1UG6A

Structure of beta-glucosidase at atomic resolution from thermus thermophilus hb8
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
426
structure length
426
Chain Sequence
NAEKFLWGVATSAYQIEGATQEDGRGPSIWDAFAQRPGAIRDGSTGEPACDHYRRYEEDIALMQSLGVRAYRFSVAWPRILPEGRGRINPKGLAFYDRLVDRLLASGITPFLTLYHWDLPLALEERGGWRSRETAFAFAEYAEAVARALADRVPFFATLNEPWCSAFLGHWTGEHAPGLRNLEAALRAAHHLLLGHGLAVEALRAAGARRVGIVLNFAPAYGEDPEAVDVADRYHNRFFLDPILGKGYPESPFRDPPPVPILSRDLELVARPLDFLGVNYYAPVRVAPGTGTLPVRYLPPEGPATAMGWEVYPEGLYHLLKRLGREVPWPLYVTENGAAYPDLWTGEAVVEDPERVAYLEAHVEAALRAREEGVDLRGYFVWSLMDNFEWAFGYTRRFGLYYVDFPSQRRIPKRSALWYRERIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Beta-Glucosidase at Atomic Resolution from Thermus Thermophilus Hb8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords beta-glycosidase
total genus 165
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2003-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ug6A00
3CZKA 1ZS2A 2BHZA 4OJYA 3DYMA 2F8QA 3ZQ9A 4H8UA 4OUEA 3PZMA 3WIJA 2PWHA 1V0LA 4F8XA 2WBKA 5E6ZA 1W3LA 3WUGA 1LWJA 3S2CA 1NWUA 5AYIA 3S6TA 3WDJA 3VD3A 1JNEA 3WFLA 1H3GA 3M6DA 1ITCA 1KGXA 5A94A 3ARTA 3W53A 1H49A 4CD5A 3WQ8A 1OGBA 2XVPA 1K6AA 4HZ8A 1CZ1A 3ARQA 1A47A 1G94A 1EXPA 2QPSA 4B9YA 4KH2A 1V08A 2J77A 3K8MA 1V3LA 2WZIA 3ZOAA 4B3KA 4OOZA 1TCMA 2ZWZA 4OKDA 1TUXA 3K8LA 1AVAA 1JFHA 4P7NA 2JF6A 3BCFA 3PZVA 1E56A 3VPLA 1AMYA 1GPFA 4PTMA 2VZVA 4J3SA 5JIWA 4TX8A 1JXKA 1KB3A 4HOZA 1Y7VA 4M56A 3VDAA 4MDOA 5IXEA 2DDXA 5BXPA 2XGIA 1AQ0A 3K8KA 1ZBKA 2C8NA 4U3AA 5A8OA 4EAMA 1B0IA 1UH4A 1LJYA 4AZCA 1L0PA 3VGBA 3K1DA 1TVNA 4D6CA 1EH9A 5A8NA 1UWQA 1Q6DA 4LGXA 1RPKA 4HMDA 1QNRA 5A6BD 1OGGA 4ZE5A 3WMBA 5A6MA 1B90A 3AS3A 1CXEA 1UQZA 2DT1A 2WKGA 3AIWA 3WEZA 4A3YA 4GO9A 3PZNA 5A3HA 1UWTA 4S3KA 2WK2A 5EFDA 3VDBA 5I3DA 3CZGA 2E8ZA 1KWKA 1WDSA 3SURA 1B9ZA 3VIMA 3WD3A 3K4AA 3NSXA 1CGYA 3FAWA 3AIQA 5IHRA 1KBKA 3M07A 5CQ1A 2VZUA 2GJPA 3CUFA 3OB8A 2QF8A 3U7BA 1J0IA 3TTSA 4P7OA 1OINA 2QLYA 3KL0A 3SUTA 3WH5A 4J3UA 4UOJA 4OBSA 1AQHA 1MQRA 5A6BA 1WNOA 1B3XA 1W1YA 1F4AA 5CLWA 4MB5A 3N12A 3DYOA 3DECA 1HL9A 2EEXA 3SCNA 4HOWA 2J7CA 5D9OA 1CIUA 1MWOA 2WZEA 4PTXA 1A3HA 1WKYA 3POHA 3PZOA 3WD1A 1VFUA 1VEMA 1JGIA 3WEMA 5BXTA 3ARSA 1JDAA 3BC9A 4NF7A 3ZMRA 3SCRA 4GIAA 5I5RA 1ISVA 2DSKA 3A4WA 2VUYA 2EQDA 2IXUA 2MANA 3WFZA 2F61A 1JL8A 4URIA 1GQLA 1QNSA 1GONA 2G41A 4CU8A 1ZJBA 2NSXA 2VQUA 4H41A 3VGGA 3NSNA 1V03A 2J7HA 3GH7A 1R8LA 1UR1A 1BQCA 4MB1A 3F5JA 4QFUA 4GZIA 1E71M 3HN3A 3SEPA 1MXGA 2OYKA 4PN2A 2V5CA 1XRVA 3DYPA 3MUAA 5D9NA 2B31A 4QP0A 2VVNA 2J74A 3RILA 5JIPA 2AOSA 3B9EA 4PMXA 1DHKA 1EO5A 2YA2A 1E6SM 2QPUA 4IM4A 2OYLA 1JZ3A 3T0DA 5A6AA 2VTFA 3RCNA 4HA3A 2XWDA 1WPCA 1JXJA 3J7HA 1VBUA 2AAAA 2XVNA 3AFBA 2WANA 1ODUA 3AHZA 1J0KA 3VIHA 5EMYA 4JL2A 2WSPA 3KL3A 3NDYA 3RDKA 3WNLA 1DEDA 1CEOA 2VJXA 2J8GA 1J9YA 1UA7A 2WMKA 4ZXOA 1G5AA 1H09A 1Q6FA 1BYCA 2W92A 4WK9A 5I79A 5JBDA 1TR1A 5CPTA 2YLAA 2W4XA 2WKLA 3DHUA 5FIPA 5I24A 1CBGA 2XVKA 3SUVA 3UEQA 1H2JA 3PN8A 1ZBVA 1JF5A 3FAXA 1JD7A 1EIBA 2XGBA 3NDZA 1HJQA 1XHGA 2X1IA 1UKTA 4FLRA 4L4OA 5DMYA 1QNQA 5FL0A 3BMVA 3LPPA 4MAZA 2DPEA 1W9PA 4JZ5A 4AISA 4GPNA 4PSPA 2V3FA 2XM1A 2ZUWA 3WNKA 1PPIA 4OIFA 2FGZA 4AEFA 2OWCA 3N9KA 5FKYA 5AC4A 2OYMA 2J7GA 4D1IA 1W3HA 4MDPA 4X0NA 1RD6A 1UH2A 1I75A 4UFHA 4DM1A 4J3XA 4CD8A 2CITA 3RIKA 2PWFA 3EMZA 3GZAA 1E3ZA 3A47A 1UR2A 2BXYA 2FDMA 1U30A 1V6YA 2XTKA 2EO7A 2D1ZA 1CXFA 4Q7NA 3VX0A 3MKKA 3LPGA 4JIEA 4ZXLA 4QLLA 4L4PA 3L4ZA 3A6OA 5CSUA 1XSJA 4HPHA 2YDSA 1FHDA 1DWAM 2JALA 3THCA 5DF0A 2ZUMA 3EMCA 2Y4SA 3OGVA 3WNMA 3N15A 1JZ2A 3MUY1 3WF2A 4MADA 1V0KA 3AICA 2XHYA 5BYWA 1ZB5A 1VENA 3TONA 1HX0A 1WCGA 3WH9A 2TAAA 1IZKA 1CXIA 4U5KA 3MUZ1 1OD0A 1HJXA 1OD8A 4UFIA 1C8YA 2GVYA 3KWXA 4B3LA 3WY1A 1DWIM 3WH8A 4CUCA 2WYSA 5CLTA 2EPOA 4H8HA 1R85A 1UG6A 1KBBA 5HNNA 4AW7A 3WEOA 1PZ3A 3WF1A 5HOSA 3WBEA 1QBAA 3RM4A 1TFVA 2V3EA 4PUEA 4LYRA 5ABGA 4JFVA 2CNCA 3VVGA 3I3DA 4U31A 2DIEA 1UKPA 3MU7A 1R87A 4PCSA 2J75A 1JAEA 4JCLA 4BQ4A 1OB0A 4GZEA 3VMOA 4W7UA 1OIMA 1US2A 4GO8A 4W93A 3ZT7A 1HP5A 4YN5A 1JNDA 2VNCA 1MW2A 1HKIA 6CGTA 4Z2KA 1XCXA 3KL5A 1M53A 3BMWA 3ECQA 1GOQA 2WCAA 1MQQA 3OLDA 3FNDA 3AXIA 3AQUA 3RJYA 2BHYA 1GQJA 4MAVA 1BF2A 1O6IA 5E0FA 3VO0A 2DT2A 2QV4A 1LWHA 1XCWA 1RP8A 3VD7A 2ZUVA 3ZJKA 1B30A 4AZ6A 2YOCA 1DWFM 1E9LA 2W5FA 3GBDA 2DH2A 9CGTA 1M03A 1JDDA 1UWSA 5C71A 3W24A 4DM2A 5A8MA 3THDA 1E6NA 1UKOA 2VZTA 4U3CA 4IUGA 2VRQA 4HOXA 1JYNA 1EO7A 3BAYA 1XSKA 2BVYA 4UQCA 1AQMA 3VGEA 1E6QM 2O9RA 5HPOA 4M82A 3NCOA 1CECA 1TA3B 3W0KA 3TTYA 1UHVA 1WDPA 2W63A 1D2KA 1PX8A 3AIRA 4ATDA 1QI0A 3AMKA 3IJ7A 4LYQA 1UZ4A 3MUIA 2E9BA 4NZCA 1JYVA 4KGJA 1WP6A 4PCTA 3FW6A 4GQQA 5D8WA 2D2OA 4KMQA 3L4XA 2YL5A 4MB3A 3SUSA 4CVUA 1H0IA 2D22A 3CHCA 4IISA 4J3VA 1GOMA 2VCBA 3F5KA 3ZSSA 4J3WA 1J11A 1E5JA 1TE1A 2YKKA 2DSWA 4HMEA 3WNPA 3KE0A 1G01A 4KRUA 1JF6A 3AZSA 1XH1A 3BXWA 2DT3A 1VF8A 1CXHA 4HA1A 1W91A 3GTNA 1V3KA 4ATLA 1PAMA 4XX6A 3GM8A 3W26A 1F4HA 4NI3A 4RE4A 4JL1A 4H2CA 4OBRA 