1UG6A

Structure of beta-glucosidase at atomic resolution from thermus thermophilus hb8
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
426
structure length
426
Chain Sequence
NAEKFLWGVATSAYQIEGATQEDGRGPSIWDAFAQRPGAIRDGSTGEPACDHYRRYEEDIALMQSLGVRAYRFSVAWPRILPEGRGRINPKGLAFYDRLVDRLLASGITPFLTLYHWDLPLALEERGGWRSRETAFAFAEYAEAVARALADRVPFFATLNEPWCSAFLGHWTGEHAPGLRNLEAALRAAHHLLLGHGLAVEALRAAGARRVGIVLNFAPAYGEDPEAVDVADRYHNRFFLDPILGKGYPESPFRDPPPVPILSRDLELVARPLDFLGVNYYAPVRVAPGTGTLPVRYLPPEGPATAMGWEVYPEGLYHLLKRLGREVPWPLYVTENGAAYPDLWTGEAVVEDPERVAYLEAHVEAALRAREEGVDLRGYFVWSLMDNFEWAFGYTRRFGLYYVDFPSQRRIPKRSALWYRERIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Beta-Glucosidase at Atomic Resolution from Thermus Thermophilus Hb8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords beta-glycosidase
total genus 165
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2003-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ug6A00
1M04A 2CITA 5FCZA 3N15A 4WF7A 2ZXBA 4AXNA 1VEOA 4WKFA 3D3AA 4AY1A 1TA3B 1ZU8A 3BAWA 5E70A 2X1IA 1KGWA 1HJVA 3NDZA 2O9RA 2Y5EA 1OIFA 4IM4A 3ARRA 5IFTA 8CGTA 2ZUMA 2WVVB 3F5KA 1E56A 3N04A 3UG3A 1WZLA 1TG7A 5JUVA 4OZOA 1SYTA 3DC0A 1OT1A 1CIUA 1VJZA 2J7CA 1E71M 3FHQA 2IXVA 1HKKA 3ALFA 5EFFA 3FHAA 1ZS2A 3AMDA 3WSUA 1TE1A 4ATWA 2DIJA 2J7BA 5A6BD 4U2YA 1ZBCA 4W7UA 5A6BA 4AD0A 1B30A 4TVUA 1LG1A 1X1NA 3EDDA 1J12A 3GXIA 3II1A 2QPSA 2VCCA 1BQCA 1XCWA 4AD5A 4F8XA 4MNJA 2VRQA 3RILA 4GXPA 2YBUA 2VCAA 2CERA 1HJQA 4CD8A 1DWIM 1WKYA 1TUXA 3KEHA 3L4WA 1O6IA 1HKIA 4J27A 3ZJ7A 3CZGA 2E8YA 2WLYA 1EO7A 1H09A 1QNPA 2JIEA 1H0GA 3PZQA 4P7NA 1C90A 2XGIA 3EMCA 2YLLA 3BC9A 1WCGA 1V0KA 5I2UA 1C92A 4MNKA 4DUWA 4RE3A 5GQBA 2FH8A 2ZUWA 1MFVA 3L4UA 3UESA 2JF6A 1X6NA 3VDCA 2JE8A 4W93A 1BGGA 5DT5A 1XH1A 2A3BA 2YLAA 1E6SM 1W2PA 4J3UA 3RDKA 4M56A 4PYSA 3VU2A 4UQAA 3TA9A 3K1DA 5A8OA 3MKKA 2XTKA 1XC6A 1EIBA 4QP0A 3CZ8A 5A6AA 5HNNA 3SUTA 2FHFA 1UKSA 9CGTA 1E72M 4TXEA 3OGRA 2BY3A 3POCA 2CHNA 4UOJA 1BVNP 3HJEA 4WSKA 2WVTA 4GINA 1UG6A 2YDSA 4RE2A 1UKPA 1J9YA 4J3WA 3CHCA 2NT0A 2VQUA 4RE4A 1JF6A 4H7VA 2AOSA 5CLTA 4UQCA 1UR0A 3AIWA 3CH9A 1EH9A 4DM1A 2VZTA 3ARTA 3WDIA 5BYWA 1MXGA 4AEFA 3VDBA 5M17A 2WMKA 1C8XA 2WWDA 1GZJA 5D9PA 5E09A 2BHZA 5GNXA 5BRQA 2WKLA 3AIRA 3F5LA 4PMZA 3WUGA 1G0CA 1BGAA 3J7HA 1GQKA 5A8NA 3QR3A 4AZIA 4D6IA 4HP5A 4AZ7A 2ZXAA 2J78A 1MW0A 5M5DA 3GBDA 1UZ1A 3NUKA 5I78A 5AYBA 5EMYA 4HPGA 5CG0A 3MV01 2F8QA 3AHZA 4GQRA 2TAAA 2BNJA 3K46A 1AQHA 2UWFA 4EK7A 4UFKA 1UR9A 1XHGA 3QHMA 3PZ9A 4UQDA 1QPKA 3PZVA 1JYWA 2CEQA 1E9LA 5C70A 1CXHA 5A94A 1E6NA 2G4FA 1U2YA 3WBAA 1FFRA 3PZIA 3VINA 2J62A 3NYDA 5AC4A 7TAAA 3D5HA 4BQ3A 1UA3A 4UR9A 3BAJA 3MUAA 2NW0A 5D8WA 2XYLA 1LL7A 2E9LA 1OCQA 1NM9A 3CHEA 4D6HA 3E1F1 5CJ5A 3U57A 5BROA 1ZBVA 1JXKA 1LLOA 2G3JA 1QW8A 4IPLA 3VGDA 4R27A 3MMWA 2W61A 2J75A 3VIJA 5EBAA 2WCGA 1MW3A 4X0NA 3ARZA 1GVIA 3L4ZA 1JNEA 2O9PA 1PIGA 1JI1A 2XM2A 4S3KA 1WPCA 5GNZA 5FL0A 1V3HA 4U5IA 4DWSD 2WBGA 1BPLB 4ZXOA 3ZJ6A 3VIFA 3DYOA 1J0YA 5LA0A 3IAPA 4DWSA 1KCKA 1UR8A 2XVGA 4H8UA 1I1WA 2YL6A 3BSGA 1L8NA 1Q6DA 1OM0A 1CEOA 4AZCB 2XUCA 4BS0A 1LL6A 3WDHA 1B3WA 2YDRA 4E2OA 3WL1A 5A6MA 2BY2A 2OYKA 3MMDA 3GM8A 1UQZA 2WC3A 4U3CA 3WF0A 4Z2HA 1C91A 1UZ4A 3WELA 4W84A 3VD9A 1V3IA 3W25A 3GH7A 1EGZA 3GXDA 2JEQA 3I3DA 4W88A 2OWWA 2DSUA 3MUZ1 4XZWA 4U33A 3WBEA 2WNWA 3VIOA 5C8BB 3AXXA 1B31A 4PUDA 3PTQA 3QGVA 1HF6A 4AWEA 3L4YA 3L2LA 2J74A 4AIEA 1B3XA 4CD6A 2Y2WA 3PZTA 2VOTA 2EO7A 4LGXA 5I0DA 4XUYA 4TX6A 2GDVA 5A6SA 1LJYA 3IANA 2JEPA 3I3BA 3ARYA 1VEMA 5EFDA 3VIIA 4MADA 5ABEA 5DT7A 4U3AA 2DQXA 3AMCA 3FAXA 1V0NA 1AMYA 2W63A 1RH9A 3AISA 2DDXA 3SCPA 3WD1A 2CBUA 3PZOA 3VD5A 2V3EA 4AISA 5E0CA 4K68A 5HPOA 4N42A 3PHAA 1UD4A 2X8RA 3WQWA 5IFPA 2CKRA 2ZX5A 1CBGA 4LYPA 2QLYA 2YOCA 4C7GA 4B15A 1ZJAA 3CMGA 5FKYA 3T2OA 3W38A 3U5YA 4XX6A 1KGUA 1NARA 3ZIZA 2BHUA 4MJ2A 3W29A 1MFUA 4JCLA 3CUFA 3RJXA 1CTNA 1WDQA 2DT1A 2DGAA 3AIUA 4M81A 3WMSA 3LPFA 4TX8A 1XGZA 2WZIA 3IAQA 3CBWA 2XIBA 5E6ZA 1CECA 1BFNA 2VVSA 3FNDA 3W28A 6CGTA 3W4RA 3WDJA 1UHVA 3VX1A 1CGYA 1QNRA 1UH4A 4R5EA 5CSUA 2V5CA 4JFWA 4NF7A 1GOMA 2PWDA 3IJ7A 4A4AA 1F4HA 4URIA 3NJ3A 4A3HA 3THCA 3W82A 3T2PA 3EYPA 4M82A 3AS1A 3A6OA 3UCQA 5A8PA 1J0KA 2ZE0A 1TFVA 1FHLA 1Z32X 1HN1A 4UOZA 4CN4A 5CLWA 4EANA 5ABGA 4CD7A 1O7AA 1UD2A 1V08A 4AZ5A 4D6JA 4F79A 3WF4A 4UQEA 4BQ5A 2XFYA 1PX3A 3WDRA 1CXLA 3AHVA 5CPQA 3EDFA 2ZXQA 4HA1A 1EDGA 3N11A 3KE0A 3W27A 1UR4A 1GQIA 2BFGA 4OKDA 2J7EA 3T09A 4HTYA 3VDHA 3QOMA 4UFMA 4ZENA 3WD0A 1H1NA 4IUGA 2J79A 1NP2A 2VL4A 1QI4A 3WQ5A 1A47A 1EO5A 5A6LA 1OD0A 2QF8A 3OB8A 1F4AA 1OD8A 1TVPA 2EBNA 1JD9A 2YKKA 1G01A 4BCEA 1B3ZA 2PC8A 2PB1A 4MJ4A 2XWEA 1NQ6A 4PCTA 2ZUUA 1US2A 1D2KA 1BYAA 2OYMA 5HXMA 4CU6A 4GKLA 3WH7A 2XVNA 1RD6A 1W1PA 3N12A 5A69A 4QCEA 3EDEA 2MANA 3PZMA 2J7FA 3ZM8A 2XFFA 1U30A 4FLRA 1P6WA 3BCDA 3GH4A 2OSXA 3GBEA 3EMQA 1E6XM 4M29A 4EE9A 1E6QM 1W9UA 1XYZA 4U5KA 1NWTA 3ARQA 1HL8A 3AICA 2CBJA 3B8SA 1HKJA 4QLJA 4QAWA 4IISA 5BXTA 3WY1A 2UY3A 2VT0A 3WN6A 3ECQA 1EDTA 1GONA 2PWEA 2XJ7A 1HL9A 2VX4A 4MB3A 4Z2JA 5BXSA 4UZSA 1C93A 3WFZA 2ZUVA 1EHAA 2ZOXA 3EDJA 3K8KA 