1UFUA

Crystal structure of ligand binding domain of immunoglobulin-like transcript 2 (ilt2; lir-1)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
194
structure length
171
Chain Sequence
b'HLPKPTLWAEPGSVITQGSPVTLRCQGTQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKECLNSSSRAIFSVVWWYRCYAYDSNSPYEWSLPSDLLELL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin-like transcript 2
molecule tags Immune system
source organism Homo sapiens
publication title Kinetic and thermodynamic properties of the interaction between Immunoglobulin like transcript (ILT) and MHC class I
rcsb
total genus 35
structure length 171
sequence length 194
ec nomenclature
pdb deposition date 2003-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ufuA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ufuA02
3V52L 1AP2A 5ADOH 3SOBH 1I8MB 5E6IC 4X6FA 3CFKB 4AG4H 4OF8A 1G0YR 5GRJH 2YPVH 1MCIA 2K1MA 35C8L 3UPRA 1DR9A 4JY6B 3DVNB 3NABH 1Q0XH 1NC4A 3N9GL 5C71A 1NCUA 4P99A 3DSNA 3T8XB 4H88L 3GSRB 5EA0H 5E99L 43CAA 1JYNA 1H0DA 4GMTH 1UA6H 3NIGF 3BAEL 5T3ZD 3VXOB 3LRSB 3MNWA 2YC1B 5DJDB 5IFHL 2NY0D 1AJ7L 3N1QC 1X5GA 1YC8A 1D6VL 4HHAA 2ZCKL 2P5EA 2P5WB 4H25A 4WU7B 1PKQA 3UJIL 3CX2A 4XPAH 3RL2A 5KW9H 4HPOH 1GYAA 1KYOJ 4M43L 3PXJA 1MJ8H 3NCBB 4JHZA 4Z7VB 4OCWH 2MCG1 3B8SA 3OB0K 5B8CA 4DOHE 5LGHH 4B41A 2V5SA 5IB2B 1JPST 1RUAL 1HILA 2HJLB 1G1YA 4NRYB 3TA3D 1DVFA 1MWAA 2DLFL 4Z0BH 1JPTL 5TE6L 1LHZA 3ALPA 3IGAB 4AM0B 5I16B 2QQLH 3B2VL 5D7KE 4OFYA 5TH2B 2M26A 3QDGD 4Q9RL 4FZ8L 4D8PB 3TNNA 1OARL 2HFFB 5J1AA 4ODXA 1P7QD 3QEHB 5DK2A 1RUQL 3GSRA 4OCYH 3O6LH 3KPTA 5JXEC 1U41A 5ID1B 3WFHB 4CMMB 5BV7L 3WXVL 2F8XC 2Z35A 3C6LD 4FS0A 5D72L 3VH8B 3R06B 1NEZG 4ZO7A 1AH1A 4DGYH 5EU6A 2VUYA 3FQWA 4NCDA 4L29A 1HNFA 3NA4A 5ITFB 4NBYB 3P77A 3FB5A 3OKKA 1TDQA 4OLYH 4QRRA 4PJ8A 3GMOB 4X5XA 1VGKA 3RL2B 1JNLH 5ICZB 3EUUA 1NAMA 2JB5H 1S7TB 2J8OA 1ULVA 4RMUA 2HA1A 4R7NA 2DQDL 2LABA 5ACLA 3R1GL 1MCOL 5D7IB 4NN6C 4HSQA 5D8JL 3TT3L 1U8HB 4L3EE 3WKMH 1UWEL 5DRWB 1KIRB 1QR1B 3QHFH 4KXZI 4X6EA 4XTRD 4WHCA 5DJCA 2Y07H 1C1EL 5IJKA 1JZ7A 1FQ9C 3BPNC 2EDEA 4BM7A 3L3IB 4Z7QF 3SKJL 1YQ2A 5AG9A 4QKXB 1W2KT 3O4LD 1CWVA 4AEIH 1MCRA 5LKNA 1T7VA 4XAKD 3MV7D 3UTSA 3S5LA 2DM7A 5E2TL 3QEHA 5DK2B 3MFFA 4YHYB 4MXQC 4Z7OF 5EUOE 4CDHA 4LP5A 5F9DC 5SV3A 1NBVH 5L7XH 2FR4B 4ZFOL 5DA4A 1C5BL 1WQVT 1ZHLA 2OR9L 1KTRL 1EO7A 1NCWL 4Q9BA 4YX2L 4UBDD 4P46B 3RWHB 1HZHH 3HZVB 1NDMA 4WUUD 1DUYA 2HTKD 3WFBL 4YEFA 5FHBH 4YHLL 5TQ0H 2CXKA 1CFBA 3MLRL 1MWAH 4DZBA 3DUSB 1LEKB 1CGWA 3NH7L 5FYJH 4XMPH 1R24B 2WLZA 1D5ZA 1PYWA 4PTTA 1X5LA 5KJRH 2OR8A 5JOPD 1IEBB 2R1YB 3GJEA 5DJ6A 5GS1B 4K3HA 4L8SC 5IT2L 1A8JH 4P9HH 4IRJB 3OWEA 1T0MB 3CDYA 2HVJA 1P69B 1WC7A 43CAB 2Y36H 4Q74A 5DO2C 1OAUH 3BQUA 4J3XA 4U6YA 4L4VB 4CNIB 4PJAE 4ODHL 4NJ9L 2GIYA 3U79A 1LO4H 1AGCB 5DO2D 1ZHKB 3WNNA 4D9LL 3IDNA 5CAYB 5IW6A 5FFLA 2F5AH 5C6WH 1BZ7A 4MZ2A 4JFHD 2H26B 4DKEH 4OCSL 2IJ0C 3BEVB 1E6OL 5EC1A 1OQXA 1F4XH 1HSBB 1U2CA 4XBGB 1NAMB 1XH3B 4PGBB 4PJEF 1YEEL 1Y6NR 1N4XH 3FRUB 2WM0A 4BYHA 3ETBF 5B3NA 4GRLC 4K7FA 5T3ZE 4KZEH 1QHPA 1CICD 5HVHB 1V3MA 1KFAH 8CGTA 1IGYB 3EFDH 2VDNL 3OAUH 3LS5L 4OZIA 3ZE2E 4XC1H 4MXWL 4OLWL 4P48A 1Q38A 3P9LB 5JW4Q 4BUGA 3S6CA 3F12B 5B38A 3MRLA 5A3IC 5JHDE 4APQB 1V7ML 4KRLB 3ZHKA 4IHOB 4HKJB 3SJVA 4G6MH 3MRQB 1HYSC 3HR5A 5E2VH 5B39G 3W81A 4R4FH 4OSUL 4KTDH 3HRPA 3VI3E 1UZ8A 4LRNL 2NZ9D 4YHLH 4KJWC 4MXQD 3CAFA 3WBDA 4R2GD 4Z7UE 5BRZA 1AIFB 4XWOD 4LHUD 4KZDH 5EPMB 2QL1A 3P4NA 3RVWD 3I02A 1J8HB 3OGCB 4MLSA 3EKCA 1ROWA 1ZANH 1CFSA 4XBEH 4M00A 5LXGH 3FZUD 5CZKA 3MTRA 4S1SL 3D2UD 25C8L 1IM9D 3OKKB 2X4TB 3I3EA 5GZNC 4K07A 1KIQA 4HWNA 2ZCLL 2XQBH 5DQ9B 5B22A 1RMFL 3GFUA 1KGCE 3VFOA 3ZDYE 3QCTH 5MERA 1TTFA 1YEKH 4NQCA 4NQVB 3WHXB 3FT2B 3IDUA 2N7AA 2XFXB 1I7RB 1NCDH 2LVEA 5FM5O 1RJZB 1AKJB 3X13B 1FE8L 1A5FL 4BH8A 1MLCB 1C5CL 1MQKL 1M05B 1VGEH 3C5SA 5T1LD 3FOMB 3JWOL 5ETUA 1RZIB 2DRUA 2YZ1A 1QZ1A 4ZOEA 4ZUTA 4QOKD 4RFEB 5I76B 2F54A 1JNJA 4J6RL 3WFDH 3L3DB 4L3EA 4WDIA 5CSZA 1Z3GL 4B5EA 5E95B 3VD3A 3IDGB 2CLZA 1Q72L 3K80A 2Z31B 3B5GA 4JM2C 1E28B 4PJGA 5IHLB 3Q2CA 2AK4A 1S7SA 4HBCL 4QRTB 5C7XH 4KZEL 2XA3A 1FZKA 1S7UA 2WWMC 3IDIB 4PJFA 1RK0B 1U91A 4G6AD 4PJ7A 5D1QA 1CFSB 1YEIL 4F2MA 3QUXA 1JHKH 4F7PB 5I1HL 3KYAA 1DBMH 3C2AH 2C4XA 1OAQL 4WW1A 4FQJL 5DD0L 3SKUD 3EO0A 4U05A 2HLFD 4R90H 4UU9B 3UPCA 3TBWA 3ULVC 3VFSB 4Z7VE 3I6KA 2QADD 2R1WB 4I4WB 2VE6B 2DTMH 3VFRB 4JFFD 3HNVL 2DKMA 3VXSD 5D7LD 3P9LA 1CDHA 1C12B 4F57L 1NEZA 5EIIB 3SCMB 4M8VA 4PGZA 5IVNA 1IC7L 1D6VH 1J1OL 4X9FA 3QIUA 5K9JH 4PD4J 2WMPA 3CFCH 4RGNB 4OKVA 3DX6B 2EZ0C 1KB5A 5DFWH 1IC1A 3GBNH 4XNZB 5IMOA 2X7LB 2ED7A 4NZRL 5GISH 3HZMA 3VG0H 2X10A 5SWZA 1XGRA 2NLJB 2XXMB 3O3EB 3I02B 3F62A 2Q7YB 3H9ZA 3SDCA 3ROOB 4IOFD 4J8RB 1BZ7B 4NO3A 4YBQD 1WT5C 1XGYL 4HWEL 1D7FA 1UM4H 3GEWB 2WSKA 4YHMH 2GT9A 3EOTH 3EDKA 1H8SA 3VXUA 4S1QH 3L3KA 2PTVA 4NQDA 1R3IL 2MJWA 4LHQB 2Q6WA 3V8OA 1AQKL 3PL6A 5CKAA 1ORQA 5IJVA 4JY6A 4ENED 2EZ0D 2GUOA 4TQEH 3SE4A 4QRPD 1SBBA 4X5WB 1X4ZA 4XH2A 5JIHA 3HE6D 4YEEA 3KYNB 2BFVL 3S88H 4CRPA 4OZFB 4TPRL 