 3QOEA 5TJJA 3S32A 2BHZA 5KAFC 2H09A 2TCTA 2E36A 4UXNA 1VQ7I 1WJEA 4KDPA 2G0EA 1TZLA 2DAOA 5H20A 4XLPF 2HEOA 4OIPF 1AWCA 1JJ6C 4PGHA 2DT5A 5FRNA 5TGTA 4J00A 3WTYC 1G3TA 4MFDA 2J5OA 4HQMA 2NVYJ 1K78A 4WXHA 3SZPA 3OYLA 1WSUA 2HOEA 3LA3A 3D0SA 3FHNA 4LLLA 1R9TJ 4WK8F 2HTSA 3IKTA 2DMUA 1I6XA 1ODDA 3HOVJ 2L7KA 3ECHA 4I98B 1Z7LA 2XASA 5GTIC 5C3EJ 5CVJA 3HC7A 4XRSG 4TV7A 4RB2C 3DCFA 5H6RA 3OYFA 4ON0A 1U8BA 2HYGD 3HUGB 3UKGA 3G73A 2KJBA 1Y8QB 1UCRA 1X3UA 3CUQB 4MO7A 2VQLA 4MEYF 1D0ZA 4WWCA 2JRTA 2FX0A 5EJCA 3HGGA 4YFXF 2ZJQF 5HVQC 3TW6A 2F5FA 3S1MJ 4CZCA 3IHUA 1XN7A 4ZDPA 4UY8I 2QYOA 4ZTJA 4BDYA 2M8GX 2LD5A 4XRFA 4BNCA 2ZXHA 3K4NA 1OCZH 2VBWA 3U21A 5K5QA 2VLAA 3CF5F 1YO5C 4C3IJ 5F27A 3D1NI 4L5JA 4CA0A 4R8HA 1I6HJ 2W57A 1TQPA 2EZHA 3VPRA 3BG9A 3NRVA 5ICCA 1YHQI 2XIGA 3MMYB 2IXSA 2XF5A 4BHCA 2HVSA 3AKZA 4MLOA 2ZCWA 2QQ8A 4DGWB 2DPDA 1P4WA 3F8NA 2ZO4A 2QBYB 1WRJA 1RUOA 4A0ZA 4BEHB 2DQLA
chains in the Genus database with same CATH topology
3F6VA 3JTGA 1ZN2A 2Z99A 5E18F 3MZHA 2VE8A 2HS5A 2R3SA 2Y75A 3H3ZA 5D5VB 3DPTA 2OAZA 5JFRA 1I1SA 2OBPA 4ENNA 1T6SA 4BHBA 2RNJA 4RGUA 3SZTA 1YTYA 2LF8A 2YSRA 1J0RA 3H92A 2UWMA 2VT2A 5J6XA 1SFUA 3V7CA 2XKOA 3L00A 1EH8A 5DCMB 5JVTA 5IT9K 2FOKA 2DW4A 1W7PA 2DQRA 3W6KB 1MDMA 3MFKA 2L4MA 1G3YA 1HXDA 3RYPA 1BI0A 4CDGA 1GXPA 2VN2A 4JK1X 1L0OC 1IZ1A 1DPUA 2RKHA 4MEXF 2EA2A 3OV8A 3WTWC 3SQNA 3ZN0A 3ULQB 1GXQA 2B0LA 4A0YA 5FB2A 1ON1A 4HF2A 3WTTC 1R22A 1C0WA 1D8JA 1AOYA 2GAUA 4A0XA 1KYWA 2FMYA 2STTA 5FD6A 3C1DA 4LMYA 1WKMA 2EA4A 3ML6A 2G7HA 1FBUA 5KVRA 2HFHA 2O6GE 3VODA 3FXRA 4LJZF 4A5MA 3KETA 2FBIA 1BI1A 1E2XA 4B8XA 2Q2EA 1BIAA 3GFMA 2P4WA 5HOOA 2MLGA 1Z1DA 4WXCA 2A69F 2PQ8A 2RDPA 3J81Z 2DTRA 2P5LC 3E3VA 3L9FA 2LSOA 4MGRA 2NNNA 5D5UB 5A2QZ 2ZJ2A 4E70A 3QOPA 4L18B 2P7VB 1PUEE 2L4AA 2P6TA 5LGNA 2VOPA 3HUGA 1B4AA 3OOPA 1LDJA 3F8CA 4IPAA 3J7AO 2A3SA 5ICEA 2W25A 5IT3A 3ZMVA 4IF4A 3WGHA 1WI9A 2VOOA 2YR2A 2H6CA 1G3SA 2IA1A 4EMSA 4L9NA 3K9TA 4EGYA 2D45A 1HSJA 3VB2A 4ENKA 3ROUA 4I0AA 1E17A 2D1VA 4LB6B 1HKSA 3V8KA 1Y0UA 3E6DA 1OKRA 4OIQF 2M30A 2XUBA 4Q48A 2XROA 2ZKZA 4BAYA 1HW1A 1SD4A 3EETA 1O3QA 5AIQA 1XB4A 4G94A 4G6DA 3F8BA 4ENJA 2QBYA 1XDSA 4HX4A 1QPMA 3HYIA 4ZZLA 1CF7B 3HIFA 4ASNA 1U3EM 3ABTA 2IW5A 3TDUC 1YLFA 3I4PA 1TW2A 4UVAA 1MDMB 4ZZDA 4U0WA 3EDPA 2DO7A 3F8FA 4IRIA 4A2UA 3BY6A 2K7LA 1BBYA 3DQVC 5D5XB 1O3SA 2XVCA 3GFLA 5LEJA 3RDIA 3RPUA 3ABUA 1SD5A 3CUOA 2MC3A 1MJAA 3HRSA 4M71A 4H0EA 3GO5A 4UV8A 2LNBA 4Q5SF 1LEBA 4KN7X 3M1EA 5E8GA 3R61A 4HX8A 2LF7A 2VXZA 1Z6TA 3F21A 6PAXA 1MJBA 3N4MA 3BJAA 1J2XA 3QP6A 2HTJA 3JSPA 3COAC 3H3UA 2A61A 1MKMA 1BIBA 1DUXC 2C6YA 2K27A 2KKOA 2IP2A 2FSWA 3QU3A 2EJRA 3ZMTA 3T0YA 1KQ9A 2M45A 1FNNA 1XGMA 1DPRA 1O7FA 2NRAC 1U78A 1GHCA 4EM1A 3W6JB 3V4GA 3U1DA 2STWA 4QWQA 2RN7A 1JHFA 2FNAA 4KIGA 4O6JA 4I01A 5FLXZ 4M6XA 2XAJA 1XMKA 4A6EA 3MAJA 5CVVA 1R36A 1USTA 3LAJA 3NEUA 4ENMA 3ELKA 5DDGA 2ISYA 4KFCA 5D6FA 2H94A 1OPCA 3I64A 4I09A 2QQBA 4PGGA 1BM9A 1G6NA 1O57A 2R7DA 5DV5A 4D0PA 4OMYA 4Q47A 1T39A 3L2CA 3WODF 2KIMA 2JTVA 2FEZA 3IWFA 2UXNA 4GCVA 2GWRA 2UXXA 1RI7A 4BYYA 3WGIA 1G4DA 2VODA 2RVCA 3RPQA 1OYIA 2GZWA 2XGXA 3ERED 1WWXA 3V8LA 2ISZA 3LQQA 1LQ1A 1T0FA 1FP2A 3G3ZA 2K02A 5FLXK 3L09A 1RIOH 1IN7A 2R7FA 1IW7F 2K4BA 2V1DA 2W84A 3IRRA 4S04A 1SMTA 2ZXJA 4M9XA 2COMA 2L3DA 2FE3A 2MD5A 1HBXG 4CHUA 1KU3A 5HLHA 4KIBA 4EJTA 4HV5A 3IWZA 4EV0A 3RYRA 4P9FA 4ESJA 1BJAA 1P4AA 4UVCA 4G7OF 5L3CA 3LWFA 3CJNA 3VEPA 1ZAOA 5HS7A 4L9JA 4M6YA 1U6GA 4IRHA 4HZFA 2ZFWA 3DKWA 1LJ9A 2V79A 3RKYA 4CZZA 4BQAA 1BI3A 3BPXA 5HDGA 2A6EF 1F4KA 4U7BA 5F6FA 1S3JA 4Y13A 4R1HA 2G7UA 3WG9A 3FM3A 3KFWX 4R79A 2Q0OA 2PBIA 2KRFA 1W4MA 2MBFA 1LDDA 1P4XA 4KNYA 1LVAA 1GVJA 5D4RA 3DPLC 4I7HA 2H6BA 1JXSA 3QPTA 3IL2A 5TRDA 3C18A 2J5PA 3LFKA 1S29A 2BBYA 1BN5A 1HQCA 2OA4A 3R4KA 4JQFA 4UNOA 3RI4A 3IKVA 2FNPA 1KU2A 2F5CA 5F1RA 5ILUA 4DQ2A 1ON2A 2JSCA 2QENA 5BQTA 3KEQA 4U88A 1SD7A 3WTZA 4AD9A 1R58A 4ZH4F 3HTSB 2RQPA 3B02A 3GEZA 2XRNA 2M5WA 5FGMA 1KA8A 5LGTA 1B9NA 3MWMA 3BP8A 4A12A 3C7JA 4FT8A 3M7GA 1IN5A 3SHFA 1FOKA 5DCFA 2BEOA 4YIFA 1R1TA 4KMFA 2DK5A 2XAQA 2O03A 4ETSA 2P8TA 5D8LB 4HA8A 2DPUA 4EJUA 2DK8A 2BV6A 5A2QK 2YX7A 1JE8A 1W5SA 5E8IA 2EFWA 4KYWA 3J81K 4L5IA 2E1NA 3GW2A 1Q1HA 2RV8A 1EH6A 4GYIA 4GO1A 4I0BA 3TKYA 5JI6A 5LRSA 2GIVA 2AS5F 1SFEA 3GVAA 3V7SA 4QLCU 5E1XA 1HW2A 2V1UA 1FY7A 1XCBA 3ZPLA 1B1BA 1ZRCA 5F64A 3SFZA 2XV4S 3BDDA 2JPCA 3BOQA 3EQLF 5DD8A 1O3TA 3TOAA 1T38A 3P9CA 2HQNA 4P5OA 3WTXC 3C3WA 2NAZA 4N0BA 3FMRA 4RGRA 4PDKA 1XSDA 1IXSB 1MJ9A 3K0LA 1D5VA 5L3DA 2BYVE 2LDUA 2Y48A 2QM3A 1MGTA 4DNCA 2EFQA 3FF5A 1R1VA 2CQKA 3T1BA 2WC2A 3BWGA 1R1UA 3WTVC 3VFZA 1FT9A 1XSXA 4EM2A 4G7ZF 2PJPA 5E1WA 3GYHX 4CXFA 4I02A 2ZMEA 2M1BA 3U9GA 2OQRA 1S8NA 1U5TC 4ESFA 3L7WA 1PP7U 2IRFG 1TNTA 3HSRA 3O3KA 1I1GA 2PG4A 2VBYA 4O3MA 1U2WA 1KGSA 3FWEA 2F5DA 3E5UA 1R5HA 3O2PE 4AVPA 2FBHA 4YG2F 1QO0D 3SXYA 3F3XA 3ZMDA 3FHZA 5BPDA 1IXRC 4LLGF 3ZN1A 4M72A 5LHGA 1BOAA 2WTEA 5FFXA 3HRMA 3DFGA 1Z7UA 3HSFA 3FX3A 3HRUA 5DEQA 5L3GA 3KE2A 2ACJA 1PDNC 2E7XA 1SFXA 3BJ6A 4GXOA 4L0ZB 1MD0A 3T8TA 3WE3A 4OINF 4JBAA 1XCVA 3KP6A 1XD7A 2CSOA 4KN4X 3WE2A 3REOA 4HW0A 4BHPA 1FWZA 3F23A 3NQOA 1S7OA 1IXCA 1R23A 5K1YA 4LFUA 4G9YA 4IHSA 3HHGA 4LD5A 1Z91A 4LK0F 5BOXA 3PQJA 3GLXA 3FMSA 2IA0A 2Z5UA 1YQAA 4XSXF 4F7ZA 4XLNF 2P5KA 3GZ6A 2O61A 1S6LA 4WXDA 5E1ZB 1I27A 4RGXA 2IVMA 3LQRA 5D8KB 3TQNA 1IRGA 4LG0B 3EUHA 2EK5A 1FC3A 1HKTA 1LEAA 5ILSA 5FD5A 4ESBA 1W5TA 4KUMA 4CO8A 2MH2A 2OQGA 3BROA 5LLQA 4NB5A 1ZH5A 3JSOA 2EV0A 5LBQA 2HKXA 5HDKA 2F5EA 1W7PB 4EQQA 2GQQA 2WV0A 1UB9A 4M74A 1Z6RA 1FP1D 3B73A 1HSTA 1XSVA 5DUIA 5ICFA 4RB0A 1SMYF 2W24A 4A5NA 2QQ9A 1J5YA 1W7PD 3E6BA 3BJOA 4CYDA 2EV5A 1BC7C 1PP8F 1ULYA 2UZKA 4KICA 3VOEA 5HS8A 1J7KA 3R6SA 3F72A 1U5TB 3P7NA 5BPIA 3Q9SA 1JGSA 5DCMA 4M9ZA 3WTUC 1USSA 4G7HF 3U2RA 2XAFA 3HRTA 1P6RA 4M73A 5JHUA 2CG4A 2XHKA 1YS6A 4OOIA 2JT1A 4IJAA 3HOSA 3K1PA 4GGGA 2X0LA 2E1CA 3J80K 1KU7A 4NQWA 2Z9OA 4AIKA 2ADUA 3PQKA 4RS8A 3DEUA 5L3BA 2DBBA 2RC4A 2IA2A 2DFIA 1YW8A 2XAGA 3FXQA 2XAHA 2Z33A 3GWZA 2A68F 3LA7A 4WCGA 3F22A 1RZ4A 4L9TA 1R7JA 5H6QA 2JZYA 3AAFA 4XSZF 3QP5A 1CGPA 4AIHA 2GA2A 3M9AA 2IPQX 3KLNA 3ZP5A 5JR3A 1LNWA 1HW5A 2EV6A 2EFPA 4LB5A 2VONA 3KP3A 2EFOA 4GYGA 4HV6A 5LHIA 1A04A 3RKXA 3MEXA 4MHGA 1QZZA 3RJPA 3TO7A 1F9NA 2PFBA 5J8FA 3FMQA 4I2OA 4HYEA 3ZMUA 2ZNYA 2K4JA 1ZLKA 4HOBA 1HKQA 4NHJA 1IN8A 4IRGA 2MH9A 2K86A 2P7CB 4XBFA 2HKOA 4MQ9F 4G8XA 4HF1A 2O8XA 1CF7A 4G6QA 3I5UA 4ZYGA 1SAXA 1S7AA 2DLLA 3CO7C 1DP7P 2FU4A 1F5TA 1ZRDA 1FZPB 1H9GA 3CO6C 4L9VA 2KIFA 1Z05A 2BE5F 1H0MA 3D5LA 1UHWA 5DD4A 4HBLA 1YIOA 3KCCA 2E7WA 3EYYA 2FMLA 4L0YB 5CVRA 4MTEA 2KJCA 4YIIA 2A5YB 1B9MA 2IT0A 2FA5A 4Q4ZF 2OD5A 1XDUA 4U0YA 3KP5A 2HR3A 3RTRA 1ZHFA 3IRQA 4LGWA 5ED4A 3I53A 3ZMZA 1ZG3A 3I59A 3QU6A 1H9TA 4LG0A 3CUQA 3HSEA 4KT5C 1OR7A 3HHHA 2ETHA 2L54A 1U5TA 5L3FA 1QQIA 2O3FA 4KA4A 1T98A 1FYKA 1YG2A 5LEKA 5DUKA 5BS6A 1LB2A 4AIJA 1IN4A 3PFIA 4HQEA 3DXJF 2M87A 4BXUA 3ZQ7A 2EWNA 2DI3A 1V3FA 3QRFF 3E97A 3FZVA 3KP2A 3R0AA 3GF2A 3Q9VA 3I54A 5CVIA 3ZMSA 3HTUA 2QWWA 1EV7A 3I71A 2PEXA 1IN6A 2A6HF 3LA2A 3MCZA 3GFJA 4PZJA 3EYIA 4EVIA 2NNYA 4KIFA 4FX4A 4LLNA 2NS0A 3JW4A 1B6AA 1ZG5A 4Y17A 5EEHA 4AWXB 3JAMZ 1ZREA 2PI0A 4HX7A 3KP7A 1OMIA 5CVUA 2Y0MA 4RAYA 2ZBKA 4IHTA 4O5VA 2GA1A 3K1NA 4M9SA 3CDHA 5DYMA 4HDUA 5ERIA 3GFIA 5J8CA 3E6CC 1K7AA 4P55A 1IF1A 4MTDA 3RIRA 1TLHB 3DV8A 2W85A 2ZNZA 3RKWA 4UVBA 1TBXA 2M8EA 5CLSA 2FBKA 2VC1A 5K5OA 2HDCA 4CICA 3JAMK 2QLZA 3P9KA 2V6CA 4MNUA 2PMHA 2ZMEB 5HLGA 3ECOA 3GX4X 1MZBA 2V9VA 1QBJA 2YPRA 1Z9CA 1G3WA 1B59A 1P2FA 2V1XA 1TQMA 4A6DA 1XGSA 4WF2A 4ZYHA 2D1HA 2WWYA 2AXLA 3KZZA 3E6MA 3K69A 3TDZC 1YFHA 1BI2A 3DF8A 3I59B 4IVNA 1FLIA 1TQIA 3E5XA 4S05A 1FSHA 3I0TA 4PCQA 5CYVA 2XKPA 2CO5A 2ESNA 2PMUA 2L01A 2MLKA 2GXGA 4OU0A 2LKPA 1ZARA 1OYWA 1R5GA 3O6BB 1FYLA 2Q8KA 1J9IA 3V8JA 2X4HA 1KQ0A 4UV9A 2IJLA 1IUYA 3WU0A 4N9HA 4ZYEA 1ZGJA 1ZRFA 4EJOA 3WGGA 2GXBA 5BMZA 1EH7A 4IXAA 3BPVA 5FFZA 1D8KA 4LK1F 3WU1B 2FRHA 3T8RA 3KZYA 3CLOA 1TW3A 1ZYRF 2OZ6A 3TO9A 1YW9A 3TOBA 3CTAA 4EJVA 3N97A 4FHTA 3GZ5A 2F2EA 4YFNF 4OIOF 4HAMA 5HDNA 1I5ZA 4K2EA 5AONA 2CW0F 2YU3A 