4TUFA 4JFVA 2WMGA 4MDOA 1WE5A 4LYQA 4PMRA 3ZJ8A 4PSPA 1ODUA 4M24A 2J4GA 3WH6A 1JZ5A 1BF2A 3AMLA 3K8LA 3ZQ9A 5I3DA 5AC5A 1V0MA 1VBRA 4JKMA 3CZJA 1UWQA 3WNNA 3W6LA 3F4VA 3RM8A 1US3A 3KL0A 5AYIA 1E1EA 1QHZA 4D6CA 3VIKA 3SCNA 1HNYA 3WNLA 3ALGA 3RM4A 4PMQA 3TTQA 2GFTA 1I1XA 1N82A 1KWKA 4CGTA 4U31A 2W4XA 2BS9A 1YQ2A 4FMVA 3ARWA 3M6DA 4AYSA 4XZBA 3CLWA 3B9AA 1DP0A 4Y7EA 2GUYA 5IHSA 3PTKA 1R87A 1E5JA 5HBFA 3LPGA 2DSKA 4WLCA 4JAWA 2D0GA 3M07A 4V2XA 2GJPA 3UR7A 2ZX7A 4P8XA 2W92A 1H2JA 4HA4A 3PBGA 5LYRA 1U33A 2WMJA 1BAGA 3WD3A 4Z2KA 3W26A 3VD3A 3BLKA 3MANA 3M46A 3VM7A 4WSJA 3AYSA 4H2CA 2CESA 4CCCA 4JFTA 4HOZA 4AZ6A 4PRWA 4YN5A 1KQZA 2UY4A 1GHRA 3W0KA 1CPUA 5D9MA 3CGTA 4QLKA 2GJXA 4W87A 1W1VA 5A6KA 1QI0A 1TR1A 4DUXA 1ZBKA 1V3LA 1OGBA 1XV8A 1Q6FA 4AZCA 1NWRA 1QI5A 4P8WA 4PCSA 1VFOA 4ACZB 1CXFA 2EEXA 3AIVA 3EDKA 4PBGA 1E5NA 4XV0A 3AIBA 3VGBA 2XM1A 2YDQA 3OLGA 4X0VA 1GOKA 4D6EA 1H49A 3BMWA 3AFBA 2Y8KA 1LF1A 2G3IA 1ISZA 1WDSA 5M3WA 2E0PA 1OIMA 3NDYA 4AZGA 4UFJA 1IV8A 1V6XA 2JF7A 2WHLA 2PWFA 3ZT6A 4ZE4A 1CGUA 1M01A 4MNMA 1LWHA 3APGA 1CGVA 1OWQA 4FLSA 2WMHA 4XB3A 1CGXA 2EQDA 3AZRA 2VR5A 4QLLA 1XH0A 1K6AA 1LQ0A 3VNZA 2O9OA 1BYCA 2VI0A 3VILA 1FH8A 2A3HA 2XFRA 3CZLA 2FHCA 1HVXA 1W3LA 2XSAA 2GK1B 2VRKA 2WYSA 3SCWA 3VTRA 3SCRA 3GDBA 4EKJA 2C0HA 5I79A 1SMDA 5HDRA 2WPGA 4QDMA 3VGGA 4PN2A 1WAWA 3BXWA 4KRTA 2WMIA 1E0VA 1GQJA 4IPNB 1EQPA 1JZ6A 1JYVA 2OWCA 4U2ZA 2A3EA 4UZUA 1L0PA 3VPLA 1NOFA 4TVCA 3UETA 4PTWA 1J0ZA 2ZX6A 2XIIA 4PTVA 5A6JA 1GPFA 3BLPX 1PX4A 3MV11 4CD5A 1MWOA 1G5AA 2D22A 2VC9A 5DFAA 3RMEA 1V3KA 4L4PA 4GIAA 4D71A 2WHKA 3ZO9A 1GNXA 2J8FA 5A2AA 1UWTA 3OGVA 3ZT5A 1BTCA 2GSJA 2FHBA 3S2CA 4WIWA 4F9DA 4DM2A 1HP5A 2DPEA 2V38A 4PUEA 2A3AA 1MVYA 2EPKX 1B3VA 1KWGA 5C71A 2E3ZA 1KQYA 3DECA 2CYGA 3WMBA 4PMNA 2Y24A 2VUYA 3VDAA 2J7GA 1KBBA 1ISXA 1GOWA 1QW9A 1E43A 1Y7VA 2X0HA 2HISA 3NCOA 1VENA 2AMGA 1DWGM 4KGLA 1GQLA 5DEZA 3ZSSA 3IK2A 3T2QA 1W9VA 3VGFA 4ACYA 1BVZA 3AHYA 4KMQA 3WUBA 2F61A 4HMDA 1ZL1A 1ZJBA 5BCAA 5FOOA 6TAAA 2DIEA 4HMCA 1W32A 4AD1A 3AZSA 4UFLA 2BVTA 3T0DA 2WB5A 1WZAA 1E4MM 1VFFA 3ARSA 4P8UA 1Q6EA 1W3KA 4D6DA 4GZJA 4P7OA 1W9XA 2CXGA 1UOKA 3U7VA 1C7TA 4UQ9A 1E4LA 1QI2A 5I6SA 3TTYA 3CMJA 1QOXA 3WQ4A 3RCNA 1ZBWA 3PN8A 3N9KA 5ABFA 1G9HA 1C7SA 4ML4A 4PEEA 3N18A 4W7VA 4UQBA 1H3GA 5BRPA 1HX0A 4AD3A 1KXHA 1H4PA 4OBSA 1DTUA 1VAHA 1J10A 3VNYA 1EOKA 4GI8A 2X0YA 2PBGA 4H41A 5ABHA 1DEDA 2DEPA 5E9AA 4LYRA 2XWDA 1VFMA 2ZIDA 2PWHA 2VX5A 2XHYA 4B9YA 1IZKA 4GZEA 3JUGA 4PSRA 2IXUA 2WC4A 4CKQA 3WQVA 3SUSA 2E9MA 3T0AA 1GW1A 2VZOA 3LPOA 2D0FA 3GNRA 2OSWA 1MW2A 2V3FA 2WSKA 3GZAA 3MSGA 1FA2A 3VMNA 2YBTA 3FW6A 1MQRA 4LX4A 4CN6A 1CNVA 3SCSA 5JBDA 1W3HA 2DSZA 3AS0A 2QMKA 1DWJM 2CCRA 2CBIA 4PMUA 3K4AA 1XSIA 3N1AA 1JFHA 2GJRA 1E55A 2E40A 5GPRA 1E0WA 3GTNA 1FHDA 3IJ8A 1E70M 1CENA 1C3FA 2DH3A 3OZPA 1GUVA 4ACZA 1V02A 1CGWA 2GDUA 1KGXA 1BYDA 3WDQA 2VQTA 2C8NA 4GO8A 4MAZA 1UWSA 5TD4A 4MTVA 4L4OA 1E6PA 2ESCA 1TA3A 2EXOA 1ISYA 4W8LA 1VB9A 4JCMA 1IZJA 2BXYA 3G6LA 3OLDA 2QPUA 3UG5A 3AQUA 1IT0A 2WZEA 4Q7NA 1UKTA 3WIJA 1W9PA 4HZ8A 2NT1A 1HT6A 3VGEA 1HIZA 3ZT7A 1CLVA 3GNOA 4C7FA 3NSXA 2JIWA 4W5ZA 1V0LA 2RGLA 1OGGA 4MB1A 3FAWA 1D3CA 2CETA 1VJSA 3SEPA 1JI2A 4J3XA 2ZX8A 1FOBA 3AMGA 4WJXA 1E0XA 1TCMA 5I5RA 1B9ZA 3WMCA 3SCTA 3WNKA 2WVVA 1JFXA 4J3VA 4QFUA 1PBGA 1E4IA 2VJXA 1WO2A 1E15A 1CLXA 1AQMA 3AS2A 5A2BA 2WBKA 3KL5A 3WEMA 1EOMA 1QBBA 3L4XA 3OZOA 4E4PA 1W9DM 1CYGA 1V6WA 3A3HA 3I3EA 4BA0A 2Y8VA 2WHMA 3AHXA 4H8VA 1UD5A 2WXDM 3VIPA 4PMDA 3PZUA 1BG9A 7A3HA 2W62A 4WKAA 1GJUA 1KXQA 5A2CA 5JBEA 1WDRA 2D23A 3WQ6A 1H5VA 1SFSA 1B0IA 2DSWA 4OBRA 3POHA 1XCXA 2BV9A 3OA5A 4UOQA 1KR1A 1TVNA 3K4DA 3FY1A 1B3YA 5CXPA 4D1IA 2VZSA 3VD7A 2FH6A 5HOSA 4W8AA 3L4VA 4YHGA 1JYNA 5KZ6A 1VF8A 1MXDA 1UKOA 2XSBA 4Q22A 2PI6A 4UNIA 3A4AA 2QV4A 3TTOA 3NSMA 2HVMA 2ZUTA 3VOCA 4LXFA 4E8CA 3ZR5A 5JBFA 4V27A 2FDMA 2EPMX 3B9DA 1NWUA 3WH9A 1JZ7A 1HJWA 4DWSB 1JF5A 1FP8A 4MDPA 1W1YA 4GO9A 3TOPA 3DHUA 1E3XA 4FK9A 3PTMA 4AC1X 2XG9A 3A4XA 3VKKA 7CGTA 4EAMA 4E8DA 2DT2A 2J7HA 5IHRA 2YIHA 4YPJA 3AS3A 1OBAA 1B2YA 3GNPA 3QHOA 4FLOA 3RPMA 1HXJA 1JXJA 1UYQA 3S6TA 2X05A 3W24A 4JKKA 3W6MA 4W7WA 3UG4A 4PTXA 5E6YA 5D9OA 5CPTA 3GXFA 8A3HA 2IUZA 5FIPA 3VD4A 5D9NA 3OLEA 4JFUA 3BAXA 2QMJA 4W85A 4AEEA 3RO8A 1JYXA 1QVBA 4QCFA 2WK2A 3SURA 2F2HA 5LA1A 1V02E 1R85A 5I24A 1BLIA 2WSPA 2ZUNA 1RP8A 1CZ1A 1NOWA 1WZMA 2VZVA 2VZUA 4HZ7A 3SUWA 2WLZA 4KH2A 1JDAA 3EBVA 1M03A 4X9YA 2RGMA 3UR8A 5A8MA 5M03A 2WVUA 2EPLX 4LQ1A 3GYCA 3WF1A 2GK1A 3WKZA 3ZMRA 4TTUA 1J11A 3W81A 3ZOAA 4KWUA 1ESWA 2WC7A 1KFWA 1JZ8A 3FN9A 1BYBA 2VVNA 2PF0A 1WP6A 1WZKA 1HVQA 3OIHA 3CO4A 5AY7A 4C7DA 3AZTA 4KGJA 1K9DA 3OBAA 1VRXA 5DMYA 2YL8A 2GVYA 1JDDA 1LL4A 2WVSA 3WH5A 3RM9A 4JHOA 1W3JA 1XD1A 2V5DA 3AYRA 2VO5A 1UWRA 1EQCA 3BMVA 4M8UA 1MQPA 1WDPA 3OGSA 3CTTA 3OLIA 1E6ZA 2WW5A 1KCLA 1UR1A 4ATLA 3VGHA 3QOKA 2V3DA 1B90A 1HJSA 3WL0A 1R7OA 1V6YA 5CQ1A 3RJYA 3WNOA 5A95A 4MNLA 4AZHA 2EPOA 1UD8A 4JHZA 3KZSA 3WDPP 3WENA 4W89A 2W66A 3O9NA 3CUJA 3GXMA 2W91A 1PZ2A 4WKHA 1G94A 3BAIA 1V6VA 1PIFA 5HPCA 3CUGA 4ZXLA 2WAGA 4DUVA 3ARUA 1S46A 2VNCA 1FP9A 2OWXA 2D20A 