2ORBH 2QHLA 1IAII 1MRCH 4PLKC 4DQOL 3SKOB 3UX9B 2WIMA 3LKSB 3QCTL 3QIUB 5CJ5A 2OJZL 4MA3A 3BEWB 4LNVA 5ESAA 4ZDHA 4ZFOA 2DM4A 4XCNB 2RCSH 2A2QT 3RBSA 1A5FH 3ARYA 3KHOA 4RFOH 3MRRA 1IAMA 4NZUL 2IALB 3L95B 4KKBD 3TPKA 1JZ5A 3R1GH 3GI8H 5ELIA 4F7EA 3MGOA 3WKML 2FX7H 3BPOC 2Q7YA 3MX0A 4NPYA 5DUML 3LDBB 3DNKA 2ZUVA 4J3OC 1KCUL 1ZHNB 3QCUL 2Y9RT 4ZTPL 2PTUA 3GB7A 2HLAB 4PJ5E 2HJKB 4UUJB 1NGXB 4PRDA 3C60D 2NMSA 4LPVA 3HPLA 2NW3B 4RBPK 4BQCA 3TA3A 3CVIL 1A6TA 4KK9D 4MQTB 3QCVL 4PGJA 1GGYA 5DGRA 1XF3A 1J18A 2AV1B 4F15B 3G6JE 3OXSB 5IG7A 5DZLA 3SE3A 1P7HL 4ODWB 4KJPD 3VFGH 1CDJA 5FKAA 1CYGA 4XCFH 2FD6L 4R96A 1TZHB 3BO8A 1RZFH 1MY7A 4FXGB 4M7ZB 1JTOA 2GSGB 4HAGA 2VZUA 3GRWA 4OZGF 2L4OA 2NLJA 1CFTA 4PJHA 5CSZB 1FO0L 3OG4B 5FYJD 2LV4A 4YX2H 3PG2A 5GPRA 3ROOA 1ZKAA 5HGAB 2W9LA 3HZMB 1KCRH 4PJBB 1KF9B 1XGTA 1OAZL 4G3YL 2EXYD 3CJJA 1J86A 3T04D 4KVNL 4YAQB 4HX1A 4Z7NE 5ICZA 2MQ3A 4V2CB 2W59A 3DV6B 1HQRB 2FO4B 1F6LL 3NACH 3RWJA 3OHXB 1MPAL 1ZHBB 4M1DL 5E4IA 5E6IA 3MCKB 4RMWA 1NCBH 3VXUB 2LFGA 4A2LA 4FRWA 3VXUE 3VG0L 2FWOB 5LAXB 4MSWA 5C8JA 3HE6C 2DYPD 1I9EA 3PP4H 3KPPB 4NJAH 3TZVA 1TPXC 5ANME 3HAEA 3OKDA 3E6HA 4KI5C 4U1NA 1V3KA 5FA4A 2FDBP 1WFNA 3SDYH 2NW2A 3HE6A 1UM5L 4XI5D 5H2BA 5F3BB 3RPIA 1HXYB 1DFBL 3HN3A 3QUZD 2YUWA 5DFVD 4PG2A 3OKNA 5ALCH 3NZ8A 1OTTD 2YPLA 1WEJH 2RQ8A 3DRTA 5T5FL 4HK3N 4XXDB 2HT2D 1J05A 4KVCH 1EAPA 5JW5B 3MLUL 1YEEH 1J0IA 1QSED 1AFVH 2E7CA 4WWKA 4OZIE 5JQHC 3JV6A 1YEDB 1R5VB 4CU8A 3MO1B 3TO2B 2CJUH 1ACYH 2IANB 1MRCL 1LP9A 1XGTB 3GB7B 4G9FE 4PJ8C 4OZGE 3GBLA 3QISA 2JCCF 4NYLA 2Q3ZA 2R0LH 1T04A 2KL6A 4GKSB 2DIBA 5MENB 1IGMH 2HWZH 2VLKD 4TULH 2JJSC 4QTHA 3SDXA 3BKCL 1T0NA 5CZVH 1MREL 1RPQA 3LH2L 5FCUH 5FCSH 4DZ8A 5L0QC 1B0RA 5HYEA 1NFDE 2XN9B 4X99A 2GFBB 3D0VA 4Q58C 2Y5TB 3RQ3A 4FXGA 5D6CA 1ZLUK 5FHAL 3WHE0 5IVOA 1V3JA 2N1KA 1HKLH 4ZAKB 3IFNL 4PRAA 1GPOH 2H9GA 2C3GA 1XIWC 1ETZB 1MLBB 1G7JB 5HHOA 2VABA 1T83A 5C0CE 1A21A 4EN3D 2F54E 2R0ZL 3CPLB 1UCBH 3QUZA 4HV8B 3UBXG 5D7LA 1F3DH 1FNAA 3ZL4L 4YBLC 4PJXB 4X7DC 4DVBA 2XQBL 3BEVA 4LQ1A 3V6BR 4X9BA 1XMWA 1HSBA 1P84K 4RX4A 2VAJA 2N7BA 3GHBH 4F7EB 2YSSA 3UO1H 1BQHB 2EO9A 3IDXL 1TVBA 1RZJC 5EU4B 4JY5L 1U8IA 3REVA 2XT1B 4YDIL 1I7TA 1KEML 4QHMB 5I75C 3LD8B 1KENL 3QFJD 4K71C 3WUWA 3CVHH 1F58L 4F9PC 2DJ4A 2X4OA 3P4OB 4PRHD 1T0PB 5TPWL 4EI6A 4L4VA 3WSQL 4PRDB 3K3QA 5AZEH 4CADB 4ZS6D 5DRNB 1A6TB 4AIZB 3VFVB 1HK6A 4H1LG 4DGVH 5C08E 3M1BB 2VLKA 1ZOXA 4Z8FH 3GKWL 1Q9OA 3QFDA 1GZPA 4NQEB 4O58L 3BYYA 4ZXBC 1NLBH 1I8MA 3DSFH 1CLCA 2GCYB 4JVWA 2CIKB 1C08A 1KNOA 3L3GB 4M6MH 1FDLH 5E08H 5GGSA 3O8XA 1UYWL 4YQXL 2GJZA 1YNKL 1KPRB 5BS0B 1EFXA 1JNHB 3IVKA 1BD2D 3EGSB 5HHXL 4HMCA 1FE8H 1CZ8H 3WJLC 3GIZL 4XWOC 1J1XL 5K9KB 1JZ2A 5HYJB 4M1CD 2HT2C 3LN5A 2LVCA 4WI8A 4GG6F 4NKIH 3L7FA 5DD1L 1AO7A 2NY6C 3UPAA 4OLZH 4NRXB 5CJ8A 1UWEH 3FT3A 3QIUC 4KKCD 5IK3A 1J9CT 4HQQL 4LSQH 5IQ9A 4LRIC 2V2WA 1KG0A 2DS4A 4KROD 4ZPTA 1TJHL 5DMYA 4ZAKC 3PWPA 4LSVL 2AXJA 4DFIA 3ZKSD 5CIPH 3VXNA 3ARZA 1OP3H 2LAGB 3ES6A 2RAMA 5AD0A 1LQSR 1RZJL 1B0GA 3NAAH 4L3EB 2YWZA 3PGCA 4EN3C 1Z2KA 4YE4L 5C08A 4UV7H 5I6XC 1H8NA 2PO6A 4M9OA 3AREB 3WJLA 2HRPL 4NQED 2F19H 4LDEB 1G7QA 1H5BA 4QHUB 1K8DB 1BFOA 2LTQB 3I2CL 4FABL 3VMNA 5ENWA 5T1LB 4NQCB 3JVGA 3QRFM 1P4IH 3TT1L 2V17L 3QUXB 3V4UH 4F7PA 1JGLH 1VFOA 1IGJB 3JV0A 3TIEB 3EYOA 4HZLA 4I18A 1G6RL 3FCTB 3MR9B 1FYHB 3V0AC 4N68A 5E8EB 3OR7A 4NWUL 5J3HC 1CT8A 2IG2H 4G7VH 3DUUA 4LVNC 4PBVC 2QSTA 1Q9LA 1MFEL 1Q9KA 2UZIL 4GXVH 4TTDC 2AGJH 2VE6A 1A7NL 1MHCB 4BK4A 4OZHF 4OLXL 4QTHB 3GMMB 1MEXL 4PUBL 3RHWK 3WNMA 4LHJB 2X4NB 1OY3B 2J3SA 3KPSA 3S37L 2OJZH 4JZOA 2ZUYA 3R4DA 2YK1L 2KQNA 3ZYZA 3GUTB 3GMOA 3C6LC 2RGSA 1RK0A 3SKNA 3ORJA 4KK8C 5DHYB 4WTZG 2ZOLA 5JW3L 3C60C 3N1GC 4BQ6A 4NWTL 5ITBL 3D85B 4GRWF 5IMMA 3FMGH 1JV5A 1FGNL 2A73A 3F5WB 5B8CB 4KKBC 3TBSB 2FL5A 1NSNH 2WIIB 5L2KE 4M8QA 2DQGH 4P59H 2X1OA 4WY7H 3B9EA 4J7RA 4QNPE 5CJOH 4FQXA 1TQBB 3TNNB 1QSZA 5JTWA 2Z93B 1OLLA 2FATL 3QXTA 1IGJA 1CDYA 3HMWH 2A6DA 2Y7QA 4K8RH 3TWCL 1CLYH 3C5ZC 3RX5A 5FM8A 4UOW1 1SBSH 1XEDA 4MD0A 1SJVA 5GGRA 5ESVA 4O2CB 2QTEA 3QG6B 2I9LA 4KTYA 1X5HA 4OUUA 4Y4HD 3GMQA 5HI3C 4TVPL 1IVLA 2P24A 5EOCH 4LOUC 5I66A 1J1XH 4XNUL 4AENA 3CFEB 2CRIA 5MEQB 1UFUA 4L29B 5C08B 2P8LA 4XZUA 4WI2A 1INEH 4KJYB 5I1JH 2VLJA 3D0LB 1S9WA 1QFWI 4U0RC 4YBLB 3BEWA 4F7TB 4JDZB 1P7KB 3N50A 1RUQH 1EEQA 3PL6C 4ZFOB 1ZANL 2XKNB 3UBXA 3RU8H 1FORH 3FN0L 2X1PA 2JK5A 4MS8C 4TRPH 2HMIC 3HS0A 5FB8B 1VEPA 3QDMA 2ZCHL 2HAZA 1S7VA 2GI7A 5KN5B 3QXUA 5DR5H 5I0DA 1CFNB 3MROA 4UQ2B 1OW0C 1INDH 2AJXH 3L1OL 1DUZA 4UILH 2B20A 2ICWJ 3PV6B 5IHZB 1D5IL 3NTCH 4HKJA 4OGXL 4YDLC 1FVEA 3THMH 1BOGA 3FO9B 2CQVA 3M17B 4YBQC 5DD5L 1FYTB 3SDYL 5D2NB 3O9WB 1FLRL 1TQCC 4M7LT 5IBTL 2VQ1B 1AHWC 5E56A 4JGUA 5IROA 4MA3B 3NGBC 4Z5RB 3QNZB 3LKOA 5ESAB 4WHTA 3FMGL 1K3IA 4MA1C 3CFEA 2AJ3B 5D2NC 4WTWA 1LO5B 4NZDA 2BVUA 1F97A 1ZHLB 1BQUA 3K81A 3WXVH 4MJ6B 4XBGA 2GAZB 2V5RA 3WS6A 3EOBB 1IAKA 1C7SA 3MC0A 2DQIH 1KLGB 5L9DH 3H3KA 4CKVX 4JDZA 1T5XA 1P7KA 1AO7D 1FC1A 4JN1H 3MOBL 5GGRY 3VD4A 3ROLA 1NDGB 2APVA 4I3SH 2QADC 2X2YA 4LCUA 2A9ML 