4BQ2A 2BNJA 3I3EA 5DT7A 1J0ZA 5BWFA 4U33A 3TTOA 4AWEA 2CKSA 3WUFA 4XZWA 1JZ4A 3EDKA 3AXHA 4DUWA 3AISA 5LA2A 1U33A 1J0HA 1NOWA 3T09A 3VTRA 3L4WA 3W27A 3GH5A 1W3JA 2DSVA 2D3NA 2XIIA 4J27A 4GINA 1Q6GA 4FMVA 3W6MA 1PX3A 1LLOA 1TG7A 2GDVA 3AIBA 1V6XA 1XC6A 5GPRA 1MW0A 5ECUA 1ZU8A 4RE2A 2CCRA 3B8SA 3UG3A 1M04A 1R86A 1NWRA 1BGAA 3CH9A 1CXKA 4KWUA 2J4GA 3T0BA 3AOFA 5BXRA 4GI8A 3F4VA 2G3IA 4CN4A 2A3AA 1LL6A 4AEEA 3SUWA 5EFFA 3T2QA 2HVMA 3ZO9A 4M80A 2D0FA 3CHDA 1SYTA 2E40A 3OLIA 5TD4A 3WELA 2FHBA 1UA3A 1ZBWA 1B3ZA 4MNJA 4P7QA 1KXTA 3VD5A 4Y7EA 3N13A 4H7VA 1BHGA 1J0JA 4P8WA 2GDUA 2W62A 2GJXA 1B3YA 1QHOA 2D23A 4UFLA 3OG2A 4YHGA 5A2CA 2CPUA 2DSUA 1BG9A 4QCEA 4AZBA 2CEQA 4F9JA 1E15A 1I1WA 1V02A 4TVDA 1QNPA 2BY2A 1VEOA 7CGTA 2CESA 3CUJA 1BFNA 1HIZA 4J28A 5M17A 3DC0A 1B31A 1BYDA 4J7RA 3ZT5A 1XSIA 2NW0A 2QMJA 4W87A 4W5UA 1OM0A 4P7LA 4AD4A 3WSUA 4KGLA 5IFTA 3VIGA 4LXFA 1VFFA 4TOQA 3OA5A 1QPKA 1JFXA 4AZCB 3VNYA 3LMYA 1BGGA 4GKLA 1WZLA 1UYQA 3VIOA 1CGXA 4W88A 2ZUTA 1G0CA 4D6DA 4UOZA 1UR4A 2J7DA 4PEEA 2YDQA 5F7UA 2FHCA 1CYGA 2VOTA 3N17A 1C8XA 5EBAA 1FHLA 5ABEA 3WL0A 4E8DA 4W8LA 3N1AA 4WSJA 2BXZA 2WB5A 4ZFMA 1E0WA 3TTQA 4WJXA 5AY7A 4NRSA 1WZKA 1GW1A 3UCQA 1GOIA 4WSKA 3AMDA 4WKHA 3VM5A 1GCYA 1E72M 2XFRA 4LQ1A 3RM9A 1UR8A 1E1EA 1HKJA 4UFJA 2E4TA 4BS0A 3PZUA 2D24A 2G8ZA 2VVSA 3AI0A 1PX4A 2DSZA 1W32A 4Q22A 4JFWA 1V3MA 2EPKX 1E0XA 1CTNA 5BROA 2WW5A 5A6LA 3W81A 2V38A 1E4MM 1H0GA 1VJSA 2E8YA 2ZX6A 3SCWA 5JBEA 5KZ6A 1KXVA 1UKSA 3SIMA 2A3CA 3G6MA 2VRKA 5CGMA 3W29A 2XUCA 4UQBA 3MSGA 4MNMA 3AMLA 4LPCA 5DFAA 3OZOA 4WKAA 5C8BB 1R7AA 1QHPA 4MB4A 4NRRA 3MSDA 4YHEA 2J79A 1UR9A 4HPGA 3MMUA 1W3KA 1WO2A 2GUYA 1B3WA 3U7VA 3BAWA 3WDQA 4MNLA 4GZJA 2E0PA 1QI5A 4CCEA 3CMGA 2V3GA 3JUGA 1C7TA 2BVTA 3QHOA 1V0MA 3N18A 2VMFA 3N11A 4D6IA 1EQCA 3BSHA 4BQ3A 2VX6A 3EDFA 5E09A 3VIIA 2BVDA 3AZTA 3ZJ7A 4X0VA 2ZUUA 1UH3A 1Z32X 1ZJAA 2Q8XA 3IJ9A 2Y8KA 4R5EA 1E0VA 4J3TA 1KQYA 4CU6A 1HKKA 1GQKA 4AD3A 3ZR6A 1HNYA 4V28A 3OLEA 3CGTA 1US3A 1OIFA 4RL3A 3SCTA 2VX7A 4FLOA 3GXIA 1C91A 3PZGA 2C0HA 7TAAA 1C3FA 3PBGA 5CPSA 4XUYA 3UR7A 1J12A 3D3AA 1XV8A 3TP4A 3A3HA 4P8XA 2FGLA 1BG4A 1H4PA 1NOUA 2J25A 3BSGA 5DT5A 3ARWA 2CBJA 1PBGA 2XSAA 1UD4A 2ZICA 1MYRA 4GI9A 2GFTA 2DIJA 3M46A 1JD9A 1CPUA 4TUFA 3SCOA 5IDIA 3CMJA 1E4IA 2RGMA 3EDDA 3CBWA 1X6NA 3WD0A 4UQ9A 3WD4A 2ZXBA 1JZ6A 1JZ7A 2G3JA 4AIOA 2PBOA 2WVUA 2WHLA 2VCAA 2G4FA 2WPGA 4MJ2A 3WQ6A 3W6LA 1UD5A 1UD2A 4AZ5A 1B1YA 1LQ0A 1N82A 4AY1A 3OBAA 5I78A 2WM0A 4AD0A 2A3HA 1NOFA 3ARZA 2PB1A 1JI2A 3PTQA 1L8NA 3W28A 2ZE0A 5GNZA 3POCA 3L2LA 2CYGA 3OIHA 1CGTA 1ZBCA 2J7EA 1MFUA 1FH7A 4AD5A 5E70A 2EPMX 2PWDA 4FK9A 3VNZA 1DWHM 4OOUA 3RPMA 2XVGA 3VDCA 3W4RA 3B9DA 4WKFA 4AZ7A 1ISWA 3SCSA 1FOBA 2YL6A 3AXXA 4UZSA 4QCFA 4UQAA 3I3BA 2VQTA 1QNOA 1OSEA 5IHSA 1DP0A 4UQEA 4GI6A 4UQDA 1P6WA 1R7OA 5ABHA 3BH4A 1BTCA 4PMZA 2CKRA 2ZUSA 4BCEA 3WF0A 5FD0A 4ZENA 2E3ZA 1VAHA 4XV0A 1VFOA 4B9ZA 3L4TA 1V0NA 4UZUA 4FF5A 2E9LA 1FFRA 3ARRA 5E9AA 4ACYA 1XH2A 3U5YA 3W25A 3N04A 1HJVA 1K9EA 3CIVA 4TTGA 1LF1A 3WDPP 3WQ5A 3CHEA 1E70M 1M7XA 2J7FA 4DWSD 1D7FA 1JYWA 4W7WA 1UZ1A 2ZX9A 4AXNA 4U2YA 1GOKA 2BY0A 4JKLA 4AZIA 1QI2A 1VFMA 4EE9A 1WZAA 1K9FA 2ZUNA 2EPNA 4JKMA 1SMDA 3AHXA 3BAIA 2WHMA 3TOPA 2UY5A 1NH6A 3NYDA 3W82A 3MS8A 1JAKA 4PSRA 3WF4A 4TXEA 3RJXA 4ZE4A 8CGTA 2V3DA 4UOQA 3RO8A 2WVTA 3IANA 5A95A 3CPUA 5CPQA 4V2XA 4QAWA 3VILA 1HN1A 5D9PA 3U57A 1XYZA 4BZYA 1JDCA 3CHFA 1PEZA 1UD6A 3G6LA 5M5DA 2CERA 3AIEA 4AZHA 2XFFA 3BAXA 4IPLA 3WMSA 1J10A 3LPFA 5A2BA 5ABFB 3GBEA 1UD8A 2WAGA 1KXHA 2FH8A 4MNKA 2YJQA 3PHAA 1ZL1A 4WF7A 4D6EA 1GQIA 5E0CA 3SUUA 5LA1A 2DGAA 3CZJA 3GXDA 2VT0A 5JBFA 2YA1A 3KZSA 2X0YA 3PZTA 4BQ5A 4CD7A 3WQ4A 4AD1A 3T2PA 1UWIA 1K9TA 2VI0A 3PTMA 4PMVA 3CZLA 4Z2HA 4B16A 1HVXA 4HZ6A 4CCDA 4CU7A 1ISYA 2RGLA 3O6AA 2VX5A 4FLSA 2XFYA 3GH4A 3T08A 5C70A 2EJ1A 4MPKA 5BRPA 3AMGA 5D4YA 3WH7A 2WXDM 1WB0A 4W8BA 1FP8A 4PMRA 2ZOXA 1YQ2A 2BV9A 2JEPA 5JUVA 1C90A 1MXDA 4JFUA 2CIPA 1M01A 4TVCA 1EOKA 1EOMA 1HKMA 5HPCA 2YDRA 1IV8A 4D6JA 1MFVA 2XPKA 5DEZA 3QHNA 1J0YA 3VUPA 2YIHA 4E2OA 1TMQA 2WSKA 1KR0A 3BGAA 3VX1A 4KRTA 2A3EA 4PRWA 3QOMA 3VIKA 3GXFA 3O2LA 3WDHA 1ESWA 5BRQA 3BCDA 4F9DA 1GUVA 3K4DA 1FP9A 3SCVA 3OGRA 6TAAA 4LX4A 2WLZA 5LA0A 2BFGA 1IT0A 4TVUA 3UG5A 4AD2A 2D20A 3WKZA 3A4XA 3AYSA 5CG0A 5I2UA 2IUZA 3E1F1 3WD2A 1EDGA 1CGWA 2A3BA 1G1YA 1GJUA 1TA3A 4DUXA 1E6XM 1RP9A 3WNNA 1MW1A 1BYBA 4UR9A 2XSBA 4DWSA 4CD6A 3D5HA 1EHNA 4PUDA 1WDQA 1NP2A 1WZMA 4B15A 1B2YA 1V02E 5FOOA 2YA0A 2W67A 2J8FA 3VU2A 1GZJA 1GNXA 2CXGA 4W7VA 3RM8A 5AYBA 3F5LA 3U5UA 5HXMA 1WDRA 1E6RA 3NJ3A 2HISA 2PBGA 5CSYA 1C92A 2X0HA 2JF7A 4HA4A 3WDRA 4P7RA 3L4UA 3FN9A 5CXPA 2ESCA 1TZ7A 3VGDA 5A8QA 5A69A 3GNOA 2G3NA 4D6FA 4DWSC 4W5ZA 3QHMA 1GOWA 2JEQA 2PC8A 3OZPA 3ARUA 2GK1A 2VR5A 2YBTA 3B9AA 3WENA 1B3VA 1JI1A 3CUIA 3T0AA 1V6VA 3WH6A 2YL9A 4JFSA 4ML4A 2JE8A 4N0RA 1SFSA 4CN6A 5I23A 1UQYA 4D1JA 4AIEA 1CGUA 2BS9A 2J47A 1Q6EA 2V5DA 1X1NA 6A3HA 1VBRA 1MW3A 2XVLA 3FY1A 3EMQA 1H11A 2UWFA 1UKQA 1VRXA 