4MPKA 4HMEA 2ZXDA 4B9ZA 4PMOA 1PJ9A 3EMZA 1XRVA 1VEPA 3VIMA 2D3NA 4PMYA 1VIWA 2EPNA 1QNSA 2W5FA 4UFIA 1M53A 4JKLA 1QNQA 1JZ2A 1PEZA 1CXEA 3CHFA 1XYFA 2BY0A 2WANA 3VMPA 2WHJA 4UTFA 2W67A 4CCEA 1GOIA 3PZNA 2Z1SA 3ZJKA 3K8MA 1ITCA 2AAAA 5CPSA 1RPKA 4HZ6A 2UY5A 2VTFA 3CUHA 3GH5A 4M80A 2WCAA 4MB4A 1FH9A 1CDGA 1E73M 1PX8A 4ZEPA 2G8ZA 4AIUA 3WFLA 3HU7A 3BSHA 1AVAA 1DWFM 2YL9A 5KEZA 1EXPA 2E8ZA 2JALA 1QI3A 4GI6A 4A3YA 2ZUSA 4JL1A 2D0HA 3SCUA 3AXHA 4ATDA 1UR2A 2XVLA 1KXTA 1ISWA 4NRRA 1AQ0A 4GQQA 4TOQA 2YL5A 2UY2A 1H41A 3AI0A 2OYLA 4D6FA 4CUCA 2VMFA 4GPNA 1UA7A 4D1JA 5IXEA 3TONA 4AIOA 1HJXA 4CVWA 1GORA 2YA1A 1UD3A 3UERA 3T0BA 2XPKA 5DO8A 3N13A 2WCSA 3BH4A 2FGLA 2GJXB 4MAVA 1JL8A 3LPPA 3O2LA 4P7LA 4Z2LA 4FLQA 1KB3A 4F9JA 4DWSC 3MUIA 4JIEA 1QHOA 4HOWA 1PPIA 2A3CA 5CGMA 3WUFA 1K9FA 2CKSA 2WM0A 2DT3A 3AIEA 4CU7A 4CVUA 1JZ3A 1KXVA 3WQ8A 3SCQA 2ZX9A 2D3LA 1TZ7A 4NI3A 3HN3A 1HP4A 3ARXA 5ECUA 1BSIA 3SCVA 4TTGA 4J3SA 1XH2A 2E9BA 2VRJA 2BY1A 2EJ1A 1DWAM 1NH6A 4S3JA 3SCOA 4JFSA 1J0JA 4OIFA 2J47A 3SIMA 1W2VA 1OSEA 3G6MA 4LPCA 4UCFA 4ZFMA 1VFUA 1NP0A 2XVKA 1EHNA 2Z1KA 3THDA 2G3MA 1WNOA 1CWYA 1GCYA 3NIYA 5I23A 2X2YA 4HPHA 4D6GA 3DHPA 3QHNA 1WB0A 1M7XA 2BXZA 1ITXA 4AW7A 5ABFB 4W5UA 3MS8A 5DF0A 4J7RA 1TMQA 3LMYA 3PZGA 3VMOA 3VO0A 1V3MA 1W9BM 1NWSA 4P7QA 4AD2A 1Q6CA 1H11A 5IDIA 4PMVA 4JZ5A 1JNDA 6A3HA 1C8QA 5FD0A 3WNMA 3VM5A 3AROA 2B31A 3BAYA 1LG2A 1UH3A 4H8HA 5GNYA 3MU7A 4HU0A 3RIKA 4V28A 1YHTA 1W91A 2YJQA 5LA2A 2DSVA 4BF7A 3OG2A 1PAMA 4OOZA 5E0FA 4OJYA 3BAKA 5JIPA 1JGIA 1GOQA 2ZWZA 5I77A 3KWXA 1MW1A 3M7SA 1DHKA 3N17A 4AD4A 1A3HA 1EA9C 1CXIA 3F5JA 1BG4A 4OUEA 3U5UA 4N0RA 4P8VA 1D7FA 2Q8XA 4CD4A 1VBUA 3CZKA 1OT2A 5D4YA 1OGSA 4NRSA 1E1FA 2VURA 5F7UA 2WZHA 2PBOA 4F66A 4BQ2A 4UFHA 3WEZA 1ECEA 1LWJA 2WMFA 1W1TA 2CPUA 1K9EA 3CUIA 3IJ9A 4W86A 3BGAA 4KRUA 3WF3A 4OOUA 2BVDA 4RL3A 2VX6A 1J01A 5BXRA 4NSBA 4AMCA 4D72A 4WK9A 3DYPA 1JAKA 3A4WA 3VUPA 2D1ZA 3UEQA 1E4NA 1XD0A 2G41A 1SR0A 1QBAA 1UQYA 5FL1A 1HJUA 2E4TA 2QHAA 2XVPA 4TVDA 3T08A 3BCFA 2D24A 2WWCA 5A3HA 4HU8A 2DH2A 4H04A 1R86A 2BHYA 5A1AA 2BVYA 2FGZA 3CPUA 3VVGA 1R7AA 4HA3A 5CZKA 4BQ4A 1MQQA 3DYMA 3L2MA 1V6UA 3SUVA 5BXPA 3WD2A 2J25A 3AMKA 4ZE5A 3MO4A 4JL2A 2NSXA 4PTMA 1KBKA 1ISVA 1J18A 2VX7A 5CSYA 1JD7A 4NZCA 3AXIA 3TTSA 2CNCA 3ZSTA 2D2OA 3A47A 4YHEA 1FH7A 1G1YA 3NSNA 1JAEA 1JDCA 4CCDA 2WKGA 1UH2A 5A8QA 1QHPA 3AOFA 4FF5A 3VX0A 1QNOA 4CU8A 3MUY1 4B3LA 3KL3A 1OB0A 1UKQA 1CGTA 2Y4SA 3W37A 2O92A 3WH8A 3VIGA 1HKMA 3ARPA 1ZB5A 2DT0A 2XGBA 3CHDA 1UWUA 2CHOA 1K9TA 5EB8A 3VIHA 1GOOA 3HMCA 2C7FA 3WUEA 1UUQA 3CZEA 2JFEX 4W8BA 4Z2IA 2OLHA 4J28A 1FFQA 3FXYA 4MB5A 1BHGA 4B3KA 3AIQA 1H0IA 1X6LA 2J77A 1SMAA 1Q6GA 3AHTA 3SUUA 2J8GA 2ZWYA 3B9EA 1Q4NX 1EDQA 1OINA 1UWIA 3W53A 1E40A 1E3ZA 4B16A 1J0HA 5BWFA 4CN1A 1CXKA 1GHSA 1JZ4A 1MYRA 5JIWA 2WMIB 1XSKA 4AZBA 2ZICA 4HOXA 1E6RA 4Z2GA 1ODZA 1UD6A 3WD4A 1JG9A 3MSDA 1PZ3A 3WF2A 2YA0A 1V3JA 2YA2A 5D8ZA 1KR0A 4GZIA 2CBVA 1C8YA 1XSJA 3CIVA 4PMXA 1V03A 1NOUA 3MMUA 1I75A 4GI9A 2G3NA 1B1YA 2X09A 2OSYA 3U7BA 1J0IA 4M1RA 4BZYA 1RP9A 1GVYA 3ARVA 1JIBA 3ZR6A 4P7RA 3WEOA 2J7DA 3L4TA 3TP4A 5CGTA 4J3TA 2PWGA 3WNPA 2O9TA 3AJ7A 2VCBA 2CIPA 2V3GA 3O6AA 1DWHM 1R8LA 2VR4A 1GJWA
chains in the Genus database with same CATH superfamily
2CITA 5FCZA 4KBXA 3N15A 4HQVA 4WF7A 4IMFA 1QPNA 2GGHA 3EXSA 3D3AA 3NFUA 2ZTJA 3QGAC 4AFYA 4GRSA 3CB8A 1QPOA 1KGWA 1VYPX 4FOJA 3LXBA 3OVRA 3C4UA 1SZGA 2HPIA 4UXDA 3F5KA 3UG3A 1E56A 5IM51 1AW2A 5BWAA 3GG0A 5DMMA 2RKXA 4C6NA 2ONEA 1AMKA 1VJZA 1UP3A 1E71M 4JIIX 3FHQA 5REQB 1ZP4A 1HKKA 1ZZMA 1NDZA 2PLCA 3FHAA 1AW1A 3T8LA 3WSUA 4US5A 4ATWA 4U2YA 5F4WA 2YZRA 4ZSUA 4AD0A 4P2VA 4TVUA 5JQ9A 3DFOA 1TE6A 1UJQA 3II1A 2Y61A 1XCWA 3BZGA 4F8XA 4MNJA 3O6DA 3W6YA 4L1GA 1S1RA 4Z1BA 2AMXA 4E3VA 3K5XA 1Q6OA 1XUUA 2CERA 2J24A 1VS1A 1TUXA 1HKIA 4J27A 2E8YA 3UJEA 4O50A 2INFA 1I2QA 3MDWA 2FTYA 5AKQA 4RV3A 3BG3A 1S38A 4N9EA 5H2ZA 4ZQCA 1V0KA 1VC4A 4KETA 4PL2A 3QN3A 5F1VA 1BKSA 2EHHA 1X6NA 2H6RA 4W93A 2A3BA 1E6SM 2NUXA 2IKGA 3RDKA 1EP2A 5J5DA 1XDLA 3CB3A 4JBRA 5FJTA 3TA9A 4HIBA 1POJA 1XRFA 2ZA3A 2XTKA 4QP0A 1VBGA 3CZ8A 4XZLX 5A6AA 2I9EA 5KTLA 1SZEA 1Z44A 3QQ1A 2Y1HA 2BY3A 1JUKA 4JHMA 4WSKA 1W37A 1WBJA 4FSAA 1UG6A 3CHCA 4J3WA 4DWDA 2VQUA 4RE4A 1H61A 1ZQ5A 6TIMA 3EKZA 4C6QA 1O94A 4D8ZA 1F3TA 1UR0A 3W1NA 3GXNA 4HVXA 5KINA 3CH9A 2WKJA 4HKPA 3GE7A 4DM1A 2VZTA 3ARTA 5BYWA 3DERA 3H2AA 3VDBA 2XFWA 1C8XA 1GZJA 3WG6A 1T99A 5E09A 2BHZA 2QCHA 5AC7A 3WZ0E 3F5LA 2C3ZA 5A8NA 3S9YA 1M6JA 4AZ7A 2PEVA 2NXGA 3KOFA 1B3OA 2C0AA 3OQ8A 5LIYX 4ORMA 1UZ1A 3NUKA 5EMYA 4HPGA 3MHGA 3TXZA 3ZFHA 1SZRA 4EF9A 2O4MA 2TAAA 3FGCA 4ZB5A 1QPKA 1JYWA 3ZYZA 1MO0A 5A94A 2QF7A 4GVFA 3CO8A 5AFDA 1U2YA 3WBAA 3P84A 3R89A 3PZIA 3P7YA 1WAUA 5AC4A 5XIMA 4BFAA 3BAJA 1MXSA 5I3GA 1DKWA 3T81A 3CHEA 4D6HA 2OG9A 3E1F1 3U57A 1VFTA 5EBUA 1JCYA 2DV0A 2YPIA 1ZNNA 1PS9A 2YXOA 2I5QA 4R27A 2WCGA 1L8PA 3BDKA 4HCHA 1VPQA 2PP0A 4PCNA 1YXYA 1JI1A 1LM1A 4S3KA 4XK2A 4ADSA 3C2FA 5GNZA 2NV9A 3LDVA 4MIMA 4O52A 1BPLB 4DLMA 3ZJ6A 3DYOA 2FYMA 4JOMA 3EB2A 1UR8A 2XVGA 3RITA 2OCZA 3P74A 3RUBL 1H1YA 1K03A 3BSGA 1OM0A 4CQBA 