2YR3A 3TIDB 4F3FA 4YFDB 3RVTC 1CFVL 7FABH 1J1PL 1VFBB 3NIDE 1CGVA 2HWZL 1ZWIA 1AXTL 2I60L 1EHLL 4GW4A 1CFNA 4O2CA 1D3CA 1YYLH 3I3BA 4XX1E 1DUZB 4X98A 5KVFH 2PW2B 3KAAA 2MPAL 5ITBH 1YMMD 3CMOH 4H8WH 4L4VE 4WJ5B 4Y2DD 2A83B 5FHAH 4EJ1C 5DEFA 1T66C 1W0WB 4XMPL 5TQ2H 1CGSH 2BMKA 2NYYD 2DYPB 1X5KA 2AEQL 4WUKL 3Q5YA 5IMLB 3W5MA 1N0LA 3U2SA 4K71B 3GSQA 2ATPA 3L7EA 4JAMB 1ZSDB 1T20B 1BHGA 4X0KA 4EI5B 2YPLD 1EAPB 1L7TL 4P4KB 3T4AA 2OR9H 3PWVA 4U6TA 4JO2H 5JPMB 4XMKL 4FNLL 3VI4F 1I8KB 3PWPD 1VACB 4LLUB 1S9YB 2EDFA 1OAXL 3C5JA 4LMQI 1WISA 4RDQF 4OB5H 5FGBC 1YN7B 4OLUH 4WO4C 3WYRA 3TVMD 5AYQA 1VHPA 2O26U 3E6HB 3TYFB 4F58H 5EOCJ 2JELL 4L4JA 3SJVB 2FEDD 5KG9B 2HTLD 4NOFA 4ODBD 5C0RL 2WK2A 3QUKB 4RWHA 3MRLB 2Z31C 1MFNA 1QTYT 1RVFL 4OZ4A 3WNKA 1T7ZA 4GXUN 1BFVH 2B0SL 2BOBA 2CLZB 3UYRH 1JTTA 2OK0H 1WAAA 4YHZL 1YEGH 1PQZA 3QO1A 3FO0L 1DE4A 5MEQA 1MHHA 5EU7C 4O2FA 4OGYH 3BIBX 1BVKB 1FDLL 3AAZA 5C07E 1AQDA 5TF1L 2E7LC 4N90D 5FYKL 1OW0A 2DMBA 5FO7B 2G75A 4J4PA 1K85A 2ED8A 4ZQKB 4JFXB 4MVBC 5DVLA 4PJ8B 4X5XB 4YDKL 1CICC 1FL5B 2C7UB 4GRLD 2W0KA 3KPSE 3LPFA 5I8CA 4LCUB 2CKBL 5MERB 3EW3B 3MRJB 2DF3A 3FT2A 4RQQA 3MLXL 3W39A 1WV7T 4O5LL 1J87A 4BQBA 2IQAA 4KKCC 4P3CH 2OSLA 4MWFA 5CD3B 4G43B 1M7DB 3K2UH 2DAVA 4M62H 3VDBA 3LN4A 4LSVH 3O2WH 1SYVA 2XI9A 2A83A 1HN1A 4CBPA 2CH8A 5D7SL 5EO1A 4D9RE 3G08A 3SDAD 3G5YB 3T77B 1LGVA 4XC1L 3QRGL 2VISB 4TOYH 3X3GL 4HIIB 1WIOA 4HIXL 1AY1H 1QRKA 2COQA 2CR6A 4GKOA 4ZFGH 5IVZA 3VGEA 2VXUH 1RI8A 3BP6B 3OXRA 3RGVD 1VFUA 2Q8BH 5DSCA 4KDVA 3TCXA 4I0PC 4Y2DB 1JZ8A 2CIKA 3I9GH 4ONGL 3NFNB 2FGWH 5GGTH 3O8XB 1V05A 2YSSB 1RV6X 4PB9L 2IBGA 3ARSA 1CBVL 4HS8H 3IVKB 5EU4A 1TFHA 2AABL 3UTTB 4XPTH 3PABA 4JJ5A 4WW2A 5DD6A 3TLRA 4ELMA 1KEGL 3RWDB 4PJ7F 1BZ9A 4X5WA 4KK6C 2UVEA 5KSBA 1OM3L 1ZT7B 1U58A 3FB7A 4NRXA 4I9WE 4PJBE 3PIQB 1LDPH 2PXYB 3I6GB 1QG3A 3RP1A 2I24N 4JPKL 1TJIH 3K0WA 5BJTB 4B7LA 4JQXA 1QSEA 3EJYC 1ED3A 4RIRA 5AUMA 4W6WB 4IRJD 2JCCB 1QO3B 3BN9C 2NY3D 2BSED 3HFMH 4H20H 3OX8A 1JI1A 2QLVB 3VXNB 2GSIB 4HWBL 3RUGE 4XTRC 3FFCD 4KFZC 1GJIA 3MNVA 4JFXA 1D6EA 2PYEE 5IB4B 2D03L 4XPFH 4FP8H 1F2XK 1MELA 5FK9B 1LE5B 4I18C 5T5FH 5FYLE 3RKDD 1YNLH 1VGKB 1J0KA 4KK5C 1ZHNA 4NO2B 4W6YB 3BUYB 4NC0B 5EC1B 1IC5L 3QJHA 1I85A 2DQEL 4KMQA 2PCPB 3L6FB 4YFLF 1IAOB 4PLNC 2R0LL 5FUOL 1VPOH 2HN7A 5HI5D 2Q8AH 5GRVK 4NP4L 1U8HA 5AG8A 5DJYB 2D31A 4U49A 2X42A 4P46C 2VDPH 4BH7B 2ADIB 1HWGB 1WAAE 4CNIA 2Z4QA 3SGKA 5HHOD 1PSKL 3H2WA 4GQ9H 2VN4A 2UWEA 3TT3H 3LQAC 1MREH 3LH2H 3QWOB 3BRFA 1U58B 3FB7B 3UC0L 1TQCB 1U92A 3H0TA 5FUZH 2VISA 5T3XL 4OQTL 4PJHF 5HVHC 3K1DA 4PRHB 5EUKA 4HMEA 1ES0A 5EZIH 2LQRA 4IS6A 5E1AA 1P9MA 3CH1A 5H37G 1J1OH 3STLB 2BSRA 1MVFA 3NFNA 4L9LC 1T5WB 1BWMA 4JO4H 3ARPA 1EK3A 5ISZD 1BEYH 5DFTA 3HI5H 4ORGA 1WWAX 3QQ4B 4Y2DC 4Y16B 1XAUA 4CN4A 1MJ7L 4CMHC 5AAMA 2QHRL 5DDHA 3RWJB 4GO6B 4OT1L 2VZSA 4O02H 3DX9A 4TNWK 1CG9B 4GSDL 5E6IB 4N8CH 1NBVL 2R69L 4L4VD 2VITB 3RGHA 1EH9A 4L8CA 5HYSA 1JV5B 2A73B 3F5WA 4DUVA 4L8BA 2C7UA 3IDXH 2F8VA 1CE1L 1BAFH 5MENA 1CIDA 1BQLH 4EQ2A 2OBGA 1HHKB 1PW3A 1HYRC 4J3UA 5B21A 4EI5C 3BDBA 3KPNB 4ZOAA 2VQUA 3MLTA 4R8WL 3HLAB 3PHOB 1I7RA 3V4PH 4LNRA 2FEDC 4JZOB 2Q76B 2GJ6E 3REWA 4U7KA 1W72L 5INCA 2AJVH 1LP9E 3K8LA 3VI3F 4D0DA 3D3VA 2YOCA 3PWJA 3K4AA 4MCZA 3HCVA 1QEWA 4H0HB 4WDIB 4IRZH 2F53D 5MHSD 2H2SD 2B1HH 4J23A 1GAFH 2H8PA 1KCLA 1ONQB 4ZODA 3WIHH 3WIFB 3BKYL 2HH0L 2AJXL 4PLJD 4YAQA 3MLZL 1RULH 4UTAH 2X4UA 5EULV 3I75B 5FOBA 3WUZA 2VWEE 4RAUA 1NLDH 3S9DB 4JHBA 3HG1E 3M45A 1I9IH 4J3SA 3QR2A 3FJTA 5DC4B 5EUOB 5GHWL 3UYPA 2IPKB 4FTVD 4I2XB 4G6ML 2DI9A 3EFFA 3C08H 4G8FA 4ETQB 3U0WH 5DHVA 3ELAT 3U4EB 2WINA 3GIZH 3QUZC 1CF8L 3AS0A 2YPKB 1FO0H 1CG9A 1W0VA 4LHUB 3PQYB 3VGHA 3UAJD 3GRWH 2XKSA 2ADIA 1LK2B 3PQYE 3OKDB 2YBRA 2NY7H 3QUXD 4L8BB 3RY6C 4OFKA 3RZWA 4G3YH 2CO7B 1J0YA 1JP5A 4WVRA 1D5XA 4KK9C 4QXUH 1Y18B 4UV4H 2WNGA 1S3KL 4XAWH 4LIQH 5BCAA 4ZPVB 3DX7B 5GSVB 2W9DL 2ZUQC 3VWKC 3LIZL 1C7TA 3AFLA 3FT4A 1CDIA 4UNVA 4DN3H 4KKLC 4OT1H 2AJSH 1QD0A 3H0TB 3CU1A 3LKRB 2VXVH 3CFKA 2YRLA 2AK1H 4TUOA 1YMHA 2JIXB 4LARH 5HVFB 1CU4H 5IW1B 1OWRM 4HXAH 5GSRB 1EIBA 2SEBB 5H94A 1ZLVH 1MF2L 3QXDB 3EOYG 3TH4T 4GAFB 3S34L 1TVBB 1OCWH 3DXAA 3KR3H 3BRDA 3MRPB 1OARH 2DQJH 5I73B 2GK0A 4LVHB 4XNMA 3WFDL 5DS8B 2V17H 3V4UL 1FVEB 1S7RB 3JVGC 4G5ZL 3RL1B 2PCPA 4X80L 5HYJD 4M61A 4QRRD 1NANI 3OJMB 2VOTA 3F7QA 4LFHD 1NUGA 3PJSA 1A7RH 2VAAB 2R23A 1EBAA 4LSSL 3HB3D 3VCLB 3U48A 2UZIH 4GXVL 5BS0D 5CIPB 4IJ3B 5F21B 1E4WL 3NVQA 3WIIL 1WK0A 1EX0A 5LJYH 2RFXA 4JO2L 4ETYA 2ITCB 2MWCA 3A6BH 1QFWL 4ZAKA 3QNYB 3RIAK 4KJQD 3BKCH 1JF5A 1FZJA 1NGQH 4LGRB 3F7YA 4Q6IA 3W5NA 2DI8A 4NO3B 3B6SA 4EVNA 3SPVB 2DTML 4Y5XB 1CD8A 1RZ7H 1I3RB 5DLML 4U33A 4EN3A 2EYRB 3OBAA 5HJ3B 1RU9L 3SCMD 2CKBH 5JORA 1R0AH 3QHZH 1U8NB 3DIFA 5D7LB 1S9XA 1K6QH 4I0PB 1QBML 2WBWB 4OGZA 3CU7A 2IWGA 2IC2A 3SGEI 3CNKA 3O6KH 4XB8A 1CXEA 5FYLH 1I8IA 1IEAA 4WFFE 3TBVA 5GGUB 3RJDA 4NKOB 3LY6A 2VIRB 3MOAH 1I7TB 3RL1A 1B2WL 4DGIH 4LASL 1J5OH 3KS0J 3RDTD 1TTUA 3SE8H 3U7WH 5BXFA 2VC2H 5BO1L 1CU4L 4E0RB 3ARWA 1BPVA 5HDLA 5GHWH 3QEUA 2MKLC 4PRBA 