1UG4A

Crystal structure of cardiotoxin vi from taiwan cobra (naja atra) venom
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
LKCNQLIPPFYKTCAAGKNLCYKMFMVAAPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxin 6
publication title Structural difference between group I and group II cobra cardiotoxins: X-ray, NMR, and CD analysis of the effect of cis-proline conformation on three-fingered toxins.
pubmed doi rcsb
molecule tags Toxin
total genus 11
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2003-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ug4A00
3NEQA 2H7ZA 1JE9A 6EBXA 2QJBC 1ERGA 2H7ZB 5DZ5A 1IDGA 1FRAA 2K3GA 1NEAA 4OM4A 4XJJA 2H62D 1CDRA 1CDQA 2L03A 1NYSA 1S4YA 2CRTA 1BTEA 1FF4A 1MR6A 2LA1A 4QTIU 3BT1U 4RUDA 2NBTA 1CDSA 1F8UB 1NYUA 1LJZA 4IYEA 1G6MA 1FASA 3EBXA 3PLCA 1VB0A 2N99A 1CDTA 1KL8A 4P7UA 5DO6A 1H0JA 1CTXA 2H62C 2ERAA 1REWC 1BXPA 1NTNA 3BT2U 1CB9A 1LXGA 5DU1A 2MJ0A 2BHIA 1QM7A 4LFTA 1FSSB 1CVOA 1ABTA 1CODA 1KC4A 1LSIA 4HQPF 2ABXA 1UG4A 1HOYA 1M9ZA 2H64B 1KFHA 3KFDE 1DRSA 1CREA 1ZADA 1HAAA 1IQ9A 1IDIA 2L5SA 2FD6U 2HLRA 1KTZB 3FEVA 3QB4B 2CTXA 2X8BB 2CRSA 2LCRA 3EVSC 1RGJA 1KS6A 4FAOC 2GOOB 1ERAA 1COEA 1CXNA 1NORA 2CCXA 2H64C 2J8BA 4FAOE 4UY2C 2VLWA 1FFJA 2H8UA 4EY8B 1KBAA 1KBTA 1LX5B 2MJYA 2H5FA 1XT3A 2UX2A 1IDHA 2MUPA 1V6PA 1YWHA 1F94A 2JVEA 3U74U 4DO8A 5IMTD 1KXIA 1NTXA 1TGXA 1LXHA 1IK8A 1ES7B 2QJAC 1B41B 2JQPA 2GOOC 2I9BE 1W6BA 1CHVS 2HLQA 3LAQU 2PJYB 4OM5A 3VTSA 1IKCA 1I02A 1TFSA 2MFAA 1CRFA 2QJ9C 1TXAA 1KBSA 1TXBA 1MAHF 4AEAA 1IJCA 1QKDA 1RL5A 1HAJA 1PLOA 2OFSA 1CCQA 3U73U 2CDXA 3NH7A 1JGKA 3NDSA 1NXBA 1IDLA 1KU6B 3ERAA 2BTXA 2QC1A 1HC9A 5IMYC 2UWRA 2MUOA 1CXOA 5EBXA 1L4WA 4ZQYA 1HC9B 4BIKB 1JBDA 2MHYA 4BDTB 2MJ4A 3HH7A 1QKEA 1ONJA 1FSCA 3KFDI 2PJYC
chains in the Genus database with same CATH superfamily