3KEOA 1XGOA 3LSTA 1YS7A 5D4SA 1FBQA 2QUFA 4HLYA 3E5QA 2QVOA 5EEGA 2PLYA 1SD6A 2L02A 1LDKB 3V7RA 4RB1A 1DDNA 1FX7A 3KLOA 4U0VA 5AIPA 1J75A 4FX0A 3HOTA 2DU9A 2YX4A 3DP7A 1QNTA 2HYFA 1KQ8A 5LRRA 4UUVA 1L3LA 1OYYA 3K1MA 2BGCA 2ESHA 3P9IA 4HF0A 5HLIA 1FYMA 5KK1A 2OZUA 3ISPA 1K79A 1BC8C 4EJWA 3MZYA 3TGNA 2VT3A 5D6EA 3LAPA 1TNSA 3MQ0A 4YFKF 2H27A 4KMUX 4RGSA 3QPHA 1FPQA 1REPC 5K5RA 1STZA 5ILVA 4B09A 2VBXA 1UHMA 2TDXA 3I58A 2VC0A 1ONVA 1P92A 2FQ3A 5D5WB 4Z2YA 4Y15A 1K6OA 3J80Z 3CUQC 1RUNA 2PN6A 2FXAA 1RNLA 2NYXA 4OIRF 1XMAA 5E20A 2HGCA 5IT9Z 1O7LA 2CYYA 2P5VA 2EFNA 3FXUA 1K78B 5ICGA 4N9IA 2MA3A 3JTHA 3QAHA 1ZGAA 3F8MA 3T5XA 2ELHA 4HDVA 5CJ9A 3IC7A 3S2WA 2D2WA 4EGZA 1VTNC 1D3YA 3Q5FA 2HWVA 2HZTA 2Z3YA 1FSEA 3GUDA 1JHHA 2HQRA 3M8EA 1T2KA 4RAZA 2EB7A 1TTYA 1R00A 4ZYDA 1IAWA 1V4RA 1ZG1A 3BZ6A 1NHAA 1YYVA 3TO6A 5HS9A 5L3EA 2CGPA 4UHTA 3FM5A 5LHHA 1QGPA 4RB3C 3R60A 3M8FA 1FBSA 5LGUA 3KP4A 3GXOA 4P96A 1WQ2A 4BH9A 1J59A 2VBZA 2VE9A 1YW7A 2FF4A 4U7DA 1UFMA 2QQAA 1O3RA 1XGNA 2RGVA 5E17F 3K2ZA 1QZYA 2KIUA 4HLXA 2G9WA 2CFXA 1F1ZA 2CWEA 4MQVA 2P6SA 3F6OA 5FO5A 1ZLJA 1IRFA 3WTSC 2O0YA 4P9UA 2QZ8A 4CGZA 4OMZA 3R0JA 4EM0B 1KYZA 2JPBA 1KU9A 2OU2A 2A07F 1U8RA 4WX9A 5TJJA 2H09A 4KDPA 4UXNA 5H20A 4XLPF 2DAOA 4OIPF 2HEOA 1AWCA 4PGHA 2DT5A 3WTYC 1G3TA 2J5OA 4HQMA 1K78A 4WXHA 3SZPA 1WSUA 2HOEA 3LA3A 3D0SA 4LLLA 4WK8F 2HTSA 3IKTA 1I6XA 1ODDA 3ECHA 4I98B 2XASA 5CVJA 4TV7A 4RB2C 5H6RA 4ON0A 2HYGD 3G73A 2KJBA 1UCRA 1X3UA 3CUQB 4WWCA 4MEYF 2JRTA 4YFXF 5HVQC 2F5FA 3IHUA 1XN7A 2QYOA 4XRFA 4BNCA 5K5QA 2VBWA 1YO5C 4L5JA 4R8HA 2W57A 1TQPA 3NRVA 5ICCA 2XIGA 4BHCA 2ZCWA 2DPDA 1P4WA 3F8NA 2ZO4A 2QBYB 1WRJA 1RUOA 4A0ZA 2DQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F6V A;  3JTG A;  1ZN2 A;  2Z99 A;  5E18 F;  3MZH A;  2VE8 A;  2HS5 A;  2R3S A;  2Y75 A;  3H3Z A;  5D5V B;  3DPT A;  2OAZ A;  5JFR A;  1I1S A;  2OBP A;  4ENN A;  1T6S A;  4BHB A;  2RNJ A;  4RGU A;  3SZT A;  1YTY A;  2LF8 A;  2YSR A;  1J0R A;  3H92 A;  2UWM A;  2VT2 A;  5J6X A;  1SFU A;  3V7C A;  2XKO A;  3L00 A;  1EH8 A;  5DCM B;  5JVT A;  5IT9 K;  2FOK A;  2DW4 A;  1W7P A;  2DQR A;  3W6K B;  1MDM A;  3MFK A;  2L4M A;  1G3Y A;  1HXD A;  3RYP A;  1BI0 A;  4CDG A;  1GXP A;  2VN2 A;  4JK1 X;  1L0O C;  1IZ1 A;  1DPU A;  2RKH A;  4MEX F;  2EA2 A;  3OV8 A;  3WTW C;  3SQN A;  3ZN0 A;  3ULQ B;  1GXQ A;  2B0L A;  4A0Y A;  5FB2 A;  1ON1 A;  4HF2 A;  3WTT C;  1R22 A;  1C0W A;  1D8J A;  1AOY A;  2GAU A;  4A0X A;  1KYW A;  2FMY A;  2STT A;  5FD6 A;  3C1D A;  4LMY A;  1WKM A;  2EA4 A;  3ML6 A;  2G7H A;  1FBU A;  5KVR A;  2HFH A;  2O6G E;  3VOD A;  3FXR A;  4LJZ F;  4A5M A;  3KET A;  2FBI A;  1BI1 A;  1E2X A;  4B8X A;  2Q2E A;  1BIA A;  3GFM A;  2P4W A;  5HOO A;  2MLG A;  1Z1D A;  4WXC A;  2A69 F;  2PQ8 A;  2RDP A;  3J81 Z;  2DTR A;  2P5L C;  3E3V A;  3L9F A;  2LSO A;  4MGR A;  2NNN A;  5D5U B;  5A2Q Z;  2ZJ2 A;  4E70 A;  3QOP A;  4L18 B;  2P7V B;  1PUE E;  2L4A A;  2P6T A;  5LGN A;  2VOP A;  3HUG A;  1B4A A;  3OOP A;  1LDJ A;  3F8C A;  4IPA A;  3J7A O;  2A3S A;  5ICE A;  2W25 A;  5IT3 A;  3ZMV A;  4IF4 A;  3WGH A;  1WI9 A;  2VOO A;  2YR2 A;  2H6C A;  1G3S A;  2IA1 A;  4EMS A;  4L9N A;  3K9T A;  4EGY A;  2D45 A;  1HSJ A;  3VB2 A;  4ENK A;  3ROU A;  4I0A A;  1E17 A;  2D1V A;  4LB6 B;  1HKS A;  3V8K A;  1Y0U A;  3E6D A;  1OKR A;  4OIQ F;  2M30 A;  2XUB A;  4Q48 A;  2XRO A;  2ZKZ A;  4BAY A;  1HW1 A;  1SD4 A;  3EET A;  1O3Q A;  5AIQ A;  1XB4 A;  4G94 A;  4G6D A;  3F8B A;  4ENJ A;  2QBY A;  1XDS A;  4HX4 A;  1QPM A;  3HYI A;  4ZZL A;  1CF7 B;  3HIF A;  4ASN A;  1U3E M;  3ABT A;  2IW5 A;  3TDU C;  1YLF A;  3I4P A;  1TW2 A;  4UVA A;  1MDM B;  4ZZD A;  4U0W A;  3EDP A;  2DO7 A;  3F8F A;  4IRI A;  4A2U A;  3BY6 A;  2K7L A;  1BBY A;  3DQV C;  5D5X B;  1O3S A;  2XVC A;  3GFL A;  5LEJ A;  3RDI A;  3RPU A;  3ABU A;  1SD5 A;  3CUO A;  2MC3 A;  1MJA A;  3HRS A;  4M71 A;  4H0E A;  3GO5 A;  4UV8 A;  2LNB A;  4Q5S F;  1LEB A;  4KN7 X;  3M1E A;  5E8G A;  3R61 A;  4HX8 A;  2LF7 A;  2VXZ A;  1Z6T A;  3F21 A;  6PAX A;  1MJB A;  3N4M A;  3BJA A;  1J2X A;  3QP6 A;  2HTJ A;  3JSP A;  3COA C;  3H3U A;  2A61 A;  1MKM A;  1BIB A;  1DUX C;  2C6Y A;  2K27 A;  2KKO A;  2IP2 A;  2FSW A;  3QU3 A;  2EJR A;  3ZMT A;  3T0Y A;  1KQ9 A;  2M45 A;  1FNN A;  1XGM A;  1DPR A;  1O7F A;  2NRA C;  1U78 A;  1GHC A;  4EM1 A;  3W6J B;  3V4G A;  3U1D A;  2STW A;  4QWQ A;  2RN7 A;  1JHF A;  2FNA A;  4KIG A;  4O6J A;  4I01 A;  5FLX Z;  4M6X A;  2XAJ A;  1XMK A;  4A6E A;  3MAJ A;  5CVV A;  1R36 A;  1UST A;  3LAJ A;  3NEU A;  4ENM A;  3ELK A;  5DDG A;  2ISY A;  4KFC A;  5D6F A;  2H94 A;  1OPC A;  3I64 A;  4I09 A;  2QQB A;  4PGG A;  1BM9 A;  1G6N A;  1O57 A;  2R7D A;  5DV5 A;  4D0P A;  4OMY A;  4Q47 A;  1T39 A;  3L2C A;  3WOD F;  2KIM A;  2JTV A;  2FEZ A;  3IWF A;  2UXN A;  4GCV A;  2GWR A;  2UXX A;  1RI7 A;  4BYY A;  3WGI A;  1G4D A;  2VOD A;  2RVC A;  3RPQ A;  1OYI A;  2GZW A;  2XGX A;  3ERE D;  1WWX A;  3V8L A;  2ISZ A;  3LQQ A;  1LQ1 A;  1T0F A;  1FP2 A;  3G3Z A;  2K02 A;  5FLX K;  3L09 A;  1RIO H;  1IN7 A;  2R7F A;  1IW7 F;  2K4B A;  2V1D A;  2W84 A;  3IRR A;  4S04 A;  1SMT A;  2ZXJ A;  4M9X A;  2COM A;  2L3D A;  2FE3 A;  2MD5 A;  1HBX G;  4CHU A;  1KU3 A;  5HLH A;  4KIB A;  4EJT A;  4HV5 A;  3IWZ A;  4EV0 A;  3RYR A;  4P9F A;  4ESJ A;  1BJA A;  1P4A A;  4UVC A;  4G7O F;  5L3C A;  3LWF A;  3CJN A;  3VEP A;  1ZAO A;  5HS7 A;  4L9J A;  4M6Y A;  1U6G A;  4IRH A;  4HZF A;  2ZFW A;  3DKW A;  1LJ9 A;  2V79 A;  3RKY A;  4CZZ A;  4BQA A;  1BI3 A;  3BPX A;  5HDG A;  2A6E F;  1F4K A;  4U7B A;  5F6F A;  1S3J A;  4Y13 A;  4R1H A;  2G7U A;  3WG9 A;  3FM3 A;  3KFW X;  4R79 A;  2Q0O A;  2PBI A;  2KRF A;  1W4M A;  2MBF A;  1LDD A;  1P4X A;  4KNY A;  1LVA A;  1GVJ A;  5D4R A;  3DPL C;  4I7H A;  2H6B A;  1JXS A;  3QPT A;  3IL2 A;  5TRD A;  3C18 A;  2J5P A;  3LFK A;  1S29 A;  2BBY A;  1BN5 A;  1HQC A;  2OA4 A;  3R4K A;  4JQF A;  4UNO A;  3RI4 A;  3IKV A;  2FNP A;  1KU2 A;  2F5C A;  5F1R A;  5ILU A;  4DQ2 A;  1ON2 A;  2JSC A;  2QEN A;  5BQT A;  3KEQ A;  4U88 A;  1SD7 A;  3WTZ A;  4AD9 A;  1R58 A;  4ZH4 F;  3HTS B;  2RQP A;  3B02 A;  3GEZ A;  2XRN A;  2M5W A;  5FGM A;  1KA8 A;  5LGT A;  1B9N A;  3MWM A;  3BP8 A;  4A12 A;  3C7J A;  4FT8 A;  3M7G A;  1IN5 A;  3SHF A;  1FOK A;  5DCF A;  2BEO A;  4YIF A;  1R1T A;  4KMF A;  2DK5 A;  2XAQ A;  2O03 A;  4ETS A;  2P8T A;  5D8L B;  4HA8 A;  2DPU A;  4EJU A;  2DK8 A;  2BV6 A;  5A2Q K;  2YX7 A;  1JE8 A;  1W5S A;  5E8I A;  2EFW A;  4KYW A;  3J81 K;  4L5I A;  2E1N A;  3GW2 A;  1Q1H A;  2RV8 A;  1EH6 A;  4GYI A;  4GO1 A;  4I0B A;  3TKY A;  5JI6 A;  5LRS A;  2GIV A;  2AS5 F;  1SFE A;  3GVA A;  3V7S A;  4QLC U;  5E1X A;  1HW2 A;  2V1U A;  1FY7 A;  1XCB A;  3ZPL A;  1B1B A;  1ZRC A;  5F64 A;  3SFZ A;  2XV4 S;  3BDD A;  2JPC A;  3BOQ A;  3EQL F;  5DD8 A;  1O3T A;  3TOA A;  1T38 A;  3P9C A;  2HQN A;  4P5O A;  3WTX C;  3C3W A;  2NAZ A;  4N0B A;  3FMR A;  4RGR A;  4PDK A;  1XSD A;  1IXS B;  1MJ9 A;  3K0L A;  1D5V A;  5L3D A;  2BYV E;  2LDU A;  2Y48 A;  2QM3 A;  1MGT A;  4DNC A;  2EFQ A;  3FF5 A;  1R1V A;  2CQK A;  3T1B A;  2WC2 A;  3BWG A;  1R1U A;  3WTV C;  3VFZ A;  1FT9 A;  1XSX A;  4EM2 A;  4G7Z F;  2PJP A;  5E1W A;  3GYH X;  4CXF A;  4I02 A;  2ZME A;  2M1B A;  3U9G A;  2OQR A;  1S8N A;  1U5T C;  4ESF A;  3L7W A;  1PP7 U;  2IRF G;  1TNT A;  3HSR A;  3O3K A;  1I1G A;  2PG4 A;  2VBY A;  4O3M A;  1U2W A;  1KGS A;  3FWE A;  2F5D A;  3E5U A;  1R5H A;  3O2P E;  4AVP A;  2FBH A;  4YG2 F;  1QO0 D;  3SXY A;  3F3X A;  3ZMD A;  3FHZ A;  5BPD A;  1IXR C;  4LLG F;  3ZN1 A;  4M72 A;  5LHG A;  1BOA A;  2WTE A;  5FFX A;  3HRM A;  3DFG A;  1Z7U A;  3HSF A;  3FX3 A;  3HRU A;  5DEQ A;  5L3G A;  3KE2 A;  2ACJ A;  1PDN C;  2E7X A;  1SFX A;  3BJ6 A;  4GXO A;  4L0Z B;  1MD0 A;  3T8T A;  3WE3 A;  4OIN F;  4JBA A;  1XCV A;  3KP6 A;  1XD7 A;  2CSO A;  4KN4 X;  3WE2 A;  3REO A;  4HW0 A;  4BHP A;  1FWZ A;  3F23 A;  3NQO A;  1S7O A;  1IXC A;  1R23 A;  5K1Y A;  4LFU A;  4G9Y A;  4IHS A;  3HHG A;  4LD5 A;  1Z91 A;  4LK0 F;  5BOX A;  