1RFDH 1IMHC 1CCZA 5D9SB 4E42A 1NGYB 5E94B 2ICEB 1RUMH 4K8RD 1FHGA 1R3HA 1FNLA 1WIPA 1ZEAH 2X7LA 5TQ0L 4X4XB 3QIWC 2BNRD 1F4YH 2H8PB 2E7MA 4OQTA 1UENA 3WIFA 2WBJC 1NBYB 1HIML 5IHUH 1CI5A 3H9SB 2CK0H 2GKIA 3BPLB 5IB3B 3LQAL 3FN0H 3A6CL 3KPQB 3TC9A 4DZBB 1SM3L 1OM3H 5C0DB 3QZWG 3ME0A 5IW3A 5HGHB 5DQJB 4Y5YC 1NCAH 1UKTA 2XWBA 4PRPE 4PJ5D 1FFOA 3D87B 4X6CF 2OTWA 1D5IH 3NTCL 2B2XH 4OUUB 5FF6A 4G42B 1A9EB 1UVQA 1NCWH 1ZMYA 4U1HA 2XG4A 5BZWB 4XCYA 1X7QA 3CSPA 4OD1L 3KPSB 4OGXH 4PG2C 1XGYH 1K8IA 1NUDA 4S0TD 4U3HA 2GSGA 1DQJB 3ZE2F 2AERT 4U1NB 1CFTB 3DYPA 4GG6A 2D7TH 2W92A 2NW2B 2DD8H 4FFZL 5C2UB 4H0IA 4GBXD 1PFCA 1WFTA 1WBYB 1IGFH 2FJHA 1U8JB 5CEYA 2DIJA 3ARGB 4N0YH 4LF3A 5ECJE 1MCEA 2FL5B 3V7AG 5C08D 3OTTA 5I30H 2YEZA 5D93C 2ORBL 1J05B 1TZIB 4G8GB 3I50L 3V2AR 3R0MA 5CILH 3OB8A 4RGMC 5FM5M 5F7NC 1R3LA 1HYSD 1QSVA 5E8EA 1OSPH 2VDNH 5ADPL 2KH2B 4RWYL 1VSCA 1IL1A 4FQIL 3C6SA 2OLDA 2Y5EA 1PLGH 3TNMB 4KGJA 3TJEH 1A7OL 2DBLH 2YC1A 5DJDA 1PEZA 1PSKH 1Z9SA 1NFDB 5DQJA 4GAYB 1LO3L 2MPAH 5E2VL 5I2IA 3CFBB 3S8WA 2ESVE 3FO1A 4KMTL 1HINL 3ULSA 4IEFB 3QHZL 1I9JL 3O45A 1XF3B 4JHWH 1CGSL 2PUQT 4KZDL 2APTA 4UINH 5DYOA 1UH3A 1IBGL 4KY1L 3D39E 3HR6A 1H3PH 4DCQA 5BV7B 3S96A 4HC1L 2F53E 2ZSWB 2GAZA 1Y0LA 5GZND 1T7WA 5EB9A 3OR6A 5ABDE 1AXSA 2NXYD 1G7HB 1B2WH 2OMNA 3BPOB 1H3GA 4Q7DA 5BRZE 4NJAL 3IDMB 3SDAB 4Q6IB 5DT1H 4NHUA 5E00B 3RWDA 4I0CC 4EDWH 1A4JB 3VXQB 5DK3A 3BIKB 4N1HB 4P23D 4EN3B 4OD1H 2R8SL 3IAQA 4CU6A 3ARFC 1QKZH 3JV4A 3FO9A 2XXCB 3OJDB 1HHGB 5I8KH 4HFUH 2J4WL 3O9WA 5F1KC 1NC4B 4G8EA 2AJVL 1HH6B 4HS3A 5GGUA 1EFXD 2JJTA 3O6LL 1P4BH 2XIDA 3TJHD 1BEYL 1I8LC 2IG2L 3OGOE 1FL3A 1TXKA 1I7ZA 3DV4A 5GS3A 2V2TA 4ODTL 5ISZE 2DMCA 1B6UA 1G7JA 4XRCA 5IB4A 2C3WA 2XZAH 5ILTL 1QLRB 5FK9A 1LE5A 5JHDB 3CLEH 3T3ME 2YEZB 2ERJB 1KJMB 4KJYA 4HGKC 1A6AB 3CFIC 1S9WB 1JWMA 3OKEB 5ACZA 2DBLL 3KNBA 3BP5A 1QUNA 4Z9KB 5K9QG 5EO0A 4ZUSB 1BQHA 3DO7B 3MRHB 1U8IB 3REVB 3WDIA 1VADB 3TZVD 3SDAA 4N0RA 3H3BC 5CJQL 3VXMA 4HPYL 5IB1A 1BVZA 3B9DA 4XNZC 1FGNH 3HE7C 4CVZB 1FG2A 1CDUA 3ALXA 4DK3A 3T1FB 5ANMA 4GKSA 4AMKL 4JANB 3V6ZA 3LZFH 6CGTA 5E2TH 1SY6H 3DTXB 3AU1A 1UB6A 4Z5RA 4HJGA 4AT6B 4JFFA 5C0EB 5C6PB 2FH6A 2OQJB 1NEZB 5EIIA 2Z31A 2H3NA 2IBZX 2W0PA 3P0VH 3DBXA 2Q76A 3REWB 1FNSL 1OTSD 1L9MA 1JWSA 2X1QA 4HIXH 5EOCL 2AQ3A 1EEZB 3MYJB 1WZKA 4OUOA 1JN6A 5DTFB 1HOCB 3HI1A 1XGPB 1LO0H 5A2LH 3SGKC 4GAJL 3DETC 4EUPH 3IDMA 5IM7B 1MF2H 2EDDA 2IAND 2E9WA 3OF6D 3OR6B 3WE6A 4Y5YA 5TE7H 1U3YA 1PGRB 4CMHB 2CK2A 3AREA 4BZ1H 3IGAA 4M3JA 4JHWL 4Z18A 4C83B 3NCJH 4MAYD 3FOLB 3UROR 1A7BA 3ZE0F 3RAJH 4PJCA 2ARJB 2R39A 4PGDB 1T4KA 5BZDA 2NY1C 3L5XL 1NMAL 1WT5A 3RA7L 2PR4H 1NLBL 1R5IA 4AL8L 1EXUB 4LHUA 4Y4FB 5ID1A 5INCB 2HFFA 4M4PA 4FQ2L 3NIDF 2J88H 4DQOH 3T0AA 3GMLA 1LVEA 2RJMA 1NFDA 3IRZA 2E6PA 4QRPA 3G5VA 3GHBL 4M02A 4LCCC 5CEZL 4YPGA 2ZUWA 2EIZB 2P46B 3E6FB 5DEFB 1ZLWK 4YWGH 4QEGA 1FRGL 2VL4A 1EVTC 3C09C 4W4OA 4UT7H 1QVOA 2QSCH 2X41A 3I75A 1JWSB 2OTUA 3V0WH 1KCSL 1AJ7H 1YDPA 3MYJA 5CEZE 5T3ZL 4X8JB 5GRWA 3KVQA 3KPRE 5FIEA 1MJJA 1KN2L 1QNZL 5A2FA 4LLMB 4JR9L 3NCYP 2RB8A 1CE6A 1G6RB 2AP2A 5IR1B 4CDGC 5DJCB 1IGYA 3MLYH 35C8H 1YNTA 3RY4A 4F7MB 3DUUB 5GRJL 4A6YB 5ILTH 4OCXL 4U0QB 3P0VL 4H8WC 3V6ZB 4OCNC 5KVGH 4CU7A 1CQKA 3KDMA 4KU1A 1MUJB 1VFAB 4JFQB 1AO7B 4OTXH 4CVZA 5E9DD 5I71C 1FSKB 1XIWA 2P8PA 3IS1X 3RVXD 5BO1H 1KCVL 4JFOB 1YUHB 2ADGA 3ZKXC 3ILQD 1QO3A 4NZUH 5T1MB 1BBDL 4R7DA 4X7SL 2EDTA 3NCEB 1LP9F 4ZDHB 3BE1L 1JRHI 5IFHH 3S35X 3T0XA 1MQ8A 5DJXA 5C07D 4ELME 3TN0C 2L0DA 4FQLL 3X14A 4HUKB 5E4EB 3U1SL 4Q6YA 1ZEAL 3IETB 1YY8B 4L3AA 4DOHB 2EDRA 4QO1A 2NY4D 5F7YC 3BUYA 3MODL 3G6DL 1K4CB 4Q2ZA 1KPVB 4KHXL 2ARJQ 4EIGB 2QHRH 1WJ3A 2J1KA 1FV1A 2R1YA 5GS1A 2FO1A 1U6AL 3O41B 4ZSOE 3WV0A 1U8NA 3DIFB 4HWZA 3MRHA 1KBGL 1X6NA 3RVVC 1LMKA 1G9MC 3AM8A 2OL3A 2OXGA 4HS6A 2IGFH 5CEXA 1LO0L 3BZ4A 2Z4QB 3EO9L 1NMBL 2H32A 1IM3B 4OZIB 3W9EB 3U36B 3KPMA 4M6AA 3BOVA 4WTXA 4HIIA 3HMXH 5C0RH 3BJLA 3KXFB 1G9ML 2AV7A 4PLOB 1W0YT 4P3DA 4D0CB 4FFZH 5MEND 3QSKB 3AS3A 1NL0H 3E3QE 1A9BA 4WI5A 4K94C 4IRZL 4L5FL 1T1ZA 5TE4H 1NPUA 1BJ1H 3QI9A 4GRWB 3VWJA 5CGMA 1NMAH 2HKHH 2FH8A 3TPUA 3EZ8A 2AXGB 1OWWA 4ZOCA 1DQDL 1GAFL 3K46A 1F45A 4LEXL 2A6IB 3IETA 5CILL 1VFMA 1YMMA 5KVEH 1FNHA 5T33L 3VG9C 1FCCA 4X6BB 3LAFA 3HB3C 4Y2DA 1FH5L 1OPGL 2UVFA 5FO9B 2FB4L 3L3OB 5IMMB 2A1WH 4PJDA 1BIIA 1RZKL 1YJDC 2E9BA 2F53B 1A1OB 1RIHL 5C3TA 5IP4A 1MCKA 1LDSA 2AK4E 2B1AL 3HLAA 1XIWB 2P8PB 1UWXH 3ZKMD 5F3BA 5SWSD 4AEEA 1FAKT 4KMTH 4P5KB 3GO1L 5MEOB 1S3KH 3T2NL 1QYGH 4OKVB 4NT6A 3U46A 4P59L 1UJ3C 1CDGA 2YA2A 5IUSA 1A1NA 3RU8L 2UY7A 4G9FB 4PJGF 1E6JH 5E9DB 2EDJA 4QTIL 4G6KL 4XVSH 5JIPA 3DXAD 4TOYL 3FRPG 2HJFB 4K2UH 3U6RA 4Y16A 3KJ4B 2HFTA 4P2RE 3BH8B 4CVXB 3MLPA 4HGWA 3CFDA 1FO0A 5CEYB 1BM3H 3FQTA 5D96C 4MD5A 4HXAL 3CXDH 1CD1A 2VL5B 1YDPB 3D2UA 4KROC 1U8OB 3D18B 3WL9B 5BMFH 2YPKA 1G9EA 3SGEH 3I9GL 5F7LB 1F58H 4U1MB 5JPMA 4ORZC 2X9WA 2JJWA 4EDXB 4Z7WB 4MJID 1GXEA 3T0WA 4BH8B 3SJVE 1S7WA 4KKAD 2VKWA 4KY1H 3N0PB 2DM2A 4F7MA 3DUHA 5F3HA 4A6YA 3ZSTA 3W0WA 1BECA 4OZHA 5EBWA 3U83A 2VLRE 4HKXB 4HC1H 1T03H 