1UG4A

Crystal structure of cardiotoxin vi from taiwan cobra (naja atra) venom
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
b'LKCNQLIPPFYKTCAAGKNLCYKMFMVAAPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxin 6
publication title Structural difference between group I and group II cobra cardiotoxins: X-ray, NMR, and CD analysis of the effect of cis-proline conformation on three-fingered toxins.
pubmed doi rcsb
molecule tags Toxin
total genus 11
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2003-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ug4A00
1KXIA 4BIKB 2ABXA 1FFJA 3KFDI 1JBDA 1IDGA 1XT3A 2GOOC 1IDLA 2CTXA 3U74U 2CCXA 2LCRA 2MFAA 1TFSA 2K3GA 1HC9A 4IYEA 1BTEA 1IKCA 2H64C 2CDXA 1NTNA 1ERAA 1F94A 2JVEA 4OM5A 3VTSA 1NORA 4BDTB 1TXAA 1G6MA 1KU6B 1LXGA 1CDQA 1QKDA 3NH7A 1NYSA 1W6BA 4P7UA 3EVSC 2PJYB 3NDSA 1ERGA 4FAOE 1FSCA 2FD6U 5IMYC 2MUOA 2BTXA 2MJ4A 5IMTD 1IDIA 4UY2C 1KFHA 2H7ZB 2H62C 1QKEA 1QM7A 1LSIA 1CTXA 1CRFA 2LA1A 3U73U 1NXBA 2JQPA 1KBSA 2BHIA 4ZQYA 2L5SA 1CREA 1RL5A 1IJCA 2MHYA 1CCQA 3BT2U 1LX5B 2QJAC 2CRSA 3ERAA 2OFSA 2GOOB 2H5FA 1KL8A 5EBXA 1KTZB 1HC9B 1LJZA 1NTXA 1ZADA 1IQ9A 1PLOA 1UG4A 4XJJA 1DRSA 2J8BA 1MAHF 2H64B 4RUDA 2MJYA 3PLCA 1CDRA 6EBXA 1FF4A 4LFTA 1CXNA 1LXHA 1TGXA 4DO8A 4FAOC 1V6PA 5DO6A 1ES7B 2UX2A 1JGKA 1FSSB 4OM4A 1KBTA 1CB9A 1CODA 1NEAA 1FRAA 2H62D 3BT1U 4QTIU 1FASA 1IK8A 1REWC 2ERAA 2L03A 2X8BB 1HAAA 2HLQA 1CDSA 4EY8B 1IDHA 1HAJA 2QJ9C 2UWRA 1CXOA 1MR6A 2I9BE 1M9ZA 1BXPA 1F8UB 2MUPA 2VLWA 4AEAA 2MJ0A 2CRTA 5DU1A 2PJYC 1JE9A 1RGJA 3FEVA 5DZ5A 1S4YA 1YWHA 1NYUA 2N99A 3QB4B 2HLRA 1KS6A 3NEQA 1HOYA 1TXBA 3HH7A 1ABTA 1I02A 2QC1A 3LAQU 4HQPF 1CDTA 2QJBC 2H7ZA 1CVOA 2NBTA 1KC4A 1COEA 1ONJA 3EBXA 3KFDE 1CHVS 1KBAA 2H8UA 1L4WA 1B41B 1VB0A 1H0JA
chains in the Genus database with same CATH superfamily