2BB0A 2XUCA 1OFEA 3GS6A 1M7JA 1B3WA 5D04C 3VFCA 5A6MA 4M7SA 1V77A 2Q3RA 3B8VA 4K36A 5HAOA 1A5BA 3UD6A 1C91A 4MWAE 1V3IA 5EMJA 2EKCA 3I3DA 2HBXA 2JEQA 1PKYA 3WFAA 1B4KA 1MRQA 2FJUB 2WNWA 3S8HA 2B7NA 3KOYA 2DUAA 1HF6A 3PUDA 4WDWA 1A50A 3PZTA 4JTFA 4HPXA 4LGXA 5AVNA 5I0DA 5C54A 2GDVA 1XDJA 2Y6ZA 1KRMA 5A6SA 2E5BA 1RJQA 2NLIA 2J9XA 3PK7A 5EFDA 5DT7A 1G4TA 4S39A 2DQXA 5HINA 1V0NA 5GVJA 4J40A 4GUFA 4DZHA 3M7WA 1QDSA 2DDXA 3LRMA 3WD1A 1SJAA 3PZOA 3IEBA 4XAFA 1R5YA 3BOLA 3SB0A 1IE7C 4YL2A 2FVLA 2OB3A 3L23A 4F0LA 4N42A 3PHAA 2CZDA 5IFPA 2ZX5A 1CBGA 4RDZA 4DJFC 1ZJAA 2VP8A 3SQMA 4IIBA 4GJ1A 4KF1A 3CUFA 3F4WA 1CTNA 4QG6A 1LZOA 2DT1A 4GE8A 1U5JA 3NDOA 5AZ1A 4M81A 3TYDA 1JDFA 3WMSA 4TX8A 1EYWA 3K2GA 3CBWA 4JX6A 5E6ZA 3W73A 4IP7A 4G1KA 4M5PA 1BRLB 2A7NA 3BPWA 3FNDA 6CGTA 3W4RA 1FWTA 2X1RA 1QNRA 2XISA 4R5EA 2VEGA 4JFWA 1GG1A 3IJ7A 1F4HA 2R8WA 3THCA 2QCDB 4BKNA 2Y5SA 3EYPA 3U4FA 2NX9A 3LX9A 3CV6A 3A6OA 3UCQA 1X96A 1DJWA 2ZE0A 5DX7A 4JX5A 1Z32X 1HN1A 4F0MA 1WA3A 3E3HA 3PBWA 3DFSA 3KTSA 1UD2A 2NXHA 3P0XA 1H63A 2VDHA 1B9BA 1PX3A 1YTEA 1A5KC 1DXFA 3RLGA 1CXLA 4BI6A 3EDFA 2NSOA 1F3WA 4HPNA 3G1SA 3IUDA 2PDGA 4LSBA 1OG6A 2BFGA 3IV8A 3MJYA 5H8MA 1W8SA 3T09A 5JU6A 3QOMA 1TYGA 1YEYA 2GQ9A 4LCRA 3MZ2A 1H1NA 3WD0A 1KTNA 2J79A 4QSHA 2V63A 4IX2A 5A6LA 3SJ3A 3GFXA 4UMBA 3QPYA 4IQDA 4AWUA 2YKKA 4BCEA 3TK7A 3WO8A 2QJNA 1US2A 2PDFA 5HXMA 4CU6A 5H8UA 3CL7A 5B7ZA 4GKLA 2XVNA 3N12A 4G7EB 2XIMA 4ZA0A 2PD9A 2PTZA 3EDEA 4B5TA 3L5MA 5I3FA 2J7FA 3QRHA 1EJXC 4C1NA 1NAL1 3UWQA 1GZ1A 3EMQA 1E6XM 1OC7A 3F03K 3B4YA 1W9UA 1OF8A 2YCEA 4I6VA 3LCWA 3W7GA 3TYAA 4W9TA 3B9NA 1HL8A 1XIIA 3G1YA 1XXXA 4DXKA 1R3SA 3PC0A 2CBJA 3TN5A 1XBXA 1HKJA 4YTSA 2OJPA 4QLJA 3WY1A 2UY3A 2VT0A 4OVXA 1TPDA 4QG9A 1GONA 2C18A 1EJWC 2PWEA 4LF1A 5BXSA 4UZSA 1TZZA 2PUZA 4K8HA 2ZUVA 3EDJA 4TUFA 4JFVA 4REQA 1WE5A 4RZ4A 2FVMA 4Y2WA 5XINA 3CAKA 2J4GA 1JZ5A 5BOEA 2E09A 1BF2A 3QVQA 5I3DA 5AC5A 4JKMA 1YTDA 1P0DA 3SCNA 2NLYA 1HNYA 3UXDA 3RM4A 2GJLA 4ZSTA 4PMQA 2Q01A 4WOQA 1H1ZA 3MI6A 4H7CA 4A21A 2HNEA 3DEQA 3HMJG 1L6SA 4CGTA 1K1DA 4U31A 3TYUA 2PRLA 1SSDA 3G2GA 4AYSA 4B4HA 4G6CA 4YLWA 3IACA 1DP0A 4O1DA 5IHSA 1R87A 3M4HA 1E5JA 3OVGA 3MTWA 3APTA 2QUTA 4PCPA 1HO1A 2D0GA 4DBSA 1GEHA 1H2JA 2Q02A 4HA4A 3NQMA 1E1CB 1BAGA 2DZAA 2OT1A 4GKTA 3BG9A 3VABA 3VD3A 4GQBA 3U48A 3VM7A 4LY8A 3S0CA 4HHPA 3AYSA 2FVKA 2A2IA 1VHNA 4HOZA 8TIMA 1CI1A 2W0UA 3T0CA 4AZ6A 1FWWA 1GHRA 2FZDA 1BSLA 5DY2A 4M6UA 5A6KA 5T8GA 1V3LA 4V33A 4QE4A 2A7PA 3WLJA 1VFOA 1T6MA 4M0XA 3KS6A 3LMZA 4S2BA 2ZDRA 3VKCA 2EEXA 1XLKA 4NNCA 1UBSA 4K1GA 7PTDA 1GOKA 1CLKA 1XBYA 1H49A 5CC7A 3MWCA 2Y8KA 1XGEA 2HE5A 2V5JA 1UC4A 3MP4A 3N4FA 4LBRA 1T96A 2Y5JA 2G3IA 4XO6A 3UNDA 3BLLA 5M3WA 5C5YA 3R8RA 1U83A 4AZGA 1VKFA 3DN5A 4GYJA 1IV8A 1CGUA 2PD5A 1LWHA 2VELA 1W3NA 3HV8A 4XB3A 1CGXA 1Q2SA 3AZRA 1LQ0A 3VNZA 2O9OA 5FF4A 3B0XA 4JEJA 2ZZ3A 2HCVA 2XFRA 1W1IE 2FZNA 3CEUA 1VP5A 1W3LA 2XSAA 1RALA 2CW6A 3B0UX 3SCRA 1XF0A 3PSVA 1C9WA 1RA5A 3WLSA 1TPUA 1G4EA 7ODCA 3GZ3A 3EWBX 2WV8A 5CBIA 1EQPA 3HZ3A 1ONXA 4D8LA 3K4WA 7ENLA 2AL1A 4EACA 4RZ5A 2DUXA 3VPLA 2Z1VA 3UETA 1UW9A 3IIXA 4PTVA 3NURA 3BLPX 3VOIA 4KWSA 4WGHA 5F1UA 1MWOA 4B5NA 1G5AA 3U2CA 1MEHA 3W2LA 3RMEA 3TJXA 4D71A 4HNCA 3C3NA 3EOEA 2WHKA 4ZO7A 3W1XA 2BLEA 2ZZ2A 3M0VA 1PO9A 3PWGA 4OBTA 4WIWA 1HKVA 4DM2A 1HP5A 5M1TA 2DPEA 3FJ4A 2Z24A 2A3AA 1MVYA 4O4VA 2D2GA 2DP3A 2ZZ5A 4C6MA 5C71A 1KQYA 2CYGA 4PMNA 3LCIA 2VUYA 1KBBA 5LHFA 3I7QA 1Z7AA 1E43A 2X0HA 3CMFA 3GU1A 2HISA 2FZBA 3QY7A 3S2MA 2R1PA 2XIJA 1GQLA 3NVTA 5DEZA 3ZSSA 4NKCA 3NQVA 3AHYA 2OU4A 1TPVA 4DI9A 5LIWX 1TPH1 6TAAA 2DIEA 4HMCA 4JNMA 1W32A 4A3QA 3AZSA 4UFLA 1TV2A 3COTA 1WZAA 5CC6A 1YADA 2VEKA 1E4MM 1VFFA 4P8UA 3QQWA 4GZJA 2CXGA 3RLUA 1MUCA 3BE7A 3PY2A 3H2FA 1P1MA 3NWRA 1NQKA 3RCNA 1F3XA 3V0SA 1KA9F 3PN8A 5IBXC 4MFDA 3L0NA 4ML4A 3TSBA 3CASA 4AVNA 4AD3A 4DO4A 2QCEA 2AKMA 1VAHA 4KCTA 4GI8A 3OZYA 4GYPA 4PUJA 4H41A 2J9ZA 4A8IA 5SWUA 1DEDA 2OEKA 5HA7A 5E9AA 3RK8A 2OGYA 1I8JA 1NDVA 2P5NA 4GZEA 5DQPA 3OYXA 3BTNA 3RRAA 2WC4A 1VZWA 5LNVA 3SUSA 2E9MA 2IKHA 2IPFA 3YPIA 3BUVA 2WSKA 3LZ5A 2YBVA 3H22A 1EF2A 3A22A 5FAJA 3VMNA 5G2IA 2I16A 1SFLA 2YBTA 4TX9A 4DBUA 4M1BA 1MQRA 4CN6A 4Y9MA 3SCSA 2PF8A 5FSEC 4A8RA 1HTIA 4S1FA 3W71A 4XVEA 4ERIA 4DXXA 2YFOA 5LZLA 4Z0SA 3W22A 1UMLA 1P7TB 1JFHA 2NQ9A 1E55A 1M5WA 3UQNA 4J2MA 4GUGA 3GTNA 2ACQA 4AY8A 2HE8A 1C3FA 4KEVA 3UWUA 4MKVA 3URBA 1N55A 3OBEA 1CGWA 1KGXA 2C8NA 3BLIA 2R1MA 4MAZA 3UGRA 2EXOA 1ISYA 1PVNA 2INEA 1DV7A 1DORA 3G6LA 1WUEA 3AQUA 1IT0A 2WZEA 5FF0A 5LXXA 2VHLA 5I02A 1HT6A 3VGEA 1A5UA 1HIZA 5KSWA 2YX0A 2NQLA 1B5TA 1CLVA 1YNQA 4MWAD 4LOCA 4DQWA 4KWWA 3V4BA 1VJSA 3P8JA 2ZX8A 4J3XA 4LUTA 1E0XA 5I09A 5TBOA 1B9ZA 3LQGA 3WNKA 4F48A 1JFXA 3TH6A 1PBGA 3UCDA 4E6MA 5HR6A 2I5IA 3AS2A 1U1HA 3M1ZA 1HW6A 3WEMA 1EOMA 1QBBA 4L9ZA 2O55A 4D2JA 4YWIA 3A3HA 3NNTA 4ZQPA 3CLMA 1BD0A 4OGZA 4IICA 4Z1AA 4PMDA 1TV4A 7A3HA 2YW4A 4C90A 4WKAA 1JUEA 2OOFA 1KXQA 5A2CA 3HGSA 5JBEA 4PB4A 1LUCA 3RXZA 3CT2A 3UZZA 2IKIA 2R9RA 4QITA 3K4DA 3UXKA 1XRSA 1B3YA 3TU9A 5CXPA 4D1IA 3AYVA 3BL3A 2QIWA 3L4VA 3N19B 4XTDA 4YHGA 5KZ6A 1VF8A 4R85A 4R88A 