3NEQA 2H7ZA 1JE9A 6EBXA 2QJBC 1ERGA 2H7ZB 5DZ5A 1IDGA 1FRAA 2K3GA 1NEAA 4OM4A 4XJJA 2H62D 1CDRA 1CDQA 2L03A 1NYSA 1S4YA 2CRTA 1BTEA 1FF4A 1MR6A 2LA1A 4QTIU 3BT1U 4RUDA 2NBTA 1CDSA 1F8UB 1NYUA 1LJZA 4IYEA 1G6MA 1FASA 3EBXA 3PLCA 1VB0A 2N99A 1CDTA 1KL8A 4P7UA 5DO6A 1H0JA 1CTXA 2H62C 2ERAA 1REWC 1BXPA 1NTNA 3BT2U 1CB9A 1LXGA 5DU1A 2MJ0A 2BHIA 1QM7A 4LFTA 1FSSB 1CVOA 1ABTA 1CODA 1KC4A 1LSIA 4HQPF 2ABXA 1UG4A 1HOYA 1M9ZA 2H64B 1KFHA 3KFDE 1DRSA 1CREA 1ZADA 1HAAA 1IQ9A 1IDIA 2L5SA 2FD6U 2HLRA 1KTZB 3FEVA 3QB4B 2CTXA 2X8BB 2CRSA 2LCRA 3EVSC 1RGJA 1KS6A 4FAOC 2GOOB 1ERAA 1COEA 1CXNA 1NORA 2CCXA 2H64C 2J8BA 4FAOE 4UY2C 2VLWA 1FFJA 2H8UA 4EY8B 1KBAA 1KBTA 1LX5B 2MJYA 2H5FA 1XT3A 2UX2A 1IDHA 2MUPA 1V6PA 1YWHA 1F94A 2JVEA 3U74U 4DO8A 5IMTD 1KXIA 1NTXA 1TGXA 1LXHA 1IK8A 1ES7B 2QJAC 1B41B 2JQPA 2GOOC 2I9BE 1W6BA 1CHVS 2HLQA 3LAQU 2PJYB 4OM5A 3VTSA 1IKCA 1I02A 1TFSA 2MFAA 1CRFA 2QJ9C 1TXAA 1KBSA 1TXBA 1MAHF 4AEAA 1IJCA 1QKDA 1RL5A 1HAJA 1PLOA 2OFSA 1CCQA 3U73U 2CDXA 3NH7A 1JGKA 3NDSA 4KSNA 1NXBA 1IDLA 1KU6B 3ERAA 2BTXA 2QC1A 1HC9A 5IMYC 2UWRA 2MUOA 1CXOA 5EBXA 1L4WA 4ZQYA 1HC9B 4BIKB 1JBDA 2MHYA 4BDTB 2MJ4A 3HH7A 1QKEA 1ONJA 1FSCA 3KFDI 2PJYC
chains in the Genus database with same CATH topology
3NEQA 2H7ZA 1JE9A 6EBXA 2QJBC 1ERGA 2H7ZB 5DZ5A 1IDGA 1FRAA 2K3GA 1NEAA 4OM4A 4XJJA 2H62D 1CDRA 1CDQA 2L03A 1NYSA 1S4YA 2CRTA 1BTEA 1FF4A 1MR6A 2LA1A 4QTIU 3BT1U 4RUDA 2NBTA 1CDSA 1F8UB 1NYUA 1LJZA 4IYEA 1G6MA 1FASA 3EBXA 3PLCA 1VB0A 2N99A 1CDTA 1KL8A 4P7UA 5DO6A 1H0JA 1CTXA 2H62C 2ERAA 1REWC 1BXPA 1NTNA 3BT2U 1CB9A 1LXGA 5DU1A 2MJ0A 2BHIA 1QM7A 4LFTA 1FSSB 1CVOA 1ABTA 1CODA 1KC4A 1LSIA 4HQPF 2ABXA 1UG4A 1HOYA 1M9ZA 2H64B 1KFHA 3KFDE 1DRSA 1CREA 1ZADA 1HAAA 1IQ9A 1IDIA 2L5SA 2FD6U 2HLRA 1KTZB 3FEVA 3QB4B 2CTXA 2X8BB 2CRSA 2LCRA 3EVSC 1RGJA 1KS6A 4FAOC 2GOOB 1ERAA 1COEA 1CXNA 1NORA 2CCXA 2H64C 2J8BA 4FAOE 4UY2C 2VLWA 1FFJA 2H8UA 4EY8B 1KBAA 1KBTA 1LX5B 2MJYA 2H5FA 1XT3A 2UX2A 1IDHA 2MUPA 1V6PA 1YWHA 1F94A 2JVEA 3U74U 4DO8A 5IMTD 1KXIA 1NTXA 1TGXA 1LXHA 1IK8A 1ES7B 2QJAC 1B41B 2JQPA 2GOOC 2I9BE 1W6BA 1CHVS 2HLQA 