3PQJ A;  3GLX A;  3FMS A;  2IA0 A;  2Z5U A;  1YQA A;  4XSX F;  4F7Z A;  4XLN F;  2P5K A;  3GZ6 A;  2O61 A;  1S6L A;  4WXD A;  5E1Z B;  1I27 A;  4RGX A;  2IVM A;  3LQR A;  5D8K B;  3TQN A;  1IRG A;  4LG0 B;  3EUH A;  2EK5 A;  1FC3 A;  1HKT A;  1LEA A;  5ILS A;  5FD5 A;  4ESB A;  1W5T A;  4KUM A;  4CO8 A;  2MH2 A;  2OQG A;  3BRO A;  5LLQ A;  4NB5 A;  1ZH5 A;  3JSO A;  2EV0 A;  5LBQ A;  2HKX A;  5HDK A;  2F5E A;  1W7P B;  4EQQ A;  2GQQ A;  2WV0 A;  1UB9 A;  4M74 A;  1Z6R A;  1FP1 D;  3B73 A;  1HST A;  1XSV A;  5DUI A;  5ICF A;  4RB0 A;  1SMY F;  2W24 A;  4A5N A;  2QQ9 A;  1J5Y A;  1W7P D;  3E6B A;  3BJO A;  4CYD A;  2EV5 A;  1BC7 C;  1PP8 F;  1ULY A;  2UZK A;  4KIC A;  3VOE A;  5HS8 A;  1J7K A;  3R6S A;  3F72 A;  1U5T B;  3P7N A;  5BPI A;  3Q9S A;  1JGS A;  5DCM A;  4M9Z A;  3WTU C;  1USS A;  4G7H F;  3U2R A;  2XAF A;  3HRT A;  1P6R A;  4M73 A;  5JHU A;  2CG4 A;  2XHK A;  1YS6 A;  4OOI A;  2JT1 A;  4IJA A;  3HOS A;  3K1P A;  4GGG A;  2X0L A;  2E1C A;  3J80 K;  1KU7 A;  4NQW A;  2Z9O A;  4AIK A;  2ADU A;  3PQK A;  4RS8 A;  3DEU A;  5L3B A;  2DBB A;  2RC4 A;  2IA2 A;  2DFI A;  1YW8 A;  2XAG A;  3FXQ A;  2XAH A;  2Z33 A;  3GWZ A;  2A68 F;  3LA7 A;  4WCG A;  3F22 A;  1RZ4 A;  4L9T A;  1R7J A;  5H6Q A;  2JZY A;  3AAF A;  4XSZ F;  3QP5 A;  1CGP A;  4AIH A;  2GA2 A;  3M9A A;  2IPQ X;  3KLN A;  3ZP5 A;  5JR3 A;  1LNW A;  1HW5 A;  2EV6 A;  2EFP A;  4LB5 A;  2VON A;  3KP3 A;  2EFO A;  4GYG A;  4HV6 A;  5LHI A;  1A04 A;  3RKX A;  3MEX A;  4MHG A;  1QZZ A;  3RJP A;  3TO7 A;  1F9N A;  2PFB A;  5J8F A;  3FMQ A;  4I2O A;  4HYE A;  3ZMU A;  2ZNY A;  2K4J A;  1ZLK A;  4HOB A;  1HKQ A;  4NHJ A;  1IN8 A;  4IRG A;  2MH9 A;  2K86 A;  2P7C B;  4XBF A;  2HKO A;  4MQ9 F;  4G8X A;  4HF1 A;  2O8X A;  1CF7 A;  4G6Q A;  3I5U A;  4ZYG A;  1SAX A;  1S7A A;  2DLL A;  3CO7 C;  1DP7 P;  2FU4 A;  1F5T A;  1ZRD A;  1FZP B;  1H9G A;  3CO6 C;  4L9V A;  2KIF A;  1Z05 A;  2BE5 F;  1H0M A;  3D5L A;  1UHW A;  5DD4 A;  4HBL A;  1YIO A;  3KCC A;  2E7W A;  3EYY A;  2FML A;  4L0Y B;  5CVR A;  4MTE A;  2KJC A;  4YII A;  2A5Y B;  1B9M A;  2IT0 A;  2FA5 A;  4Q4Z F;  2OD5 A;  1XDU A;  4U0Y A;  3KP5 A;  2HR3 A;  3RTR A;  1ZHF A;  3IRQ A;  4LGW A;  5ED4 A;  3I53 A;  3ZMZ A;  1ZG3 A;  3I59 A;  3QU6 A;  1H9T A;  4LG0 A;  3CUQ A;  3HSE A;  4KT5 C;  1OR7 A;  3HHH A;  2ETH A;  2L54 A;  1U5T A;  5L3F A;  1QQI A;  2O3F A;  4KA4 A;  1T98 A;  1FYK A;  1YG2 A;  5LEK A;  5DUK A;  5BS6 A;  1LB2 A;  4AIJ A;  1IN4 A;  3PFI A;  4HQE A;  3DXJ F;  2M87 A;  4BXU A;  3ZQ7 A;  2EWN A;  2DI3 A;  1V3F A;  3QRF F;  3E97 A;  3FZV A;  3KP2 A;  3R0A A;  3GF2 A;  3Q9V A;  3I54 A;  5CVI A;  3ZMS A;  3HTU A;  2QWW A;  1EV7 A;  3I71 A;  2PEX A;  1IN6 A;  2A6H F;  3LA2 A;  3MCZ A;  3GFJ A;  4PZJ A;  3EYI A;  4EVI A;  2NNY A;  4KIF A;  4FX4 A;  4LLN A;  2NS0 A;  3JW4 A;  1B6A A;  1ZG5 A;  4Y17 A;  5EEH A;  4AWX B;  3JAM Z;  1ZRE A;  2PI0 A;  4HX7 A;  3KP7 A;  1OMI A;  5CVU A;  2Y0M A;  4RAY A;  2ZBK A;  4IHT A;  4O5V A;  2GA1 A;  3K1N A;  4M9S A;  3CDH A;  5DYM A;  4HDU A;  5ERI A;  3GFI A;  5J8C A;  3E6C C;  1K7A A;  4P55 A;  1IF1 A;  4MTD A;  3RIR A;  1TLH B;  3DV8 A;  2W85 A;  2ZNZ A;  3RKW A;  4UVB A;  1TBX A;  2M8E A;  5CLS A;  2FBK A;  2VC1 A;  5K5O A;  2HDC A;  4CIC A;  3JAM K;  2QLZ A;  3P9K A;  2V6C A;  4MNU A;  2PMH A;  2ZME B;  5HLG A;  3ECO A;  3GX4 X;  1MZB A;  2V9V A;  1QBJ A;  2YPR A;  1Z9C A;  1G3W A;  1B59 A;  1P2F A;  2V1X A;  1TQM A;  4A6D A;  1XGS A;  4WF2 A;  4ZYH A;  2D1H A;  2WWY A;  2AXL A;  3KZZ A;  3E6M A;  3K69 A;  3TDZ C;  1YFH A;  1BI2 A;  3DF8 A;  3I59 B;  4IVN A;  1FLI A;  1TQI A;  3E5X A;  4S05 A;  1FSH A;  3I0T A;  4PCQ A;  5CYV A;  2XKP A;  2CO5 A;  2ESN A;  2PMU A;  2L01 A;  2MLK A;  2GXG A;  4OU0 A;  2LKP A;  1ZAR A;  1OYW A;  1R5G A;  3O6B B;  1FYL A;  2Q8K A;  1J9I A;  3V8J A;  2X4H A;  1KQ0 A;  4UV9 A;  2IJL A;  1IUY A;  3WU0 A;  4N9H A;  4ZYE A;  1ZGJ A;  1ZRF A;  4EJO A;  3WGG A;  2GXB A;  5BMZ A;  1EH7 A;  4IXA A;  3BPV A;  5FFZ A;  1D8K A;  4LK1 F;  3WU1 B;  2FRH A;  3T8R A;  3KZY A;  3CLO A;  1TW3 A;  1ZYR F;  2OZ6 A;  3TO9 A;  1YW9 A;  3TOB A;  3CTA A;  4EJV A;  3N97 A;  4FHT A;  3GZ5 A;  2F2E A;  4YFN F;  4OIO F;  4HAM A;  5HDN A;  1I5Z A;  4K2E A;  5AON A;  2CW0 F;  2YU3 A;  3KEO A;  1XGO A;  3LST A;  1YS7 A;  5D4S A;  1FBQ A;  2QUF A;  4HLY A;  3E5Q A;  2QVO A;  5EEG A;  2PLY A;  1SD6 A;  2L02 A;  1LDK B;  3V7R A;  4RB1 A;  1DDN A;  1FX7 A;  3KLO A;  4U0V A;  5AIP A;  1J75 A;  4FX0 A;  3HOT A;  2DU9 A;  2YX4 A;  3DP7 A;  1QNT A;  2HYF A;  1KQ8 A;  5LRR A;  4UUV A;  1L3L A;  1OYY A;  3K1M A;  2BGC A;  2ESH A;  3P9I A;  4HF0 A;  5HLI A;  1FYM A;  5KK1 A;  2OZU A;  3ISP A;  1K79 A;  1BC8 C;  4EJW A;  3MZY A;  3TGN A;  2VT3 A;  5D6E A;  3LAP A;  1TNS A;  3MQ0 A;  4YFK F;  2H27 A;  4KMU X;  4RGS A;  3QPH A;  1FPQ A;  1REP C;  5K5R A;  1STZ A;  5ILV A;  4B09 A;  2VBX A;  1UHM A;  2TDX A;  3I58 A;  2VC0 A;  1ONV A;  1P92 A;  2FQ3 A;  5D5W B;  4Z2Y A;  4Y15 A;  1K6O A;  3J80 Z;  3CUQ C;  1RUN A;  2PN6 A;  2FXA A;  1RNL A;  2NYX A;  4OIR F;  1XMA A;  5E20 A;  2HGC A;  5IT9 Z;  1O7L A;  2CYY A;  2P5V A;  2EFN A;  3FXU A;  1K78 B;  5ICG A;  4N9I A;  2MA3 A;  3JTH A;  3QAH A;  1ZGA A;  3F8M A;  3T5X A;  2ELH A;  4HDV A;  5CJ9 A;  3IC7 A;  3S2W A;  2D2W A;  4EGZ A;  1VTN C;  1D3Y A;  3Q5F A;  2HWV A;  2HZT A;  2Z3Y A;  1FSE A;  3GUD A;  1JHH A;  2HQR A;  3M8E A;  1T2K A;  4RAZ A;  2EB7 A;  1TTY A;  1R00 A;  4ZYD A;  1IAW A;  1V4R A;  1ZG1 A;  3BZ6 A;  1NHA A;  1YYV A;  3TO6 A;  5HS9 A;  5L3E A;  2CGP A;  4UHT A;  3FM5 A;  5LHH A;  1QGP A;  4RB3 C;  3R60 A;  3M8F A;  1FBS A;  5LGU A;  3KP4 A;  3GXO A;  4P96 A;  1WQ2 A;  4BH9 A;  1J59 A;  2VBZ A;  2VE9 A;  1YW7 A;  2FF4 A;  4U7D A;  1UFM A;  2QQA A;  1O3R A;  1XGN A;  2RGV A;  5E17 F;  3K2Z A;  1QZY A;  2KIU A;  4HLX A;  2G9W A;  2CFX A;  1F1Z A;  2CWE A;  4MQV A;  2P6S A;  3F6O A;  5FO5 A;  1ZLJ A;  1IRF A;  3WTS C;  2O0Y A;  4P9U A;  2QZ8 A;  4CGZ A;  4OMZ A;  3R0J A;  4EM0 B;  1KYZ A;  2JPB A;  1KU9 A;  2OU2 A;  2A07 F;  1U8R A;  4WX9 A;  5TJJ A;  2H09 A;  4KDP A;  4UXN A;  5H20 A;  4XLP F;  2DAO A;  4OIP F;  2HEO A;  1AWC A;  4PGH A;  2DT5 A;  3WTY C;  1G3T A;  2J5O A;  4HQM A;  1K78 A;  4WXH A;  3SZP A;  1WSU A;  2HOE A;  3LA3 A;  3D0S A;  4LLL A;  4WK8 F;  2HTS A;  3IKT A;  1I6X A;  1ODD A;  3ECH A;  4I98 B;  2XAS A;  5CVJ A;  4TV7 A;  4RB2 C;  5H6R A;  4ON0 A;  2HYG D;  3G73 A;  2KJB A;  1UCR A;  1X3U A;  3CUQ B;  4WWC A;  4MEY F;  2JRT A;  4YFX F;  5HVQ C;  2F5F A;  3IHU A;  1XN7 A;  2QYO A;  4XRF A;  4BNC A;  5K5Q A;  2VBW A;  1YO5 C;  4L5J A;  4R8H A;  2W57 A;  1TQP A;  3NRV A;  5ICC A;  2XIG A;  4BHC A;  2ZCW A;  2DPD A;  1P4W A;  3F8N A;  2ZO4 A;  2QBY B;  1WRJ A;  1RUO A;  4A0Z A;  2DQL A; 
#chains in the Genus database with same CATH topology