1O7AA 5A6SA 3AIVA 3VM7A 3VINA 3VIPA 2ZX5A 1J18A 3ALGA 2D0GA 1GOOA 4H8VA 3GYCA 2VCCA 3VIFA 4U2ZA 2WWCA 2CETA 2Z1SA 4ACZB 2YLLA 3AJ7A 4UFKA 4DWSB 1CDGA 1UOKA 2W61A 2X09A 3IK2A 3BAKA 3AS2A 3IAQA 3MV11 2XIBA 2WHJA 4M8UA 2E9MA 3MV01 5KEZA 3BAJA 1W1PA 3AHTA 1OT1A 3ZT6A 1FH9A 7A3HA 4QDMA 3WL1A 3FHAA 3MO4A 1CXLA 1W2VA 2PWEA 1E73M 3FHQA 2O9TA 1QW9A 3APGA 3WDIA 1HJUA 1XGZA 1CNVA 5I77A 1LL4A 5CZKA 4PBGA 1EHAA 4PMYA 3ARVA 4RE3A 2VL4A 4Z2JA 1DTUA 1VB9A 1QVBA 4UNIA 2GK1B 1E6ZA 1E6PA 2NT1A 1VJZA 3IJ8A 4F66A 4W89A 3UESA 1FA2A 1HJWA 1QHZA 2NT0A 2QMKA 3QGVA 1BVNP 3LPOA 1D3CA 4XZBA 2EPLX 1H41A 1KFWA 2WC4A 4PMUA 1XYFA 2D0HA 1OBAA 2ZWYA 2BY1A 2DH3A 1EQPA 3AYRA 4OZOA 4TX6A 1GVIA 1KWGA 4C7DA 1GHRA 1JIBA 2WC3A 2X2YA 4GXPA 2DEPA 1CWYA 3GNPA 3O9NA 3BLKA 2VURA 3UERA 4YPJA 4P8UA 1UUQA 1HJSA 1HVQA 2Y24A 4QLJA 4CGTA 1V6UA 3CO4A 1W2PA 4HTYA 1VEPA 4W86A 1BSIA 1C8QA 2CBVA 3EDEA 2FH6A 1LG2A 1KCKA 4CCCA 4S3JA 1OCQA 4M24A 2PWGA 3ARXA 4P8VA 1EDQA 2OWWA 1CLXA 5A8PA 4HP5A 1W9UA 1UWUA 1V6WA 2VRJA 4HU0A 4C7FA 2WC7A 4D72A 4LYPA 1I1XA 4DUVA 2IXVA 1V3JA 2OWXA 1KCLA 3II1A 3TA9A 5E6YA 1HP4A 4AYSA 2WVVA 4PMNA 1S46A 3ARYA 2WCGA 3CZEA 3NUKA 5A6JA 1BLIA 4EK7A 2CHNA 4V27A 2J7BA 3SCQA 3L4VA 2AMGA 4MTVA 4AIUA 4N42A 3EYPA 5HBFA 2EBNA 3VGHA 2WMIB 3PTKA 5FL1A 3L4YA 1UR0A 2WCSA 3SCPA 1K9DA 4GQRA 5CJ5A 4HZ7A 1HF6A 5GQBA 3UR8A 2O9PA 5M03A 2JIEA 1J01A 2WLYA 3VMPA 3AIUA 1NQ6A 3A4AA 1QI3A 1W1TA 2WMGA 4JAWA 5D9MA 1E1FA 2GJXB 5ABFA 2WZHA 1NWTA 1UD3A 3ZR5A 2JFEX 1EGZA 4XB3A 1WAWA 4E8CA 1WE5A 1NWSA 1CGVA 1TVPA 2Y8VA 5A2AA 3SCUA 1MQPA 2ZIDA 2WMJA 3DHPA 1H5VA 3NSMA 1YHTA 3HU7A 2VR4A 3GXMA 1LL7A 3BLPX 4D6GA 4IPNB 1FH8A 2ZX7A 5EB8A 4JFTA 2W91A 4A3HA 3CUHA 4PTWA 1BPLB 2BY3A 4PMQA 1E43A 3WUBA 4ACZA 4FLQA 4R27A 3VGFA 4Z2GA 1HXJA 2VC9A 1GVYA 5M3WA 3MANA 2JIWA 2ZXAA 3WF3A 5D8ZA 4BA0A 3AS0A 4M1RA 1GJWA 1QOXA 2WBGA 1V3HA 1E55A 5A1AA 3EBVA 1LG1A 3AZRA 3VIJA 3EDJA 4D71A 1BVZA 4JKKA 1Q4NX 4UFMA 1SMAA 4TTUA 1CLVA 4JCMA 1E4NA 1PIFA 1HL8A 1BYAA 3GNRA 4PMDA 1KXQA 2VZOA 5DO8A 4Z2IA 1NP0A 2QHAA 1W9BM 5I0DA 8A3HA 1H1NA 1NM9A 3UETA 3ZJ6A 3CZ8A 3CUGA 1ITXA 3ZSTA 4CVWA 2VX4A 4CKQA 3WQWA 1W9DM 2VZSA 4BF7A 4PTVA 4ATWA 3L2MA 4K68A 2BHUA 2DQXA 2OSXA 3WNOA 2WVVB 3IAPA 5FCZA 5A6KA 1ECEA 1UWRA 3HJEA 3ZJ8A 2Z1KA 1W9VA 4ZEPA 4EANA 2WVSA 4WLCA 1RH9A 1GORA 3VOCA 4PYSA 4HMCA 3OGSA 2WMFA 1X6LA 1DWGM 2DT0A 4H04A 2ZXDA 1NARA 2WMHA 3AHVA 3FXYA 1JZ5A 3W38A 3M7SA 1BAGA 1VIWA 2UY3A 2XJ7A 2WNWA 3QOKA 4EKJA 1E4LA 4U5IA 2VO5A 4QLKA 3CLWA 2PI6A 4F79A 1ISXA 1U2YA 2FHFA 3AHYA 1E5NA 2O9OA 1G9HA 4X9YA 3PZQA 3VDHA 1EA9C 2YL8A 2D3LA 1OT2A 2ZXQA 4HU8A 3GDBA 3T2OA 2WMIA 2Y5EA 3PZ9A 1QW8A 1C7SA 2PF0A 1JG9A 2O92A 1KR1A 1XD1A 1XD0A 5I6SA 3UG4A 3HMCA 3WBAA 4M81A 3VKKA 3NIYA 5LYRA 2F2HA 1E3XA 2G3MA 2J78A 2EXOA 5GNYA 1ISZA 4AMCA 3VMNA 2W66A 3ALFA 3ARPA 1PJ9A 3MMWA 3VD4A 3ZM8A 2C7FA 1IZJA 2XG9A 1FFQA 4M29A 1SR0A 1V3IA 1E40A 2WWDA 4Z2LA 4MJ4A 5BCAA 1OGSA 1OWQA 4W85A 4CN1A 2CBIA 4E4PA 4AZGA 3W37A 5AC5A 3AS1A 1JZ8A 2Y2WA 1PIGA 1QI4A 4WIWA 1KQZA 1KGWA 2CBUA 2ZX8A 4D6HA 1JYXA 1W1VA 2XM2A 4JHOA 4JHZA 3MMDA 1Q6CA 2XYLA 3AROA 2X8RA 5IFPA 4NSBA 2OLHA 3VD9A 1DWJM 4A4AA 2OSWA 4PMOA 2XWEA 2UY4A 3AMCA 3QR3A 4W8AA 4CD4A 1C93A 4W84A 3WMCA 3WUEA 1GHSA 3RMEA 5BXSA 2YBUA 2UY2A 1PZ2A 2GSJA 1QBBA 1EDTA 4UCFA 2J62A 2X05A 3KEHA 4AC1X 3CTTA 1XH0A 2CHOA 5CGTA 1ODZA 2GJRA 1HT6A 2OSYA 5GNXA 4C7GA 1W9XA 3WN6A 3WQVA 4UTFA 1KGUA 3OLGA 1CENA 3PZIA 3K46A 3ZIZA 1MVYA 5HDRA 2WHKA
chains in the Genus database with same CATH superfamily
2FIQA 3DYMA 2F8QA 1P1MA 4YJ5A 4OUEA 2HEJA 1XYAA 3LZ3A 2J6VA 1EEPA 2PWHA 4F8XA 1G7UA 2C14A 5E6ZA 1W3LA 3RLHA 2FPTA 4M6PA 4GWEA 5EYWA 3S6TA 3WDJA 5K3VA 3VD3A 1JNEA 1H3GA 1ITCA 2DZBA 4JTCA 2GOUA 1AD1A 4CD5A 3TOYA 2IKJA 3FCPA 3EWZA 1IXOA 4ZB0A 3MQTA 2XVPA 3M0HA 4ICNA 1SQ7A 2AQWA 3SM0A 1A47A 1G94A 4NUWA 3DZ1A 3S3GA 1JCNA 2J77A 3U2EA 2ZVIA 2QS8A 2DVXA 2IPFA 2E5BA 5CC7A 1AVAA 1QR7A 5T91A 3RNDA 1A3XA 3P80A 3C3NA 3GU9A 4LUIA 2HK0A 1DL3A 5JIWA 1JXKA 3S2NA 4Y9PA 3K8KA 4U3AA 3M7WA 4HSOA 1FWNA 1LJYA 1FDZA 3R79A 2LLEA 1TVNA 2VFGA 4D6CA 1SSGA 3DKJA 4LGXA 4HMDA 1G4TA 4OV4A 2YSWA 3IIOA 1XLGA 3TQVA 5KSWA 4FOJA 1B90A 3AS3A 2DT1A 2PDCA 4H9YA 1WQ5A 1UWTA 7PTDA 1NY1A 1GZ1A 3S6OA 5EFDA 3KOZA 5CPNA 1X6UA 2E8ZA 1Z48A 4AY7A 3SURA 3CC1A 3CMFA 3K4AA 5C9WA 1SJAA 3FAWA 3CWOX 1KBKA 3KW3A 1KCXA 3LLDA 3M07A 1K70A 1PCWA 2QULA 4LYKA 2VZUA 6TIMA 2F9RA 4WY0F 3U7BA 1LUCB 1ONRA 3HIJA 3TTSA 2AKZA 3KL0A 3SUTA 4HKPA 3QY8A 2R8WA 2Z29A 1K1DA 3BL3A 4OQVA 2POZA 3U2OA 1B3XA 3VA8A 3N12A 2DW7A 4DAIA 3DECA 1VYRA 3VI2A 1NFPA 1CLKA 4DQWA 3LQGA 1NAL1 1MWOA 2BOGX 4HHHA 4HD5A 2V30A 1PDYA 3RRXA 1VFUA 3IRSA 5BXTA 4WDXA 1JDAA 3OODA 4HNLA 3HV9A 3ZMRA 3SCRA 1HKVA 3NEHA 4Q6JA 1ZALA 2DSKA 3G5EA 2VUYA 2EQDA 2IXUA 2MANA 4MG4A 1GONA 1Z69A 3A4JA 3LQLA 1ZJBA 2NSXA 3VGGA 4JICA 4F0KA 2ZRYA 5DRIA 3KS5A 3UG8A 3WJWA 3K5XA 3HN3A 1MXGA 3U48A 2ON3A 4MF4A 3MUAA 3T6CA 1IXPA 2J74A 4O10A 5HAOA 3B9EA 4PMXA 2J9ZA 1UP0A 4MY1A 4L61A 4MZYA 3LBCA 2ABAA 3GC4A 1LLZA 1KBIA 2BBFA 4Q4MA 