3VW3L 3MJ9H 4MQ7B 1HDMB 4NRZB 4M6NH 1AGBA 1WBYA 1EGJA 4HK3J 4PRHA 5EUKB 2EYSA 1GGIH 1U8JA 2EEAA 4IS6B 2EXWD 4NQSB 3V0VB 3OPZL 1FJ1B 2XY2A 2P5WA 1IJ9A 5HHVH 5TDNA 1N64H 3MLWH 3N9GH 4TTDD 1JVKA 1T1WB 5CZXD 4F2MB 4O2EA 4U6VH 1DE4B 3EDFA 1WGOA 1CGUA 4JCMA 4DKEL 1AQDB 2OR7A 1S7QA 4LLYA 4L8CB 1FO0B 3HMXL 4KPHH 4D9RD 1CTNA 3KLHC 2FECI 4YGVA 5IB2A 5FV1L 3U9UA 4WV1C 1SMAA 4Q97A 3O8XC 3BHBA 4MNGA 1WFOA 2W65B 3IU4L 4KRPD 5D6DA 2B4CC 3PDDA 1U8QA 2YD5A 5ACMA 3DSFL 5I1GL 3ECBB 2I5YL 1N6VA 5IVXB 4MNHB 4I77L 1FLTX 3T65B 1F6FB 1A1NB 1JF6A 3M1BA 1IARB 3QH3B 5F96L 1Q9OB 2NNAA 4UV7L 32C2A 2BNRA 2FD6H 2P45B 5GQBA 1HH6A 2FIRT 4G8IB 3DVGA 1XF5B 4PJHB 4P2YA 3MZTA 3W11C 4N90E 3QQ3A 1JHLH 3LKNA 3CUPB 3NFSH 2J6EH 4A2MA 3EYFA 5GGQL 2AV7B 2KPNA 3CZFB 3L5WB 4KAQH 2OTPA 2JJTC 3RIFF 4HW6A 1ZLUH 3CMOL 3DOSA 4H8WL 2K3TA 4OZIF 4LPXA 3BH8A 4CVXA 3IJSA 1LD9B 4LVOC 2BY0A 1HIMH 5ERWB 2X4SB 2ICES 5ICXB 4AQOA 25C8H 3O4OB 4XVTH 1SVZA 5HY9A 3PGDA 2ZP0T 1H3VA 1MRDH 3O4LE 4QXGL 1VA9A 2CK0L 4X8XA 3RA7H 3BZFA 1JFQH 3QXAB 5T1LA 4PS4L 4NPYB 1RZ8B 3A6CH 3EHBC 4AK1A 4WW2B 3LB6C 1U8KB 5F9OL 3OG6B 3SY0B 3KPRB 1BIHA 1ZT1A 3VMOA 4MNGE 1MCCA 1D9KC 2DTSA 4RAVB 3RGVC 4HF5L 1UM5H 4DEPB 2QQKH 3CX5K 3TZVC 4FQJH 3ARFA 3MV8A 2Y06L 3HUJF 4HH8A 4UB0L 4XMKH 2BRQA 1B0GB 1MCOH 3MJ8B 1JGVL 3QIBB 4P2RA 1QLRA 5F6HJ 3TM6A 3V4PL 3QNYA 4HCRA 3MBED 1T7YA 3GRWL 5IBLD 4E41E 3HZKA 3UTQB 1J8HD 3ZYOA 3DX8A 1WZ1H 1EEYB 4ZUVB 4JRXE 2NY3B 4TUOB 1R3JA 1CGXA 1FP5A 3CCHB 4WW2F 1C16A 5IFAH 5D72H 3WIHL 1T22B 2YUZA 3PABB 4JJ5B 4WUUB 5DD6B 5FYKD 5DJ0B 2YN3A 4C55A 1YMME 1DN0A 4OCXH 4RGOH 3MGOB 4XXCA 3EOAB 4M93C 1P5UA 4M61B 2FATH 1KT2B 3HUJE 4X9HA 1OSPL 3U9PL 2VZOA 4CAGA 3T2QA 5D7KD 2DLEA 5F6IB 2GJ6A 5C0BD 1I1AB 5HPOA 3QEQE 5I8EA 3T08A 3X12A 1KXQE 2WP3O 4HUWA 1S7WB 5C0JB 3D0VB 3GSWA 3FN9A 4XP4H 3QDAA 3ULVL 4X9IA 4G8IA 1BBDH 4PFEA 3NCCB 4LCWD 3SDXF 4NWTH 1MFAH 3BWAA 3B2UD 3O8XD 2YXFA 5F9JA 4MD0B 5GGRB 4GG6B 5ESVB 1BD2E 2EXYC 3MLXH 2C3XA 1A7QH 1I1AC 3DMMB 1INEL 2HT3D 3IJHB 4KI5F 4F7CA 2W9EL 4Y1AA 3TVMB 1PEWA 2AABH 5I1DA 1VESA 4I3RL 2PO6D 5DURD 4IM8A 3P2TA 4KUZH 2HFEA 2V9TA 1HH9B 3DHMA 4NQSA 3ARFD 4R0LC 4S11A 4JRYD 5L8KB 3B9KB 1FORL 4E5XB 5CBEB 3VFWA 1E4XI 1HXMA 3BH9B 4ONOA 4I77H 1EJ6A 4WU5B 3DRTB 1IEHA 3BP6A 1CLYL 2I27N 2VDML 4LL9A 1S5IL 1A22B 3RWIA 2VLJE 4MHHI 1OD7A 4NO0D 4EOWL 3PDOA 3ULUH 3K2MC 3MACH 5BZDB 4PV8B 1N26A 4Y4HB 1EBPA 4QHKJ 2RCSL 3STBA 3X13A 2IF7A 1R3IH 1X7QB 4UU9A 4HAFA 3EO9H 5A2IH 5I1JL 5J56B 3WJJC 5FA4B 3BD3A 3IFOA 1HHKA 1VDGA 4R4BA 4YXLH 1OGAD 3A67L 3KPNA 4W4OC 3TZVB 1A14H 1FGVH 1I1AA 4CW1A 1TVHB 4E42B 4WCYH 4BZ2H 2BXYA 4MXVF 2CKBA 5L8JB 2ENSA 5EBLB 4U1LA 3QDGB 1MCSA 4L9DA 3G6AB 2J8UE 2AK4B 3RTQC 3STLA 1RIVL 2IADA 1FVDB 2OTUB 4K3GA 4TPRH 1J11A 3ZKND 4NBZB 3VD7A 4LEXH 4YPJA 4ORGB 4QLRA 1DQDH 2XZAL 1AGDA 4PRID 3AMKA 1F11B 1K2DA 1J8HA 1EGJH 3OGCA 4WV1A 1T1XB 5KVEL 1BF8A 3F7PC 1URLA 4ZO8A 3MNZB 1H0DB 5J11B 3PGFL 3QO0A 2VLKE 3PDOB 3MREA 1DVFB 4RNRA 2J7LA 5FF6B 2OXHA 4DUXA 5DVNA 5CJBA 4N9GA 3VRJB 4FG6D 1B4JH 1AD9A 3GSNL 3SO5A 2O61A 4NO0A 4XBEL 1QFOA 1JGUH 1T2QH 2NY0C 4WFEE 4X83A 4PRNB 3PWPB 1M6OB 2Z91B 1DANT 3I3DA 4C59B 2L7UA 1DSFH 1LO2H 3DMMC 4TUKH 1QSEE 2OX5A 3UTZA 2AVGA 2D4DA 4UTBL 1W0WA 3DI3B 3KXFA 4ELKB 1U92B 4QRSB 3OKMA 1CE1H 4GLRI 5BVPL 2DLFH 1H5BB 4GAJH 2DQTH 4NQDE 1E0OB 4FQ1L 4M1GH 1N5YL 3HZKB 4ZUSA 1LE9B 3T0EC 3S4SG 3HNSH 4OM0H 1KJVA 4PJAB 4YR6A 3DO7A 3VFWB 5DA0B 3LEXA 3MV9E 3ROLB 5EOTB 1EMTH 5BMFL 3BT2H 4IOFC 1X5JA 3GBML 3MGAA 4F3FB 5BS0A 1EFXB 1JNHA 3QI9C 3VWJC 4JFED 1YMMB 4ONFL 5C0AA 4WGVB 3KLDA 3WNOA 5FA3B 4X6BA 2W9EH 4FMFA 1LNUA 4XCCH 3MPCA 3IU3A 4BZ2L 3AVEA 4OKDA 3BXNA 4JG0L 5EN2B 2GTWA 4OZFA 4AEHL 1IZJA 2HJKA 5D5MF 3I50H 1I7ZB 3DV4B 3RRQA 4LSPH 4YDLB 5CKGA 4Z7VF 4EOWH 4CADA 2D0FA 2DDQL 1QRND 2QR0A 1QPXA 2WAHA 3CFJA 3HAEH 2X1XR 4WWKD 5KSAD 4DAGH 5C70A 1C08B 1KNOB 3L3GA 5JR1H 2CIIB 1C5CH 1KPRA 3MCG1 3BP5B 5E2UH 1DANU 5JOEA 4WW2C 5DMKA 3TBYB 1KN2H 5KBNC 2H6PA 1F5WA 2G75B 1T1YA 4PP1D 4GKNB 5BV7H 1GZQB 3QIWB 5HGDA 4RAUB 3CX5J 3WNLA 5IB1B 2J12B 3A6OA 2DQGL 2IAMC 3VA2C 1WIUA 4OV5A 4PR5B 5JORB 2H32H 5I30L 3RNQA 1AD9B 3T3PF 4MAUH 1F4AA 3P11L 1RJYB 4RBPH 4WI6A 1U0QA 4Y19B 5C6TH 4CVUA 2Z8WC 3KHQA 3PF2A 2R56L 4HT1L 1XCTB 1HHGA 2P4AB 4UOJA 4JM4H 2ESVB 2DICA 4X6DE 3GSOB 2K7QA 2ZG3A 4GKZA 4Y88A 5EC2B 5F88A 4PJFE 4NKMB 4R9HA 1NBZB 3S98A 2R8SH 2ATKA 1DBBH 3HE6B 2VXUL 1EMTL 3AAZB 4ACPA 3EJZD 3C8HA 3D48R 4TVPE 5AZ2H 5FKPB 1BFTA 1NQBA 1X5YA 1V7NL 1CD1B 2P44B 2HVKB 2UY6A 3ARXA 5DRXA 2XWJA 3SKJH 3NIGE 1CBVH 3BPCA 3OAYH 2BFVH 4XVTL 2KDGA 4ODTH 1UG9A 4HKBB 3QB7C 4DUWA 4EI5D 1JRHL 2VXVL 4JPIA 1H5BC 4UZGA 1C5BH 5EBWB 4HZLB 4I18B 3MV01 4JANA 1KLUA 5HGBA 1BLNA 4NGHL 3WUWG 5FDWB 2ICWB 5IV2A 3QEGL 4ODHH 5IIEA 1REIA 1UEYA 3S36X 1ZAGA 1EA9C 2WUCH 4OCRL 4PGCB 3BJ91 1GC1C 1MJUH 1PD6A 5E2UL 3ECBA 3TEUA 4POUB 5GS2H 4OF6A 1LEGA 4IDLA 1G7MA 5E2WH 2I26N 5DUMH 3SQBA 2DM3A 3DARA 3MV7B 1Z5LA 1QP1A 4PJFF 1I9RH 3K74B 1KTLB 1OP5H 3DBXB 4XWGH 3D39A 4R96B 4WWKB 4JG0H 2PYEA 5HHMD 5KSAB 1EDQA 5I9QB 1O5DT 3NCYS 5CD5C 3CLEL 1R5WA 2BSTB 1H3UA 1JGDA 5HGAA 3SE4C 1MCBA 3ZE0E 