1KXIA 4BIKB 2ABXA 1FFJA 3KFDI 1JBDA 1IDGA 1XT3A 2GOOC 1IDLA 2CTXA 3U74U 2CCXA 2LCRA 2MFAA 1TFSA 2K3GA 1HC9A 4IYEA 1BTEA 1IKCA 2H64C 2CDXA 1NTNA 1ERAA 1F94A 2JVEA 4OM5A 3VTSA 1NORA 4BDTB 1TXAA 1G6MA 1KU6B 1LXGA 1CDQA 1QKDA 3NH7A 1NYSA 1W6BA 4P7UA 3EVSC 2PJYB 3NDSA 1ERGA 4FAOE 1FSCA 2FD6U 5IMYC 2MUOA 2BTXA 2MJ4A 5IMTD 1IDIA 4UY2C 1KFHA 2H7ZB 2H62C 1QKEA 1QM7A 1LSIA 1CTXA 4KSNA 1CRFA 2LA1A 3U73U 1NXBA 2JQPA 1KBSA 2BHIA 4ZQYA 2L5SA 1CREA 1RL5A 1IJCA 2MHYA 1CCQA 3BT2U 1LX5B 2QJAC 2CRSA 3ERAA 2OFSA 2GOOB 2H5FA 1KL8A 5EBXA 1KTZB 1HC9B 1LJZA 1NTXA 1ZADA 1IQ9A 1PLOA 1UG4A 4XJJA 1DRSA 2J8BA 1MAHF 2H64B 4RUDA 2MJYA 3PLCA 1CDRA 6EBXA 1FF4A 4LFTA 1CXNA 1LXHA 1TGXA 4DO8A 4FAOC 1V6PA 5DO6A 1ES7B 2UX2A 1JGKA 1FSSB 4OM4A 1KBTA 1CB9A 1CODA 1NEAA 1FRAA 2H62D 3BT1U 4QTIU 1FASA 1IK8A 1REWC 2ERAA 2L03A 2X8BB 1HAAA 2HLQA 1CDSA 4EY8B 1IDHA 1HAJA 2QJ9C 2UWRA 1CXOA 1MR6A 2I9BE 1M9ZA 1BXPA 1F8UB 2MUPA 2VLWA 4AEAA 2MJ0A 2CRTA 5DU1A 2PJYC 1JE9A 1RGJA 3FEVA 5DZ5A 1S4YA 1YWHA 1NYUA 2N99A 3QB4B 2HLRA 1KS6A 3NEQA 1HOYA 1TXBA 3HH7A 1ABTA 1I02A 2QC1A 3LAQU 4HQPF 1CDTA 2QJBC 2H7ZA 1CVOA 2NBTA 1KC4A 1COEA 1ONJA 3EBXA 3KFDE 1CHVS 1KBAA 2H8UA 1L4WA 1B41B 1VB0A 1H0JA
chains in the Genus database with same CATH topology
1KXIA 4BIKB 2ABXA 1FFJA 3KFDI 1JBDA 1IDGA 1XT3A 2GOOC 1IDLA 2CTXA 3U74U 2CCXA 2LCRA 2MFAA 1TFSA 2K3GA 1HC9A 4IYEA 1BTEA 1IKCA 2H64C 2CDXA 1NTNA 1ERAA 1F94A 2JVEA 4OM5A 3VTSA 1NORA 4BDTB 1TXAA 1G6MA 1KU6B 1LXGA 1CDQA 1QKDA 3NH7A 1NYSA 1W6BA 4P7UA 3EVSC 2PJYB 3NDSA 1ERGA 4FAOE 1FSCA 2FD6U 5IMYC 2MUOA 2BTXA 2MJ4A 5IMTD 1IDIA 4UY2C 1KFHA 2H7ZB 2H62C 1QKEA 1QM7A 1LSIA 1CTXA 4KSNA 1CRFA 2LA1A 3U73U 1NXBA 2JQPA 1KBSA 2BHIA 4ZQYA 2L5SA 1CREA 1RL5A 1IJCA 2MHYA 1CCQA 3BT2U 1LX5B 2QJAC 2CRSA 3ERAA 2OFSA 2GOOB 2H5FA 1KL8A 5EBXA 1KTZB 1HC9B 1LJZA 1NTXA 1ZADA 1IQ9A 1PLOA 1UG4A 4XJJA 1DRSA 2J8BA 1MAHF 2H64B 4RUDA 2MJYA 3PLCA 1CDRA 6EBXA 1FF4A 4LFTA 1CXNA 1LXHA 1TGXA 4DO8A 4FAOC 1V6PA 5DO6A 1ES7B 2UX2A 1JGKA 1FSSB 4OM4A 1KBTA 1CB9A 1CODA 1NEAA 1FRAA 2H62D 3BT1U 4QTIU 1FASA 1IK8A 1REWC 2ERAA 2L03A 2X8BB 1HAAA 2HLQA 1CDSA 