1WPCA 3J7HA 4GIYA 2HS8A 2XVNA 3V1HA 3AHZA 3AU2A 3RU8X 3H6OA 4KPLA 5EMYA 3NDYA 4QE1A 3W00A 1TQJA 1J9YA 1OY0A 2WMKA 1EJVC 2F6UA 1EUAA 3BLIA 4PZVA 1UJQA 3COTA 4HQVA 5LNUA 4RX0A 3DHUA 2ZADA 5GJNA 2XVKA 4XKMA 5LNVA 3L0NA 1JF5A 4AF0B 1EIBA 3CAWA 1HJQA 3NDZA 2PTDA 4S2BA 4B90A 1VGAA 2R94A 5DMYA 3KDOA 1QNQA 4REQB 2PFHA 3BMVA 3LPPA 3TYBA 1VFHA 4AISA 4GPNA 4WUIA 3OZYA 3MSRA 2RJHA 2V5BA 4DYKA 2FGZA 2FZDA 2VGFA 3N9KA 4M5PA 4WCJA 5FKYA 4Y8FA 3W2MA 4D1IA 3G1DA 1OQFA 2QCCA 1E9ZB 4LF1A 2IW0A 1NVMA 2DJXA 1UUMA 2PWFA 3EMZA 3GZAA 3U4AA 1E3ZA 3E74A 4LF2A 1MDRA 1UR2A 1F74A 1V6YA 2G0WA 4ICCX 1XLBA 2CU0A 4Q7NA 4GX8A 3LMZA 3LPGA 4JIEA 4ZXLA 4QLLA 4IMGA 5CSUA 6ALDA 5HWNA 3NQ7A 2GVEA 1DWAM 3U3HA 3BANA 1VC4A 3R2GA 2DJLA 2ZUMA 3S1VA 3WBXA 4ALDA 3UJFA 3I4KA 5AC7A 4FEZA 2Y4SA 3OGVA 3WNMA 1JZ2A 2QAPA 1QOQA 2HK1A 3RLVA 3MP3A 1A5CA 1VENA 3TONA 1JDEA 3WH9A 2PZ0A 2ALDA 1OD0A 1O5QA 1OD8A 4UFIA 1K6WA 2NQHA 3KWXA 4B3LA 1XW8A 4IXHA 5CLTA 4H8HA 4ZOBA 4MSSA 4AW7A 3WF1A 5FF2A 5CPMA 4YYCA 1UROA 4DF1A 1TV2A 1QBAA 3QVQA 4MY8A 4XAZA 5DQPA 2V3EA 1ZAJA 4PB3A 3E0WA 3VC6A 3EWCA 4AVOA 2VHLA 3OHIA 2DIEA 3G1HA 4XD6A 2P10A 2RDUA 3IUIA 4JCLA 4A8LA 1DQXA 3M0MA 4RW5A 5LZLA 1Z41A 4DJEC 1OIMA 3ZT7A 1HGYA 3CV1A 2ACRA 4RDYA 2BP1A 6CGTA 1XCXA 1S2CA 4ORIA 4NASA 3R10A 1FWHC 3AQUA 3RJYA 4H8NA 7REQA 3GIPA 4ZMGA 2DT2A 5BU6A 2QV4A 4RNIA 1VCGA 3TYAA 1N8FA 2FPYA 1B30A 1FWEC 4AZ6A 1E9LA 1S3HA 2FZMA 1AH0A 2DH2A 1EXBA 3H2FA 4FO4A 3WMLA 5C71A 1UKOA 2Y1HA 4U3CA 3GAKA 1OVDA 4O16A 3S9YA 3C0JA 3UY7A 3ZLHA 4IPJA 3RX4A 4NX5A 4HNOA 2GLKA 3I7RA 3WLTA 1U5VA 2V8ZA 1TA3B 4ILSA 4OWGA 2OX1A 2QKFA 1UHVA 4F0MA 1FHVA 3HZ3A 3VNIA 3SW6A 3HFTA 3RX2A 1A0EA 1UZ4A 2E9BA 4KGJA 4ZVJA 1UASA 2PGRA 1QWKA 1AJ0A 1KRAC 3FW6A 2D2OA 4KMQA 3ZSSA 1J11A 2Y63A 1XUUA 3VAVA 1TE1A 2YKKA 3KE0A 4S3EA 4KRUA 4NJJA 4Q8NA 5HA7A 1XH1A 3BXWA 2DT3A 1W3IA 3DIPA 3UWVA 3KCJA 3QW4B 1QFEA 2ZDSA 4QQ3A 4XX6A 3STPA 4H2CA 2BNJA 3H4WA 3S2JA 1UIPA 5KITA 2ANUA 4HMNA 5C9RA 3FYYA 3VABA 4OBTA 2R91A 1JZ4A 5AYYA 4RPPA 1EIXA 4JOMA 1U33A 1NOWA 3KFTA 4HA0A 3W7HA 3L4WA 1W3JA 4FS9A 2XIIA 4GUJA 3QXBA 1HO4A 2INFA 3W6MA 4JY8A 2WJDA 4NZFA 4F0SA 1YPFA 5JMUA 3UJSA 3B8DA 4XO6A 4BWLA 3O0FA 3TK7A 1RY0A 3WZ0E 2Q6ZA 3AIBA 3P3BA 4DXXA 1V6XA 4RDZA 3B8SA 3KVJA 3UG3A 3TCEA 4ZQNA 1BGAA 1CXKA 1J5SA 3QY6A 2J4GA 4LUJA 5G2HA 5LGZA 1P0BA 3GVWA 3W7EA 3AOFA 1C29A 2W9MA 1DOSA 3F4VA 2G3IA 4CN4A 4X2PA 3HV8A 4AEEA 1VH7A 4M80A 1M68A 3CHDA 3MUXA 4Q8MA 5CAKA 1BVWA 2DVUA 2E40A 2GSHA 3OLIA 3MI2A 3HQ1A 1KXTA 2W0UA 3NQVA 3N13A 3W1UA 1DHPA 1BHGA 1J0JA 5AC8A 2VEPA 4P8WA 4ORMA 2BWGA 2EPHA 2GJXA 1QHOA 5DBUA 2OKOA 3OG2A 2NWRA 4PUKA 1XS2A 4F9JA 1E15A 3LB0A 1V02A 3N3TA 4GYJA 4TVDA 1TPFA 4Y6GA 3G1XA 4QEEA 1BFNA 4L6OA 1HIZA 4IQJA 5M17A 1TSIA 3WJYA 1FWGC 2YZRA 4J7RA 4DF2A 4POCA 3ZT5A 2NW0A 3SR7A 2QMJA 1HW6A 1QPKA 5HNUA 1JFXA 1EWEA 4ZTXA 2AL2A 3UZZA 2OJPA 3LGGA 2QVHA 1KW1A 1PYMA 4EVZA 1G0CA 3H53A 5FF3A 4UOZA 4TMBA 4H83A 1DJWA 5C2CA 3N17A 2QDGA 3SADA 5EBAA 3VFLA 4JN8A 5ABEA 3KP1A 3N1AA 3GU2A 3ZS4A 4UTKA 2VR2A 4WJXA 3WK2A 5MKGA 2HNEA 3B0UX 1WZKA 1S3TC 3VM5A 3GLCA 3FA5A 3TW9A 1GPWA 4NJHA 2ZA3A 4YIWA 3PTDA 3NQEA 1M9HA 2PRLA 4NZ3A 4JS3A 3R58A 2WOQA 1X7FA 2NVDA 4RXGA 1W32A 1H62A 2EPKX 4H9XA 1EP2A 1P1XA 2BSLA 4QS5A 3EOUA 2V38A 4RZ6A 5CZTA 4GFIA 1E4MM 1H0GA 5JBEA 1YBQA 2XN1A 1PKLA 2A3CA 1OCNA 3EPOA 4LC6A 5CGMA 1HFBA 1GW9A 3NM3A 4XBKA 2XUCA 2ADAA 2BOFX 3DFYA 2V9DA 4UTIA 2JKAA 3AMLA 3JR2A 2ZZ6A 2IQ0A 3PB2A 1R7AA 1QHPA 4GNKB 3HF3A 2HVNA 2J79A 3F7JA 2VWSA 3LHUA 1RCQA 1W3KA 3GR7A 4N6EA 1P6BA 3WDQA 5IBXC 6REQB 3XISA 1XM3A 4ML9A 1AUSL 5AYXA 3H26A 2V2DA 3M4HA 3PWGA 2BVDA 3AZTA 1GWJA 2F6KA 2PP1A 2X1SA 4X0VA 4XBSA 1MRQA 2Q8XA 1GQNA 1EX1A 3L9CA 1Q2SA 1IYXA 1ICPA 1KQYA 3O15A 4QJ3B 4FSAA 3DFPA 3GDTA 4CU6A 4AD3A 1TWSA 3ZR6A 4PE8A 1AZ2A 1JGMA 5FESA 4IT1A 3TXVA 2OQHA 1F05A 4KEMA 3AUJA 1C91A 1A80A 1ME7A 2Y5SA 3PZGA 1QCWA 1VZWA 3UR7A 1XV8A 4H7ZA 3ABXA 1EX5A 3PK7A 4OVXA 4ZB5A 1H4PA 1NOUA 1B4EA 3BSGA 3ARWA 3F4WA 1G4PA 3DG3A 2Z2BA 1GVEA 5IDIA 1E4IA 4EWJA 1YPXA 4RZBA 3EDDA 1IIHA 4G6CA 4UQ9A 4ADTA 1JZ6A 4XK2A 2PBOA 5F2MA 3CJPA 5F2IA 2C91A 4ZO8A 4MJ2A 4WOQA 4HHLA 4JTRA 3EX3A 5MKGB 3W88A 1QK2A 4G7FA 4R7JA 1N82A 3B8TA 2A3HA 3ARZA 4QR6A 1JI2A 3W28A 2V5KA 2ZE0A 3L2LA 1CGTA 3G1SA 3CNYA 3D47A 1IWPA 4UR8A 4JQAA 5AHLA 3EA2A 3VNZA 3T7VA 3NO1A 4OOUA 2XVGA 3W4RA 1ISWA 3OBKA 3AXXA 3H12A 4V1YA 4UQAA 2VQTA 3GHRA 3DAQA 3ORWA 3CH0A 4GI6A 2J88A 4BCEA 1Q7ZA 3GFZA 1ADSA 4OV9A 5K2ZA 4ZENA 1VAHA 4YNGA 3BOXA 3W23A 3RYSA 4FF5A 3ARRA 5E9AA 3BLOA 1U1HA 1XH2A 3KHJA 3KBMA 3U5YA 1HJVA 1K9EA 1UPMB 1LF1A 3D0CA 3CHEA 1E70M 2J7FA 1D7FA 2ZX9A 4AXNA 1GOKA 1OYCA 1IT8A 3I68A 4YCPA 1QI2A 1VFMA 3DBPA 1WZAA 1XLAA 3NL3A 3NQ2A 5FI8A 3S0CA 2PUZA 1TO3A 1TIWA 1FVPA 3VUSA 1SMDA 4IQDA 3DFSA 4B5WA 4Z1CA 4QS6A 4FXSA 3BAIA 4CNUA 1XDJA 3CQIA 1BF6A 1W6TA 2BB0A 4NQ1A 4I3GA 3VOHA 1RBAA 4OHQA 4ZO7A 8XIMA 4L4MA 2QF7A 4UOQA 2WQPA 2WVTA 3CPUA 4AF0A 5BOEA 4H6KA 3VILA 2NQ9A 3G18A 1VIZA 3F1QA 3DG7A 1BSLA 4BZYA 1DE6A 1PEZA 3UWWA 5ABTA 2XFFA 4G5DA 