4X6FB 4ODVL 4OQ1A 4JDTH 4JPKH 4FFYH 5CLWA 3KJ6L 4YE4H 1FH5H 4JKMA 4GW4B 1RJZA 4C58B 2FEEL 1XFPA 5GIRA 4XCYB 4QCIB 4LLAA 1J88A 3IFPA 3B8YA 1IT9H 5DC0A 1TTGA 1KCRL 8FABB 1ED3B 1EXUA 5DD1H 3KXFD 4J3WA 3VGBA 3RTQA 3HE7A 5T3XH 1A0QL 3F58H 4LLQA 3EHBD 3V8CA 3AXLA 2E5EA 3O11A 5EZOH 3Q3GA 3WCYA 3RX8A 5FKPA 3L3DA 5K9OB 4HKZA 2QR0B 1QBBA 2O5YL 5DRXB 5FYLL 1PKQB 2DJUA 3W11D 2HTKC 4U1GC 2BDNL 3PP3K 2YA0A 4MJ2A 3TN0D 2JK5B 3KGRA 2AI0L 1RUAH 4HUNB 4Z76B 5DJ8B 2BY2A 1A2YA 5HDBF 5FECA 1NCTA 4XP5H 1MCWW 3WHXA 4LKXA 4WFED 1NCDL 2R2HB 4KK6D 3ILPA 3BZ4B 4X6DA 5K59F 2Y6SD 1JGLL 2EICA 2XTJC 3KPQA 3B9AA 3C09B 1KCSH 1KT2A 5D2LB 1Z3GH 4K3JH 5EU5A 1I9RL 4LDLB 4U2YA 1G6RH 3FT3B 2ZUSA 2PR4L 4N8PA 1EHXA 5C0CA 5JXAL 3LMJH 1OP5K 5KTEH 4WJ5A 4OLXH 2AJ3A 4NQDD 4AL8H 4KK5D 3S96B 3VXME 4O02L 2B1HL 3J7HA 1FFNA 3HE7B 4PRIE 1G7PB 1J0HA 3QNZA 4M9PA 1JHKL 4MJ4A 4LLQB 3BKYH 4LLDA 4HCRL 3VFNB 3P73A 3MGTB 2BJMH 5HI5C 2VLMD 4GS7B 5JHDA 4NFDA 3UTSE 4KTEL 2NY5C 4GG6E 4NHCH 2GT9B 3CK0H 2BHYA 3AB0C 4RQQB 3W39B 5IESL 1TLKA 2LU4A 3HNVH 3HZYA 1A6ZB 4HUXA 4H0GA 5FECB 1IEBA 2QQQA 5DK0A 5CCKH 1IGFL 3KPOA 2F5BL 5T1DL 4UINL 4QRRE 3QWQB 3HKFA 3T0VA 4N0YL 4LCIL 3OAZH 4FTVA 3RUGB 5EO1B 4H1LA 1NANH 3HMWL 4AEIL 2HH0H 3H9SE 4K8RC 2H32B 2NY2C 3VFUB 4OAWA 1Y18A 1YEJL 4NNXA 4OTXL 4QHKI 1ZHKA 2P5WE 4LPTA 3H9HA 3IDYC 1DN2A 4IJ3C 4JRYB 4LVNB 5BVPH 2CRYA 3ARDB 1JE6A 4PRPB 4QHNA 5I1AB 3C08L 1A47A 1WTGT 4KXZH 2DLTA 3MMEB 1UWGH 4HWEH 3MV7A 1CL7L 5GGSY 1GIGH 4ZD3L 4Z76A 4PJ5B 1QKZL 4KI5D 5IBTH 3CDFA 3S7GA 1FIGL 4JKPH 4KWUA 4U1IB 5T5NF 3SKNB 2R0KH 3W0WE 3NZHL 2DWDB 2APFA 4I2XA 5TPWH 5DUPH 1BJMA 1F11A 4Y4HA 4LCWB 1WBZB 3BKMH 4TSAL 1GCFA 3NH7H 3G04A 5GXBB 1KN4H 4LKCB 3GMPA 1Q9KB 1WSST 2GK0B 4XT1C 1UB5B 1D5XB 2HP4A 3MCLL 5GISL 1D5MA 2NY5H 2YPVL 3GMRB 2XTJD 1QACA 4CW1B 3ULUF 4YDVA 4X4MA 4FTVE 4JPWH 2A6JB 3I6LD 5E08L 4LSPL 3WDHA 4FTVB 4MA8L 5KG9A 3P0YH 1A6UL 1XF5A 5EZLA 1CXLA 5C9KA 1OTTC 1MHEA 1AIFA 2I9LB 3G5ZB 3LKRA 4G6FB 3RNKB 1Q9WB 1SJEB 1T1WA 4UIKH 5DD5H 3UZEA 4AY0A 4DN4L 2A74B 2VXQH 3G5VB 4JVPA 4EZMA 4WEMB 4RFOL 5IM7A 3GM0A 1T1XA 4XCEA 5AD0B 2G5BA 3QNXA 4U7MA 4K3JL 3PGCB 2K9UA 3MRFB 5KSVB 3WS3A 1G0XA 1SJHA 5E8NB 1QYGL 3DMMD 12E8H 2AEIT 1AR1C 2KBGA 3MFGB 4X6CB 3F8UB 4P5TA 4AG4L 4MNQD 3GI9H 3FOLA 1ZA6B 4J4PC 4M03A 1FVCA 2ARJA 1ZHBA 3GSNA 4MAUL 1I3VA 4MB5A 1JI2A 1VPOL 1I1CA 2E27L 4MXWH 4OLWH 3ZTJH 4LCWA 3HC3H 5F9WC 3WDJA 3EFDL 4WI4A 4HUXB 3MOBH 3TIEA 4GS7C 3RDTC 2A1WL 1CLZH 5ESQB 4LMQE 1M7IB 3U9PH 2UZYB 2J6EA 3GMLB 5DVOA 2X4QA 4DKFL 3UJTH 5TGBA 1JMZA 2B7DT 2KUTA 2NTSP 5JA9A 1W8OA 5C8JB 5DJAB 5SX4I 4GMTL 2EYSB 3WO4C 4YDVB 2YPLE 1KV3A 5D2NA 2CUMA 4NNXB 3HC0A 4G9DB 5CCKL 4DJMA 4KVNH 2W0FB 4XC3L 4RA3A 4I3RH 3QQNA 5B4MD 3HUJB 2ZCKH 2AEQH 1BBJA 5CS7A 1FPTL 4M43H 4BSJA 5HHQA 2NTFA 2CSPA 3TBTB 3P4NB 2E3VA 2WANA 1T22A 4IDJH 5EOQH 4MQSB 5T3XE 1XH3A 4PGBA 2R29L 1WCBA 4CUCA 2AGJL 3VWKD 4Y5VC 3V95A 1JMXA 1JRHH 1PG7L 1IGTB 4M6NL 4U1IA 5HHOE 2IFGA 2MTPA 1RZ8A 1KIUA 4ENEC 3TBYA 1XCQA 4Z7UA 3IU3B 5CSBA 1FL6A 1NAMH 4PJ9A 4Z95L 1J0ZA 4OLYL 3KJ4C 4JZJC 1JNNL 3MRCA 5TDPB 1AHWA 1LEIB 1BOGB 3C60B 4KRPB 1DQQA 2JJUA 4FZEH 4HUWB 4Z7WE 5C0JA 1ZTXH 2A77H 4P0DA 2V2XB 4TSCH 4R7DB 4OLUL 1AO7E 5DUPL 1U3ZA 4JQIL 4QHLB 1Q94B 4RISH 4ZUUA 4M7KH 1K4DA 1A14L 2XNAA 1LO5A 5D1XC 3RAJL 3QH3A 3JTTA 5D1ZD 1INQA 4WY7L 3OF6A 1MLBA 1A02N 3LQAH 3U0PB 4ZUVA 1BVLB 1A7PH 4IRSA 4XPHL 4ZUWA 5DMKB 4NDMA 5LGJA 3CZJA 2X4SA 3T2OA 5BW7C 1ZA6A 1I9IL 3QZWA 4KHTH 1YQVL 1RUKH 5C3LD 2I07B 1SJHB 3NA9L 5FGCE 2FX9H 1LD9A 3CC5A 1Q0YL 3ARTA 1IKNC 4P2QD 2HG5A 5EO9B 4HWZB 4P4KC 5B39A 1JYXA 1N7MH 4XVJH 5DVKA 1E4KA 1QQDA 3CSYB 4Q6IC 5CEXB 1M7IA 3LQMA 4Z77B 5D1QC 3O6FC 1FL6B 2QV2A 3C8DA 3FOMA 5DURB 5F7DB 5TDOA 1OT2A 3X11B 2DMKA 1NFKA 4JR9H 4ZAKD 1YN6B 2PYFB 1ZGLA 1GHFH 5KSUA 2ZPKL 3BDYH 3BYTA 2EKSB 3H7BA 2VRAA 1KEGH 2DL9A 2X05A 1C12A 2M1KA 4TN9A 2WBJD 4U2ZA 1OGAB 3RDTB 3O45B 4TYUA 4P2RB 4XP6H 4XB7A 1BP3B 3AROA 1INDL 2DBJA 2BZDA 4BFBD 3RHWF 2GEEA 4UDTB 5JW4R 1AY1L 1B4RA 5F1IB 2G5BB 4WW1B 3DETD 3EO0B 5GJSH 3C6SB 3MLRH 3S34H 4YC2B 4YDIH 1YN7A 4JFDD 5FO8B 5EUOA 4K3DL 2V7NA 3IFLL 5C0FB 2C1PB 3EYVB 4CGTA 5HYSB 4M7KL 1GPOL 4TQEL 5ALBH 4PBWD 3RKDC 3UTSB 1F42A 3VXRE 5IQ7H 1DEDA 1SVCP 1RIUH 4KV5E 5CHNB 3GKWH 4IDJL 4NUJA 1J7VR 1M7DA 2CKBB 4XNQB 1KB5H 5JA8B 2BDNH 2DQIL 3QDGA 4N0CD 3ES6B 5D1XD 5HDQH 4R4ND 4CN1A 5IBUB 2GK2A 1D9KA 2DDQH 2JCCE 3VFTA 3NA9H 3NFPA 3DMMA 3EJYD 1BJ8A 3P9MB 3B4NA 4BSVA 4D9LH 3MRIB 1V7MH 4F7CB 5AYUH 5F7UA 1U36A 4ZQKA 1DVFC 1G7QB 2EDKA 2AEWA 3GI8L 2OMBA 3BN3B 4QHUA 1UM6L 4V2BA 3D18A 5D2LE 4OFDA 1U95A 4JO1L 1ZSDA 3QCUH 5J06A 1QQDB 3LPGA 3AS1A 3JXAA 3MCKA 3OR7B 2E8YA 2CLRB 4ALAL 4ONHA 3WN5A 5FO9A 3QAZB 4YFLI 4I5BA 4JPVL 1Q9LB 3FONA 1KG0B 2EE6A 4L3ED 2V7NB 3QPXH 5C0FA 5LWYL 2ED9A 2DOCA 5F6HI 3UXFA 4GAGL 3VMPA 4ZG1A 5F8QC 4UDUA 3JV5A 1RSFA 3NABL 5EBGA 5TDOB 2R56H 3DO3A 3Q48A 3U4AA 3EYQC 1OPGH 5AWNH 1RZJH 4MNQE 4MAYA 1FJ1A 3ULVH 4F33B 5IW6B 2PXYD 1PZ5A 4JKLA 4EXKA 5DXWA 5FKAB 4P2OD 4YC2C 1WAAF 4H5SA 5E1HB 1TZHA 3BO8B 3V6OA 1KJVB 3OX8B 4YR6B 3H42H 1I3GL 1EEZA 3SDAC 4YXHH 2ITCA 5F89B 1NBYA 5JPNB 