3LAQU 2PJYB 4OM5A 3VTSA 1IKCA 1I02A 1TFSA 2MFAA 1CRFA 2QJ9C 1TXAA 1KBSA 1TXBA 1MAHF 4AEAA 1IJCA 1QKDA 1RL5A 1HAJA 1PLOA 2OFSA 1CCQA 3U73U 2CDXA 3NH7A 1JGKA 3NDSA 4KSNA 1NXBA 1IDLA 1KU6B 3ERAA 2BTXA 2QC1A 1HC9A 5IMYC 2UWRA 2MUOA 1CXOA 5EBXA 1L4WA 4ZQYA 1HC9B 4BIKB 1JBDA 2MHYA 4BDTB 2MJ4A 3HH7A 1QKEA 1ONJA 1FSCA 3KFDI 2PJYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NEQ A;  2H7Z A;  1JE9 A;  6EBX A;  2QJB C;  1ERG A;  2H7Z B;  5DZ5 A;  1IDG A;  1FRA A;  2K3G A;  1NEA A;  4OM4 A;  4XJJ A;  2H62 D;  1CDR A;  1CDQ A;  2L03 A;  1NYS A;  1S4Y A;  2CRT A;  1BTE A;  1FF4 A;  1MR6 A;  2LA1 A;  4QTI U;  3BT1 U;  4RUD A;  2NBT A;  1CDS A;  1F8U B;  1NYU A;  1LJZ A;  4IYE A;  1G6M A;  1FAS A;  3EBX A;  3PLC A;  1VB0 A;  2N99 A;  1CDT A;  1KL8 A;  4P7U A;  5DO6 A;  1H0J A;  1CTX A;  2H62 C;  2ERA A;  1REW C;  1BXP A;  1NTN A;  3BT2 U;  1CB9 A;  1LXG A;  5DU1 A;  2MJ0 A;  2BHI A;  1QM7 A;  4LFT A;  1FSS B;  1CVO A;  1ABT A;  1COD A;  1KC4 A;  1LSI A;  4HQP F;  2ABX A;  1UG4 A;  1HOY A;  1M9Z A;  2H64 B;  1KFH A;  3KFD E;  1DRS A;  1CRE A;  1ZAD A;  1HAA A;  1IQ9 A;  1IDI A;  2L5S A;  2FD6 U;  2HLR A;  1KTZ B;  3FEV A;  3QB4 B;  2CTX A;  2X8B B;  2CRS A;  2LCR A;  3EVS C;  1RGJ A;  1KS6 A;  4FAO C;  2GOO B;  1ERA A;  1COE A;  1CXN A;  1NOR A;  2CCX A;  2H64 C;  2J8B A;  4FAO E;  4UY2 C;  2VLW A;  1FFJ A;  2H8U A;  4EY8 B;  1KBA A;  1KBT A;  1LX5 B;  2MJY A;  2H5F A;  1XT3 A;  2UX2 A;  1IDH A;  2MUP A;  1V6P A;  1YWH A;  1F94 A;  2JVE A;  3U74 U;  4DO8 A;  5IMT D;  1KXI A;  1NTX A;  1TGX A;  1LXH A;  1IK8 A;  1ES7 B;  2QJA C;  1B41 B;  2JQP A;  2GOO C;  2I9B E;  1W6B A;  1CHV S;  2HLQ A;  3LAQ U;  2PJY B;  4OM5 A;  3VTS A;  1IKC A;  1I02 A;  1TFS A;  2MFA A;  1CRF A;  2QJ9 C;  1TXA A;  1KBS A;  1TXB A;  1MAH F;  4AEA A;  1IJC A;  1QKD A;  1RL5 A;  1HAJ A;  1PLO A;  2OFS A;  1CCQ A;  3U73 U;  2CDX A;  3NH7 A;  1JGK A;  3NDS A;  1NXB A;  1IDL A;  1KU6 B;  3ERA A;  2BTX A;  2QC1 A;  1HC9 A;  5IMY C;  2UWR A;  2MUO A;  1CXO A;  5EBX A;  1L4W A;  4ZQY A;  1HC9 B;  4BIK B;  1JBD A;  2MHY A;  4BDT B;  2MJ4 A;  3HH7 A;  1QKE A;  1ONJ A;  1FSC A;  3KFD I;  2PJY C; 