3T78A 3C0QA 2OODA 4BY3A 4QJ4B 5JH1A 3ERPA 1UD8A 2QGHA 3PJUA 4MNKA 1KFLA 3PHAA 2ZTJA 3CL7A 3CWHA 4LV4A 4K8EA 5JH2A 1MNZA 1XG4A 3BQ6A 4FP1A 1PHQA 3KZSA 1XICA 3PZTA 3OVPA 1YX1A 3WQ4A 3M41A 4GYPA 3T2PA 1K9TA 2HQAA 3WBYA 3WQFA 3PTMA 2YCEA 1H7OA 3CEPA 1TMLA 3OHMB 3KS6A 2OZ0A 3UP8A 3WLQA 2PCEA 2FJKA 3QYQA 4Q8TA 4S1FA 3MMTA 1ISYA 4B5UA 3GXPA 4FLSA 2XFYA 1UW9A 3GH4A 3T08A 2I16A 5TQLA 3WH7A 1WB0A 3TW6A 3HPSA 4LUSB 1XYMA 5K9DA 1IE7C 2J6XA 1Q4WA 1G67A 2VENA 1O4UA 1TWIA 1C90A 3A24A 3BG9A 3GNDA 4IMEA 4JFUA 3UA3A 2CIPA 4TVCA 3FDKA 2ZRZA 1G6CA 1WUFA 4D6JA 1HTIA 2B7NA 2YIHA 4E2OA 1TMQA 2NUXA 1VFTA 3VX1A 5H1WA 2A3EA 4LT9A 5XIAA 3GXFA 3O2LA 3WDHA 3NQBA 1LLWA 3WLPA 3ABQA 1ME9A 1O68A 4F3HA 6TAAA 5IDZA 2WLZA 1RVGA 2PDMA 3UG5A 3W75A 1GOXA 3B4YA 3AYSA 4NNBA 4IGSA 2IUZA 3E1F1 3MBFA 4FXRA 4Y8EA 3HPAA 4JNYA 1TA3A 4LWWA 3O8AA 2G5WA 1DE5A 2XSBA 1YDNA 4XAPA 1PO9A 3D5HA 1EHNA 1Q7QA 5E5CA 1WZMA 1B2YA 1V02E 4QJ5B 2YA0A 2J8FA 2Q02A 1W5PA 1GZJA 3TQKA 1WDRA 5GVJA 3TX9A 1EJXC 3G1RA 4CNNA 1RXOB 2C19A 4F48A 4HA4A 3F2DA 4L1GA 5A8QA 3E0VA 2XGZA 3GNOA 4DWSC 1IEWA 1OCBA 3QHMA 3W7MA 2C1IA 1T41A 2E67A 3PPFA 2CZ5A 3V0SA 3B9AA 3KLLA 1JI1A 2OB3A 2CXEA 3C2YA 1EYWA 1V6VA 1EEXA 3B4UA 3A12A 2QIIA 2Q3RA 5DN1A 4DY1A 3VNJA 2H8ZA 4IMAA 3UZYA 4Q8QA 3BARA 3C5QA 1Q6EA 1FDYA 4G7EA 2V5DA 1X1NA 2Z26A 5H8MA 3EGJA 3WK1A 4MFEA 1X98A 1XINA 1H11A 4AG0A 4JTLA 1RJQA 5K4ZA 2Q8ZA 4FNRA 3WLHA 3ANVA 1J18A 2D0GA 4AWTA 3LHZA 2VCCA 3QR0A 3VIFA 3GDKA 2PMQA 2WWCA 2CETA 1EGMA 2REQB 3I10A 3AJ7A 1NU5A 4UFKA 1M7OA 3T44A 2X09A 2AAMA 3BAKA 3MV11 4GXMA 4M8UA 1QJWA 1OC6A 5E93A 1R3TA 3MV01 3BAJA 3AHTA 1OT1A 1XI3A 3ZT6A 1I2NA 3BQ5A 1SJDA 3FHAA 3MO4A 4G8TA 5DXXA 2PWEA 4FIRA 1QW9A 3LDVA 4WGXA 2DZXA 2E6FA 1JQVA 3M6YA 1LL4A 4L4LA 4PBGA 3ARVA 2A0NA 4PH6A 3LXBA 1DTUA 1JPMA 2I57A 3OA3A 4UNIA 2YPIA 4GA8A 2GK1B 1FWJC 4HVXA 3NOEA 4XBJA 1OX6A 4EIVA 2NT1A 3IJ8A 4W89A 2PRMA 3UESA 4GOAA 1JJKA 2QMKA 4J2PA 3QGVA 3S42A 1D3CA 1KC7A 3IIZA 2WC4A 4PMUA 1TKKA 1LORA 1LQ2A 2PGEA 1EPXA 2ZWYA 1QMLA 1W17A 3ID7A 4L64A 4OZOA 3P81A 1BRLA 1GVIA 3T07A 1JIBA 4GXPA 1AD4A 3BLKA 3H7RA 2QQ6A 1L6YA 4X61A 3UERA 4YPJA 4H9VA 3LK6A 6REQA 2E6AA 5FJRA 1MUWA 1V6UA 1W2PA 4HTYA 2ZRXA 2OO0A 3H2MA 1BKHA 1BSIA 3W1AA 1JULA 3NQFA 3LLXA 4YL2A 3UXIA 4L7ZA 3V36A 1OCQA 3CEUA 1SUXA 5A8PA 3T4WA 1SU5A 1UWUA 1TWWA 2VGBA 2VRJA 2ZVRA 4JR5A 3MCOA 1HP4A 1BWKA 4C5YA 3VNMA 1S46A 2WCGA 5C7VA 1P4CA 4F0HA 1KBJA 4EK7A 3M0YA 4ZR8A 5B7YA 4HB7A 4AIUA 1YE4A 2PAJA 5HMEA 4LBSA 2ASHA 2EJAA 3CWNA 2VUNA 4M1BA 4GH1A 3W2UA 2V67A 5GQBA 2P50A 4ECLA 3VMPA 1NQ6A 4FHAA 1W1TA 2NV9A 4LJ3A 2WMGA 4H9UA 1E1FA 4LB4A 3PPCA 2Z1XA 4FXJA 4J5NA 4L6HA 3KRBA 1M7JA 2NQJA 2JFEX 4XB3A 3CAQA 1WAWA 1WE5A 2QCFA 3UXAA 1CGVA 4Z1DA 4M6QA 1LBMA 1H5VA 2QUVA 1I45A 3B04A 4GE8A 3HU7A 3WLRA 3NDOA 3BLPX 1ZQ5A 2I1OA 4D6GA 1OJXA 4RR4A 5B7ZA 2NVCA 3W86A 4P61A 3OZMA 4PTWA 1BPLB 2BY3A 4PMQA 1TPUA 4C1NA 1H7WA 1K7FA 3N2XA 4Z2GA 1Y5VA 5M1TA 1HXJA 3VFCA 5M3WA 1GVRA 2ZXAA 1TRIA 1QOXA 2WBGA 3QRHA 1V3HA 2ONEA 1XDLA 1LG1A 1PWMA 3VIJA 4NYUA 4NXSA 4D71A 1BVZA 1W0MA 2GQ9A 4JKKA 4JCMA 1E4NA 1RBOB 2NXHA 4O0KA 3QC3A 4KQNA 3CIWA 4D9PA 4IUOA 3CYVA 5DO8A 4QISA 3OVGA 4Z2IA 1W9BM 2QUUA 1OFQA 3ABRA 1FKXA 4K6AA 5JQ9A 3S46A 3ZJ6A 1QASA 2PPGA 1ITXA 4DBSA 2QPXA 1CCWB 3CQHA 1EBGA 5FJJA 2QJNA 2DQXA 4K68A 3L2MA 1TPEA 2WNNA 1TVLA 3WLKX 3LHTA 1UWRA 2Z1KA 2ZBTA 3W02A 1LZOA 4EANA 2WSYA 3LN3A 4HHMA 4WLCA 4HYWA 3VOCA 3LV6A 3W7IA 3MT1A 3IVUA 2ZXDA 3UD6A 3AHVA 4L56A 4XKYA 3W38A 4C6EA 2DIKA 1PDZA 1YW1A 1VIWA 3QOKA 3QV7A 4U5IA 2BVWA 2PI6A 1IXNA 1F61A 3MY9A 1IF2A 4F2BA 1XPGA 2GGHA 1RY8A 4WDTA 3VOIA 4YWIA 3W1NA 3O0KA 3ES8A 2WM1A 3ITLA 3VDHA 1EA9C 2ZXQA 3BG3A 2QAFA 3N2TA 3GDBA 1Z44A 1X39A 3IS4A 3T2OA 2Y5EA 2PE4A 2HSAA 5EY5A 3WLLA 4B91A 1AH4A 2O92A 2QCLA 4AWUA 4JQ4A 3GW3A 1HKWA 4O18A 1XD0A 4XZNX 2Z2UA 2Z6IA 1SO3A 3VKCA 4DRSA 3SRFA 3QJAA 4PCFA 3VKKA 4ZODA 3V1PA 1J5TA 1Q65A 3GVGA 1OFPA 2QJJA 3NIYA 4DO7A 2F2HA 1GVSA 4XO7A 3S5SA 3JS3A 2EXOA 3NVDA 1UC5A 5FAGA 3WX7A 1GK8A 3VMNA 1AL7A 2L5HA 5LIWX 1K3UA 1XKYA 1Q66A 1IZJA 2XG9A 1FWWA 3OVQA 1FFQA 4M29A 4AB4A 4Z2LA 4MJ4A 3NZQA 3C2OA 5BCAA 1OGSA 4LEFA 4W85A 4CN1A 4IIFA 2CBIA 5I3JA 5G1YA 3VZZA 3AS1A 1ADDA 1HUVA 3DX5A 4OECA 2XM2A 1POJA 4JHOA 1TE6A 4XUGA 1LTDA 2XSXA 4NSBA 2R24A 3VD9A 3MHFA 1ECQA 5DX7A 1WXYA 3SGZA 3CM4A 4W8AA 3QR1A 4CD4A 4DJFC 1I2OA 1VPYA 4H19A 2NX1A 3O6YX 2GOKA 4GRSA 1N8IA 2PDYA 4J40A 4JD4A 1PZ2A 2GSJA 2XDFA 4MKNA 4UCFA 2J62A 3QBUA 2X05A 3KEHA 4QQUA 1YEYA 3CTTA 1C9DA 1ODZA 4MYXA 1OZQA 1W9XA 2ZRWA 3RLGA 3WN6A 2DVTA 1R3WA 3HG2A 3EX2A 2CWNA 4EPBC 3P93A 1FX6A 1J93A 3CZKA 4OU1A 1UMYA 4OJYA 3AO0A 4H8UA 1QPOA 2GUUA 4PUMA 2W3ZA 3HOJA 3S2CA 4AHQA 1KFEA 3WFLA 2Z1BA 1XIBA 4JTAA 1TTPA 3KBSA 1T0OA 2I17A 1WKFA 5AFDA 4E6MA 3K1GA 1FDJA 4PBFA 4KCVA 1OGBA 5HINA 3E0FA 4LRSA 3ARQA 4KEZA 4LH8A 1LRTA 1PUDA 2QYGA 1TPVA 4S23A 5AHEA 4KH2A 1N2VA 3N3MA 3PBWA 1RVKA 2GWNA 1TUXA 4JQ3A 3NPXA 2JF6A 3BCFA 3KVKA 3F4CA 3L66A 1AMYA 1GPFA 2P3ZA 4PR4A 1DXIA 4J3SA 1EJ7L 4TX8A 1KB3A 1Y7VA 3V35A 1F6KA 