4EY8B 1IDHA 1HAJA 2QJ9C 2UWRA 1CXOA 1MR6A 2I9BE 1M9ZA 1BXPA 1F8UB 2MUPA 2VLWA 4AEAA 2MJ0A 2CRTA 5DU1A 2PJYC 1JE9A 1RGJA 3FEVA 5DZ5A 1S4YA 1YWHA 1NYUA 2N99A 3QB4B 2HLRA 1KS6A 3NEQA 1HOYA 1TXBA 3HH7A 1ABTA 1I02A 2QC1A 3LAQU 4HQPF 1CDTA 2QJBC 2H7ZA 1CVOA 2NBTA 1KC4A 1COEA 1ONJA 3EBXA 3KFDE 1CHVS 1KBAA 2H8UA 1L4WA 1B41B 1VB0A 1H0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KXI A;  4BIK B;  2ABX A;  1FFJ A;  3KFD I;  1JBD A;  1IDG A;  1XT3 A;  2GOO C;  1IDL A;  2CTX A;  3U74 U;  2CCX A;  2LCR A;  2MFA A;  1TFS A;  2K3G A;  1HC9 A;  4IYE A;  1BTE A;  1IKC A;  2H64 C;  2CDX A;  1NTN A;  1ERA A;  1F94 A;  2JVE A;  4OM5 A;  3VTS A;  1NOR A;  4BDT B;  1TXA A;  1G6M A;  1KU6 B;  1LXG A;  1CDQ A;  1QKD A;  3NH7 A;  1NYS A;  1W6B A;  4P7U A;  3EVS C;  2PJY B;  3NDS A;  1ERG A;  4FAO E;  1FSC A;  2FD6 U;  5IMY C;  2MUO A;  2BTX A;  2MJ4 A;  5IMT D;  1IDI A;  4UY2 C;  1KFH A;  2H7Z B;  2H62 C;  1QKE A;  1QM7 A;  1LSI A;  1CTX A;  1CRF A;  2LA1 A;  3U73 U;  1NXB A;  2JQP A;  1KBS A;  2BHI A;  4ZQY A;  2L5S A;  1CRE A;  1RL5 A;  1IJC A;  2MHY A;  1CCQ A;  3BT2 U;  1LX5 B;  2QJA C;  2CRS A;  3ERA A;  2OFS A;  2GOO B;  2H5F A;  1KL8 A;  5EBX A;  1KTZ B;  1HC9 B;  1LJZ A;  1NTX A;  1ZAD A;  1IQ9 A;  1PLO A;  1UG4 A;  4XJJ A;  1DRS A;  2J8B A;  1MAH F;  2H64 B;  4RUD A;  2MJY A;  3PLC A;  1CDR A;  6EBX A;  1FF4 A;  4LFT A;  1CXN A;  1LXH A;  1TGX A;  4DO8 A;  4FAO C;  1V6P A;  5DO6 A;  1ES7 B;  2UX2 A;  1JGK A;  1FSS B;  4OM4 A;  1KBT A;  1CB9 A;  1COD A;  1NEA A;  1FRA A;  2H62 D;  3BT1 U;  4QTI U;  1FAS A;  1IK8 A;  1REW C;  2ERA A;  2L03 A;  2X8B B;  1HAA A;  2HLQ A;  1CDS A;  4EY8 B;  1IDH A;  1HAJ A;  2QJ9 C;  2UWR A;  1CXO A;  1MR6 A;  2I9B E;  1M9Z A;  1BXP A;  1F8U B;  2MUP A;  2VLW A;  4AEA A;  2MJ0 A;  2CRT A;  5DU1 A;  2PJY C;  1JE9 A;  1RGJ A;  3FEV A;  5DZ5 A;  1S4Y A;  1YWH A;  1NYU A;  2N99 A;  3QB4 B;  2HLR A;  1KS6 A;  3NEQ A;  1HOY A;  1TXB A;  3HH7 A;  1ABT A;  1I02 A;  2QC1 A;  3LAQ U;  4HQP F;  1CDT A;  2QJB C;  2H7Z A;  1CVO A;  2NBT A;  1KC4 A;  1COE A;  1ONJ A;  3EBX A;  3KFD E;  1CHV S;  1KBA A;  2H8U A;  1L4W A;  1B41 B;  1VB0 A;  1H0J A; 