1MXDA 1UKOA 1QO5A 1TPB1 3TOYA 3A4AA 5CPOA 4E8CA 3ZR5A 2FDMA 3TDFA 3LNMA 1FP8A 4L80A 4MDPA 1NFBA 3VE9A 2NQJA 4UUIA 2E6FA 4IPIA 2Z2AA 2FKPA 3I65A 3LV5A 3A4XA 3VKKA 7CGTA 3GD6A 5ENLA 4EAMA 4E8DA 3BLFA 5IHRA 2QS8A 3GNPA 1B2YA 5I07A 1M7OA 3RPMA 1CCWB 3OA3A 1SR9A 4HSNA 3S6TA 5EY5A 3W24A 4JKKA 4LNYA 3B8WA 3W6MA 2JK2A 5E6YA 1JCLA 3GXFA 5HMEA 8A3HA 3GC5A 5FIPA 3USZA 3OLEA 2ANUA 3BAXA 3NPWA 4ZBCA 4QHRA 4W85A 4DAIA 3FJ6A 1QVBA 2JBMA 3KAOA 2F2HA 1BLIA 5FEXA 1MEIA 3QW4B 1HL2A 2ZUNA 1WZMA 3OZMA 3SUWA 1M03A 4X9YA 3LNPA 3TJIA 3ZWTA 2Z25A 3JVAA 3GYCA 3VOGA 1PHWA 4Q4KA 4IJBA 2PRHA 1KLZA 3GNDA 3K1GA 3W81A 3S1GA 4KWUA 1UIOA 2DORA 1EF3A 1RJRA 3T42A 1RHCA 1HVQA 4QISA 2ZZ1A 4FOKA 4ZQRA 4GNJA 3TJ4A 4Q7BA 1R9XA 1N2VA 3H8AA 2YL8A 5A5WA 3WH5A 3TX9A 4JTRA 1W3JA 4IXXA 1MQPA 4FPSA 3OGSA 3KM8A 3V5FA 3NQEA 4K8GA 1ME7A 3CTTA 4R3UA 2WNZA 1EYEA 4XTIA 3OLIA 4IQEA 4NJKA 4ATLA 3VGHA 5D2TA 3WL0A 1XQKA 3DFNA 4EX4A 3WNOA 3F7JA 1FDJA 1XLMA 1H5YA 4HMNA 4JHZA 4DJED 4Z1DA 4O15A 3KZSA 3TC3A 4E0CA 4R53A 2W66A 1ADSA 3R8GA 1S2VA 3AXMA 3GXMA 4Z42C 3NQFA 1PZ2A 4WKHA 3BAIA 5E5CA 4O10A 2X7WA 6PTDA 4RW3A 2O56A 4IFKB 4U28A 1HO4A 4IT1A 3BGGA 4HMEA 3AWOA 1US0A 2OKOA 4PMOA 5EKYA 5AYYA 2C1GA 4A6GA 3VIMA 3UVIA 3L0GA 2POZA 2OEMA 3DBPA 1IWPA 2W5FA 1M53A 1Q85A 3UP8A 2C71A 3QV6A 2W67A 1GOIA 3PZNA 2RDTA 2PP1A 5AHIA 3W9ZA 1RPKA 1G4PA 2ZRWA 3NM1A 3GH5A 3TSMA 3QLDA 3N6HA 4Z17A 2HVOA 3S9ZA 4ZCWA 3VNLA 1A5CA 1AVAA 2YL9A 2XN1A 3M44A 2REQB 4F0HA 2JALA 4WOZA 1O12A 2XN0A 5D2XA 4R7WA 2NUWA 5HWNA 1UR2A 1ONWA 4IMCA 3BVJA 4HGXA 3UWEA 4GQQA 4TOQA 3THAA 3O07A 3I6RA 4DIAA 1X8FA 3IV3A 4GIRA 3TLLA 1UA7A 3PFMA 3HG4A 5IXEA 2ZRYA 1HJXA 3RG6A 4CVWA 1JQVA 1UD3A 2F9RA 3KTCA 3T0BA 2DZBA 2XPKA 4LS2A 5DO8A 3N13A 1XIHA 2WCSA 3RCMA 3U0HA 1IXPA 1C8VA 3R2GA 4MAVA 2BSLA 1BTMA 3O2LA 4DF1A 4F9JA 4GD0A 4DWSC 1PPIA 1EJUC 1EEXA 4WCJA 2ZX9A 3HN3A 1SO5A 1KRCC 3QR0A 3PF3A 5B80A 2GVJA 3K13A 1NU5A 3WQOA 1J0JA 1P0NA 4YU1A 5C55A 1TQJA 1R9ZA 3HPXA 3B03A 4J2PA 2FMNA 3G6MA 1RJPA 4ZFMA 1VFUA 1I0BA 1Z48A 4WY0A 3LCGA 1EHNA 3NL6A 1AFSA 3MI3A 4C6DA 3QH2A 3LM7A 4D6GA 3DHPA 3QHNA 1WB0A 1E9YB 1M7XA 1ITXA 4AW7A 4Q4RA 3VMOA 3PZGA 1W9BM 2ZZ6A 3TNBA 1Q6CA 3QW3A 5J5RA 1RA0A 3E5BA 5D2VA 1C8QA 3WNMA 3P5ZA 1T7LA 1K4GA 1UH3A 3MU7A 3FYOA 3PUOA 4HU0A 1XIDA 4GBUA 3RIKA 4QJ1A 3IIOA 1W91A 3TXVA 2DSVA 1SJDA 4H01A 1RZMA 4OQVA 1LQ2A 1LBMA 4GNKB 3HQPA 5E0FA 4OJYA 5CAKA 2G3FA 1ONEA 3KWXA 4A3UA 3W01A 1AW5A 1KV8A 5FA5A 1TJ2A 4HK5A 1A3HA 2PTWA 1BG4A 4UNKA 5L9FA 3IGUA 1ZCOA 4N0RA 4P8VA 1D7FA 4NUWA 1KFLA 3IIZA 1POKA 3XINA 4MZ8A 3CZKA 1JQXA 3CIXA 3TN4A 3WQEA 1OGSA 4OE7A 2NQ5A 1E1FA 5F7UA 3LB0A 1MRAA 4UFHA 1LWJA 4ROQA 1Q4WA 2PDWA 1VFLA 3UA3A 4EPDC 1D3HA 1D7KA 2ZDSA 4S38A 5I3IA 2FB2A 4AMCA 1PTGA 3MT1A 4WK9A 1A0EA 1J79A 3S2NA 3SGGA 4RCXA 2DFAA 1FWFC 3DOPA 1QO2A 1XD0A 2G41A 1SR0A 1QBAA 4WVXA 3PUGA 3G8EA 2QHAA 1RAKA 3RGTA 3BCFA 5AHEA 3C2YA 4KS0A 3W7NA 2WQPA 4IIFA 5A1AA 2BVYA 5MKGB 5HMFA 3DENA 2F84A 3NPVA 3A3WA 3H4XA 1X8CA 3PB0A 2V67A 3MKCA 1V79A 4Q4OA 3WD2A 4LVAA 2GVGA 4KIRA 5AYXA 1KBKA 1J18A 1QFEA 2CNCA 3RX4A 2D2OA 3VKBA 2OTDA 4CNPA 2BTMA 1JDCA 4CCDA 4ES4A 1UH2A 5HQMA 1PSCA 3CH0A 6REQB 4B3LA 1IR2A 4EIVA 4Z0JA 3JS3A 1FUYA 4NJGA 4H7ZA 3W37A 2EF9A 3QZEA 3T4WA 3E0WA 3DC8A 4XUGA 4A29A 3CHDA 3WLHA 1K9TA 4HNVA 4I7WA 4X9SA 5TNVA 1UP0A 3ISIX 5I3JA 4G56A 2F38A 5KZDA 3WUEA 1H7WA 4N7QA 1VBJA 1RK6A 4DZ5A 4E2BA 3VOJA 1S2CA 4J3ZA 4DLFA 1Y5XA 2FQIA 3HG5A 3I6EA 1EJRC 1SMAA 1V93A 3AHTA 2ISDA 2CWXA 3RMJA 3TR2A 2J8GA 2D73A 4O8AA 3O1NA 3B9EA 1DIKA 3W53A 5CKSA 3T55A 4JYEA 4Y96A 1TQXA 1GHSA 4DX3A 1KTCA 4B2DA 5DCEA 3G1AA 1IWAA 2WMIB 1XSKA 2F7FA 4AZBA 4HOXA 1FKWA 4Z2GA 3UPWA 2DW7A 3MSDA 2V5LA 3LZ3A 1LT7A 2GOUA 2YA2A 4LYKA 1Z42A 3BLEA 5J04A 2CBVA 1C8YA 3I10A 1V03A 2HZGA 2Y89A 5DMNA 2GPTA 1SW0A 1UUMA 2XZ7A 3N2TA 4HN4A 1GVYA 1XLIA 3KTXA 2PTYA 1DJXA 1KFBA 4KCVA 4Q4MA 3TIMA 1XX1A 4KWOA 3IIVA 2J7DA 1A0CA 2PDHA 1J96A 4JXCA 5I00A 5FF2A 2RFGA 4J3TA 1JR1A 2ACSA 3AJ7A 2VCBA 2QULA 4JN6A 2YW3A 1GJWA 3R12A 3VIJA 1WQ5A 3K30A 4LS1A 4AXNA 2RJGA 2WJZA 4AX7A 3BAWA 5HNTA 5AC6A 1HJVA 2OODA 1YIXA 3NL2A 4GGHA 1OIFA 4GCXA 5CZ0A 3W7RA 5G5IA 4CQAA 3E6EA 3IRDA 2NUYA 1TG7A 5JUVA 1FQ0A 4NZ3A 4XZNX 2J7CA 4YTUA 3Q4DA 4FO4A 3ALFA 1G69A 1ZS2A 1M3UA 1NTHA 3G8RA 3AMDA 1MZRA 3V0TA 2IQ0A 3PPFA 2J7BA 3OODA 3QKZA 4YTQA 3S5OA 4QNEA 1NVMA 5A6BA 4H6RA 1TUFA 1B30A 3EAUA 3EDDA 1MEWA 2QPSA 4QJ3B 3NAVA 1BQCA 4O12A 3G3DA 2OEJA 2BG5A 2YBUA 1HJQA 1DWIM 3MWAA 2H8ZA 2OPJA 1O6IA 3ZJ7A 3EX6A 3HPZA 3W7CA 1EX1A 1QNPA 1FY6A 3PZQA 5JH2A 3BOXA 4XSLA 3HB9A 3A64A 4G9PA 4IMEA 1EZWA 5I2UA 1C92A 3QXBA 1XLBA 1XYMA 5GQBA 2QAPA 2FH8A 3L4UA 1R3TA 3UESA 3ATZA 1S2TA 2JF6A 4Q6XA 4ILSA 2I7GA 1JDEA 3C2EA 3DG6A 4J3UA 4PYSA 3L21A 2GUBA 4DYEA 3VU2A 2KZHA 5A8OA 5EMKA 2I1OA 2H90A 1AJZA 3BZJA 2ZCGA 1UKSA 3LM3A 1J4EA 3OGRA 4I9AA 3POCA 2CHNA 3HJEA 2BMBA 3UZ5A 1WKDA 1RPXA 2BXVA 2YDSA 3CWHA 3B40A 1L2QA 4B5UA 4H7VA 2QUNA 2GGIA 3W7KA 4DPPA 3MZNA 3KXQA 1EJVC 4DB7A 4ERAA 2PDNA 3HTWA 3NL5A 5M17A 4R7OA 3UXLA 2WWDA 5TQLA 3NVDA 4N02A 3GKAA 1SO3A 4PMZA 2CZ5A 3WUGA 4MGGA 3J7HA 1Q7MA 4D6IA 1MW0A 5M5DA 3R0KA 5I78A 5AYBA 1TJ1A 2OZ8A 5CG0A 3AHZA 