 1POG A;  3F6V A;  3F0C A;  5E79 C;  2WY8 Q;  3JTG A;  1ZN2 A;  3F9K A;  2Z99 A;  3VYU B;  5E18 F;  3MZH A;  2VE8 A;  2M7A A;  2HS5 A;  2R3S A;  1VQP I;  2Y75 A;  3H3Z A;  3PNT A;  5F04 A;  5D5V B;  3DPT A;  2OAZ A;  5JFR A;  3A01 B;  1BJZ A;  1I1S A;  5J40 A;  2OBP A;  4E7K A;  2E19 A;  4ENN A;  1T6S A;  4Y4R A;  4BHB A;  2JA6 J;  2RNJ A;  4RGU A;  1LVK A;  3SZT A;  3JRC A;  1YTY A;  2LF8 A;  1A35 A;  2YSR A;  2K5C A;  1J0R A;  1QRY A;  2JJ7 A;  3UNG C;  3H92 A;  4HG2 A;  2K9M A;  4XKB A;  1TWC J;  1ORK A;  5J3L A;  3H0D A;  4XK4 A;  3ZQI A;  2UWM A;  2CMP A;  1K4T A;  2VT2 A;  5J6X A;  1SFU A;  3V7C A;  5DM7 F;  2XKO A;  2NVT J;  3CP2 A;  5IP9 J;  3L00 A;  3GTP J;  1EH8 A;  1VF9 A;  5DCM B;  1MNM C;  5JVT A;  5IT9 K;  2FOK A;  1OR7 C;  3O8G A;  2DW4 A;  1W7P A;  2DQR A;  3W6K B;  1MDM A;  3MFK A;  2WB1 N;  2F4O B;  2GXA A;  2ME0 A;  2L4M A;  1G3Y A;  1HXD A;  3PFY A;  3BTL A;  3RYP A;  1BI0 A;  4CDG A;  2IS1 A;  1GXP A;  2VN2 A;  4JK1 X;  1L0O C;  3S2H J;  1IZ1 A;  4D5C A;  4MFE A;  1DPU A;  2RKH A;  3PIP F;  4MEX F;  5HOD A;  1X3Z B;  2EA2 A;  2VJ5 A;  3BR0 A;  3K4K A;  1UG2 A;  4CCM A;  3FKI J;  3OV8 A;  3WTW C;  1OCT C;  3SQN A;  3ZN0 A;  3ULQ B;  1GXQ A;  2B0L A;  4A0Y A;  2LLK A;  1ON1 A;  5FB2 A;  1MSE C;  4HF2 A;  3MVP A;  3LOC A;  3WTT C;  1R22 A;  1C0W A;  1D8J A;  2Y0S N;  2MAB A;  1AOY A;  2GAU A;  2IS2 A;  4A0X A;  1KYW A;  3H1C A;  3LSR A;  2FMY A;  2STT A;  1X1P A;  3LSP A;  1B72 B;  3H9Q A;  5FD6 A;  3C1D A;  3I55 I;  4A3M J;  2FQ4 A;  4LMY A;  1WKM A;  2EA4 A;  2BOL A;  2ZFU A;  2IAI A;  2G7H A;  1FBU A;  3ML6 A;  4BUP A;  3PIO F;  5KVR A;  2H1K A;  2E1M B;  2HFH A;  1YJ9 I;  2BY0 A;  3W2W A;  2O6G E;  3VOD A;  3RSN A;  2MG4 A;  3FXR A;  2F4I A;  4LJZ F;  3GTO J;  4L5E A;  2YS9 A;  4A5M A;  3KET A;  2JRM A;  2FBI A;  1K83 J;  4XN3 A;  1BI1 A;  1E2X A;  4B8X A;  3OYN A;  2Q2E A;  1BIA A;  1SC7 A;  3GFM A;  2P4W A;  3QYB A;  2MLG A;  5HOO A;  1Z1D A;  2OCE A;  4WXC A;  4B43 A;  2A69 F;  2PQ8 A;  2RDP A;  2XAU A;  3QYE A;  5IYC J;  4QTR A;  1GVD A;  2E71 A;  3QWL A;  4B1R A;  3J81 Z;  2DJN A;  2CW7 A;  2DTR A;  2P5L C;  1XPX A;  3E3V A;  3L9F A;  3QYF A;  2LSO A;  4MGR A;  2NNN A;  1V54 H;  5D5U B;  1BOB A;  5A2Q Z;  2ZJ2 A;  4E7H A;  4E70 A;  3QOP A;  2BY1 A;  4L18 B;  2P7V B;  1YX5 A;  1PUE E;  2L4A A;  1N77 A;  2P6T A;  4UUT A;  3AG4 H;  5LGN A;  1GT0 C;  1APL C;  5EZG A;  3LNQ A;  2VOP A;  3HUG A;  3GTQ J;  2UV1 A;  3SDB A;  3JRG A;  1B4A A;  3OOP A;  1LDJ A;  1A5J A;  5JHF A;  3F8C A;  4IPA A;  5JLW A;  1I39 A;  3M3Y J;  1W5C C;  2A3S A;  5ICE A;  3LFU A;  3J7A O;  2EZL A;  2W25 A;  3ZMV A;  5IT3 A;  1T95 A;  2DDA A;  4IF4 A;  4CYC A;  2LYC A;  3HL2 A;  2L9N A;  1OQY A;  3WGH A;  3FXO A;  1WI9 A;  3SYT A;  4BJT A;  4XOT A;  2VOO A;  2WV1 A;  2YR2 A;  2H6C A;  1G3S A;  2IA1 A;  4EMS A;  4XLC A;  4L9N A;  3K9T A;  4EGY A;  2D45 A;  1RR7 A;  3G2B A;  1HSJ A;  3PUB A;  3VB2 A;  4ENK A;  3GTJ J;  4JYK A;  2V1N A;  3ROU A;  4I0A A;  1E17 A;  1V5G A;  2D1V A;  4LB6 B;  4XOP A;  5M3M J;  1HKS A;  3V8K A;  1Y0U A;  3KZI C;  5GAG J;  4XLH A;  4CH7 A;  3E6D A;  1ZGW A;  1OKR A;  1IV8 A;  3A4C A;  2HI3 A;  2IGM A;  4CCJ A;  4OIQ F;  1J09 A;  2M30 A;  2XUB A;  4Q48 A;  2XRO A;  2ZKZ A;  2W7N A;  4BAY A;  2EIL H;  3CP8 A;  3ABL H;  1HC8 A;  1HW1 A;  1SD4 A;  1NK2 P;  3EET A;  1TWA J;  1A6I A;  1QHG A;  3HBL A;  3SZG A;  1O3Q A;  5AIQ A;  3NWT A;  1LKX A;  1XB4 A;  4G94 A;  4G6D A;  4DOZ A;  3K4C A;  3F8B A;  3AG3 H;  3OSF A;  1O4X A;  4ENJ A;  2QBY A;  4FAS D;  1D1B A;  2OJE D;  3JRE A;  1XDS A;  4HX4 A;  4IQ4 A;  5FJ8 J;  1QPM A;  3HYI A;  4C2T A;  4ZZL A;  2L9S A;  3ZQC A;  1CF7 B;  3HIF A;  1MMD A;  2DT7 B;  3RQI A;  2LC2 A;  4HPQ A;  4ASN A;  4YRV A;  1U3E M;  3ABT A;  2IW5 A;  2OC6 A;  3TDU C;  1YLF A;  3I4P A;  2EBI A;  1W36 C;  1TW2 A;  1IV6 A;  3IH3 A;  4UVA A;  3K6G A;  1MDM B;  2COB A;  4ZZD A;  4YEJ A;  1S72 I;  4U0W A;  3EDP A;  1TP4 A;  2VQG A;  2IEK A;  2DO7 A;  3F8F A;  2CQX A;  3DTI A;  5KCM A;  4A2U A;  1MBE A;  4IRI A;  1HCR A;  2RRE A;  3BY6 A;  2K7L A;  1ITY A;  1BBY A;  3DQV C;  3BR1 A;  5D5X B;  4KT6 A;  1O3S A;  2XVC A;  3GFL A;  3K10 A;  5LEJ A;  2JVG A;  3RDI A;  3RPU A;  3ABU A;  3X2Q H;  1SD5 A;  4JOM A;  3CUO A;  2MC3 A;  2UUZ A;  1MJA A;  3HRS A;  4M71 A;  4H0E A;  2BXY A;  2XSJ C;  5F1J A;  3GO5 A;  4UV8 A;  2LNB A;  4XRS A;  2LMD A;  4Q5S F;  1LEB A;  1LFU P;  4KN7 X;  3M1E A;  4UUS B;  2CS3 A;  5E8G A;  3R61 A;  2WB1 A;  2M34 A;  3HKZ N;  4HX8 A;  2LF7 A;  1UMQ A;  2BVM A;  2VXZ A;  3NAR A;  1Z6T A;  3F21 A;  1BR2 A;  3KYD B;  6PAX A;  1MJB A;  3BQZ A;  3QQA A;  3N4M A;  3BJA A;  4PJJ A;  1J2X A;  3QP6 A;  2HTJ A;  3JSP A;  3COA C;  3OSG A;  3K4B A;  1HF0 A;  2LY9 A;  1Y0N A;  3H3U A;  2A61 A;  4Y33 A;  5FKK A;  1MKM A;  2QGU A;  1H89 C;  4XKW A;  2XRL A;  1BIB A;  5J1Y A;  3ZQF A;  1DUX C;  3CMA I;  1VFC A;  2C6Y A;  2QSH X;  2X6X A;  1R49 A;  2KP6 A;  2K27 A;  3PNV A;  1A6Q A;  2R7Q A;  2KKO A;  3PSF A;  2OUM A;  2LR8 A;  4AYB A;  2IP2 A;  2FSW A;  2VKD A;  2XF6 A;  1X19 A;  2AHQ A;  1MBK A;  3QU3 A;  2EJR A;  3TBI A;  2NVX J;  2ECB A;  3H0G J;  2L7Z A;  3ZMT A;  2HDD A;  3ZGK A;  1YIT I;  4X6A J;  3T0Y A;  1KQ9 A;  2M45 A;  1FNN A;  3S8P A;  1XGM A;  1DPR A;  1O7F A;  2R7Z J;  2WAD A;  2NRA C;  4C2M J;  1U78 A;  5JVG F;  1GHC A;  2NVQ J;  1OCC H;  2KQR A;  2BZT A;  4EM1 A;  3W6J B;  3HOW J;  3V4G A;  4PK4 A;  3U1D A;  3WU2 C;  2HPI A;  4I76 A;  3KX2 A;  1JT0 A;  2STW A;  1IO2 A;  4QWQ A;  3OYK A;  3OYJ A;  2RN7 A;  1JHF A;  3G1L A;  1FIA A;  4E6K G;  1QHH D;  2LH9 A;  1A36 A;  3K4L A;  2FNA A;  4KIG A;  4O6J A;  3ZQG A;  3FXJ A;  4OWR B;  1P9Q C;  4I01 A;  5FLX Z;  4M6X A;  2XAJ A;  2VQC A;  1I50 J;  1XMK A;  3H3V K;  4A6E A;  5F0F A;  3MAJ A;  1LUJ B;  3I56 I;  2KL4 A;  5CVV A;  1R36 A;  3S17 J;  4RA2 A;  3JCU C;  1UST A;  2JA8 J;  3IH4 A;  3LAJ A;  2WBM A;  3OYI A;  4I99 C;  3NEU A;  2R0Q C;  1S5L C;  2Y2Z A;  1DP3 A;  2E60 A;  1HA8 A;  4ENM A;  3ELK A;  5CKT A;  2DA3 A;  3PNY A;  5DDG A;  4F92 B;  2ISY A;  1GDT A;  3D5R C;  4KFC A;  4PSW A;  5J47 A;  1NG6 A;  5D6F A;  2K3P A;  2H94 A;  4BBS J;  1OPC A;  3I64 A;  4I09 A;  3DEW A;  1QPI A;  1D5Y A;  3M07 A;  4W97 A;  3E7L A;  2A6T A;  2QQB A;  4PGG A;  1RC9 A;  1BM9 A;  1G6N A;  1O57 A;  2R7D A;  4IHV A;  3MZ8 A;  5DV5 A;  2B7E A;  4D0P A;  4OMY A;  4Q47 A;  1T39 A;  3L2C A;  2OF7 A;  3WOD F;  3HB9 A;  2KIM A;  2JTV A;  2FEZ A;  1Z67 A;  3KYC B;  1UEL B;  3K2A A;  2A05 A;  3IWF A;  2UXN A;  4GCV A;  2GWR A;  2UXX A;  1RI7 A;  1SAN A;  4BYY A;  4YIR X;  2LFB A;  4FTH A;  3WGI A;  3O8H A;  4B4C A;  1G4D A;  2VOD A;  1NH3 A;  3KYL A;  3JRF A;  1WJ5 A;  3EUK L;  3ZRG A;  2RVC A;  4XM3 A;  1OYI A;  2GZW A;  3RPQ A;  3MKW B;  1TT5 B;  2XGX A;  5KHD A;  1WJD A;  3AL0 C;  3ERE D;  1WWX A;  4IL6 C;  1F43 A;  4B48 A;  3RZD J;  3V8L A;  2ISZ A;  3FK6 A;  1Y6I A;  3OMY A;  2Q1Z B;  3LQQ A;  1AHD P;  3VYT B;  1LQ1 A;  1T0F A;  1FOW A;  3S1R J;  1FP2 A;  3G3Z A;  2K02 A;  3BR2 A;  5FLX K;  1ZTR A;  3L09 A;  1RIO H;  1IN7 A;  4CCL A;  2W82 A;  2E2I J;  2R7F A;  1F36 A;  1IW7 F;  1GV5 A;  3GLL A;  2K4B A;  2AXT C;  2V1D A;  2W84 A;  1KZH A;  4C3H J;  3IRR A;  4S04 A;  2X9D A;  3ABK H;  1SMT A;  4IOC F;  2ZXJ A;  1D1A A;  4M9X A;  2COM A;  4XON A;  2L3D A;  1FTZ A;  2FE3 A;  3BTI A;  2R5Y A;  5HNH A;  2KIQ A;  3ZOB A;  3S3O A;  1WZ2 A;  2MD5 A;  1HBX G;  2Y0S A;  4CHU A;  1WVR A;  3I9V 2;  2PJR B;  1KU3 A;  3S16 J;  2HVQ A;  2AQE A;  5HLH A;  4KIB A;  3EUH C;  3ZQL A;  1MBJ A;  4HV5 A;  3IWZ A;  4EJT A;  3C2B A;  3HOU J;  2JSP A;  4D5F A;  4EV0 A;  4LG3 A;  3RYR A;  4P9F A;  1Z0X A;  4ESJ A;  4Y3O A;  1BJA A;  1T0F C;  2CQ7 A;  1P4A A;  4UVC A;  4G7O F;  5L3C A;  3LWF A;  3CJN A;  2I5U A;  4FIS A;  2W4S A;  1P7I A;  1X1A A;  3L2U A;  1YJN I;  5FRM A;  3VEP A;  1ZAO A;  5HLT A;  4A3L J;  3K4M A;  5HS7 A;  4NC8 A;  4L9J A;  4M6Y A;  4V2G A;  1U6G A;  4IRH A;  1M1E B;  1HLV A;  4E7I A;  2IGO A;  1SEU A;  4LOC A;  4HZF A;  2ELK A;  2ZFW A;  3CDI A;  3DKW A;  4F91 B;  1LJ9 A;  2OV7 A;  3TMO A;  1EA3 A;  4A3B J;  2V79 A;  3RKY A;  4CZZ A;  4BQA A;  3DBL B;  2DYR H;  2JA2 A;  2R7R A;  1BI3 A;  3BQY A;  1RPW A;  3CDL A;  5KNL A;  1ETO A;  3BPX A;  4RMN A;  5HDG A;  1MND A;  5H2F C;  2AO9 A;  3W3C A;  2A6E F;  1F4K A;  4U7B A;  5F6F A;  4PJL A;  1S3J A;  3TL4 X;  2LY2 A;  5EDN A;  1YJW I;  1OCR H;  4AYB N;  3BG5 A;  4A3F J;  4Y13 A;  4M3E A;  2V9K A;  4R1H A;  2CRG A;  2QA4 I;  2G7U A;  3WG9 A;  1PJR A;  3FM3 A;  3KFW X;  2BHY A;  4R79 A;  5E3O A;  4BU2 A;  2Q0O A;  4RLQ A;  4XRM A;  2BXZ A;  2PBI A;  2KRF A;  1W4M A;  2MBF A;  4A3G J;  1VND A;  2Y30 A;  3KPH A;  1K6Y A;  1LDD A;  4FCY A;  2VPR A;  2LKX A;  1RES A;  1P4X A;  4KNY A;  1LVA A;  1GVJ A;  5D4R A;  4UUS A;  2DA6 A;  5FKL A;  3DPL C;  2VQH A;  5EG0 B;  2PMZ N;  4I7H A;  2H6B A;  2V9P A;  5FKO A;  2EZI A;  4IQJ A;  4M6V A;  3B6A A;  1JXS A;  3HPG A;  5IOY A;  3G6E I;  2LG4 A;  1TWH J;  2DOE A;  3QPT A;  3DWL E;  3CCL I;  3IL2 A;  5TRD A;  3C18 A;  3DLL F;  2J5P A;  4Y52 J;  3LFK A;  1S29 A;  2IGN A;  3ZXS A;  1QU3 A;  3OWT A;  4BJ6 C;  2ID3 A;  2BBY A;  1BN5 A;  1K61 A;  1HQC A;  