3P73B 4NO5B 2ZKHH 5A3ID 3FN3A 4ZYKB 1L6XA 4PY7A 4FQHB 4JZJB 1RHHA 4GFTB 4K7FB 3AY4C 4P49A 5DRZA 4WI9A 1F90H 4PR5A 2NY3C 1UXWB 3ARVA 3IJYA 3VXMB 1S9KC 1BFVL 3BXNB 2FJFA 4K7PL 1JZ3A 3QQ9C 2XTJE 3WD5L 4R0LB 2R2BA 5DUBB 3NAAL 4MB4A 4XNMB 3PJSB 1R24A 1MNUH 2Y72A 1RULL 2W38A 1U8PB 4JCLA 1PYWB 3NCMA 5HHVL 5KSBF 3HR5B 4I48A 4NZTL 4NKMA 3D3VD 1KJ2H 4FQCH 2JLLA 5D1ZA 1DBKL 3CFJB 2D31B 5AUMB 1D5BA 2IPUK 3GJFB 4ELMF 1G7PA 5E7FA 1FRGH 3O3AB 4QRSA 1U9KA 4HIEA 3BQUB 5SX4H 2JB6B 4GRMA 5CEZD 2GY7B 4L1HA 3UTZB 5JW4N 1U93A 4NM8H 1K5NB 4LEOB 5GJTH 5HJ3A 3QDJA 1T1YB 4L4TE 1ZV5A 1R3LB 1S78D 3PGDB 1S7XA 2XV6B 5I1GH 3B6SB 5F1NA 4EVNB 3SGDI 4HLZG 5GZOD 4Y5XA 4YHZH 1EGJL 5ADPH 4Q9QL 3LEXB 2YD8A 3FONB 2P42B 3TO2A 1A3QA 1F6AA 1G6RA 4EUPA 5IR1A 5ISZB 2A0LC 5EFIA 3V4VL 3G5XB 3OL2A 4XBPB 5JDSB 3UZQA 3TBWB 5GGQH 3OJ2C 2R2BB 3MV8B 4HBQA 4C4KT 5I66B 5F7WC 1A6PA 4NNYB 3MRDB 5IHZA 5KAQG 4GLRH 3QBTB 4YFEA 4UBDC 2EKJA 1VFAA 3OV6A 4JFQA 4JEGB 2ZNWA 1BGXL 3QHFL 3QIWD 5E8DH 5EG6C 1EPFA 1CK0L 4F9PA 4QRQB 3LHPH 2V6HA 4YO0B 5C0IB 2ZSWA 4XAWL 2BHZA 3LIZH 3W82A 5DMIH 1S9VB 1H3PL 2R29H 4TVPD 3PWJB 4NN6B 3UBXB 3JV6B 5JOFB 3HCVB 1HHHB 4PY7B 1A4KA 2H9GB 3MO1A 3T2PA 3L5WA 3ZTNL 4XI5C 3PXHA 4Y5XC 2NX5B 3VU2A 5F7HA 4JRXB 1E4WH 3O4OC 2BC4B 3IXAA 3WS3B 4YK4C 4LARL 4TNVF 3JWDL 4XP9H 4J8RA 1Q1JL 3MV9B 2G2RA 5KSAC 3DGGB 3G6JA 4N1CA 2X4RB 5DQDH 4QXTA 1MWAB 1KB9J 1MUJA 3CMGA 3SDXB 4G8FB 4ETQA 4X98B 4Y19D 2A6JA 4U1HB 3WO4B 1S5HB 3MBEB 4LLWA 1SEQH 1MWAL 1P5VA 2XWBB 1ZLVK 2BVOA 1PVHA 2P43B 1E6OH 4G9FD 3G5XA 4XBPA 3MXWH 5D5ME 5JDSA 3UZVB 4PB0L 5D70L 1G9MH 5GJTL 4YGAB 3D3VB 4IBLT 3VH8A 3F7VB 5M95B 2IMMA 4MCZB 1MRDL 2GW5A 4QXGH 3ULUD 2BNRE 3D39B 4HUMB 2WUBH 1IC5H 3U2SB 4MDIB 4BQ8A 5FV2A 4ERSH 2NY2B 4QF1A 3UBXI 2XOTA 2V9RA 1BOYA 3L7EB 2XA8L 3WIIH 4K9EC 3OAUL 4LAQH 2ZJSH 5DHXB 1CVSC 1QA9A 4LCYA 1PG7W 5F9JB 1IRAY 2YD2A 3AMLA 4JN1L 3P30H 3T1WA 1QFHA 3P0GB 1QRNE 1XZ0B 1IQWL 1ZVYA 3DX8B 3H7LA 5ICYA 1MAMH 4PV8A 5E6ID 1ZTXL 1K2DB 3JWOC 2BOCB 3K4ZA 4X0KB 3C5JB 4EI5A 4M93B 5M7QA 3BP4A 3RVXC 5ISZA 3PWVB 3UEZA 4PJ7E 5D1QD 5CBAA 2VXSL 3LV3A 2PETA 3RX7A 4HG4K 4Y19E 5DFVC 2V5MA 1QBMH 1LK3L 2MOVA 1YY9C 3QUKA 4HPOL 2C1OA 4HJGB 1NGXA 3VXRA 1KELH 1N6UA 3P11H 5I71B 4R2GB 2NW3A 2IPTH 3TA3B 2FYYB 3MLTB 3T09A 1A9BB 5MEOA 3O6FD 4LBEB 3CVHB 5HYIA 1YEJH 3O9WD 3IXTB 3VFMA 3BWAB 3VGDA 3BRGC 1Q0YH 1ZT4B 5I75B 4WFGE 1E4KC 4HIEB 1I1YB 3IKCA 4N9OB 1X5ZA 2NX5A 2B4CL 4P4KA 4JFDB 1NC2A 4OSUH 5C09D 1CDBA 1CICB 3L3OA 2EDXA 4EKXA 3CFDB 2Z8RA 1GGCL 4MZ3A 3A67H 1AGFB 1HCVA 1WICA 4PJXE 4D94A 4UUJA 4NHUB 2CDFB 3UJJH 2OM5A 3O2VH 4PP2B 4G7VL 5IF0A 3VXQA 1UKQA 2VERN 4QWWC 4HUUA 1FZMB 3LS4L 5J4MA 5D7JC 4KJQC 3LVEA 5KS9B 4H1LB 2FEEI 2R23B 4O9HL 4P5KA 4P5TC 1G0DA 2KZ1B 4X9GA 1NBQA 4DGYL 5DI8B 4OBRA 2B0SH 1FIEA 2CRMA 3J8F7 4ZO9A 4Y1AD 3LN4B 3PWLA 4ODVH 2YK1H 4GW1B 4N0FB 4HULB 2XZQH 4UQ3A 2V7HA 4L4TD 3MYZA 5JZ7C 1UKSA 4E0RA 3UTOA 4NC2B 3B9KD 1A6AA 4XP1H 1NJ9A 1WEJL 2MQCA 4UT7L 1O7VA 1SYSB 5DJ8A 3M07A 1TNNA 2M2DA 7CGTA 2NY6B 1CD0A 4F80A 4R4NC 1FN4A 1DDHB 1JBJA 5D70H 3F7RA 3RY5A 4WV1B 1NSNL 2ESVD 1LNUB 1ACYL 1AKJD 1IGIH 2CLVB 5DEZA 5I1EL 2IPTL 5CD3A 3WS6C 1ZLSL 2VNCA 4D3CH 4M8QB 3WLBA 4DKAA 5LVEA 2IBZY 4OZFH 4OV6F 3ULVD 1I1AD 1P6AB 2IMNA 1F8TL 2CDFA 4PRPD 3X17A 4MQ7A 4X6DB 5DS8A 2O5ZH 5J89A 1EHNA 1YY9D 1T2JA 1SBSL 3DURA 3GIVA 1G1CA 2AXFB 4X7SH 4PREB 2VZ1A 3O9WC 3VFMB 2D7OA 4BJLA 2CDGB 1PZUB 4DWHA 2C5DC 2NNAB 4Y16D 3ZHDA 4O4YL 1C5DB 1M71B 4A6YH 1HHIB 3QUXC 5MHSE 5F7EH 5GRZA 1TCRB 3T0ED 4QF1B 4NC1C 4PRAB 1DLFL 1KTDB 4P5TB 4LLVB 2W9DH 2WIIA 5I1LA 4F7TA 3OZ9H 4Z8FL 4GRLB 3DHJA 2M8XA 2YUXA 2XQYK 3FQRB 1MJJB 4PGDA 5IBLC 1KPUB 1U95B 2P5ED 4RGMB 1QR4A 3FFDA 3BP4B 4JFPA 4HIJA 1TJIL 4Z0XB 4Z7OE 1KIPB 3FL7A 1XF2A 1PX3A 3UO1L 1QFWH 4KUCD 4NZTH 1FLRH 1N3NA 1K8IB 4HFUL 4BUHA 1MHEB 3FKUS 3IRPX 1AKJA 4JFEE 4PJCF 5HGBB 4RMTA 4FFVC 3KPPA 4TSCL 1CN4A 3NFPB 1RUPH 5EU6B 4FP8L 4ISVA 1FSKC 4OAWB 1MCDA 3MMEA 3MLSL 2F5BH 3EBAA 2X70A 4PREA 2ATPB 5T1DH 4NCC1 3H9HB 3RGVA 1T5WA 3WXWH 3PWNA 3BN9D 1DQTA 4UT9L 2PTTB 5GRXG 4ZXBD 6FABL 2RIKA 3K8MA 3Q6FA 4R3SA 3F65A 1DQML 1ORSA 2IAMA 1A3LL 4MNQB 2BJML 4U1JB 2EYTB 3NCFB 4X5LA 5FUOH 1YEFL 2DWDA 3RTQD 4KHTL 1NUFA 1EZVX 2F74A 1AXTH 2I60H 1EHLH 5C2BH 2C26A 5F1SA 2GTZA 2C4FT 3HG1A 4OF7A 1MCJA 4XP4L 4OZHE 2E6QA 4R6UA 4LSUL 4OI7A 4LAJH 4Q0XH 3UTPE 4G7YL 2V2XA 3GIVB 3SEPA 1PAMA 5J57B 2NR6C 3NPSB 5JMOC 2YMXH 3ALWA 5A16A 4MJ5B 3LHPL 3IDYB 2OL3B 4HS6B 1K6QL 3H8NA 4D0DB 3L3JA 4DTGL 3ZDXF 1T80A 5IQ9B 2VLRA 5HI4D 2HMID 2CRZA 4ZPTB 2GCYA 4J3TA 5IWLA 1OTUC 3ZE1E 5C6TL 4MJ6A 2DB8A 4YXKL 4N8VB 5ID0A 3IJHA 2OI9C 1QHOA 1HHJB 4PV9B 3P9WB 2P1YA 3TVMA 1BREA 4HT1H 3ABZA 1YA5A 3FQTB 3W2DH 5J13C 1L7TH 3LKPB 1DZBA 1E27A 1J8KA 4GBXA 3FZUC 1OL0A 3MACL 5TE6H 3LN5B 1T20A 4FABH 4Z0BL 1MQKH 1VGEL 1XF4B 3CSYA 3TIDA 2E7LA 1MIML 1ORQB 5IJVB 2EIBA 5EO0B 2F9BT 5GJSL 5I1CH 2YS4A 3DECA 5F97E 1H3XA 3OMZA 4K55A 1WC7B 3C87A 4KI1A 4TNVK 5IQ7L 5T1KB 2MQ0A 4PYGA 3EO1B 1EVUA 2QBWA 1K4DB 1FG2B 4J4PD 3FTGA 2VDLH 4XHJD 4D0CA 3JTTB 2VLJD 1CFQB 5CJOL 3FT4B 3O6ML 4GRMB 1OP3K 1AR1D 2FX8H 3SQOL 3FO0H 2NY5L 4PUBH 