4MDOA 3VDAA 5IXEA 2BZNA 2XGIA 3W22A 3SRKA 5CAHA 4AZCA 4P5UA 4Q4QA 1UWQA 4YVXA 4JX6A 3LYEA 3LX9A 4OGZA 5H8UA 2Y62A 5A6MA 1CXEA 1A0CA 2GGIA 3AIWA 4NVTA 4IWWA 1V5XA 4GO9A 3PZNA 4N9CA 3BJTA 3VDBA 5I3DA 5LIUX 1WDSA 1B9ZA 3R0UA 3CXOA 2PDBA 5TNVA 2PF8A 4CEUC 2FZNA 2G4JA 4Q3MA 4E2BA 3AIQA 4D8ZA 1EC9A 3ATYA 5REQB 3G1FA 3OB8A 1F3WA 1J0IA 4AX7A 4DO6A 1A0DA 4KWWA 3WH5A 4J3UA 1UBSA 2Y89A 4H2HA 4OBSA 4QEHA 1MQRA 1AQHA 1GTEA 4JY9A 3VE9A 5CLWA 2PDNA 3IK4A 1DORA 2O7SA 4MB5A 4GMEA 2HTMA 3G24A 3ITYA 1RR2A 3TR9A 2ACQA 1FCBA 4AH7A 3SJNA 3W76A 1A3HA 2DP3A 3PZOA 4G9PA 1JGIA 3WEMA 3OVRA 4IJRA 4MJMA 1SFLA 2OQLA 2V5JA 3ARSA 5JXQA 4ZOEA 3TQ0A 2FPVA 4NF7A 4OE7A 1FWDC 4GIAA 5I5RA 1ISVA 4QNWA 3DC8A 3A4WA 4QG8A 3HG4A 4Y96A 4H9TA 1P48A 5L6UA 3C86A 3RCMA 3NSNA 2P3EA 1RV8A 1V03A 4RJEA 4DLMA 3GH7A 1R8LA 1UR1A 1BQCA 2JGYA 3W72A 2Y0FA 3SEPA 4PN2A 2V5CA 2VVNA 2Z0IA 5JIPA 1EYEA 2UV8G 1F3EA 2YA2A 3QZEA 1E6SM 4IM4A 2OYLA 1QWGA 3CUXA 3RCNA 4FB7A 3R25A 1YXDA 2CZDA 4XD5A 1K8YA 2Z1WA 2O0TA 3M0ZA 1J0KA 3A13A 2C15A 4JL2A 3IV3A 1BXCA 3QGKC 1DEDA 1LT8A 3OTRA 1IEIA 2VJXA 1UCWA 2J8GA 2F84A 1VR6A 4A3RA 3G77A 1BQGA 3W07A 4ERAA 1THFD 2W92A 4WK9A 4EPEC 3L0GA 2J9XA 5FIPA 1F7BA 1OG0A 4UTTA 7ODCA 3U0HA 1CBGA 1LBFA 1OF6A 3C0SA 3SUVA 1H2JA 3NWRA 2BASA 3EB4A 3S5NA 4H7CA 4A8IA 4O15A 2REQA 1N7KA 4PRRA 3VNDA 1KNWA 4LVFA 1W9PA 4MIMA 4PSPA 9XIMA 4KW2A 2Z28A 2ZUWA 3WNKA 3ZXWA 2DZPA 2YCKX 1E1CA 5EGRA 3R94A 2OWCA 1V77A 2OYMA 2J7GA 4MDPA 4X0NA 5KZDA 1RD6A 1I75A 4DM1A 4WHBA 3RIKA 3TW7A 2PLJA 3A47A 4ZZ9A 1RLDA 2BXYA 3G22A 2EO7A 1CXFA 2AMXA 3QSTA 4XQ6A 1Q63A 3GO2A 3BW3A 4L4PA 3A6OA 2OEMA 1WAUA 4HPHA 5C9ZA 1VD6A 2YDSA 5D05A 1FHDA 1F9CA 3IGXA 2JALA 3THCA 4WQ6A 5DF0A 3TC6A 3NQ8A 3N15A 3MUY1 3WF2A 2FKPA 4MADA 3FEQA 1QPQA 3O7UA 3AICA 1ZB5A 1HX0A 4GJ1A 1WCGA 3PY2A 4NAEB 5F4SA 3C2EA 3WH8A 1RJRA 4CUCA 1QAPA 1KBBA 3URQA 6XIMA 4IFKA 1GEHA 1RQEA 2PTYA 4EXBA 3KP0A 4YTUA 1I9CB 3MCNA 4M0XA 3IJDA 3T8QA 2Y5JA 1F3TA 4MWAB 1TFVA 3LCHA 4GYFA 4LYRA 5ABGA 3CU2A 4JFVA 3GW0A 2CNCA 3VVGA 4ZGYA 1A50A 4C1LA 1UKPA 3E6EA 4GVGA 4PCSA 2QCGA 4I8YA 4CNOA 1V4YA 1W8GA 3VMOA 2E6DA 1US2A 4W93A 2GUBA 2EG6A 5DMNA 3OG3A 1JNDA 2VNCA 1RUSA 3BW2A 3KL5A 1M53A 4YS1A 1SW7A 3BMWA 1AL8A 2WCAA 3ECQA 4I9JA 3OLDA 3B0YA 2AQVA 5I3GA 1OABA 1GQJA 1BF2A 3VO0A 1ZENA 3PNZA 4GD0A 1I0DA 4LY8A 3VD7A 1H5YA 2YOCA 3EOOA 1DWFM 2W5FA 3AJXA 9CGTA 3B9OA 3CK5A 3GKFA 1M03A 4FNQA 2VZTA 3R6IA 4UNLA 4IUGA 5AN7A 4L1XA 2HMCA 3BG5A 2Y70A 2BVYA 3MHUA 3PUGA 4GH3A 3L12A 4C6LA 1S1RA 5HPOA 1TV3A 4M82A 3NCOA 2VDGA 3W0KA 4AMAA 2JKPA 4DLFA 1O1HA 1WDPA 4S3GA 2W63A 1D2KA 4FOKA 3AIRA 4YVVA 5BWAA 2H3DA 4KWVA 1WDDA 3AMKA 4DELA 1TMHA 2DUZA 3QYSA 4LYQA 4FOUA 1IGSA 3P8IA 2ZA2A 3L0KA 4GQQA 3EWUA 4MB3A 4LRTA 2G37A 3CHCA 4DVOA 3G0SA 5LHEA 3PJXA 4MZ8A 3W2KA 5KZMA 3MZ2A 1CB2A 4J3VA 1DIOA 2VCBA 3F5KA 1YTDA 4CQDA 4J3WA 1E5JA 4B3ZA 4HMEA 3WNPA 3LCWA 2PLMA 4PODA 4FI4A 2QT3A 4PRTA 4LUSA 2X1RA 3SB0A 2AGTA 3BO9A 1W91A 4NZ4A 3M0IA 2IPWA 1TPC1 4H9ZA 4ZA0A 3TNOA 1V3KA 5T26A 4NI3A 2XH4A 4I7VA 4NKCA 2NQZA 3MP5A 4XD4A 3ENLA 4BQ2A 3CV7A 1EJSC 1X1ZA 5DT7A 5A5WA 5BWFA 4U33A 2XZ9A 5LNRA 3WUFA 3LCLA 4XZWA 3UVIA 3P7YA 4JXCA 2CLEA 3EDKA 3AXHA 4GJJA 4FNPA 4ENLA 1R3QA 3T09A 4O0ZA 2QCDB 4IOTA 3W27A 3CQ0A 1JCLA 3GH5A 2DSVA 4JHMA 4GINA 1Q6GA 4FMVA 2QEZA 1SPQA 1XLMA 3NA8A 2GDVA 2X1TA 2ZZ1A 4JEQA 1LDCA 1MW0A 4LBRA 4GXWA 4JGDA 1JUBA 4QHRA 5HK4A 4JTQA 3UVAA 4O1DA 4Y90A 4GUIA 4YYFA 4GI8A 3EWDA 5D02A 1LQAA 3WELA 3T0CA 1UA3A 1ZBWA 4MNJA 3SY5A 1W1ZA 3VD5A 1MZHA 4MOZA 1KO0A 1GKRA 3C8FA 1XIIA 4QDPA 3H24A 1P0NA 4GLEA 4D2JA 1YLVA 3IJLA 4UFLA 1NDZA 1MEWA 2C1HA 3GDMA 5A2CA 2DSUA 5EL1A 3R11A 4Y9MA 1QO5A 1I1WA 1R9YA 4L9YA 2BY2A 1KFCA 3DOPA 3BW4A 1T8QA 3KRZA 2RDXA 4MLRA 1T99A 4HCDA 1DJHA 1C8VA 3URNA 1DJXA 1XSIA 3GS6A 3FV9A 3BMXA 3R4IA 2CC0A 1OM0A 5HQMA 4P7LA 3ZYZA 3STFA 3EAUA 2Y85A 3VIGA 3B8UA 4LXFA 4ICMA 1AFSA 3R0KA 2G3FA 4AHPA 1JEZA 1U1UA 1L6SA 4Q4OA 3NG3A 3HFYA 3T42A 3REQB 1EZWA 3CQJA 4YU1A 4GKLA 1WZLA 1UYQA 4W88A 2ZUTA 2V81A 3TLQA 4D6DA 3MC5A 3Q45A 4ZSUA 4PEEA 2QCMA 4DAFA 3AXMA 2VOTA 1C8XA 1S2UA 4IHCA 3P60A 4HCHA 1H1YA 4W8LA 1OFBA 3VK5A 2BXZA 3R8GA 4ZFMA 4XSMA 3TTQA 4Y2WA 4A29A 5AY7A 2XINA 4FALA 2FGBA 4NRSA 5BMXA 4MZ1A 5G1TA 3U9IA 4WSKA 2AKMA 4G7EB 4FIQA 4LQ1A 2DZAA 1QT1A 1UR8A 3GG0A 1ZRQA 3S5ZA 4DN1A 1R9ZA 3N34A 4XIMA 4UMBA 4BS0A 2TYSA 2J9YA 4R3UA 2G8ZA 1DIKA 2VVSA 3GXNA 4ZQRA 3MHGA 3FJLA 2AGKA 2OT0A 4EF8A 3H55A 4Q22A 2EGZA 5LIXX 1E0XA 2VC6A 2WW5A 4JBRA 3DGRA 3UW6A 4RPQA 2FMNA 5BOFA 5CZSA 1K03A 5KZ6A 3SIMA 2VFIA 4A05A 5T9CE 3G6MA 1T6MA 3V4BA 3BLFA 4MNMA 3PC0A 4LPCA 5DFAA 3LRMA 2P0OA 2FTPA 3S5OA 3W1PA 5C8BB 3UFYA 5LIYX 4NRRA 1AA1B 3NZ1A 2NUWA 3MMUA 5CC5A 1JRCA 3RR4A 3RO6A 2GUYA 1B3WA 3WLSA 3GUWA 4GZJA 3IACA 1A4MA 1QI5A 3LSCA 3RRAA 1EF2A 1XIHA 1C7TA 3WLNA 3ELFA 4RCXA 3QHOA 4AAJA 1V0MA 4IJBA 3W74A 3VCRA 4D6IA 4MLJA 1CX9A 3EDFA 9XIAA 5XINA 3ZJ7A 1UH3A 2ISFA 3GDLA 1EZ2A 1WXJA 1JUKA 1ZJAA 4J3TA 3L7RA 1KD0A 3S83A 6ENLA 3UNTA 4LCRA 3APTA 4GQBA 5HQEA 1HKKA 4JYDA 4NZJA 1HNYA 4DBEA 3GVRA 