#chains in the Genus database with same CATH topology
 1KXI A;  4BIK B;  2ABX A;  1FFJ A;  3KFD I;  1JBD A;  1IDG A;  1XT3 A;  2GOO C;  1IDL A;  2CTX A;  3U74 U;  2CCX A;  2LCR A;  2MFA A;  1TFS A;  2K3G A;  1HC9 A;  4IYE A;  1BTE A;  1IKC A;  2H64 C;  2CDX A;  1NTN A;  1ERA A;  1F94 A;  2JVE A;  4OM5 A;  3VTS A;  1NOR A;  4BDT B;  1TXA A;  1G6M A;  1KU6 B;  1LXG A;  1CDQ A;  1QKD A;  3NH7 A;  1NYS A;  1W6B A;  4P7U A;  3EVS C;  2PJY B;  3NDS A;  1ERG A;  4FAO E;  1FSC A;  2FD6 U;  5IMY C;  2MUO A;  2BTX A;  2MJ4 A;  5IMT D;  1IDI A;  4UY2 C;  1KFH A;  2H7Z B;  2H62 C;  1QKE A;  1QM7 A;  1LSI A;  1CTX A;  4KSN A;  1CRF A;  2LA1 A;  3U73 U;  1NXB A;  2JQP A;  1KBS A;  2BHI A;  4ZQY A;  2L5S A;  1CRE A;  1RL5 A;  1IJC A;  2MHY A;  1CCQ A;  3BT2 U;  1LX5 B;  2QJA C;  2CRS A;  3ERA A;  2OFS A;  2GOO B;  2H5F A;  1KL8 A;  5EBX A;  1KTZ B;  1HC9 B;  1LJZ A;  1NTX A;  1ZAD A;  1IQ9 A;  1PLO A;  1UG4 A;  4XJJ A;  1DRS A;  2J8B A;  1MAH F;  2H64 B;  4RUD A;  2MJY A;  3PLC A;  1CDR A;  6EBX A;  1FF4 A;  4LFT A;  1CXN A;  1LXH A;  1TGX A;  4DO8 A;  4FAO C;  1V6P A;  5DO6 A;  1ES7 B;  2UX2 A;  1JGK A;  1FSS B;  4OM4 A;  1KBT A;  1CB9 A;  1COD A;  1NEA A;  1FRA A;  2H62 D;  3BT1 U;  4QTI U;  1FAS A;  1IK8 A;  1REW C;  2ERA A;  2L03 A;  2X8B B;  1HAA A;  2HLQ A;  1CDS A;  4EY8 B;  1IDH A;  1HAJ A;  2QJ9 C;  2UWR A;  1CXO A;  1MR6 A;  2I9B E;  1M9Z A;  1BXP A;  1F8U B;  2MUP A;  2VLW A;  4AEA A;  2MJ0 A;  2CRT A;  5DU1 A;  2PJY C;  1JE9 A;  1RGJ A;  3FEV A;  5DZ5 A;  1S4Y A;  1YWH A;  1NYU A;  2N99 A;  3QB4 B;  2HLR A;  1KS6 A;  3NEQ A;  1HOY A;  1TXB A;  3HH7 A;  1ABT A;  1I02 A;  2QC1 A;  3LAQ U;  4HQP F;  1CDT A;  2QJB C;  2H7Z A;  1CVO A;  2NBT A;  1KC4 A;  1COE A;  1ONJ A;  3EBX A;  3KFD E;  1CHV S;  1KBA A;  2H8U A;  1L4W A;  1B41 B;  1VB0 A;  1H0J A; 