4IX7 A;  2OA4 A;  3R4K A;  4JQF A;  4UNO A;  4CUG A;  3RI4 A;  3IKV A;  4OAY A;  2EIK H;  2FNP A;  3VYR B;  5EF6 A;  1KU2 A;  3OIO A;  2F5C A;  1V55 H;  5F1R A;  5ILU A;  1WJA A;  5FKM A;  4DQ2 A;  5J4Y A;  1ON2 A;  5E3M A;  2JSC A;  3WHC A;  4RBO A;  1AKH B;  2QEN A;  2RAE A;  3FBN B;  3KEQ A;  4U88 A;  1SD7 A;  3WTZ A;  5BQT A;  4AD9 A;  1R58 A;  1K4S A;  2L9R A;  4E7S A;  1OLT A;  4ZH4 F;  3HTS B;  2R7S A;  2CV2 A;  2CU7 A;  2RQP A;  3B02 A;  3RQ4 A;  2GOX B;  3GEZ A;  1JKQ C;  2XRN A;  2M5W A;  4D1Q A;  3TED A;  5FGM A;  2XSD C;  2VJJ A;  1KA8 A;  3RCO A;  4GDF A;  5GPC A;  5LGT A;  4U87 A;  4UB8 C;  3OR2 C;  1IGN A;  1B9N A;  2XC7 A;  2IS4 A;  3MWM A;  3BP8 A;  2K3F A;  4A12 A;  1U9N A;  3C7J A;  2MW8 A;  4D7N A;  1YOV B;  1IUF A;  4FT8 A;  3M7G A;  1U0J A;  3EPZ A;  3AFH A;  1IN5 A;  2DFH A;  3CLQ A;  3SHF A;  5DS9 A;  1WPK A;  1FOK A;  2VKE A;  5DCF A;  2BEO A;  1ENH A;  3IAS 2;  1R1T A;  4YIF A;  4KMF A;  3ZQH A;  3BG6 A;  2DK5 A;  2XAQ A;  3CCM I;  1I3Q J;  4ZTF A;  5IPA A;  2O03 A;  4ETS A;  2P8T A;  5D8L B;  4HA8 A;  4AVZ A;  5B66 C;  2DPU A;  1MMG A;  2DK8 A;  4EJU A;  2BV6 A;  1JUS A;  1AA7 A;  2YX7 A;  5A2Q K;  1MH4 A;  1VQK I;  1JE8 A;  1YRN B;  3BTJ A;  1W5S A;  5E8I A;  2EFW A;  4KYW A;  3Q3S A;  3DTE A;  3TP3 A;  1VQM I;  3CJQ B;  3ASO H;  1B8I B;  3J81 K;  4L5I A;  4BE1 A;  2E1N A;  3GW2 A;  3DPU A;  1Q1H A;  2PJR A;  2RV8 A;  1EH6 A;  4GYI A;  2R4G A;  4GO1 A;  4BBR J;  3ZR8 X;  4B47 A;  2KRH A;  2L7F P;  5LD2 C;  4I0B A;  1ZEL A;  1IDZ A;  4ZDO A;  3TKY A;  5JI6 A;  5LRS A;  1IRZ A;  2GIV A;  2AS5 F;  1XS9 A;  1XG1 A;  5F08 A;  1SFE A;  3GVA A;  3V7S A;  5IYB J;  2CJJ A;  2R5Y B;  2PX9 A;  4QLC U;  2VUM J;  2XPU A;  1BL0 A;  1NTC A;  5E1X A;  2VL8 A;  1HW2 A;  5TIS C;  2V1U A;  2WAF A;  1BW6 A;  1ETX A;  1FY7 A;  1XCB A;  3ZPL A;  1B1B A;  3NWS A;  3GTM J;  2KHM A;  1ZRC A;  5F64 A;  3SFZ A;  2XV4 S;  3L2Q A;  3BDD A;  1GV2 A;  2JPC A;  2H1L A;  1X1C A;  3BOQ A;  2DYS H;  3EQL F;  5DD8 A;  3TOA A;  1T38 A;  3P9C A;  1O3T A;  2HQN A;  4P5O A;  2XF7 A;  4IOA F;  3WTX C;  1JKR C;  4QPO A;  2QSF X;  3C3W A;  2BW3 B;  2BVL A;  5GPA A;  2NAZ A;  4N0B A;  3FMR A;  4RGR A;  1MMS A;  4PDK A;  2QKL B;  2L0K A;  3H36 A;  2X1D A;  1ERD A;  1X4P A;  1E0E A;  1XSD A;  1XTA A;  3C2G A;  1IXS B;  1MJ9 A;  2O8K A;  3K0L A;  1D5V A;  1RR8 C;  4XOR A;  3BZC A;  5L3D A;  2L7M P;  2VKV A;  3IH2 A;  2BYV E;  2LDU A;  2Y48 A;  2QM3 A;  1MGT A;  4DNC A;  3GZN B;  4XKV A;  3L2R A;  2EFQ A;  3GBG A;  3FF5 A;  1TC3 C;  3S1Q J;  1R1V A;  3AG1 H;  2CQK A;  3T1B A;  5B1A H;  2WC2 A;  3BWG A;  1R1U A;  5KAI C;  1X3W B;  3WTV C;  3CC7 I;  2L5Q A;  3VFZ A;  1DU6 A;  1FT9 A;  1XSX A;  4EM2 A;  4G7Z F;  2PJP A;  5E1W A;  3CCY A;  2Y9Y A;  4ABZ A;  3GYH X;  4CXF A;  1R4N B;  4I02 A;  2NXN B;  1OCO H;  2ZME A;  2M1B A;  3U9G A;  2E5N A;  2OQR A;  1S8N A;  3OOU A;  1PUF A;  3CZ6 A;  2M2E A;  2ZSI B;  1U5T C;  1JTX A;  4CCK A;  4ESF A;  1OJL A;  3DU5 A;  3L7W A;  4N4O B;  1PP7 U;  2IRF G;  3Q0V A;  1TNT A;  3HSR A;  4ZYA A;  4ZJZ A;  3O3K A;  4IHY A;  1I1G A;  1SAU A;  2PG4 A;  1BR1 A;  1I3A A;  4KJZ A;  2VBY A;  2GM4 A;  3BG7 A;  1IDY A;  4BQO A;  4O3M A;  3VWB A;  1U2W A;  2VKH A;  1KGS A;  2CUZ A;  4A93 J;  3A0B C;  3FWE A;  2KDZ A;  1DGW Y;  2F5D A;  1YIJ I;  2PMZ A;  3E5U A;  3OYD A;  2Y9Z A;  1R5H A;  3O2P E;  5C4J J;  2LBF A;  4AVP A;  3QPS A;  2FBH A;  2CH0 A;  4YG2 F;  1QO0 D;  4BQN A;  3SXY A;  3ERM A;  4ITV A;  4EAT A;  3F3X A;  1Z77 A;  3ZMD A;  3FHZ A;  3HG9 A;  5BPD A;  1IXR C;  4LLG F;  4XQF A;  3N05 A;  3JRB A;  1OIS A;  5E3N A;  3ZN1 A;  1KON A;  1MNE A;  4M72 A;  1RKW A;  5LHG A;  1BOA A;  2DMN A;  2WTE A;  5FFX A;  4E7Z A;  1ZR4 A;  3LSJ A;  3CCJ I;  3HRM A;  3DFG A;  3LMM A;  1Z7U A;  2LOO A;  3ESW B;  3HSF A;  1Z3Y A;  5M5Y J;  3FX3 A;  3HRU A;  2JA5 J;  5DEQ A;  1BA5 A;  5L3G A;  2Z16 A;  3KE2 A;  3CMY A;  2ACJ A;  2LKS A;  1PDN C;  2KT0 A;  2DA5 A;  5HNF A;  2E7X A;  1SFX A;  3BJ6 A;  4GXO A;  4JX5 A;  3SEQ A;  4L0Z B;  1MD0 A;  3T8T A;  3WE3 A;  3JRD A;  4OIN F;  2MGQ A;  1X2M A;  3LSI A;  3DKX A;  2NOG A;  3C2H A;  2XDV A;  4JBA A;  1XCV A;  5K7Z A;  3KP6 A;  2D5V A;  1XD7 A;  2CSO A;  3S1N J;  3I3L A;  4KN4 X;  3WE2 A;  3REO A;  1MH3 A;  3OS2 A;  4HW0 A;  3NAU A;  4BHP A;  1FWZ A;  3F23 A;  2M4K A;  1JGG A;  3NQO A;  2OCC H;  1S7O A;  1IXC A;  1R23 A;  5C44 J;  4G6T B;  4HST A;  2FUG 2;  3MKL A;  5K1Y A;  3CC2 I;  3CD6 I;  4LFU A;  4G9Y A;  4JP0 A;  4IHS A;  3SDG A;  1VQN I;  3HHG A;  2VPL A;  4RDU A;  4LD5 A;  3TW7 A;  3OYB A;  1VZ0 A;  1Z91 A;  4LK0 F;  5BOX A;  5FLM J;  3HZJ A;  3MD2 A;  3PQJ A;  3GLX A;  3FMS A;  3CME I;  2JA7 J;  2X1C A;  3LL7 A;  4DYQ A;  2IA0 A;  2Z5U A;  4BS9 A;  1DQU A;  2HOS A;  4PUS A;  2IS6 A;  1YQA A;  4XSX F;  1NG7 A;  4F7Z A;  4XLN F;  2HZD A;  2P5K A;  1WCM J;  3GZ6 A;  1ZKG A;  2O61 A;  1S6L A;  2GIZ A;  4WXD A;  3K4J A;  4PSX A;  5E1Z B;  4RAF A;  1I27 A;  5CPR B;  4GFB A;  4RGX A;  2IVM A;  3LQR A;  5D8K B;  3H5A A;  3TQN A;  2Y31 A;  2R7T A;  1IRG A;  4LG0 B;  3JRI A;  2DA4 A;  4II2 A;  1UAA A;  1Y8R B;  2XGE A;  2R7V A;  4F93 B;  1LFP A;  3EUH A;  2EK5 A;  3VSL A;  4BQQ A;  2HVR A;  4KIT B;  1VQO I;  1FC3 A;  1ETV A;  1HKT A;  2O9L A;  2LRE A;  2XPV A;  2YU9 J;  1RRJ A;  1V5E A;  4XKC A;  3L2W A;  1LEA A;  2KFD A;  3BG3 A;  5ILS A;  4BXF A;  1D0Y A;  2IGK A;  5FD5 A;  4ESB A;  5J4V A;  2B63 J;  1W5T A;  4KUM A;  2EH3 A;  2MH2 A;  4AUX A;  1FIP A;  4CO8 A;  2OQG A;  3BRO A;  3CES A;  1B72 A;  2BW3 A;  1SVO A;  5LLQ A;  4NB5 A;  1ZH5 A;  3JSO A;  1VQ8 I;  2EV0 A;  1H8A C;  5LBQ A;  2K9Q A;  2HKX A;  1Y56 A;  1JKP C;  1YI2 I;  1IRX A;  3SEZ A;  5HDK A;  5FLV A;  2F5E A;  1N75 A;  1W7P B;  3L2V A;  4EQQ A;  1LE8 B;  2GQQ A;  2LTP A;  2WV0 A;  1UB9 A;  3BZK A;  4M74 A;  2HQA A;  1BR4 A;  1Z6R A;  3Q0W A;  3J7Z I;  1FP1 D;  4J19 A;  3B73 A;  2VJ4 A;  1HST A;  5FKN A;  2L2O A;  1XSV A;  5DUI A;  3OR1 C;  5ICF A;  3CQZ J;  4YEL A;  4M3G A;  4RB0 A;  4A3E J;  5GTH C;  1MMA A;  3PUF A;  1SMY F;  3DEE A;  2W24 A;  2R92 J;  4QPQ A;  3KIO A;  5EZH A;  1R5I D;  4A5N A;  3MKZ A;  5M3F J;  2QQ9 A;  1J5Y A;  3LSK A;  1W7P D;  4LIT A;  3E6B A;  3BJO A;  2NS8 A;  4A69 C;  3DU6 A;  1JJ8 C;  4CYD A;  1WFX A;  2EV5 A;  4JX4 A;  4D9J A;  1BC7 C;  2VI6 A;  1PP8 F;  1ACI A;  1ULY A;  1GLN A;  2UZK A;  1D1C A;  1HOM A;  4KIC A;  4IHX A;  3VOE A;  2DJI A;  5HS8 A;  2HXI A;  1QA6 A;  1UG0 A;  1J7K A;  3HJE A;  3R6S A;  2K9L A;  3F72 A;  1U5T B;  4GRI A;  4AID A;  3P7N A;  5BPI A;  1WHU A;  3Q9S A;  1JGS A;  3OS1 A;  5DCM A;  4M9Z A;  2XB0 X;  1SVM A;  3WTU C;  1X58 A;  1USS A;  4B3A A;  4G7H F;  3U2R A;  3H9J A;  2XAF A;  3TP0 A;  2VJI A;  3HRT A;  2Y69 H;  2W1O A;  1P6R A;  4M73 A;  4AM3 A;  2EPF A;  1QVU A;  5JHU A;  1G59 A;  4IO9 F;  3GCM A;  2CG4 A;  2WAQ N;  4N4N B;  2XHK A;  4XID A;  1FMV A;  3W6V A;  1YS6 A;  3RKQ A;  4UB6 C;  2F6C A;  2LVS A;  4OOI A;  2GOM A;  4HRI A;  2JMW A;  2JT1 A;  4IJA A;  3RPU D;  3FXK A;  3HOS A;  2H8W A;  2OTJ I;  3K1P A;  2V6E A;  4GGG A;  2Z1D A;  1ZR2 A;  4W1U A;  2X0L A;  3JRH A;  1ETY A;  2E1C A;  3J80 K;  5IYD J;  1T33 A;  2AQF A;  5C4X J;  3PL8 A;  1KU7 A;  4XLF A;  3S93 A;  3FXL A;  3Q0U A;  4E4H A;  4NQW A;  2Z9O A;  4AIK A;  2QEX I;  5EG0 A;  4BGD A;  2ADU A;  3PQK A;  4RS8 A;  3DEU A;  2HDW A;  1HDD C;  1TL8 A;  1IC8 A;  1A31 A;  5L3B A;  2DBB A;  2RC4 A;  4BE0 A;  2IA2 A;  3S2D J;  2DFI A;  1YW8 A;  2XAG A;  3FXQ A;  1XC5 A;  2XAH A;  4CYC B;  2Z33 A;  4DYR A;  3GWZ A;  3HEF A;  1FJL A;  2A68 F;  3LA7 A;  3CJR B;  4WCG A;  3IAM 2;  3F22 A;  1RZ4 A;  1VI0 A;  4L9T A;  1R7J A;  5H6Q A;  1V5F A;  2JZY A;  3AAF A;  2HOT A;  3H5R A;  3S3M A;  2ZC2 A;  4XIC A;  4BL0 B;  4XSZ F;  3QP5 A;  3E1S A;  1CGP A;  4AIH A;  2GA2 A;  3M9A A;  2X85 A;  3HOZ J;  3VDX A;  2IPQ X;  1Y1V J;  4BJ5 C;  1R6R A;  5GAH J;  3KLN A;  5IP7 J;  2X6W A;  3ZP5 A;  3CJT B;  5JR3 A;  3IV5 A;  1LNW A;  1JI8 A;  2KIS A;  1HW5 A;  2EV6 A;  2R7U A;  2K9N