3CGTA 3KBNA 1US3A 3ANUA 4TQTA 2PURA 3IIPA 3SCTA 3GQYA 2C0HA 7TAAA 5CPSA 4XUYA 1F76A 4IMDA 3D3AA 2EF9A 5FF4A 2QDHA 3A3HA 4P8XA 2FGLA 3C0LA 3DFOA 5AYZA 4K2SA 3HPZA 1PBGA 5J5DA 1UD4A 1MYRA 3K13A 2DIJA 2TPSA 5CEWA 1LUCA 1I6NA 1VYSX 1CPUA 3GC2A 3W7CA 5FEZA 3CBWA 1S2WA 1X6NA 3N73A 3WD4A 2QCHA 2ACSA 2G3JA 4HNVA 3S2MA 1H60A 4ERGA 2G4FA 2WPGA 1DJNA 4AZ5A 1B1YA 1LQ0A 5I78A 3SRHA 4AD0A 1VJIA 2PB1A 3ITGA 1L8NA 2CYGA 1ZBCA 3TN3A 1E1CB 1MFUA 1FH7A 2OMAA 2BTMA 2JBMA 2VP8A 5E70A 4FK9A 3Q94A 3VDCA 3B9DA 4AZ7A 3SCSA 4UZSA 1W1A1 4FX8A 4WXYA 3I3BA 4HT3A 3REQA 1P6WA 1R7OA 3G1YA 1BTCA 3N2MA 2ZUSA 4CQBA 4PGLA 4RNFA 2YCLA 1Q3NA 3WF0A 5FD0A 4XV0A 4NU7A 1B3OA 1W5MA 1PE1A 4IIHA 4WRHA 1ZSXA 1HO1A 2YR1A 3G3MA 3W25A 3N04A 3O3RA 3CIVA 4TTGA 4LEQA 3WDPP 3R7MA 4LNCA 1ITUA 2H90A 1JYWA 4FR6A 2ATMA 3TROA 2BY0A 4C5ZA 4L6DA 2ZUNA 2H3BA 2EPNA 3B03A 5DMLA 3QKEA 3LENA 2OG9A 1TRDA 1S5NA 5F4WA 4M3PA 3WF4A 1PB0A 2PDIA 3NO5A 4R9OA 2V3DA 3FDGA 3UWQA 5CPQA 4V2XA 3ES7A 1HQTA 5E1QA 3PNUA 1XYCA 1XYZA 1ZAHA 1JCXA 4IIEA 3CHFA 1SZEA 3PBVA 5M5DA 3TJIA 2CERA 4ES4A 2Q01A 3AIEA 3BAXA 4B5VA 1J10A 1YNYA 1FXPA 2WPBA 5ABFB 3I7SA 4PB5A 1XLEA 3HPXA 2WAGA 4W9TA 2FH8A 3TEVA 4S3CA 1KA9F 4R88A 4WF7A 2WKJA 3H22A 3SUUA 3CZJA 2B7PA 3QW3A 2VT0A 2CLHA 3PM6A 4YTRA 5FAJA 1UIOA 2P1FA 3PG8A 3AYVA 3AXKA 2DUAA 2HV5A 2VI0A 4FNUA 1SO4A 2WO5A 4PMVA 1H61A 4FX7A 3UGVA 3OW1A 1S2TA 4Z2HA 4C6KA 3KOWA 1HVXA 4LUTB 1KFBA 4HZ6A 2EAWA 1L2QA 4CCDA 1KM4A 5LKYA 1OHLA 1B9BA 2RGLA 3MDUA 3THAA 1TPH1 1W56A 4MPKA 5BNKA 5D4YA 4TX9A 1AW1A 1EBHA 3EXRA 4GC3A 4KEUA 4A6GA 2JEPA 2PDQA 3N4FA 4DJEA 1W31A 5JUVA 3I6TA 3USBA 1MXDA 1M01A 1EOKA 3EWBX 1EOMA 1HKMA 2FMOA 5HPCA 1D3GA 3NQ6A 1IV8A 3W83A 2XPKA 1XIDA 3VUPA 3O07A 1V51A 3BGAA 4J35A 4KRTA 2V82A 3W1TA 3EB3A 4A21A 1OFDA 1MZRA 4KIEA 4E5TA 5BRQA 1R46A 4NJIA 3BCDA 4F9DA 4LVGA 1FP9A 4LX4A 5C9XA 3IV8A 3SFKA 4JTGA 4NT0A 1BXNA 3URBA 3WKZA 4FX6M 2R1PA 2OLAA 3S5YA 1E6XM 3WNNA 4JTTA 4V33A 4UR9A 3E0IA 4DWSA 2Z2AA 3AAMA 1RCXB 4IL2A 4TMCA 4PUDA 4B15A 2HNHA 5REQA 1VCFA 3FSTA 2CXGA 3TZNA 1VHCA 2OELA 1XYBA 3FA3A 5CSYA 2X0HA 2JF7A 3WDRA 4P7RA 7REQB 3FN9A 2ESCA 1X8CA 4JTUA 5A69A 4D6FA 3LCIA 4I7UA 1Y8BA 3OZPA 4K1WA 3ARUA 3TN6A 3CUIA 1ALDA 1IWBA 3RCYA 2GDQA 3WH6A 2YL9A 1XBXA 1Y5WA 4ZQOA 2C16A 3FLUA 1OF8A 1SJBA 4U4MA 4D1JA 1RCOB 1CGUA 4DYEA 2BS9A 2J47A 2HXUA 1ELSA 5J5RA 1SVDA 1MW3A 3BV7A 3FY1A 1LOSA 4NNCA 4GJIA 2UWFA 3BV4A 1VRXA 3EA3A 2V63A 5G4WA 3ALGA 3G3DA 1K7EA 4QROA 2FZBA 4DPQA 4ZOAA 1PTDA 4GHRA 2YLLA 1PV8A 1UOKA 2W61A 3IK2A 3KTXA 3HA1A 5C55A 3TJ4A 4LS1A 4D8LA 4GY1A 1W1PA 2CLFA 4Q33A 1R47A 4QDMA 4PB4A 1TCDA 4D8AA 1E73M 2PDJA 1PCKA 3WDIA 1HJUA 2Y7DA 3DI1A 1OC7A 4KRZA 3UPWA 3KVLA 3UWYA 4AEOA 1US0A 5CZKA 1EHAA 4RE3A 2YXOA 3FGCB 1VB9A 4Q4SA 2AL1A 4DF0A 3SY1A 3C4UA 1GVOA 1F6YA 4AYGA 4BJHA 4S3AA 2F2KA 3PPGA 4O1CA 4K7YA 5CJMA 3GK0A 3QV8A 1YADA 5CBIA 3L67A 2XIOA 4GGBA 1GT8A 1QATA 1KBLA 4HCLA 2BY1A 2OEJA 2NLYA 4A3UA 2JKEA 2DH3A 4HK5A 2VEFA 2NQ5A 4C7DA 2VGIA 3FJ4A 5H6HA 3UT0A 4O50A 3CB3A 1CWYA 3GNPA 4JTSA 3O16A 1GG1A 3GE7A 1UBPC 1J4EA 1O66A 1UUQA 4UTTC 1PKYA 3QMRA 4QLJA 3B97A 2GPTA 3CO4A 5FSEC 4GUGA 3UPBA 2GWGA 4L80A 1MEIA 4W86A 3W7QA 1KM0A 1C8QA 5HQLA 4AQLA 5DY2A 1F3XA 4P8VA 3AC0A 1W9UA 1W1IE 1V6WA 3M5VA 4HU0A 2OT1A 2WC7A 2ZZ5A 4LYPA 1I1XA 4DUVA 2RAGA 1V3JA 3L68A 5K4XA 2Q71A 3RITA 2VFEA 1D3HA 2O56A 3LHVA 3EWXA 3CZEA 2P8BA 3GTIA 5F2LA 3E2VA 3STEA 4E3TA 1XXXA 1BLIA 1XIFA 4V27A 2V2HA 3T55A 3IGUA 4N42A 4GUHA 4I90A 3VGHA 5CGQA 1R3YA 3R43A 2WCSA 4DWDA 4GQRA 5CJ5A 3R5EA 3W2NA 4KFOA 4HZ7A 1R2SA 4B2DD 4C6DA 5F2GA 4XTDA 3DHDA 5FSDC 3B06A 2O9PA 4JEJA 3JZEA 3V5FA 2V68A 1NEYA 3A4AA 3W87A 4IIGA 2ABBA 5D9MA 1VP5A 5ABFA 1R3RA 3UJEA 1OK6A 4XKYB 4PUWA 3RU6A 4N9EA 3SCUA 3ZVIA 1QW7A 4U28A 1MQPA 4JNZA 3DHPA 4XAFA 3H2CA 3GXMA 5HJLA 1LL7A 5LHFA 3EWWA 3H54A 4JFTA 2AL2B 1L9WA 1E43A 1SZFA 5BU9A 4FLQA 3DI0A 5CKSA 4R27A 2VC9A 2GVLA 4DZAA 2A6LA 4R7WA 3WF3A 2RFGA 3ZR4A 2P53A 1GJWA 3QFEA 1Q2RA 4DI8A 5A1AA 1XLKA 2DZWA 1DJIA 3PR2A 3RR1A 1ENUA 3EDJA 5CH9A 1QXLA 1UMLA 4UFMA 4H1ZA 2ISVA 1OEPA 4IP5A 3GNRA 2RH9A 4PMDA 5ENLA 1KXQA 4GK8A 1ZY9A 1M6JA 1SZNA 2ODOA 1R5YA 5HANA 1NP0A 2HE8A 2QHAA 3SQLA 3PUOA 2Z4GA 3HG5A 3ZWSA 8A3HA 1H1NA 3CZ8A 3ZSTA 1KLZA 2J24A 4EP8C 4CKQA 2RDWA 4W4QA 4Z17A 2R1KA 2BHUA 2OSXA 4G1KA 1SSDA 3HM7A 5FCZA 3R0DA 4U10A 3MKVA 2HVOA 3B8VA 1W9VA 3FYOA 3A9IA 4NJGA 2G50A 1RH9A 2FZ9A 3RG6A 4IIBA 3OYXA 1X6LA 4QM1A 1DWGM 1MDLA 1TPB1 3DU0A 3GHSA 4UTWA 2UY3A 3CPGA 2FHFA 1FBAA 2QCDA 1E5NA 2OZTA 4JNMA 1R6WA 4GBUA 2FQIA 2O9OA 3WCZA 1W5QA 3TQPA 4AWSA 4ZO9A 3VCCA 2D3LA 1OT2A 2WMIA 1KV8A 2FLIA 1VBHA 2HPIA 1JG9A 3WLJA 1HL2A 1XD1A 1T5AA 2PTZA 3HMCA 3WBAA 3WK3A 3P14A 4M81A 3PFMA 3GNNA 4RV8A 5TF0A 2WJEA 5LYRA 4WJ8A 2GGGA 4Y9NA 2G96A 1D8CA 3VOFA 1KFJA 4IX2A 5CSSA 1PJ9A 1YBQB 1EPVA 3ZM8A 5AVHA 4C6FA 3H2AA 3H7UA 2HPMA 4HNUA 3L2IA 1V3IA 1LBLA 2CLPA 2A5HA 2Z25A 1H63A 2QIWA 3EX1A 2XH7A 2Y2WA 3PAOA 1DJGA 4WIWA 4IMCA 4E3VA 1KGWA 2CBUA 1YDVA 2ZX8A 2QV5A 3UJRA 1G4SA 2VDIA 1GVFA 3FSUA 4QITA 3MMDA 5IFPA 