2VFFA 4QG8A 4J5NA 1G6CA 2WNNA 4GIEA 2UWFA 5LXEA 3QHMA 3Q2DA 3C86A 3PZ9A 4UQDA 3PZVA 3Q37A 1S2AA 2CEQA 2HQAA 3ITXA 3LI1A 1DBTA 5C70A 3E0LA 1PYFA 3KDOA 1S5WA 1OZMA 4IJCA 1CB2A 3KHJA 4QIUA 2VKZG 2PDCA 1R2RA 2E6AA 3APYA 7TAAA 3SN4A 3MUAA 3QSRA 5M2FX 4RXGA 2ZQ0A 1LL7A 1DOSA 2E9LA 4Y9NA 1PDYA 2QW5A 2OX1A 5CJ5A 1IIGA 2QQ6A 1ZBVA 1ICPA 1CW2A 3CS2A 3BJSA 1QW8A 2FMOA 3ZVHA 2O7QA 5EBAA 1SSGA 4ZZ9A 3CL8A 4BWLA 1GVIA 3L4ZA 1JNEA 5D09A 1DJNA 1PIGA 2O9PA 3KX6A 3LHYA 4O8RA 4HPJA 3W7OA 4GVGA 4DWSD 2VEIA 4LF2A 3TQVA 4RJEA 1J0YA 4AH7A 3IAPA 4H8UA 1I1WA 2P76A 3QR1A 3F2DA 3Q67A 1P7TA 1P6CA 5BOFA 2ZYFA 3D46A 4LEQA 1N8WA 3GTFA 2R1KA 3SDOA 4U3CA 1D8CA 3WF0A 1PB0A 2VENA 3W25A 3GH7A 4XAZA 3MUZ1 2NWSA 3VIOA 3AXXA 1B31A 2PTDA 3DFHA 2G97A 3QGVA 1S39A 4CQDA 4AWEA 3L2LA 5CBBA 3VKDA 2J74A 4AIEA 3TLQA 1ZHAA 2DZXA 3S3GA 2VOTA 2EO7A 3SSJA 1XUZA 4X60A 4CNNA 2VOMA 1PIIA 1LJYA 4IWWA 3I3BA 4L4LA 5D33A 1YXDA 2JQXA 5IRPA 1VEMA 3DHFA 3VIIA 4HA0A 1A3XA 2YFNA 3SCPA 3PPHA 3O0KA 4NL1A 4LFYA 2GGJA 3W7JA 5GJNA 3EOOA 4YYFA 5E0CA 4K68A 4UCGA 1UD4A 1FWCC 4BR1A 2CKRA 4H9VA 3GNXA 3C2VA 3RCYA 1ADDA 3T2OA 1A5MC 1E0UA 3WK3A 3VXGA 4GXWA 3W29A 2A21A 4NYUA 3R8HA 1WDQA 4RW5A 3RR4A 5LKYA 3QC0A 2DGAA 5CPLA 3AIUA 5AB3A 4PTDA 3LPFA 1XGZA 2WZIA 1MDLA 3IAQA 1T40A 1IIHA 4AHPA 3PJXA 2HS6A 1NELA 1K77A 3GVWA 2HJPA 3EX4A 1UHVA 1UH4A 1REQA 3E5PA 4PMJA 2V5CA 4OV9A 5G4EA 4URIA 1KTBA 1XPGA 1QMLA 4A3HA 5MHBA 1AD4A 3CL6A 4M82A 5LIKX 1UZDA 3AS1A 5AHFA 4MKNA 4H3DA 2YDAA 3XIMA 2PGWA 4CN4A 2QUVA 2OR2A 3LSCA 3QYQA 4LRSA 4CD7A 1TMHA 2B7PA 4G8TA 4D6JA 4AZ5A 4F79A 4UQEA 2W6RA 5D2YA 3W85A 3CAWA 4DJDD 4PUMA 3AHVA 5CPQA 1YNYA 2ZXQA 1VFHA 1EDGA 3N11A 1J5TA 1RCXB 2R6OA 3PSWA 1Q66A 1UR4A 3W27A 4OKDA 4S3AA 3E2SA 5BU9A 1Q13A 2J7EA 4HTYA 3IGSA 3SQSA 1XLDA 5EMMA 4UFMA 3BO9A 3QYSA 2PE4A 3OU8A 4C6PA 4HHLA 2VFEA 4IUGA 3O7UA 1SZNA 3GIQA 4R7JA 1A47A 1OD0A 2QF8A 2XIQA 1F4AA 4KQNA 4IF2A 2EBNA 1JD9A 5EL1A 3VOFA 3C52A 4K7VA 3H7VA 2XWEA 1C9DA 2ZBTA 4N6FA 5T91A 1BYAA 2OYMA 2FFCA 5A69A 2MANA 1GVQA 3GFZA 4FLRA 2V68A 1PKMA 4ZO8A 1F2JA 3DH7A 3GBEA 2Z2BA 3UW6A 4U5KA 3RR1A 2ZA1A 3B8SA 3GTHA 4IISA 1FWBC 3F2CA 2PCEA 3WN6A 1EDTA 1DTNA 1OK6A 2VD8A 4MB3A 4C1LA 4Z2JA 4LWWA 3K8KA 2ZOXA 1CX9A 4B3ZA 3A9IA 3RHGA 3WH6A 3E12A 1FDZA 3AMLA 3FKKA 2Y7DA 4I9TA 1V0MA 1VBRA 1XYLA 5D05A 3RM8A 3KL0A 3SADA 1L9WA 4N2YA 5K7JA 4JTIA 2R94A 1O5QA 3TTQA 1G7VA 1EPXA 1I1XA 1F5ZA 3E2RA 1WDDA 3W74A 5BMXA 3M43A 2C16A 4LW7A 7TIMA 2YXGA 2W4XA 1R2TA 1UCWA 1AJ0A 1LBLA 2QXWA 4FMVA 4LCSA 5LGXA 2I9UA 3CLWA 3WQCA 4LUJA 4BHYA 4MLJA 4N4QA 3S46A 3L0KA 1ECQA 3LPGA 2ZC8A 2DSKA 1N7KA 4JAWA 4V2XA 4PFMA 2HRWA 3UR7A 1K70A 2ZX7A 1QOPA 4P8XA 1GPWA 2XN2A 3PBGA 4IP5A 2WMJA 4I9MA 4N6EA 3W26A 3MANA 1TTJA 4H2CA 2CESA 4Q8MA 4JFTA 3ZXWA 1SJCA 1S2WA 4PRWA 2UY4A 3MKVA 3DU0A 3ITVA 5D9MA 3NEVA 2GJXA 3G1DA 2CLFA 3CTLA 3UZXA 1W5MA 2IPGA 3FIGA 1KM5A 4DUXA 1KM0A 3DFTA 1OGBA 2ICSA 1Q6FA 3TYBA 4PCSA 3A5VA 4TMBA 4ACZB 1H7XA 1ZAHA 4NILA 4L1XA 3VGBA 2PZNA 2DVTA 1SW3A 6REQA 3BMWA 3AFBA 5EYWA 4JTSA 3DFPA 1WDSA 4YVPA 1OIMA 4H9YA 2Z6IA 2WHLA 2PWFA 3FLUA 3H70A 1HUVA 2BOEX 4O18A 4MNMA 2ZTKA 4K38A 2WMHA 4O1AA 4J9JA 2VR5A 4NG3A 4QLLA 1XH0A 1K6AA 3S4TA 1PTAA 3JW7A 4O13A 4YS1A 1ADOA 4WDXA 4AX6A 2BOFX 3CZLA 2BOGX 2VRKA 2OZ3A 4EKJA 3MMTA 2C0HA 2QEZA 3W1AA 4QDMA 1P43A 2WMIA 5BOOA 1FCQA 1GQJA 2E1WA 2P8CA 2J6XA 3KBJA 3UWVA 1JZ6A 1JYVA 3HM7A 1Y5WA 2A3EA 3IJQA 3LCXA 4CQCA 1ZSXA 3PB2A 1L0PA 2FB3A 4QXIA 5AHMA 4FHAA 1RV8A 2ZX6A 4XIMA 2B7OA 1GPFA 4JIPA 5HMDA 5CSRA 2WSQA 3ONCA 3MV11 2D22A 5DFAA 3NZPA 1V3KA 1A53A 4L4PA 4XKYA 3WLRA 2OXNA 2AQWA 3O6YX 5FF7A 3ZO9A 5MKGA 2WSRA 1UWTA 1BTCA 2GSJA 5E93A 2SFPA 1WYIA 2ZE3A 4Q8VA 1W54A 2H9AA 4AEOA 5FAGA 4NQ1A 4AHQA 5HJXA 5LNUA 3H23A 2V38A 3UWZA 1TWDA 4UBPC 1UASA 1I0DA 3WJWA 3GR4A 1B3VA 1KWGA 1B57A 1EC9A 2E3ZA 3WMBA 1EJSC 2XSXA 1LOLA 3N29A 2XZ9A 1PKLA 5I3HA 4Q4QA 1QW9A 5E9XA 2AMGA 3N3TA 4KGLA 2DZTA 1BVZA 2R1NA 5BNKA 3GDRA 3KRUA 1ZL1A 5BCAA 4E8GA 3WJZA 1GK8A 3BJFA 4L7ZA 2ZFAA 3ARSA 1Q6EA 3CUZA 2WZMA 1W3KA 5AYZA 4LVFA 3EB4A 4UQ9A 1QI2A 3VNIA 1XBZA 3S1VA 4O4WA 4JTQA 4BJHA 1UB3A 4XBJA 1C7SA 1BRLA 4PEEA 1UPPA 4WDTA 1SFTA 2YXXA 1DTUA 1GZGA 3S83A 1J10A 1EOKA 2X0YA 2PBGA 1JRCA 2A6NA 4IG2B 1DPMA 1JGMA 1H62A 3BW2A 1VFMA 1VYSX 4B9YA 3OBKA 2W9MA 3SRKA 4GI4A 4PSRA 1YPIA 3NQAA 3T0AA 3V0UA 2D0FA 2V3FA 1RBLA 1FA2A 2ALDA 3ITYA 3HQOA 1PKNA 3FW6A 2HTMA 4DXVA 1CNVA 1K8YA 2QJGA 1DWJM 4EPEC 2CBIA 4IQLA 2ZADA 2E40A 3M0KA 3THQA 3IJ8A 4GIYA 1R47A 3OZPA 3BSMA 1BYDA 2VQTA 3N4AA 3B97A 4K7YA 5TD4A 2ESCA 3TA6A 1TA3A 2CLHA 4DJFA 4W8LA 4JCMA 1IZJA 3HV9A 3S42A 4R33A 4PUNA 4F2BA 3OHIA 2NT1A 3BANA 4H9XA 1FWIC 3OTRA 4JTDA 1G4SA 2VGGA 3MBFA 2FJKA 3EGJA 3CC1A 1RBAA 4LV9A 1TPWA 3NSXA 1KC7A 1V0LA 2RGLA 4MB1A 1TPC1 4QX4A 2PWVA 1JI2A 1FOBA 4HJFA 5I5RA 1TCMA 3LTYA 2WVVA 1NJJA 3WJXA 3OIXA 3SRDA 3LRKA 3MCOA 3UXAA 3CV2A 5A2BA 2WBKA 4JQ3A 4Q4SA 3L4XA 3T7VA 5G4HC 3PFRA 4LBUA 3I3EA 3P6LA 4BA0A 1LRTA 2WHMA 4H8VA 1UD5A 3GNNA 3VI2A 1GKQA 1GJUA 2E6YA 2D23A 3TKFA 1YDYA 3NZ1A 1B0IA 4OBRA 4UR7A 1VIZA 3VC6A 3GTIA 4KEMA 5CH9A 2PODA 4LAKA 3VD7A 1CT5A 3THUA 3GKFA 2ALRA 2CFFA 2R91A 1O5KA 1UR3M 2GQ3A 