A;  2M0C A;  2EFP A;  4LB5 A;  1H88 C;  2VON A;  3KP3 A;  2EFO A;  4GYG A;  4HV6 A;  5LHI A;  1A04 A;  3RKX A;  3MEX A;  3PO2 J;  4MHG A;  1QZZ A;  3RJP A;  5GAD J;  3TO7 A;  1F9N A;  4FQG A;  2PFB A;  5J8F A;  3FMQ A;  4I2O A;  4HYE A;  3ZMU A;  2ZNY A;  4B44 A;  1BW5 A;  3H35 A;  2HQ5 A;  2M4G A;  5GP9 A;  3GTK J;  2K4J A;  1ZLK A;  1Y1W J;  4HOB A;  4X1E A;  1HKQ A;  4NHJ A;  1FTT A;  1IN8 A;  4IRG A;  1S7E A;  2MH9 A;  2K86 A;  2DXI A;  2P7C B;  4XBF A;  2HKO A;  5JLX A;  1ETQ A;  4MQ9 F;  3A02 A;  5B1B H;  4J01 A;  4G8X A;  4HF1 A;  1R71 A;  4A3D J;  2O8X A;  1CF7 A;  5DM6 F;  2ICW G;  4G6Q A;  3I5U A;  4ZYG A;  4HNU A;  1SAX A;  1S7A A;  1RKT A;  2M7B A;  1MBH A;  2DLL A;  3BC8 A;  3CO7 C;  4IKF A;  1DP7 P;  2RQQ A;  2FU4 A;  4ZC3 A;  2DA7 A;  1F5T A;  1WH5 A;  3E0J B;  1ZRD A;  4BDZ A;  1FZP B;  1H9G A;  4RLF A;  3FDY A;  3A1Y A;  3VSK A;  3CO6 C;  3CC4 I;  2WA0 A;  3M1C A;  4L9V A;  1W1W E;  2KIF A;  3V42 A;  4A3I J;  1Z05 A;  2BE5 F;  3DBR B;  1Y39 A;  1H0M A;  2M9H A;  3D5L A;  1UHW A;  4OAZ A;  5DD4 A;  4HBL A;  1YIO A;  3KCC A;  2E7W A;  3EYY A;  3BT9 A;  2FML A;  3SFI A;  4L0Y B;  5CVR A;  4MTE A;  2KJC A;  1S9H A;  4YII A;  1WH7 A;  2A5Y B;  2NOJ B;  3PSI A;  1B9M A;  1EKE A;  3DKY A;  2IT0 A;  2FA5 A;  4Q4Z F;  2ZJR F;  2OD5 A;  1XDU A;  4U0Y A;  4C2U A;  3KP5 A;  2HR3 A;  4XNF A;  1P7J A;  3M4O J;  3RTR A;  1B8I A;  2KDO A;  1ZHF A;  3PJR A;  3IRQ A;  2E34 A;  4LGW A;  5ED4 A;  4II3 A;  5IP6 A;  3FXM A;  3I53 A;  3ZMZ A;  1ZG3 A;  3I59 A;  3QU6 A;  2X1E A;  3JR9 A;  1H9T A;  1VQL I;  2MYS A;  2XGC A;  4LG0 A;  1VQ6 I;  3K70 D;  4M3D A;  1IJW C;  1FOX A;  3IP4 B;  3CUQ A;  3HSE A;  2DMQ A;  4KT5 C;  1OR7 A;  3HHH A;  3FK7 A;  2QKM B;  1U9O A;  2ETH A;  2L54 A;  2DCE A;  4AC0 A;  1U5T A;  3HOX J;  2RNG A;  5L3F A;  2DFF A;  3IUO A;  2HYJ A;  1QQI A;  2O3F A;  4KA4 A;  2NS7 A;  1T98 A;  2EZK A;  2R93 J;  4NNJ A;  3OYG A;  1XX5 A;  4PFO A;  1FYK A;  2X6Y A;  1YG2 A;  3G4S I;  3PO3 J;  5M5W J;  1G2H A;  5LEK A;  5DUK A;  5BS6 A;  1LB2 A;  4AIJ A;  2JWT A;  1IN4 A;  2E1M C;  3PFI A;  4HQE A;  3DXJ F;  3OYA A;  1N25 A;  2M87 A;  2ZJP F;  4BXU A;  4HNT A;  3ZQ7 A;  2EWN A;  4LIU A;  3KEY A;  2DI3 A;  4NC6 A;  1V3F A;  3QRF F;  4PFP A;  3E97 A;  3FZV A;  4DW6 A;  2L9V A;  3KP2 A;  3S14 J;  3R0A A;  3GF2 A;  2V26 A;  3GTG J;  3Q9V A;  3I54 A;  5CVI A;  3ZMS A;  3HTU A;  2QWW A;  1EV7 A;  3I71 A;  2P81 A;  1WJB A;  2PEX A;  1SFO J;  1IN6 A;  5EGO B;  1MBG A;  4CCO A;  3VYS B;  2K40 A;  2A6H F;  3LA2 A;  3MCZ A;  2LRD A;  2GBY A;  3GFJ A;  3FBI B;  4PZJ A;  3DBH B;  1TWF J;  3EYI A;  2ECC A;  4EVI A;  2NNY A;  4KIF A;  3HM5 A;  4FX4 A;  4LLN A;  2NS0 A;  2P0W A;  3JW4 A;  3CCV I;  1PVE A;  1B6A A;  2X48 A;  2Z2S B;  3HKZ A;  1ZG5 A;  4Y17 A;  5EEH A;  1SFK A;  2V4J C;  4AWX B;  3JAM Z;  2CUF A;  1ETK A;  1ZRE A;  2PI0 A;  3FKJ A;  1WJC A;  9ANT A;  4HX7 A;  2VXD A;  3CCU I;  3KP7 A;  3I4N J;  3WG7 H;  3BLY A;  2E1O A;  4EEF G;  4G12 A;  1OMI A;  5CVU A;  2DOF A;  2LBF B;  4I6Z A;  2Y0M A;  4RAY A;  2HU9 A;  2ZBK A;  2QF7 A;  3HOY J;  2DN0 A;  1SVL A;  4IHT A;  4O5V A;  2QSG X;  2GA1 A;  3K1N A;  4DBR A;  2KMU A;  2K85 A;  4QIW N;  4M9S A;  1W0T A;  3CDH A;  2DDB A;  5DYM A;  4HDU A;  3D5S C;  3FIW A;  5ERI A;  3BTC A;  1VQ5 I;  1HDP A;  2KRC A;  3GFI A;  5J8C A;  2DFE A;  3E6C C;  1ZK8 A;  5EYR A;  1K7A A;  4P55 A;  1IF1 A;  4MTD A;  3RIR A;  2DA1 A;  3K7A J;  3L1P A;  2CFO A;  1WI3 A;  4E7J A;  3CCR I;  4AU7 A;  1TLH B;  1VQ9 I;  3A03 A;  3DV8 A;  2JUG A;  2W85 A;  2ZNZ A;  3RKW A;  4UVB A;  1LFB A;  1TBX A;  2M8E A;  5CLS A;  2FBK A;  2VC1 A;  1JUM A;  5K5O A;  3J7Y J;  2HDC A;  2I10 A;  4CIC A;  4BEH A;  3JAM K;  3UR3 C;  3A2K A;  2QLZ A;  3P9K A;  2V6C A;  4MNU A;  2PMH A;  2ZME B;  2KLO A;  5HLG A;  3ECO A;  2CUJ A;  5GAE J;  3GX4 X;  1MZB A;  2V9V A;  4KIS A;  1MIJ A;  1QBJ A;  2K9S A;  4B3X A;  3LSH A;  1N78 A;  1FMW A;  3BR3 A;  2YPR A;  1Z9C A;  1G3W A;  1B59 A;  1IG7 A;  1P2F A;  4DYC A;  3G71 I;  2V1X A;  1TQM A;  5IOZ A;  2I8D A;  3WHB A;  3U1K A;  4C9Y A;  3H5N A;  4A6D A;  4FET A;  1XGS A;  3ASN H;  4DZJ A;  3BCA A;  4WF2 A;  1JTY A;  4ZYH A;  3FIS A;  2D1H A;  2WWY A;  2AXL A;  3KZZ A;  3E6M A;  3K69 A;  3HGY A;  3TDZ C;  3PM1 A;  3HPH A;  1CQT A;  1YFH A;  1BI2 A;  2BY3 A;  3W2A A;  2FD5 A;  3DF8 A;  4PJM A;  4A3J J;  4P1W A;  4XLA A;  3I59 B;  4IVN A;  3W2V A;  1FLI A;  3I4M J;  1TQI A;  2F4M B;  2KZV A;  3E5X A;  4HNV A;  4FE4 A;  4S05 A;  3DTK A;  3CCS I;  4XN0 A;  1RET A;  2DOA A;  1PYV A;  1FSH A;  1PUF B;  3I0T A;  2WY7 Q;  3OIQ A;  1QVT A;  4PCQ A;  5CYV A;  2XKP A;  4DJA A;  2CO5 A;  2ESN A;  1YX3 A;  2PMU A;  2KPM A;  3JRA A;  2L01 A;  3J7A Y;  2MLK A;  2GXG A;  4OU0 A;  2LKP A;  3CCE I;  1ZAR A;  3S15 J;  1OYW A;  1R5G A;  1MMN A;  2LY1 A;  2VIX A;  4BXX J;  4F3Q A;  1GUU A;  3O6B B;  2B9S A;  4BKX A;  1FYL A;  2OPT A;  3OL3 A;  2R5Z B;  2R7X A;  3GTL J;  2Q8K A;  1J9I A;  5EEA A;  3V8J A;  2WAQ A;  4A3C J;  2X4H A;  1KQ0 A;  4DBQ A;  4UV9 A;  1TWG J;  2IJL A;  1IUY A;  2JN6 A;  3WU0 A;  4XLE A;  4N9H A;  1MSF C;  2E35 A;  2EIN H;  2W00 A;  2JQ7 A;  4ZYE A;  1ZGJ A;  2DA2 A;  5F0C A;  1ZRF A;  3HDD A;  4EJO A;  3WGG A;  2FOW A;  2GXB A;  1Z21 A;  3LSM A;  2ID6 A;  5BMZ A;  4F55 A;  4NDL A;  4CSW A;  2OTL I;  2MSY A;  2O7O A;  1EH7 A;  3CCQ I;  1LE8 A;  1WGX A;  4IXA A;  3BPV A;  5FFZ A;  1D8K A;  2TRT A;  4LK1 F;  1DU0 A;  4PJ0 C;  3WU1 B;  2FRH A;  3T8R A;  3KZY A;  3QPL A;  4S0H B;  4D7M A;  3CLO A;  1TW3 A;  1ZYR F;  2OZ6 A;  3TO9 A;  2XPW A;  1YW9 A;  3TOB A;  2CW8 A;  3CTA A;  4EJV A;  4A3K J;  3MN2 A;  3N97 A;  4FHT A;  3GZ5 A;  2F2E A;  2JVH A;  3M8J A;  2DMP A;  4YFN F;  2ME6 A;  2EIM H;  4M3B A;  1OFC X;  4OIO F;  4HAM A;  4RAG A;  5HDN A;  1I5Z A;  3OYM A;  4K2E A;  5EGO A;  5AON A;  2CW0 F;  5K7F A;  1D0X A;  3S3N A;  2YU3 A;  4IHW A;  4BAC A;  4NC7 A;  3KEO A;  2JK3 A;  1XGO A;  4RM3 A;  1E3P A;  3LST A;  1YS7 A;  4NBQ A;  5IY5 H;  5D4S A;  1FBQ A;  2QUF A;  2KZG A;  3P5J A;  3OYE A;  3EUA A;  2HNH A;  3QOD A;  4HLY A;  3SJM A;  2ZSH B;  3E5Q A;  2FJ1 A;  2BY2 A;  3B6C A;  2QVO A;  2X51 A;  5EEG A;  4BY7 J;  4X0G A;  2PLY A;  4CCN A;  1SD6 A;  1X2N A;  1FOY A;  2L02 A;  1AKH A;  1LDK B;  3V7R A;  2LK2 A;  2H8R A;  3HXL A;  3ONQ A;  4RB1 A;  2E5Z A;  3ABM H;  1DDN A;  1FX7 A;  3ZQQ A;  3BCB A;  3KLO A;  4U0V A;  5AIP A;  4FX0 A;  1W0U A;  1J75 A;  3HOT A;  2DU9 A;  5J1R A;  1MBF A;  2YX4 A;  1MW7 A;  3DP7 A;  1QNT A;  2HYF A;  2JUC A;  3H9G A;  1KQ8 A;  3AL0 B;  4LIV A;  5LRR A;  4UUV A;  2XGD A;  2F48 A;  3OIP A;  1L3L A;  1OYY A;  3K1M A;  2BGC A;  2CUE A;  4NUB A;  4F52 A;  2ESH A;  3P9I A;  4HF0 A;  5HLI A;  3OYC A;  5DTD A;  1FYM A;  5KK1 A;  2OZU A;  3ISP A;  1K79 A;  4QSH A;  1BC8 C;  4EJW A;  3MZY A;  3TGN A;  2YUS A;  2VT3 A;  5D6E A;  3LAP A;  1TNS A;  5FRO A;  5E3L A;  3MQ0 A;  3OYH A;  2QCO A;  2ZB9 A;  4YFK F;  2H27 A;  1UHS A;  2A5W A;  3G1M A;  4KMU X;  4RGS A;  5F0H A;  1OCP A;  1NK3 P;  5J1U A;  2MC4 A;  3QPH A;  2MFZ A;  2R7O A;  1FPQ A;  1EJ9 A;  2MD0 A;  1REP C;  5K5R A;  1STZ A;  5ILV A;  3K70 C;  5LFA A;  4B09 A;  2DOD A;  4MIM A;  2R5Z A;  2VBX A;  1UHM A;  2TDX A;  3I58 A;  2VC0 A;  1ONV A;  2M3A A;  1P92 A;  3RZO J;  2VAS A;  2FQ3 A;  5D5W B;  1X1B A;  3ZCO A;  4V2F A;  4Z2Y A;  4Y15 A;  1K6O A;  1E3H A;  3J80 Z;  3CUQ C;  4ANJ A;  1ETW A;  2N8G A;  1RUN A;  2PN6 A;  1X4O A;  4C3J J;  2FXA A;  1RNL A;  2NYX A;  4OIR F;  1XMA A;  5E20 A;  2HGC A;  5IT9 Z;  1JKO C;  4IEJ A;  1O7L A;  2CYY A;  5CQG A;  2P5V A;  2R7W A;  2EFN A;  3FXU A;  5M5X J;  1K78 B;  3CMM A;  5ICG A;  3OS0 A;  4N9I A;  2CQN A;  3LSG A;  2MA3 A;  4DIQ A;  3JTH A;  1XMX A;  2CV1 A;  2V7F A;  3QAH A;  2CQQ A;  5B3S H;  1ZGA A;  3F8M A;  1VQ4 I;  3T5X A;  1JUP A;  2ELH A;  4HDV A;  2ELJ A;  1TT0 A;  2XB5 A;  2EQR A;  1T56 A;  1DGR M;  3IC7 A;  1X1D A;  2X6O A;  5CJ9 A;  2D2W A;  3S2W A;  5BNG A;  2VB6 A;  4EGZ A;  4NQW B;  1VTN C;  1QZE A;  1D3Y