4AIZA 1YEIH 3MFFB 3L3JB 1GGUA 2KZWA 4LAQL 3WEXA 4P3DB 2NTFB 2AQ2A 1CLZL 3ZDXE 5IROC 5AAWA 1NGZA 1IGML 1A6UH 3KNBB 1YC7A 2ADFH 3PNWB 2IQ9H 1KCVH 2I07A 2WBJB 3QIUD 4OCRH 5E6YA 4RSVA 3N85H 4PJ9B 4M1CC 5ALCL 4JKWA 5A2JH 1W0VB 2YMXL 5IFJA 1DBJL 3D3VE 2HT4D 3CDCA 3ZE1F 5K93A 3QEQD 2EH8H 1IFHL 1BX2A 1OGTA 2AJYH 3BDXA 3CFCL 3SDCC 3ARDD 5IVXA 5E24E 1MI5B 1JF1A 5C7XL 2I5YH 1D5ZB 4AYFA 3T65A 4X4ZA 4PTTB 3HC3L 3DX7A 1LO2L 4TUKL 1A6VL 1QFPA 2XKUA 2ZJSL 4MWFB 2VLLB 3QHTC 4XNXL 1PG7H 4KQ4H 2O61B 3T4YB 4HDIA 3IFPB 3D25A 2JCCA 2PXYC 2I25N 4S2SB 1FAIH 4DVRH 1NAKH 3OKLA 1TCMA 4C56B 5L7XL 2P24B 2AK1L 4LFHG 3T0BA 1YMHB 2JIXA 4U6YB 1FBIH 3D9AH 1KOAA 1N5AB 4KJPC 4L8DB 1DP0A 2SEBA 3RI5K 4UAOB 4ELKA 3S3SA 4PJCE 4GT7A 1OCWL 3KR3L 4QT5B 2R4SL 5FGCB 1RQ5A 1HKLL 3MV9A 1IQDB 3G6JB 5CINH 3Q6FB 4DW2L 4FQXB 3IAPA 4MGXA 3INUL 1JFQL 4LSTH 2P8MA 3VD9A 4JFFE 1F00I 2FWOA 3MLVH 4YHKL 5LAXA 4POYA 4Y4FA 4WNQB 1MNUL 4LSSH 4OZHB 3EIFA 4YIQA 3MJ7B 2GTZB 4AH2B 1HXYA 1IM9A 1X5IA 2B4CH 5E8PB 3MBEC 2ADFL 4G6JL 2XACC 3E6FA 5L0QB 2BVQA 3GGWB 3MRGB 3V0VA 2CKNA 3P9MA 4BSVB 1JZ4A 2CO6B 5TDNB 3QEUB 4RFNB 3BESR 1QA9B 4LCYB 5E94A 5D7IF 4OCSH 4PJ5A 3FFCE 1N59B 3S4SB 5D1QB 1MFCH 1JN6B 4G6FD 5DDHB 3S35L 4K7PY 1WBZA 2EE2A 2DQCL 2DQUH 3CDGB 4IMLA 4LP4A 4O58H 1E6JL 1IKFL 3D85A 4NUGH 3ZDYF 5FO8A 4QT5A 3LS5H 2V9QA 2OCFD 1CLOH 4I9WD 1KFAL 4DGIL 1J5OL 4APQD 3ZZ1A 5JHLH 2A9NH 2VR5A 5IFJB 1GZQA 3QIWA 5HGDB 4JLRB 5MP6H 4B7IA 3UMTA 3VFGL 3NGBB 4TUJA 5I19L 5BOZG 2PW1A 4U4BA 1AD0A 3GNML 5JIIA 4DAGL 1VFBA 3CXDL 2HRPH 4FQXD 4XVJL 2QJDA 4Y4KC 1R5IB 2EIEA 3EDJA 3JZ7A 1OSZA 1XCTA 1NGYA 4R4FL 4O4YH 3TA3C 4BZYA 3O3AA 5FYLD 1MFDL 3GSOA 5D6DC 4Y8DC 2X9XA 4HDIB 5F88B 2X09A 2FHBA 4K3DH 3HRZB 4LGPB 3SGDH 3VFUA 4S1RH 2UZXB 3V5DA 1PX4A 2FBOJ 2AJYL 4X4XA 3QDJB 3ISWA 5IHUL 4NO2A 5HVGB 1T1ZB 3QI9B 3VWJB 2XWTA 3OZ9L 1NCAL 3QAZC 1JZ6A 4U6HB 5FGBA 5DJ2B 5HDQL 4LSDA 2JTDA 5LGHL 1KJ2A 1S5IH 5GRUL 1DDHA 5ICXA 3C2SA 2P49B 5IGXH 3SBWC 5E7BA 3FQNB 5SWZE 3IYLW 4MQXD 3UTTE 1QOKA 1Y6MR 1CR9H 3JWOH 5F8RC 3W9EA 2D7PA 2ESVA 2F53A 2OZ4H 2VKXA 4MJIE 5EORL 3PWLB 4NBXB 4G6AC 2R1XA 1EO8H 2R1WA 4Q9RH 3PV6A 4BZ1L 3MXVL 4UQ3B 4MAYB 4G80A 3AUVA 4RAVA 4F33A 4JGJA 4PD4K 4DW2H 5C0IA 4S1SH 1RVFH 1KN4L 4NQEA 4JFYB 3WXWL 4KQ3L 1F4HA 1GL4B 3MV8D 3K4DA 1TJGH 2OK0L 1SJXA 3E3QC 5INDA 3QUMA 2O5XL 4HJJL 4CN6A 1ZVSB 4MAYC 4O00A 1KB5L 4PJXF 4UT9H 2WW8A 3IDIA 4P9ML 3HRZA 2FHCA 3V5DB 3TWCH 2VDKL 3GDBA 4JZJA 3VXMD 3X14B 4FFYL 1ITBB 2PYEB 5F96H 1TETH 3V6OC 5I1HH 3P0YL 4PIRF 5EU3B 4D0BB 5F9AC 5GGSB 3H9SD 1OAQH 3MNZA 1JJUA 1RURL 5DRWA 2OL3L 1PLGL 3TH2T 4MXVE 4HMDA 5DUBA 1T5XB 5C2BL 3ARBB 3VGGA 1CF8H 2G9HB 1DN0B 4LSUH 3FQXA 1AD0B 4X7FC 1QRNA 1FZOB 2VSCA 2F58L 1CL7I 3IDJA 2IPUG 2VXSH 2DLHA 2WINB 3VCLA 3SHSA 3EDEA 1WITA 1Q72H 4HS8L 3WNPA 4X4ME 3ULVF 2ITDA 3WO3B 4D9QD 2W07A 4P4KD 3QPXL 1MFBL 1HI6A 1IKFH 2XN9D 2IANE 2X9YA 3N1PC 4LIQE 4ZPVA 4QRUA 3SGJC 3WFCH 3O2DL 4NRZA 4RWYH 3BD5A 5EZJA 3ARED 2EDWA 4ZFGL 2APWA 5EBLA 3VRIA 3BD4A 3SDCB 3EJZC 1QFUH 4X7TB 1FNEB 1MCFA 4Y4HC 4PGEA 4Y0GA 4PJAA 5DJ2A 1FL5A 3VE0B 2J2ZA 3B2UC 1TNMA 2VQTA 1NMBH 2E6JA 2IPKA 3H42L 2FGWL 1UM4L 1R3KB 4H26B 1RZGB 1ORSB 2IAMB 4O51A 4R7NB 1L0XA 1AXIB 1QBAA 3BPLC 1GOHA 4BFGA 1JPFA 5H35B 2EH7L 3GK8L 4DGVL 1MCLA 4JB9H 1I1FA 3P4LA 4YBHA 4QWWD 3U9UB 1BD2A 1OF2B 8FABA 3MRKB 5DWUH 3MODH 2MMXA 3RTQB 4RNRB 4CVWA 3F7VA 3LEYH 3PWPE 1MHPL 2JF1A 1OP9A 4ISVB 3VRJA 3MA7B 5JO5A 1OGAA 2ZWLT 1BMGA 4MD4A 2YRPA 3NZ8B 4W81A 3PUCA 4ZFZA 1ZT4A 2CPCA 1DJSA 32C2B 1NUNB 2X4NA 5HHME 3VWKA 4GMSH 4PLJC 1H3WM 2XZCH 4R97B 1UA6L 1CGTA 3OAYK 4IIQC 1MHHB 1N2RB 2BC4A 2F5AL 3IXAB 1R0AL 3L3HB 1AGDB 4URTB 1JPSL 4HGWB 1CXIA 2E9JA 1UQSA 5DF0A 1NL0L 2X4TA 4WENB 3BHBB 3PWUB 2WQ8A 2BP3A 4KQ3H 3I6LE 2PO6C 5E9DE 4BFEA 3SKMA 3RZCA 4XPAL 3SDCD 4Y19A 3E2HB 1A7PL 2FO4A 3BISA 1A6VH 1S5HA 3MBEA 4JO4L 4ODSH 4XPHH 4BQ9A 4NFBA 3AGVA 2BVOB 5DI8A 1ZLSH 4PJCB 3GSVB 4YHPA 4Z7WA 4EDXA 1N0XH 4ZTOH 5LGKA 5T33H 3V4VH 4LASH 4LLWB 1X9QA 5HHXH 1UZ8B 3BGMB 1MCNA 4UNTA 3BAEH 2ATKB 2A9MH 4FMKA 3MNWB 4H88H 3NPSC 4XCFL 3C9NA 4PJEA 4RGNE 2UWEB 3RWEA 3MA7A 1OAYH 4KI5E 2XYCA 3I2CH 1KACB 4JKPL 5AZ2L 5E2JA 1A6WH 3VDCA 5KANG 1MRFH 3RVUD 5A40E 3ESUF 4E9LA 1H8OA 4JQVC 3WEXB 2BX5A 4HX1B 2X89A 1UH2A 1ZVSA 3QWRA 4KUZL 2YD4A 1HQRA 2MSPA 2P5WD 1AP2B 5KSBE 3VFPA 1R3HB 2DQHH 3CVIH 1EEYA 1MJ7H 4YHKH 1XGUB 5KN5A 2VH5H 3TF7C 4HUUB 1OTSC 4Y1AE 3ARUA 1R3KA 4PJEE 3O2DH 3QDMB 2VDMH 4I0KA 4MA8H 4BH7A 1F4WL 2FGZA 5FUCE 4ELMB 1OTUD 3ARBA 4WO4D 4X4YB 1UEMA 5FGSA 2CDEA 1QLFA 3L5JA 4N5ED 1IQWH 3NN8A 5L6YL 3F12A 2JJVA 2V7HB 5B38B 1SEQL 4RZCA 1B9ZA 4OI8A 1PZ5B 4G8GD 3I6GA 1WWCA 5I17B 5C09E 3BVNB 3IFLH 5C0BB 2FIKB 3NMEA 3CD4A 2GITB 3IKCB 2BNRB 3V0WL 4LK4A 2EH7H 4HK0B 2WWMD 1MCWM 1X3DA 4ALAH 1R3JB 3EOBA 3HNTH 3VXPB 3SBWA 5IMOB 1C16B 2XA8H 5DD3L 1JGDB 1Z0NA 1ETZA 1AGFA 1UXWA 3IJYB 4ODUA 5I0ZA 5GGTA 1DSFL 2MCPH 4NUGL 1N0XL 3V9FA 4ZTOL 4IOIB 1YEFH 2VDOH 4PP2A 1CGYA 5LCVL 3IJSB 1YPZA 3MLZH 4UTAL 2YWYA 5I9QC 5ERWA 5KVGL 3VA6A 5SV4A 3L9RB 4OZGA 1DLHB 5GIRB 1U8PA 4HJ0D 1MCPH 5DHVB 5DGQA 4DN4H 5D1ZB 1X5FA 2XN9A 4OM0L 1GGTA 2P7TB 5HGGS