2G95A 3P3BA 3LLFA 4IP4A 4Y6GA 4Q22A 2QV4A 4RUBA 3VOCA 4LXFA 4V27A 2QIIA 3QF0A 3FVDA 4F2TA 3M0JA 1JZ7A 1HJWA 4JNZA 1VCGA 4QE1A 1W1YA 2HK1A 4L6HA 4QNWA 4GO9A 3A23A 2XG9A 2J7HA 1QPQA 3UWWA 2YIHA 1F3EA 3C8NA 4MF4A 2DY3A 3BV4A 1TV8A 4GZ7A 3TMLA 3EWWA 1HXJA 1JXJA 4GUHA 3MSYA 5JVLA 5CPTA 2DW6A 2IUZA 4G2DA 3NQ7A 2QMJA 3REQB 4AEEA 3RO8A 4IFOA 2YR1A 3SURA 2QNEA 2KX9A 4HZ7A 3GAYA 4KH2A 5FJRA 2CLPA 2ZRZA 1OYCA 1TWSA 2WVUA 4PFHA 3DGRA 1A5AA 4NT0A 5H1WA 2GK1A 3WKZA 3ZMRA 3H24A 4OU1A 4TTUA 4NY2A 1AL7A 3QSTA 1L6GA 4C1KA 2V8ZA 3FN9A 3NO5A 2VVNA 3KWSA 1WP6A 4O1CA 3G1XA 5C2GA 2Y8UA 3UU0A 3AZTA 2PDKA 2VWSA 1K9DA 2I56A 1VRXA 5BMWA 4YCOA 1LL4A 2YCLB 2V5DA 1VRDA 1UWRA 1EQCA 2X1TA 2Z0IA 3HG2A 4M8UA 1TCDA 1PV8A 1W1ZA 3EXRA 3FKRA 1BXBA 3N73A 2YZ5A 3L65A 3EPOA 4LT9A 4CNOA 4PE8A 3QOKA 3KBNA 1HJSA 2HROA 4L4MA 3KW3A 4OT7A 4ZQMA 5E0KA 3RJYA 3CWOX 4JQ2A 1GG0A 3CYVA 2EPOA 1UD8A 4AU0A 2CXEA 4NAFA 4NJJA 1QWGA 1R30A 4MY1A 3WLKX 2W91A 3W1QA 4PRTA 2XH2A 4IX0A 2GWGA 3E0FA 2VGFA 3ARUA 4WY0F 3BW4A 3GB6A 4UTUA 4QS6A 2ZXDA 4L56A 4PB5A 2G0WA 3EMZA 3FK4A 4YXGA 5C6MA 4O0KA 3QZAA 2Q71A 3B0VC 1OX4A 4UFIA 4K8EA 4JKLA 2CLMA 2WZTA 1QNQA 3M0YA 4MY8A 4NYYA 4Q3MA 1GYLA 4JQ1A 3GK0A 5F2MA 3V3WA 4UTFA 4QDPA 3V16A 3FJNA 3FYYA 3K8MA 5FJUA 1NIUA 5DLCA 3UZJA 4YTRA 3CUHA 2GVEA 2QVNA 1CDGA 3O05A 1PX8A 4ZEPA 5HULA 2G8ZA 1EZ2A 3CQJA 2UV8G 1W17A 1Q6LA 4LAZA 2P0IA 1DWFM 3NZGA 5CPNA 4PRRA 1ZCCA 5HK4A 1QI3A 1SQ7A 4WXZA 4A3YA 1H7RA 3TZFA 1U5HA 3SCUA 1DJZA 2XVLA 3DBNA 2E5DA 1ISWA 5F2IA 4UTIA 3ITGA 2RJHA 2YL5A 4D6FA 2FFIA 5TIMA 1GGOA 1VCVA 1Y5VA 4GPNA 3NPXA 3MQTA 4LVDA 1GORA 2YA1A 3W7MA 4C60A 2GYIA 4X63A 1SW7A 1OQFA 2Q8LA 2CLIA 3LSBA 1HQTA 1R3VA 3DG7A 3AUJA 4Z2LA 1WUFA 2A79A 5LHEA 4E3TA 3MUIA 3R7MA 2A3CA 2IPWA 5KETA 3RU6A 4CVUA 1KXVA 1XR2A 4EPKA 1HP4A 1XPYA 1BSIA 4KKXA 4FAMA 5K2ZA 2BY1A 3E0VA 3CWNA 1DWAM 4Z1YA 4NASA 4XD4A 3H21A 4JFSA 5FI8A 4OIFA 4Q4PA 3KCOA 2Z26A 3BICA 3HOJA 2E7FA 3LHUA 1W2VA 1OSEA 1UZHA 3NEHA 2XVKA 4IG2A 3TQ0A 2W3ZA 1CWYA 3F4CA 3NIYA 1VPYA 3G1VA 4J4KA 4OHQA 4WZHA 1BKHA 2BXZA 2QCGA 3KFTA 3MS8A 3R13A 1XQLA 3T78A 3FX4A 4DO6A 4AD2A 3B0PA 1H11A 1U5VA 3ZVHB 4JZ5A 1XG4A 3ELFA 4OV4A 3G3MA 3QM3A 3VM5A 3AROA 3MPGA 3EA2A 1LG2A 3D6NA 3SIZA 4H8HA 5GNYA 1KV5A 4UNLA 1R3YA 1YHTA 2YJQA 5LA2A 2JKEA 3NXFA 4BF7A 1DE5A 3OG2A 1AH4A 4ECLA 1PDZA 3WJSA 1JPMA 2YB1A 1W5PA 3T05A 4JN7A 3P61A 2CWNA 4ZQNA 1JGIA 1W5OA 4TR9A 3GHTA 5FSDC 4GC3A 1MW1A 3M7SA 2BGNE 3ID7A 2QGYA 1EA9C 1MUWA 4NJIA 5AVHA 3URAA 1XM3A 3C2RA 4OUEA 2ADAA 5J8LA 3LI0A 3LHWA 3QMSA 1BWKA 4CD4A 4PC8A 3NQDA 4HHHA 1OT2A 5D4YA 1FCVA 2VURA 3RF9A 1VQTA 3WK1A 3PR2A 2PBOA 3S5ZA 3WLMA 2IW0A 3UWYA 2DJXA 1O95A 4ZOCA 4LUIA 1ZALA 4YNGA 3WEZA 1ECEA 2QJHA 1YYAA 1P48A 2CPUA 2PDYA 4GH3A 4RV8A 3IS4A 2TPSA 4CQ9A 1F9CA 4KRUA 4OOUA 3PVFA 2OVLA 4K6AA 4RL3A 1J01A 1BWVA 3LHTA 4NSBA 2CLKA 4HHMA 2C15A 3KP0A 3B06A 3NOEA 3DYPA 1Z89A 1LRNA 1RVKA 1J8VA 4KFNA 2D1ZA 2VC6A 1GVEA 3EXTA 4WD0A 4E5TA 1BXNA 5FL1A 4AYGA 1F6YA 2XVPA 3LHVA 4TVDA 5FF3A 3LXCA 2Z27A 3KLKA 4KFOA 2D24A 2WWCA 5T9CE 4HU8A 2A7RA 4EF8A 1R86A 3CPUA 1R7AA 1FWSA 2WQDA 3S5SA 4IZGA 2CZVA 5CEWA 1REQB 3EKGA 3RLVA 2VC5A 1V6UA 2DZSA 1YW1A 2CLEA 3E38A 5BXPA 4GACA 2J25A 3AMKA 3A21A 2BZNA 5C2XA 1IEXA 1X7FA 1V7AA 4FR6A 1ISVA 3AXIA 5C2CA 1GT8A 3ZSTA 3A47A 5AN7A 4LBSA 2F6KA 2RDUA 4ZODA 5U7SA 3GR8A 1M9HA 5DCBA 4I5XA 4CU8A 1J5SA 3GR7A 5CJMA 2EPHA 2X2GA 2Z4GA 1CGTA 5I03A 3G77A 1TTIA 4FNPA 2VGBA 5CCZA 3W7LA 3IIPA 2DT0A 3TYCA 2CHOA 5AZ0A 4WXYA 3PM6A 1OFAA 1Z9AA 1VFSA 2C7FA 2QCNA 3PTDA 4I90A 3W2MA 3OJGA 4W8BA 4Z2IA 3RPDA 3W1LA 1FFQA 3FXYA 2HMCA 3OP2A 4MYXA 1BHGA 3B8UA 2C91A 4NXKA 4I9JA 2J77A 1JCTA 3NQ6A 1IQ8A 1RUSA 4E4UA 1IEQA 1KD0A 1ITUA 5BW6A 1OINA 1E40A 4B16A 4RNJA 1J0HA 2J6VA 5BWFA 2OO6A 2Y7GA 1OFBA 3AALA 3L66A 1OG0A 1UD6A 3WD4A 1E0TA 1JG9A 1IEIA 8XIAA 3PG8A 2YA0A 3VKJA 1V3JA 3TUUA 4K39A 3TAOA 5D8ZA 1KR0A 4GZIA 4FXSA 1KM1A 4Y8FA 1NOUA 3IRSA 4PUKA 4F40A 1KBJA 3OVPA 1I75A 1KCZA 4C6JA 2G3NA 3UT0A 3U8GA 1RP9A 3ARVA 4QJ5B 3ZR6A 3WEOA 1TKKA 1TPEA 5KITA 6XIAA 3VCRA 4JX4A 5CGTA 3T0TA 2PWGA 2O9TA 1Q7ZA 3SSZA 4LC6A 4K3ZA 1R8LA 3VD9A 3SCWA 1M04A 1V5XA 3H12A 4LANA 1DJGA 3BGJA 4ZVJA 3GAKA 4WKFA 4AY1A 4M6PA 1ZU8A 5E70A 3KBSA 4KIEA 3BOFA 3TC7A 4GLEA 2Y5EA 3TW6A 4IM4A 3TW7A 3ARRA 2OFJA 1QU4A 2Z1BA 8CGTA 4H8NA 2ZUMA 2WVVB 2NV1A 1XICA 5F2LA 4AF0A 3TEVA 3IARA 4OZOA 1SYTA 3CV1A 3S47A 2CU0A 1A4MA 3C6CA 1PZ0A 3LRLA 3ABQA 1AL8A 3T44A 4MPQA 4O57A 4DEFA 3LYEA 3FSTA 5A6BD 4W7UA 4KFPA 3SQLA 2FTPA 4HSOA 1LG1A 1J12A 2ZKMX 3GXIA 2CHRA 4RNHA 4NZJA 4Q8PA 2VCCA 5K4XA 2VRQA 3RILA 1ZPTA 4GXPA 5IDZA 2QJIA 2VCAA 3GUWA 4Q7IA 3PAOA 4A05A 2C79A 1XS2A 2R14A 2ZRUA 3G1RA 1WKYA 3L4WA 4ZB2A 1WBHA 3CZGA 3LG3A 1EO7A 1H09A 4TMCA 3SJNA 1QW7A 4P7NA 1QXLA 1C90A 3KBMA 2XGIA 4BF5A 3MJMA 3M0ZA 3PUEA 2YLLA 3BC9A 4NZ4A 2QUUA 3T9PA 1QOQA 1GKPA 1WCGA 4JR5A 3TZNA 4MNKA 4DUWA 4RE3A 2ZUWA 2J9YA 2TSYA 3KRSA 3NZRA 3VDCA 4AHOA 5DT5A 1BGGA 3UPBA 2YLAA 4DPQA 4DO5A 1A4LA 1TWIA 4M56A 2PGRA 3MW7A 4DBWA 5FJOA 4UQAA 3GSMA 2BGSA 3C2OA 3K1DA 5CGQA 3MKKA 5D38A 1XC6A 1EIBA 3DI0A 2NV2A 5B7YA 3RNDA 2FHFA 3UJRA 9CGTA 1QTWA 3U9IA 3BARA 3P93A 4UOJA 1IEWA 4AAJA 