#chains in the Genus database with same CATH homology
 1KXI A;  4BIK B;  2ABX A;  1FFJ A;  3KFD I;  1JBD A;  1IDG A;  1XT3 A;  2GOO C;  1IDL A;  2CTX A;  3U74 U;  2CCX A;  2LCR A;  2MFA A;  1TFS A;  2K3G A;  1HC9 A;  4IYE A;  1BTE A;  1IKC A;  2H64 C;  2CDX A;  1NTN A;  1ERA A;  1F94 A;  2JVE A;  4OM5 A;  3VTS A;  1NOR A;  4BDT B;  1TXA A;  1G6M A;  1KU6 B;  1LXG A;  1CDQ A;  1QKD A;  3NH7 A;  1NYS A;  1W6B A;  4P7U A;  3EVS C;  2PJY B;  3NDS A;  1ERG A;  4FAO E;  1FSC A;  2FD6 U;  5IMY C;  2MUO A;  2BTX A;  2MJ4 A;  5IMT D;  1IDI A;  4UY2 C;  1KFH A;  2H7Z B;  2H62 C;  1QKE A;  1QM7 A;  1LSI A;  1CTX A;  4KSN A;  1CRF A;  2LA1 A;  3U73 U;  1NXB A;  2JQP A;  1KBS A;  2BHI A;  4ZQY A;  2L5S A;  1CRE A;  1RL5 A;  1IJC A;  2MHY A;  1CCQ A;  3BT2 U;  1LX5 B;  2QJA C;  2CRS A;  3ERA A;  2OFS A;  2GOO B;  2H5F A;  1KL8 A;  5EBX A;  1KTZ B;  1HC9 B;  1LJZ A;  1NTX A;  1ZAD A;  1IQ9 A;  1PLO A;  1UG4 A;  4XJJ A;  1DRS A;  2J8B A;  1MAH F;  2H64 B;  4RUD A;  2MJY A;  3PLC A;  1CDR A;  6EBX A;  1FF4 A;  4LFT A;  1CXN A;  1LXH A;  1TGX A;  4DO8 A;  4FAO C;  1V6P A;  5DO6 A;  1ES7 B;  2UX2 A;  1JGK A;  1FSS B;  4OM4 A;  1KBT A;  1CB9 A;  1COD A;  1NEA A;  1FRA A;  2H62 D;  3BT1 U;  4QTI U;  1FAS A;  1IK8 A;  1REW C;  2ERA A;  2L03 A;  2X8B B;  1HAA A;  2HLQ A;  1CDS A;  4EY8 B;  1IDH A;  1HAJ A;  2QJ9 C;  2UWR A;  1CXO A;  1MR6 A;  2I9B E;  1M9Z A;  1BXP A;  1F8U B;  2MUP A;  2VLW A;  4AEA A;  2MJ0 A;  2CRT A;  5DU1 A;  2PJY C;  1JE9 A;  1RGJ A;  3FEV A;  5DZ5 A;  1S4Y A;  1YWH A;  1NYU A;  2N99 A;  3QB4 B;  2HLR A;  1KS6 A;  3NEQ A;  1HOY A;  1TXB A;  3HH7 A;  1ABT A;  1I02 A;  2QC1 A;  3LAQ U;  4HQP F;  1CDT A;  2QJB C;  2H7Z A;  1CVO A;  2NBT A;  1KC4 A;  1COE A;  1ONJ A;  3EBX A;  3KFD E;  1CHV S;  1KBA A;  2H8U A;  1L4W A;  1B41 B;  1VB0 A;  1H0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...