#chains in the Genus database with same CATH topology
 3NEQ A;  2H7Z A;  1JE9 A;  6EBX A;  2QJB C;  1ERG A;  2H7Z B;  5DZ5 A;  1IDG A;  1FRA A;  2K3G A;  1NEA A;  4OM4 A;  4XJJ A;  2H62 D;  1CDR A;  1CDQ A;  2L03 A;  1NYS A;  1S4Y A;  2CRT A;  1BTE A;  1FF4 A;  1MR6 A;  2LA1 A;  4QTI U;  3BT1 U;  4RUD A;  2NBT A;  1CDS A;  1F8U B;  1NYU A;  1LJZ A;  4IYE A;  1G6M A;  1FAS A;  3EBX A;  3PLC A;  1VB0 A;  2N99 A;  1CDT A;  1KL8 A;  4P7U A;  5DO6 A;  1H0J A;  1CTX A;  2H62 C;  2ERA A;  1REW C;  1BXP A;  1NTN A;  3BT2 U;  1CB9 A;  1LXG A;  5DU1 A;  2MJ0 A;  2BHI A;  1QM7 A;  4LFT A;  1FSS B;  1CVO A;  1ABT A;  1COD A;  1KC4 A;  1LSI A;  4HQP F;  2ABX A;  1UG4 A;  1HOY A;  1M9Z A;  2H64 B;  1KFH A;  3KFD E;  1DRS A;  1CRE A;  1ZAD A;  1HAA A;  1IQ9 A;  1IDI A;  2L5S A;  2FD6 U;  2HLR A;  1KTZ B;  3FEV A;  3QB4 B;  2CTX A;  2X8B B;  2CRS A;  2LCR A;  3EVS C;  1RGJ A;  1KS6 A;  4FAO C;  2GOO B;  1ERA A;  1COE A;  1CXN A;  1NOR A;  2CCX A;  2H64 C;  2J8B A;  4FAO E;  4UY2 C;  2VLW A;  1FFJ A;  2H8U A;  4EY8 B;  1KBA A;  1KBT A;  1LX5 B;  2MJY A;  2H5F A;  1XT3 A;  2UX2 A;  1IDH A;  2MUP A;  1V6P A;  1YWH A;  1F94 A;  2JVE A;  3U74 U;  4DO8 A;  5IMT D;  1KXI A;  1NTX A;  1TGX A;  1LXH A;  1IK8 A;  1ES7 B;  2QJA C;  1B41 B;  2JQP A;  2GOO C;  2I9B E;  1W6B A;  1CHV S;  2HLQ A;  3LAQ U;  2PJY B;  4OM5 A;  3VTS A;  1IKC A;  1I02 A;  1TFS A;  2MFA A;  1CRF A;  2QJ9 C;  1TXA A;  1KBS A;  1TXB A;  1MAH F;  4AEA A;  1IJC A;  1QKD A;  1RL5 A;  1HAJ A;  1PLO A;  2OFS A;  1CCQ A;  3U73 U;  2CDX A;  3NH7 A;  1JGK A;  3NDS A;  4KSN A;  1NXB A;  1IDL A;  1KU6 B;  3ERA A;  2BTX A;  2QC1 A;  1HC9 A;  5IMY C;  2UWR A;  2MUO A;  1CXO A;  5EBX A;  1L4W A;  4ZQY A;  1HC9 B;  4BIK B;  1JBD A;  2MHY A;  4BDT B;  2MJ4 A;  3HH7 A;  1QKE A;  1ONJ A;  1FSC A;  3KFD I;  2PJY C; 