A;  3Q5F A;  2CV0 A;  2W48 A;  2HWV A;  2HZT A;  2Z3Y A;  3BR5 A;  1FSE A;  3GUD A;  5CQE A;  1JHH A;  2HQR A;  4V19 K;  3MKY B;  3M8E A;  4RM2 A;  1Q1V A;  1YE9 A;  5K7H A;  4RAZ A;  4BE2 A;  1T2K A;  3A01 A;  1UJ8 A;  3G1O A;  2EB7 A;  1TTY A;  1E3O C;  3OY9 A;  1R00 A;  4HSR A;  4ZYD A;  1IAW A;  3AG2 H;  1V4R A;  4XR6 A;  1ZG1 A;  1YRN A;  3BZ6 A;  1NHA A;  1JT6 A;  1YYV A;  2DMT A;  3TO6 A;  1AU7 A;  1UZC A;  4ZDL A;  2E2J J;  5HS9 A;  4M3F A;  5L3E A;  2CGP A;  2DTZ A;  4UHT A;  3OL4 A;  4DZP A;  3FM5 A;  5LHH A;  1QGP A;  4RB3 C;  3R60 A;  4PJN A;  3M8F A;  1FBS A;  5LGU A;  1T8I A;  3KP4 A;  2O5R A;  4H4K C;  2F5V A;  3GXO A;  4P96 A;  2E2H J;  1R4M B;  1EF4 A;  1WQ2 A;  4BH9 A;  1J59 A;  3GME A;  1FEX A;  2VBZ A;  2VE9 A;  2EIJ H;  4IZZ A;  1YW7 A;  4HEA 2;  2FF4 A;  4U7D A;  1UFM A;  2QQA A;  4Y7N J;  1XGN A;  1O3R A;  2RGV A;  5E17 F;  3K2Z A;  1QZY A;  4FE7 A;  2KIU A;  4HLX A;  1ZQ3 P;  2G9W A;  4C30 A;  2CFX A;  2GLO A;  5B5E C;  3DLA A;  1F1Z A;  1LPQ A;  2CWE A;  4MQV A;  2NVU B;  2P6S A;  2ZXI A;  4Z6Y A;  3F6O A;  4JX6 A;  5FO5 A;  1ZLJ A;  3A0H C;  1IRF A;  3WTS C;  2HPM A;  2ZME C;  2Q2E B;  2WAE A;  2IBD A;  2O0Y A;  1Z3X A;  2QZ8 A;  2LP0 A;  4P9U A;  4OMZ A;  4CGZ A;  3R0J A;  4XMY A;  3CF2 A;  4EM0 B;  4BY1 J;  1KYZ A;  2ZXW H;  4XL9 A;  2JPB A;  1WJF A;  2HXO A;  1KU9 A;  2OU2 A;  2A07 F;  1G8X A;  1W36 D;  4E7L A;  1U8R A;  1T08 B;  4WX9 A;  2DT6 A;  2M0M A;  3BR6 A;  2HOA A;  3QOE A;  5TJJ A;  3S32 A;  2BHZ A;  5KAF C;  2H09 A;  2TCT A;  2E36 A;  4UXN A;  1VQ7 I;  1WJE A;  4KDP A;  2G0E A;  1TZL A;  2DAO A;  5H20 A;  4XLP F;  2HEO A;  4OIP F;  1AWC A;  1JJ6 C;  4PGH A;  2DT5 A;  5FRN A;  5TGT A;  4J00 A;  3WTY C;  1G3T A;  4MFD A;  2J5O A;  4HQM A;  2NVY J;  1K78 A;  4WXH A;  3SZP A;  3OYL A;  1WSU A;  2HOE A;  3LA3 A;  3D0S A;  3FHN A;  4LLL A;  1R9T J;  4WK8 F;  2HTS A;  3IKT A;  2DMU A;  1I6X A;  1ODD A;  3HOV J;  2L7K A;  3ECH A;  4I98 B;  1Z7L A;  2XAS A;  5GTI C;  5C3E J;  5CVJ A;  3HC7 A;  4XRS G;  4TV7 A;  4RB2 C;  3DCF A;  5H6R A;  3OYF A;  4ON0 A;  1U8B A;  2HYG D;  3HUG B;  3UKG A;  3G73 A;  2KJB A;  1Y8Q B;  1UCR A;  1X3U A;  3CUQ B;  4MO7 A;  2VQL A;  4MEY F;  1D0Z A;  4WWC A;  2JRT A;  2FX0 A;  5EJC A;  3HGG A;  4YFX F;  2ZJQ F;  5HVQ C;  3TW6 A;  2F5F A;  3S1M J;  4CZC A;  3IHU A;  1XN7 A;  4ZDP A;  4UY8 I;  2QYO A;  4ZTJ A;  4BDY A;  2M8G X;  2LD5 A;  4XRF A;  4BNC A;  2ZXH A;  3K4N A;  1OCZ H;  2VBW A;  3U21 A;  5K5Q A;  2VLA A;  3CF5 F;  1YO5 C;  4C3I J;  5F27 A;  3D1N I;  4L5J A;  4CA0 A;  4R8H A;  1I6H J;  2W57 A;  1TQP A;  2EZH A;  3VPR A;  3BG9 A;  3NRV A;  5ICC A;  1YHQ I;  2XIG A;  3MMY B;  2IXS A;  2XF5 A;  4BHC A;  2HVS A;  3AKZ A;  4MLO A;  2ZCW A;  2QQ8 A;  4DGW B;  2DPD A;  1P4W A;  3F8N A;  2ZO4 A;  2QBY B;  1WRJ A;  1RUO A;  4A0Z A;  4BEH B;  2DQL A; 
#chains in the Genus database with same CATH homology
 3F6V A;  3JTG A;  1ZN2 A;  2Z99 A;  5E18 F;  3MZH A;  2VE8 A;  2HS5 A;  2R3S A;  2Y75 A;  3H3Z A;  5D5V B;  3DPT A;  2OAZ A;  5JFR A;  1I1S A;  2OBP A;  4ENN A;  1T6S A;  4BHB A;  2RNJ A;  4RGU A;  3SZT A;  1YTY A;  2LF8 A;  2YSR A;  1J0R A;  3H92 A;  2UWM A;  2VT2 A;  5J6X A;  1SFU A;  3V7C A;  2XKO A;  3L00 A;  1EH8 A;  5DCM B;  5JVT A;  5IT9 K;  2FOK A;  2DW4 A;  1W7P A;  2DQR A;  3W6K B;  1MDM A;  3MFK A;  2L4M A;  1G3Y A;  1HXD A;  3RYP A;  1BI0 A;  4CDG A;  1GXP A;  2VN2 A;  4JK1 X;  1L0O C;  1IZ1 A;  1DPU A;  2RKH A;  4MEX F;  2EA2 A;  3OV8 A;  3WTW C;  3SQN A;  3ZN0 A;  3ULQ B;  1GXQ A;  2B0L A;  4A0Y A;  5FB2 A;  1ON1 A;  4HF2 A;  3WTT C;  1R22 A;  1C0W A;  1D8J A;  1AOY A;  2GAU A;  4A0X A;  1KYW A;  2FMY A;  2STT A;  5FD6 A;  3C1D A;  4LMY A;  1WKM A;  2EA4 A;  3ML6 A;  2G7H A;  1FBU A;  5KVR A;  2HFH A;  2O6G E;  3VOD A;  3FXR A;  4LJZ F;  4A5M A;  3KET A;  2FBI A;  1BI1 A;  1E2X A;  4B8X A;  2Q2E A;  1BIA A;  3GFM A;  2P4W A;  5HOO A;  2MLG A;  1Z1D A;  4WXC A;  2A69 F;  2PQ8 A;  2RDP A;  3J81 Z;  2DTR A;  2P5L C;  3E3V A;  3L9F A;  2LSO A;  4MGR A;  2NNN A;  5D5U B;  5A2Q Z;  2ZJ2 A;  4E70 A;  3QOP A;  4L18 B;  2P7V B;  1PUE E;  2L4A A;  2P6T A;  5LGN A;  2VOP A;  3HUG A;  1B4A A;  3OOP A;  1LDJ A;  3F8C A;  4IPA A;  3J7A O;  2A3S A;  5ICE A;  2W25 A;  5IT3 A;  3ZMV A;  4IF4 A;  3WGH A;  1WI9 A;  2VOO A;  2YR2 A;  2H6C A;  1G3S A;  2IA1 A;  4EMS A;  4L9N A;  3K9T A;  4EGY A;  2D45 A;  1HSJ A;  3VB2 A;  4ENK A;  3ROU A;  4I0A A;  1E17 A;  2D1V A;  4LB6 B;  1HKS A;  3V8K A;  1Y0U A;  3E6D A;  1OKR A;  4OIQ F;  2M30 A;  2XUB A;  4Q48 A;  2XRO A;  2ZKZ A;  4BAY A;  1HW1 A;  1SD4 A;  3EET A;  1O3Q A;  5AIQ A;  1XB4 A;  4G94 A;  4G6D A;  3F8B A;  4ENJ A;  2QBY A;  1XDS A;  4HX4 A;  1QPM A;  3HYI A;  4ZZL A;  1CF7 B;  3HIF A;  4ASN A;  1U3E M;  3ABT A;  2IW5 A;  3TDU C;  1YLF A;  3I4P A;  1TW2 A;  4UVA A;  1MDM B;  4ZZD A;  4U0W A;  3EDP A;  2DO7 A;  3F8F A;  4IRI A;  4A2U A;  3BY6 A;  2K7L A;  1BBY A;  3DQV C;  5D5X B;  1O3S A;  2XVC A;  3GFL A;  5LEJ A;  3RDI A;  3RPU A;  3ABU A;  1SD5 A;  3CUO A;  2MC3 A;  1MJA A;  3HRS A;  4M71 A;  4H0E A;  3GO5 A;  4UV8 A;  2LNB A;  4Q5S F;  1LEB A;  4KN7 X;  3M1E A;  5E8G A;  3R61 A;  4HX8 A;  2LF7 A;  2VXZ A;  1Z6T A;  3F21 A;  6PAX A;  1MJB A;  3N4M A;  3BJA A;  1J2X A;  3QP6 A;  2HTJ A;  3JSP A;  3COA C;  3H3U A;  2A61 A;  1MKM A;  1BIB A;  1DUX C;  2C6Y A;  2K27 A;  2KKO A;  2IP2 A;  2FSW A;  3QU3 A;  2EJR A;  3ZMT A;  3T0Y A;  1KQ9 A;  2M45 A;  1FNN A;  1XGM A;  1DPR A;  1O7F A;  2NRA C;  1U78 A;  1GHC A;  4EM1 A;  3W6J B;  3V4G A;  3U1D A;  2STW A;  4QWQ A;  2RN7 A;  1JHF A;  2FNA A;  4KIG A;  4O6J A;  4I01 A;  5FLX Z;  4M6X A;  2XAJ A;  1XMK A;  4A6E A;  3MAJ A;  5CVV A;  1R36 A;  1UST A;  3LAJ A;  3NEU A;  4ENM A;  3ELK A;  5DDG A;  2ISY A;  4KFC A;  5D6F A;  2H94 A;  1OPC A;  3I64 A;  4I09 A;  2QQB A;  4PGG A;  1BM9 A;  1G6N A;  1O57 A;  2R7D A;  5DV5 A;  4D0P A;  4OMY A;  4Q47 A;  1T39 A;  3L2C A;  3WOD F;  2KIM A;  2JTV A;  2FEZ A;  3IWF A;  2UXN A;  4GCV A;  2GWR A;  2UXX A;  1RI7 A;  4BYY A;  3WGI A;  1G4D A;  2VOD A;  2RVC A;  3RPQ A;  1OYI A;  2GZW A;  2XGX A;  3ERE D;  1WWX A;  3V8L A;  2ISZ A;  3LQQ A;  1LQ1 A;  1T0F A;  1FP2 A;  3G3Z A;  2K02 A;  5FLX K;  3L09 A;  1RIO H;  1IN7 A;  2R7F A;  1IW7 F;  2K4B A;  2V1D A;  2W84 A;  3IRR A;  4S04 A;  1SMT A;  2ZXJ A;  4M9X A;  2COM A;  2L3D A;  2FE3 A;  2MD5 A;  1HBX G;  4CHU A;  1KU3 A;  5HLH A;  4KIB A;  4EJT A;  4HV5 A;  3IWZ A;  4EV0 A;  3RYR A;  4P9F A;  4ESJ A;  1BJA A;  1P4A A;  4UVC A;  4G7O F;  5L3C A;  3LWF A;  3CJN A;  3VEP A;  1ZAO A;  5HS7 A;  4L9J A;  4M6Y A;  1U6G A;  4IRH A;  4HZF A;  2ZFW A;  3DKW A;  1LJ9 A;  2V79 A;  3RKY A;  4CZZ A;  4BQA A;  1BI3 A;  3BPX A;  5HDG A;  2A6E F;  1F4K A;  4U7B A;  5F6F A;  1S3J A;  4Y13 A;  4R1H A;  2G7U A;  3WG9 A;  3FM3 A;  3KFW X;  4R79 A;  2Q0O A;  2PBI A;  2KRF A;  1W4M A;  2MBF A;  1LDD A;  1P4X A;  4KNY A;  1LVA A;  1GVJ A;  5D4R A;  3DPL C;  4I7H A;  2H6B A;  1JXS A;  3QPT A;  3IL2 A;  5TRD A;  3C18 A;  2J5P A;  3LFK A;  1S29 A;  2BBY A;  1BN5 A;  1HQC A;  2OA4 A;  3R4K A;  4JQF A;  4UNO A;  3RI4 A;  3IKV A;  2FNP A;  1KU2 A;  2F5C A;  5F1R A;  5ILU A;  4DQ2 A;  1ON2 A;  2JSC A;  2QEN A;  5BQT A;  3KEQ A;  4U88 A;  1SD7 A;  3WTZ A;  4AD9 A;  1R58 A;  4ZH4 F;  3HTS B;  2RQP A;  3B02 A;  3GEZ A;  2XRN A;  2M5W A;  5FGM A;  1KA8 A;  5LGT A;  1B9N A;  3MWM A;  3BP8 A;  4A12 A;  3C7J A;  4FT8 A;  3M7G A;  1IN5 A;  3SHF A;  1FOK A;  5DCF A;  2BEO A;  4YIF A;  1R1T A;  4KMF A;  2DK5 A;  2XAQ A;  2O03 A;  4ETS A;  2P8T A;  5D8L B;  4HA8 A;  2DPU A;  4EJU A;  2DK8 A;  2BV6 A;  5A2Q K;  2YX7 A;  1JE8 A;  1W5S A;  5E8I A;  2EFW A;  4KYW A;  3J81 K;  4L5I A;  2E1N A;  3GW2 A;  1Q1H A;  2RV8 A;  1EH6 A;  4GYI A;  4GO1 A;  4I0B A;  3TKY A;  5JI6 A;  5LRS A;  2GIV A;  2AS5 F;  1SFE A;  3GVA A;  3V7S A;  4QLC U;  5E1X A;  1HW2 A;  2V1U A;  1FY7 A;  1XCB A;  3ZPL A;  1B1B A;  1ZRC A;  5F64 A;  3SFZ A;  2XV4 S;  3BDD A;  2JPC A;  3BOQ A;  3EQL F;  5DD8 A;  1O3T A;  3TOA A;  