3W2UA 2WVTA 1UKPA 1J9YA 1BEUA 1AG1O 3V5CA 4N9DA 2W79A 4HSHA 5CSSA 3N2MA 4FP1A 2AOSA 4RDVA 3R43A 1W3TA 2RUSA 3O0FA 1IT8A 3AIWA 4YCPA 4M51A 1EH9A 3WDIA 1TV7A 1MXGA 4NAEB 4AEFA 1QUMA 3G5EA 3NPUA 2WMKA 3QQ0A 5GNXA 5BRQA 1X1ZA 3ZLFA 3AIRA 4IGHA 1G0CA 1F8IA 1GQKA 3ITCA 3QR3A 4AWSA 4AZIA 4HP5A 3GBDA 3W70A 3W76A 3MV01 3FA5A 3W7HA 2FZMA 4GQRA 4O1FA 3IUIA 1TB3A 1AQHA 5AC8A 2NWRA 4UFKA 4ZTYA 4AY7A 4EK7A 2WJEA 1DJQA 4O1EA 1KFJA 1E9LA 1U22A 1CXHA 1E6NA 4IJRA 1K02A 3GTXA 2IS7A 3GX9A 3VINA 2PC4A 2J62A 5EMLA 4HK6A 3NYDA 4S3FA 5DXYA 3D5HA 2PMQA 4BQ3A 1UA3A 5I3KA 2RDXA 1GWJA 1Q63A 2YB4A 3ES8A 5D8WA 4PZVA 1OCQA 2VUNA 1XGDA 3B8IA 4GJIA 4KWVA 5BROA 2YYTA 2QCFA 2G3JA 4JIRA 3WJYA 3TJLA 1YE6A 3VGDA 3MMWA 2W61A 3NGFA 2J75A 1XLFA 1MW3A 4X0NA 4XZIA 3GVRA 1J2WA 1QWKA 3HG3A 2WBGA 4ZXOA 3VIFA 3STPA 1XIJA 3ABOA 5LA0A 4DWSA 1OX6A 3H4GA 3VCCA 1DJYA 1S5MA 2YL6A 5AECA 1L8NA 1Q6DA 2Y7EA 1CEOA 1JCXA 4AZCB 3B9OA 1LL6A 3WDHA 5U4NA 1S3HA 2YDRA 4UIOA 3WL1A 2BY2A 5IBXA 3GM8A 1JPKA 5FJPA 2AGTA 1UZ4A 3D0CA 4W84A 4RNIA 1XLGA 3Q45A 2OWWA 4W88A 2DSUA 1RVGA 4XZWA 4U33A 3WBEA 4QDWA 1BWLA 3ZR4A 5C8BB 9XIMA 4DJFD 3PTQA 1O1ZA 2NQZA 3L4YA 5HQLA 1FWRA 4WSHA 3H2EA 4CD6A 2Y2WA 1XIEA 5LIUX 5G2WA 2VEPA 1I60A 4XUYA 4TX6A 3RX2A 2JEPA 3URNA 4MADA 5ABEA 4U3AA 3AMCA 3MP3A 3W1PA 4GWEA 2CBUA 4MSSA 1ZLPA 3R11A 3VD5A 1QJWA 4QE5A 3C8FA 4AISA 2CZFA 2X8RA 4FIQA 3WQWA 3N2XA 2E28A 1Q2RA 4LYPA 4GYKA 3R58A 2R24A 1XDMA 3R0UA 3CMGA 3HFYA 3U5YA 3ZS4A 1KGUA 3CHVA 4ZO9A 1EX5A 2BHUA 1WOAA 4MJ2A 1DJIA 5DELA 3KHDA 4FXFA 2BDQA 4KEUA 4GA8A 3IVTA 1R6WA 4GMEA 1CECA 3I4KA 1AJ2A 2WPBA 4S3GA 3W28A 3WDJA 4F0SA 3VX1A 1CGYA 1KBIA 2D2JA 5CSUA 1GOMA 4A4AA 4JY8A 4HK7A 2XH7A 2VXNA 3NJ3A 1OADA 3DFQA 3ABXA 4NVTA 3W82A 4HU4A 1KKRA 3UGVA 3O6CA 1Q45A 1ZAJA 4FX7A 3HJZA 2Q6ZA 3VE7A 3SN1A 1K7FA 5ABGA 1I2OA 3UYIA 1YPXA 4LB3A 4FOUA 4XSMA 3WLIA 1BXCA 5FJJA 1IGSA 3W87A 3PP7A 3VNKA 2Y88A 4HA1A 2P3EA 3KE0A 3VDHA 4QJ4B 2CC0A 3EOSA 3GW3A 4ZENA 2P0OA 5D37A 1Z41A 4Q8NA 1NP2A 2VL4A 1EO5A 3T40A 4PUWA 4DY1A 2XH4A 1OF6A 3VCNA 3G0UA 3LTSA 1OD8A 2H9AB 1TVPA 1G01A 1B3ZA 2OT0A 3L67A 2PC8A 4NI8A 4MJ4A 1NQ6A 4PCTA 4C6BA 4QS5A 1ITQA 4RE0A 3HPAA 1XCFA 5A6TC 6XIMA 4IXHA 1W1PA 3IGXA 4MKSA 4IH3A 4QCEA 3VC5A 5C9ZA 4FS9A 3ZM8A 8XIMA 2XFFA 1P6WA 3BCDA 5G1YA 1Z69A 3UPMA 3EOUA 3GRIA 3B05A 4GX8A 3O8AA 3R0DA 1TV3A 2OSXA 4EE9A 4M29A 3FJLA 2IKJA 1E6QM 3GQYA 1XYZA 3QC3A 4LUYA 5K4ZA 1NWTA 3QV8A 2ZVIA 4GJJA 4LALA 4HN8A 3AICA 4IL2A 3ITTA 1W5QA 3DESA 3P60A 5BXTA 1LOQA 1LBFA 1L6WA 1X97A 3W7QA 4MLRA 1SPQA 2XJ7A 1HL9A 3WFZA 1EHAA 4GYFA 4QQUA 3KVLA 2WMGA 3L12A 3CPRA 3E9AA 3ZJ8A 1EPVA 1FHVA 4M24A 4GQGA 3VNMA 2J66A 1MI3A 3K8LA 3M41A 4IIDA 1UWQA 3F4VA 1US3A 4MVAA 4Y9PA 4D6CA 1FWAC 3RO6A 5BZAA 2VFGA 1N82A 3W3OA 3E74A 3RPTA 3OPSA 1W1B1 4IUOA 1TJPA 3FEMA 1YQ2A 4RXFA 3ARWA 3M6DA 3D47A 4JTHA 3UR2A 2ZRXA 3B9AA 3W72A 2V5BA 2GUYA 2CLOA 4QEEA 2A1YA 3M16A 4JTTA 3VA8A 2EG8A 3IJLA 3B3DA 4WLCA 5T26A 2XGZA 3M07A 1Y8BA 2W92A 1SGJA 2GOKA 2HV5A 1O5RA 3WD3A 3KOXA 4Z2KA 3QY8A 3LLDA 3BLKA 1XISA 3WK2A 3GHUA 3ZLGA 3C61A 2OX4A 1EA0A 4IGNA 2I14A 2XINA 2AQOA 4YN5A 3JZEA 2ISWA 2BX7A 3W0KA 4CEUC 4QLKA 2O7SA 3EWZA 3TYEA 1W1VA 2GLKA 1JPIA 1QI0A 1XC4A 4NAEA 1ZBKA 4H9MA 1Y65A 1XV8A 4OWGA 4AZCA 4P8WA 2V2CA 4G5DA 4NJHA 5EMUA 1CXFA 2INZA 2NVCA 3AIVA 3EDKA 4DNHA 1X6UA 1K8CA 4C6KA 1E5NA 4XV0A 4HD5A 5KZMA 5L6UA 4JDYA 3OLGA 3BG5A 3G1FA 1YX1A 4D6EA 1RQBA 1L6FA 2QDEA 1XG3A 1OZQA 3EZ4A 2VYOA 1S5VA 4LCQA 1SM9A 1LF1A 1ISZA 4GG9A 1FCBA 3TN6A 4O19A 2JF7A 7REQB 3MUCA 3APGA 4RDYA 1OWQA 4FLSA 4U10A 3DCPA 4FNTA 5HUPA 2QJJA 5GJMA 2PSNA 1V8EA 2QR6A 4X2RA 3VILA 4JTLA 5MF5A 1FH8A 3I7RA 4RNFA 2A3HA 4KESA 2FHCA 4XBSA 4F0RA 1HVXA 3IVSA 3HQ1A 1DVJA 3VTRA 3WQPA 4RX0A 4C5ZA 4S2CA 4LAOA 4EXBA 1VLIA 3Q94A 4GCAA 1UJPA 2J88A 2WPGA 1FWNA 4L1WA 3SM0A 4XZMX 1WAWA 3BXWA 1ELSA 4KRTA 1X98A 1VPXA 3CIWA 3CV7A 1BVWA 1I2RA 4IPNB 1PXGA 1AZ1A 4RPQA 4W4QA 2OWCA 4U2ZA 2P8BA 4UZUA 4IGSA 1JPHA 3LK6A 1M41A 1NOFA 4TVCA 4KCWA 3FFSA 3STFA 4B91A 1XW8A 1J0ZA 1TWZA 4UMAA 4JD4A 4IIHA 5A6JA 4LV4A 4G7EA 3GUGA 2VC9A 2O4QA 1AH3A 3WYZA 1LT8A 4B2DD 4JYDA 1E51A 2QT3A 1PWLA 4ADUA 4QBXA 1GNXA 3SFKA 3P14A 3OGVA 2AKZA 3ZT5A 1PTDA 3FVMA 3S2CA 1LLZA 3N6JA 4F9DA 3MUXA 3QMTA 4BEUA 3TNOA 1YMYA 2QCDA 1DXEA 3BLDA 3DIPA 4PUEA 4H6QA 4CEXC 3SBFA 3GHRA 1U1JA 2Y24A 3IJIA 4TV6A 3VDAA 3WLOA 1ISXA 1RCOB 3TWBA 3NCOA 3M5YA 3M5ZA 3T2QA 4DZIA 4NXSA 2Z1WA 1IXOA 4YTTA 4XD5A 2EAWA 4EOUA 5D02A 5FOOA 3ITLA 2OQYA 4E2VA 3T0DA 2WB5A 3W2NA 4YVVA 3BW3A 4YYCA 1ME9A 2Y63A 1H50A 1K6WA 2QKFA 4D6DA 3U7VA 4FXRA 4CLMA 2QYGA 2EJAA 1C7TA 4YVXA 1E4LA 5I6SA 3QY6A 3N9RA 3WQ4A 1ZBWA 4ZOAA 3NOYA 3PWIA 3N9KA 3CT7A 1OC6A 2QDDA 3KVKA 3P62A 2IPJA 4H6KA 3TWAA 3NQGA 2V81A 4UQBA 3V1PA 3O06A 1HX0A 1RR2A 2QZRA 3VNYA 3PJWA 3TFXA 4LYRA 2XWDA 3H2OA 4ZQOA 2Z29A 4X3ZA 2PWHA 2VX5A 2XHYA 1ZJIA 1IZKA 5K9CA 4DYJA 3JUGA 2IXUA 4CKQA 3WQVA 2FPYA 2VZOA 1M65A 3GZAA 3MSGA 3ITOA 2E77A 2PDIA 3R4IA 3PS7A 2TYSA 2CLLA 3RN6A 4C6OA 2DSZA 3L68A 5C7HA 3AS0A 2CCRA 2F6UA 2JGYA 3DI1A 3E0IA 4Y9AA 4PMUA 3K4AA 1XSIA 3HIJA 3N1AA 2VR2A 2GJRA 1A5NC 1DIOA 1E0WA 2R82A 1Q8JA 1E70M 4HCDA 1CENA 4F3HA 2GJNA 1S2UA