#chains in the Genus database with same CATH homology
 3NEQ A;  2H7Z A;  1JE9 A;  6EBX A;  2QJB C;  1ERG A;  2H7Z B;  5DZ5 A;  1IDG A;  1FRA A;  2K3G A;  1NEA A;  4OM4 A;  4XJJ A;  2H62 D;  1CDR A;  1CDQ A;  2L03 A;  1NYS A;  1S4Y A;  2CRT A;  1BTE A;  1FF4 A;  1MR6 A;  2LA1 A;  4QTI U;  3BT1 U;  4RUD A;  2NBT A;  1CDS A;  1F8U B;  1NYU A;  1LJZ A;  4IYE A;  1G6M A;  1FAS A;  3EBX A;  3PLC A;  1VB0 A;  2N99 A;  1CDT A;  1KL8 A;  4P7U A;  5DO6 A;  1H0J A;  1CTX A;  2H62 C;  2ERA A;  1REW C;  1BXP A;  1NTN A;  3BT2 U;  1CB9 A;  1LXG A;  5DU1 A;  2MJ0 A;  2BHI A;  1QM7 A;  4LFT A;  1FSS B;  1CVO A;  1ABT A;  1COD A;  1KC4 A;  1LSI A;  4HQP F;  2ABX A;  1UG4 A;  1HOY A;  1M9Z A;  2H64 B;  1KFH A;  3KFD E;  1DRS A;  1CRE A;  1ZAD A;  1HAA A;  1IQ9 A;  1IDI A;  2L5S A;  2FD6 U;  2HLR A;  1KTZ B;  3FEV A;  3QB4 B;  2CTX A;  2X8B B;  2CRS A;  2LCR A;  3EVS C;  1RGJ A;  1KS6 A;  4FAO C;  2GOO B;  1ERA A;  1COE A;  1CXN A;  1NOR A;  2CCX A;  2H64 C;  2J8B A;  4FAO E;  4UY2 C;  2VLW A;  1FFJ A;  2H8U A;  4EY8 B;  1KBA A;  1KBT A;  1LX5 B;  2MJY A;  2H5F A;  1XT3 A;  2UX2 A;  1IDH A;  2MUP A;  1V6P A;  1YWH A;  1F94 A;  2JVE A;  3U74 U;  4DO8 A;  5IMT D;  1KXI A;  1NTX A;  1TGX A;  1LXH A;  1IK8 A;  1ES7 B;  2QJA C;  1B41 B;  2JQP A;  2GOO C;  2I9B E;  1W6B A;  1CHV S;  2HLQ A;  3LAQ U;  2PJY B;  4OM5 A;  3VTS A;  1IKC A;  1I02 A;  1TFS A;  2MFA A;  1CRF A;  2QJ9 C;  1TXA A;  1KBS A;  1TXB A;  1MAH F;  4AEA A;  1IJC A;  1QKD A;  1RL5 A;  1HAJ A;  1PLO A;  2OFS A;  1CCQ A;  3U73 U;  2CDX A;  3NH7 A;  1JGK A;  3NDS A;  4KSN A;  1NXB A;  1IDL A;  1KU6 B;  3ERA A;  2BTX A;  2QC1 A;  1HC9 A;  5IMY C;  2UWR A;  2MUO A;  1CXO A;  5EBX A;  1L4W A;  4ZQY A;  1HC9 B;  4BIK B;  1JBD A;  2MHY A;  4BDT B;  2MJ4 A;  3HH7 A;  1QKE A;  1ONJ A;  1FSC A;  3KFD I;  2PJY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...