1T38 A;  3P9C A;  2HQN A;  4P5O A;  3WTX C;  3C3W A;  2NAZ A;  4N0B A;  3FMR A;  4RGR A;  4PDK A;  1XSD A;  1IXS B;  1MJ9 A;  3K0L A;  1D5V A;  5L3D A;  2BYV E;  2LDU A;  2Y48 A;  2QM3 A;  1MGT A;  4DNC A;  2EFQ A;  3FF5 A;  1R1V A;  2CQK A;  3T1B A;  2WC2 A;  3BWG A;  1R1U A;  3WTV C;  3VFZ A;  1FT9 A;  1XSX A;  4EM2 A;  4G7Z F;  2PJP A;  5E1W A;  3GYH X;  4CXF A;  4I02 A;  2ZME A;  2M1B A;  3U9G A;  2OQR A;  1S8N A;  1U5T C;  4ESF A;  3L7W A;  1PP7 U;  2IRF G;  1TNT A;  3HSR A;  3O3K A;  1I1G A;  2PG4 A;  2VBY A;  4O3M A;  1U2W A;  1KGS A;  3FWE A;  2F5D A;  3E5U A;  1R5H A;  3O2P E;  4AVP A;  2FBH A;  4YG2 F;  1QO0 D;  3SXY A;  3F3X A;  3ZMD A;  3FHZ A;  5BPD A;  1IXR C;  4LLG F;  3ZN1 A;  4M72 A;  5LHG A;  1BOA A;  2WTE A;  5FFX A;  3HRM A;  3DFG A;  1Z7U A;  3HSF A;  3FX3 A;  3HRU A;  5DEQ A;  5L3G A;  3KE2 A;  2ACJ A;  1PDN C;  2E7X A;  1SFX A;  3BJ6 A;  4GXO A;  4L0Z B;  1MD0 A;  3T8T A;  3WE3 A;  4OIN F;  4JBA A;  1XCV A;  3KP6 A;  1XD7 A;  2CSO A;  4KN4 X;  3WE2 A;  3REO A;  4HW0 A;  4BHP A;  1FWZ A;  3F23 A;  3NQO A;  1S7O A;  1IXC A;  1R23 A;  5K1Y A;  4LFU A;  4G9Y A;  4IHS A;  3HHG A;  4LD5 A;  1Z91 A;  4LK0 F;  5BOX A;  3PQJ A;  3GLX A;  3FMS A;  2IA0 A;  2Z5U A;  1YQA A;  4XSX F;  4F7Z A;  4XLN F;  2P5K A;  3GZ6 A;  2O61 A;  1S6L A;  4WXD A;  5E1Z B;  1I27 A;  4RGX A;  2IVM A;  3LQR A;  5D8K B;  3TQN A;  1IRG A;  4LG0 B;  3EUH A;  2EK5 A;  1FC3 A;  1HKT A;  1LEA A;  5ILS A;  5FD5 A;  4ESB A;  1W5T A;  4KUM A;  4CO8 A;  2MH2 A;  2OQG A;  3BRO A;  5LLQ A;  4NB5 A;  1ZH5 A;  3JSO A;  2EV0 A;  5LBQ A;  2HKX A;  5HDK A;  2F5E A;  1W7P B;  4EQQ A;  2GQQ A;  2WV0 A;  1UB9 A;  4M74 A;  1Z6R A;  1FP1 D;  3B73 A;  1HST A;  1XSV A;  5DUI A;  5ICF A;  4RB0 A;  1SMY F;  2W24 A;  4A5N A;  2QQ9 A;  1J5Y A;  1W7P D;  3E6B A;  3BJO A;  4CYD A;  2EV5 A;  1BC7 C;  1PP8 F;  1ULY A;  2UZK A;  4KIC A;  3VOE A;  5HS8 A;  1J7K A;  3R6S A;  3F72 A;  1U5T B;  3P7N A;  5BPI A;  3Q9S A;  1JGS A;  5DCM A;  4M9Z A;  3WTU C;  1USS A;  4G7H F;  3U2R A;  2XAF A;  3HRT A;  1P6R A;  4M73 A;  5JHU A;  2CG4 A;  2XHK A;  1YS6 A;  4OOI A;  2JT1 A;  4IJA A;  3HOS A;  3K1P A;  4GGG A;  2X0L A;  2E1C A;  3J80 K;  1KU7 A;  4NQW A;  2Z9O A;  4AIK A;  2ADU A;  3PQK A;  4RS8 A;  3DEU A;  5L3B A;  2DBB A;  2RC4 A;  2IA2 A;  2DFI A;  1YW8 A;  2XAG A;  3FXQ A;  2XAH A;  2Z33 A;  3GWZ A;  2A68 F;  3LA7 A;  4WCG A;  3F22 A;  1RZ4 A;  4L9T A;  1R7J A;  5H6Q A;  2JZY A;  3AAF A;  4XSZ F;  3QP5 A;  1CGP A;  4AIH A;  2GA2 A;  3M9A A;  2IPQ X;  3KLN A;  3ZP5 A;  5JR3 A;  1LNW A;  1HW5 A;  2EV6 A;  2EFP A;  4LB5 A;  2VON A;  3KP3 A;  2EFO A;  4GYG A;  4HV6 A;  5LHI A;  1A04 A;  3RKX A;  3MEX A;  4MHG A;  1QZZ A;  3RJP A;  3TO7 A;  1F9N A;  2PFB A;  5J8F A;  3FMQ A;  4I2O A;  4HYE A;  3ZMU A;  2ZNY A;  2K4J A;  1ZLK A;  4HOB A;  1HKQ A;  4NHJ A;  1IN8 A;  4IRG A;  2MH9 A;  2K86 A;  2P7C B;  4XBF A;  2HKO A;  4MQ9 F;  4G8X A;  4HF1 A;  2O8X A;  1CF7 A;  4G6Q A;  3I5U A;  4ZYG A;  1SAX A;  1S7A A;  2DLL A;  3CO7 C;  1DP7 P;  2FU4 A;  1F5T A;  1ZRD A;  1FZP B;  1H9G A;  3CO6 C;  4L9V A;  2KIF A;  1Z05 A;  2BE5 F;  1H0M A;  3D5L A;  1UHW A;  5DD4 A;  4HBL A;  1YIO A;  3KCC A;  2E7W A;  3EYY A;  2FML A;  4L0Y B;  5CVR A;  4MTE A;  2KJC A;  4YII A;  2A5Y B;  1B9M A;  2IT0 A;  2FA5 A;  4Q4Z F;  2OD5 A;  1XDU A;  4U0Y A;  3KP5 A;  2HR3 A;  3RTR A;  1ZHF A;  3IRQ A;  4LGW A;  5ED4 A;  3I53 A;  3ZMZ A;  1ZG3 A;  3I59 A;  3QU6 A;  1H9T A;  4LG0 A;  3CUQ A;  3HSE A;  4KT5 C;  1OR7 A;  3HHH A;  2ETH A;  2L54 A;  1U5T A;  5L3F A;  1QQI A;  2O3F A;  4KA4 A;  1T98 A;  1FYK A;  1YG2 A;  5LEK A;  5DUK A;  5BS6 A;  1LB2 A;  4AIJ A;  1IN4 A;  3PFI A;  4HQE A;  3DXJ F;  2M87 A;  4BXU A;  3ZQ7 A;  2EWN A;  2DI3 A;  1V3F A;  3QRF F;  3E97 A;  3FZV A;  3KP2 A;  3R0A A;  3GF2 A;  3Q9V A;  3I54 A;  5CVI A;  3ZMS A;  3HTU A;  2QWW A;  1EV7 A;  3I71 A;  2PEX A;  1IN6 A;  2A6H F;  3LA2 A;  3MCZ A;  3GFJ A;  4PZJ A;  3EYI A;  4EVI A;  2NNY A;  4KIF A;  4FX4 A;  4LLN A;  2NS0 A;  3JW4 A;  1B6A A;  1ZG5 A;  4Y17 A;  5EEH A;  4AWX B;  3JAM Z;  1ZRE A;  2PI0 A;  4HX7 A;  3KP7 A;  1OMI A;  5CVU A;  2Y0M A;  4RAY A;  2ZBK A;  4IHT A;  4O5V A;  2GA1 A;  3K1N A;  4M9S A;  3CDH A;  5DYM A;  4HDU A;  5ERI A;  3GFI A;  5J8C A;  3E6C C;  1K7A A;  4P55 A;  1IF1 A;  4MTD A;  3RIR A;  1TLH B;  3DV8 A;  2W85 A;  2ZNZ A;  3RKW A;  4UVB A;  1TBX A;  2M8E A;  5CLS A;  2FBK A;  2VC1 A;  5K5O A;  2HDC A;  4CIC A;  3JAM K;  2QLZ A;  3P9K A;  2V6C A;  4MNU A;  2PMH A;  2ZME B;  5HLG A;  3ECO A;  3GX4 X;  1MZB A;  2V9V A;  1QBJ A;  2YPR A;  1Z9C A;  1G3W A;  1B59 A;  1P2F A;  2V1X A;  1TQM A;  4A6D A;  1XGS A;  4WF2 A;  4ZYH A;  2D1H A;  2WWY A;  2AXL A;  3KZZ A;  3E6M A;  3K69 A;  3TDZ C;  1YFH A;  1BI2 A;  3DF8 A;  3I59 B;  4IVN A;  1FLI A;  1TQI A;  3E5X A;  4S05 A;  1FSH A;  3I0T A;  4PCQ A;  5CYV A;  2XKP A;  2CO5 A;  2ESN A;  2PMU A;  2L01 A;  2MLK A;  2GXG A;  4OU0 A;  2LKP A;  1ZAR A;  1OYW A;  1R5G A;  3O6B B;  1FYL A;  2Q8K A;  1J9I A;  3V8J A;  2X4H A;  1KQ0 A;  4UV9 A;  2IJL A;  1IUY A;  3WU0 A;  4N9H A;  4ZYE A;  1ZGJ A;  1ZRF A;  4EJO A;  3WGG A;  2GXB A;  5BMZ A;  1EH7 A;  4IXA A;  3BPV A;  5FFZ A;  1D8K A;  4LK1 F;  3WU1 B;  2FRH A;  3T8R A;  3KZY A;  3CLO A;  1TW3 A;  1ZYR F;  2OZ6 A;  3TO9 A;  1YW9 A;  3TOB A;  3CTA A;  4EJV A;  3N97 A;  4FHT A;  3GZ5 A;  2F2E A;  4YFN F;  4OIO F;  4HAM A;  5HDN A;  1I5Z A;  4K2E A;  5AON A;  2CW0 F;  2YU3 A;  3KEO A;  1XGO A;  3LST A;  1YS7 A;  5D4S A;  1FBQ A;  2QUF A;  4HLY A;  3E5Q A;  2QVO A;  5EEG A;  2PLY A;  1SD6 A;  2L02 A;  1LDK B;  3V7R A;  4RB1 A;  1DDN A;  1FX7 A;  3KLO A;  4U0V A;  5AIP A;  1J75 A;  4FX0 A;  3HOT A;  2DU9 A;  2YX4 A;  3DP7 A;  1QNT A;  2HYF A;  1KQ8 A;  5LRR A;  4UUV A;  1L3L A;  1OYY A;  3K1M A;  2BGC A;  2ESH A;  3P9I A;  4HF0 A;  5HLI A;  1FYM A;  5KK1 A;  2OZU A;  3ISP A;  1K79 A;  1BC8 C;  4EJW A;  3MZY A;  3TGN A;  2VT3 A;  5D6E A;  3LAP A;  1TNS A;  3MQ0 A;  4YFK F;  2H27 A;  4KMU X;  4RGS A;  3QPH A;  1FPQ A;  1REP C;  5K5R A;  1STZ A;  5ILV A;  4B09 A;  2VBX A;  1UHM A;  2TDX A;  3I58 A;  2VC0 A;  1ONV A;  1P92 A;  2FQ3 A;  5D5W B;  4Z2Y A;  4Y15 A;  1K6O A;  3J80 Z;  3CUQ C;  1RUN A;  2PN6 A;  2FXA A;  1RNL A;  2NYX A;  4OIR F;  1XMA A;  5E20 A;  2HGC A;  5IT9 Z;  1O7L A;  2CYY A;  2P5V A;  2EFN A;  3FXU A;  1K78 B;  5ICG A;  4N9I A;  2MA3 A;  3JTH A;  3QAH A;  1ZGA A;  3F8M A;  3T5X A;  2ELH A;  4HDV A;  5CJ9 A;  3IC7 A;  3S2W A;  2D2W A;  4EGZ A;  1VTN C;  1D3Y A;  3Q5F A;  2HWV A;  2HZT A;  2Z3Y A;  1FSE A;  3GUD A;  1JHH A;  2HQR A;  3M8E A;  1T2K A;  4RAZ A;  2EB7 A;  1TTY A;  1R00 A;  4ZYD A;  1IAW A;  1V4R A;  1ZG1 A;  3BZ6 A;  1NHA A;  1YYV A;  3TO6 A;  5HS9 A;  5L3E A;  2CGP A;  4UHT A;  3FM5 A;  5LHH A;  1QGP A;  4RB3 C;  3R60 A;  3M8F A;  1FBS A;  5LGU A;  3KP4 A;  3GXO A;  4P96 A;  1WQ2 A;  4BH9 A;  1J59 A;  2VBZ A;  2VE9 A;  1YW7 A;  2FF4 A;  4U7D A;  1UFM A;  2QQA A;  1O3R A;  1XGN A;  2RGV A;  5E17 F;  3K2Z A;  1QZY A;  2KIU A;  4HLX A;  2G9W A;  2CFX A;  1F1Z A;  2CWE A;  4MQV A;  2P6S A;  3F6O A;  5FO5 A;  1ZLJ A;  1IRF A;  3WTS C;  2O0Y A;  4P9U A;  2QZ8 A;  4CGZ A;  4OMZ A;  3R0J A;  4EM0 B;  1KYZ A;  2JPB A;  1KU9 A;  2OU2 A;  2A07 F;  1U8R A;  4WX9 A;  5TJJ A;  2H09 A;  4KDP A;  4UXN A;  5H20 A;  4XLP F;  2DAO A;  4OIP F;  2HEO A;  1AWC A;  4PGH A;  2DT5 A;  3WTY C;  1G3T A;  2J5O A;  4HQM A;  1K78 A;  4WXH A;  3SZP A;  1WSU A;  2HOE A;  3LA3 A;  3D0S A;  4LLL A;  4WK8 F;  2HTS A;  3IKT A;  1I6X A;  1ODD A;  3ECH A;  4I98 B;  2XAS A;  5CVJ A;  4TV7 A;  4RB2 C;  5H6R A;  4ON0 A;  2HYG D;  3G73 A;  2KJB A;  1UCR A;  1X3U A;  3CUQ B;  4WWC A;  4MEY F;  2JRT A;  4YFX F;  5HVQ C;  2F5F A;  3IHU A;  1XN7 A;  2QYO A;  4XRF A;  4BNC A;  5K5Q A;  2VBW A;  1YO5 C;  4L5J A;  4R8H A;  2W57 A;  1TQP A;  3NRV A;  5ICC A;  2XIG A;  4BHC A;  2ZCW A;  2DPD A;  1P4W A;  3F8N A;  2ZO4 A;  2QBY B;  1WRJ A;  1RUO A;  4A0Z A;  2DQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...