4C6IA 3TUUA 1DWJM 2E77A 4BF9A 1AZ1A 1YTEA 2OSWA 2UY4A 1PVNA 4C65A 1C93A 3WMCA 4JTEA 3WUEA 1GHSA 2RHGA 3DGBA 2DZSA 1EDTA 5C0QA 3GZ3A 1XH0A 3FS2A 2R82A 5GNXA 3NL6A 3LCGA 4GYPC 4MWAC 5I3FA 3E9AA 3K46A 3ZIZA 3W7GA 1MVYA 3GRIA 5HDRA 1U83A 4XTIA 4M6VA 2INZA 2GJNA 1ZS2A 3LD5A 3ZQ9A 1IEXA 3IVSA 3CB8A 2OLSA 3PZMA 1TJRA 1V0LA 1F2JA 4O53A 5K9CA 2WBKA 4K1GA 1NWUA 4GKTA 2XIJA 3LERA 1NTHA 3QTPA 2I56A 1YPIA 1B57A 3CYJA 3NURA 3PPHA 4O1AA 2C18A 2DU2A 2YGYA 1CZ1A 2BOEX 5C2GA 2NX9A 3MO7A 1XCFA 3N9SA 4FAMA 3K8MA 2WZIA 3ZOAA 4OOZA 2ZWZA 4OKDA 4LCSA 3Q2DA 2FB2A 3K8LA 4GCXA 2GJLA 1JRBA 3PZVA 1E56A 3HO8A 2WV8A 3O1NA 4US5A 1UJPA 2VZVA 3P62A 4A35A 3IJQA 3UBPC 4M56A 2ISDA 2DDXA 1OX4A 1AQ0A 5A8OA 3W71A 3S1XA 1VBGA 3VGBA 3GUGA 4I9MA 2Q09A 4E0CA 1EH9A 4FZIA 5LXXA 1KV5A 1Q6DA 5TBOA 1EA0A 4DJDA 4WDWA 3IEBA 5A6BD 4FNTA 1AH3A 1UQZA 4Q8PA 3M44A 3S9IA 3G1AA 5KZEA 4N9BA 1SW0A 3NSXA 4LAOA 2QXWA 4EF9A 5IHRA 3WLIA 4J4KA 3IIXA 4MM1A 1Y5XA 2QF8A 3NGFA 2C79A 1OINA 2QLYA 4BKNA 2YFOA 3UF9A 2R1NA 5D04C 5A6BA 1W5NA 2VFHA 3TYEA 1W1YA 4IQLA 3L65A 4RE0A 2YYUA 1Q85A 3RF9A 1VFSA 3DYOA 1HL9A 2EEXA 3LHWA 3D3FA 1UZDA 5HNTA 4NL1A 4F4RA 2J7CA 3MJMA 1CIUA 3STGA 1V8EA 3U6WA 5D32A 1WKYA 3WD1A 4GC4A 3RK8A 2PWVA 3VXGA 2PEVA 3VZYA 4KCTA 3BC9A 2PU0A 3EXTA 4GVIA 2TSYA 1Y65A 3PJWA 3HQOA 2A79A 1UB3A 2F61A 4QRNA 1JL8A 2GQ3A 2A2IA 1GQLA 4CU8A 4GBDA 4J9JA 2J7HA 1IEVA 2FTWA 1MMFA 1LYXA 4RLIA 3LSBA 3WO8A 3ZLGA 2POTA 4GZIA 1E71M 1EWDA 2PLCA 1XRVA 2ZYFA 3MDWA 1PKMA 3E96A 2AOSA 1DHKA 2P88A 1EO5A 4G1NA 2QPUA 1L6WA 4TU1A 3T0DA 5EBUA 4F2UA 4PA8A 4HA3A 3GYEA 2OZ8A 3TC3A 4IG2A 1VBUA 2AAAA 3AFBA 3WLOA 3HURA 2A85A 1XFBA 2ZC1A 1KTCA 4ROPA 4LS0A 4B2DA 3WNLA 1CEOA 1UA7A 3N9RA 1KM5A 2VEGA 4N9DA 4LAKA 1H09A 4KIRA 5I06A 1DJZA 5JBDA 1TR1A 1J6PA 2YLAA 2WKLA 1DIDA 5CJNA 4B5TA 3GG8A 3UEQA 1E51A 5DCEA 3FAXA 3Q67A 1XHGA 4OT7A 3V16A 1ZGDA 1UKTA 1GYLA 4L4OA 5C54A 4MAZA 2DPEA 1C9WA 1A49A 4K37A 2V3FA 2AQOA 2VYOA 1PPIA 4HJWA 2WQDA 4AEFA 3HQPA 1R9XA 4I5UA 5M2FX 1H7RA 1RD5A 3JRKA 4MUZA 4XD3A 3OBEA 2HCVA 4HYRA 4HN8A 4UFHA 4J3XA 5A8GA 2X40A 4AUBA 1U30A 2XTKA 1JPHA 2D1ZA 3KVMA 4MHBA 2VD8A 1GZGA 1TJ0A 1Z8AA 3OQ8A 3MKKA 4X2RA 1LT7A 3RXZA 3CHVA 8XIAA 1XSJA 3LY0A 5EKYA 1V93A 1QTWA 1YE6A 3R8RA 1XGEA 3ABOA 3EMCA 5CC3A 3XINA 1X96A 4G56A 5FEWA 4IP7A 1V0KA 4KBXA 4IF2A 2XHYA 1CXIA 1M7PA 8RUCA 3B8WA 1HJXA 2GVYA 3WY1A 5SWUA 2WYSA 2EPOA 1PSCA 1R85A 3OO2A 5C6MA 1UG6A 1O5KA 2H9AB 2QNEA 2GGEA 1PZ3A 4NZ5A 3UGRA 1HGWA 3UY8A 5HOSA 4KT2A 1SO5A 3WBEA 7TIMA 3URAA 4IICA 3IARA 1EC7A 3RM4A 4DO4A 4PUEA 2QUMA 5CSRA 3P0XA 5F1UA 5AECA 3I3DA 4U31A 4F2TA 3H2EA 2X7VA 2I14A 2VKZG 3OJGA 5AZ1A 5D2YA 1V6TA 3ONBA 1YRRA 4R53A 1ZLPA 1T8XA 5HR6A 1KCZA 1HP5A 2CLOA 4YN5A 1WXZA 1MW2A 1HKIA 4Z2KA 3G0XA 1GOQA 1MQQA 2IPJA 3FNDA 3AXIA 1D8WA 1L8PA 3PUEA 3DFTA 4Y9OA 4MAVA 1O6IA 1I2RA 1R0MA 4CLMA 1LWHA 4NAFB 5DXYA 2FZ8A 3ZJKA 4O12A 1OCJA 1RZMA 3M64A 3N6HA 3GBDA 1WOAA 1JDDA 1UWSA 1G4EA 3TR2A 3ZZ1A 3W24A 3TN5A 1E6NA 4KS0A 3AU6A 5AHIA 4HOXA 5G2WA 4Q8WA 2VM8A 2ZZ2A 1AQMA 3VGEA 1E6QM 2VFFA 3M43A 3TAOA 1O5XA 1CECA 5CPLA 1T40A 4TV5A 3TTYA 4R7OA 1PX8A 5HR7A 3GY1A 2PS2A 3Q58A 1QI0A 1CW2A 3IJ7A 3NZRA 4JIIX 3MUIA 2Z1VA 1WP6A 5AOUA 3W6YA 1LRNA 1O94A 3L4XA 2D22A 4HNCA 3CASA 2NWSA 4IISA 1VLWA 4JTDA 4NP7A 4LW7A 4M7SA 1G01A 1JF6A 3AZSA 2VEIA 3B40A 3ZVHB 4HHPA 1CXHA 4HA1A 5AHNA 4XZHA 3GTNA 4ATLA 3E2RA 3GM8A 3W26A 1F8IA 1F4HA 2OO6A 3P5ZA 3TJLA 1FCVA 1FWIC 3E49A 4JL1A 4JIRA 4OBRA 1PHWA 1QK0A 3E0LA 1J0ZA 1HZYA 8TIMA 3KOXA 3ABZA 4S3BA 1X8FA 2PDXA 4K39A 2PRHA 2IKIA 3QV6A 1IIGA 3AISA 5HULA 1XF0A 2BODX 3GKAA 3N2CA 3VTRA 1YTKA 3TC7A 2D3NA 2F6XA 4O8RA 5AKQA 3W9ZA 3LS9A 3P74A 3BLDA 1TG7A 4Q4PA 2VC5A 2PP0A 3V0TA 3VKDA 2H6RA 5ECUA 1ZU8A 3GSMA 2CCRA 1M04A 1WKEA 2CLLA 2VFDA 1YDYA 3CH9A 2HE5A 4PTNA 5EPDA 4GI4A 1H7PA 2XH0A 4QNEA 5BXRA 3HGOA 2QZRA 4C6CA 4XZIA 3BUVA 4N02A 3UXKA 1R3SA 5EFFA 3QFWA 3T2QA 4LCQA 3ZO9A 3FOKA 1GG0A 5TD4A 2FHBA 3IGSA 4P7QA 4KWOA 4LFYA 1J79A 4MKSA 3UXDA 4IFKB 4GCAA 1SJCA 2HJPA 5I07A 3QQWA 2GDUA 1B3YA 2ZC8A 1NDYA 2CPUA 4AZBA 3UZWA 2CEQA 1BXBA 2HZGA 3N25A 1QNPA 2OZ3A 1VEOA 1TV8A 2CESA 2E1DA 3MUCA 3CUJA 2XISA 3DC0A 1BYDA 1WKDA 3MYOA 1RLCL 3K30A 1E9YB 4LOCA 4GABA 1XLHA 4W5UA 4GY0A 4UR7A 4TOQA 4E8GA 3ITOA 3DUGA 3OA5A 4XAYA 3GWQA 1PTAA 4AZCB 4C1NB 3F4DA 2YXXA 3VNYA 3P2VA 1TELA 2ZZ4A 3LMYA 1BGGA 2PDUA 3BPWA 1PL9A 3A22A 1SO6A 4TIMA 1A3WA 4LALA 1XYLA 2C71A 2J7DA 1F6PA 4IL0A 1JVNA 3E12A 5F7UA 2FHCA 1ZCOA 1FHLA 3WL0A 1K8CA 1EGVA 4I6VA 2PTXA 2WB5A 3QLDA 1GKPA 1E0WA 1ZP4A 4MPQA 3T40A 1W1B1 1OFOA 4WZHA 3LBMA 3AMDA 1VYPX 1YMYA 4HU3A 1E72M 2XFRA 1E1EA 1F07A 2I5QA 2YDAA 3F2BA 4A3QA 1PX4A 2G95A 4O13A 2DSZA 3W73A 1DQUA 4FNSA 4F0RA 1BWVA 3DENA 4XVEA 4M51A 1A5BA 1Q6RA 1YXYA 1AMKA 5A6LA 3W81A 5KETA 1KXVA 3A9BA 1UKSA 4UTHA 1FWAC 2QCNA 1CB7B 2YCIX 1GEQA 2VRKA 3W29A 1EP3A 4UQBA 3PS7A 2PGFA 4WKAA 1JR1A 4MB4A 3PBYA 1T96A 3MSDA 4YHEA 4HPGA 1T7LA 3H2OA 3SO7A 3GG1A 3H4GA 1QNVA 2HBXA 2WZTA 4CCEA 3CMGA 4PL2A 3NL5A 1SZRA 2BVTA 1JPKA 2NUYA 1AK5A 4JN7A 1EQCA 5T8GA 2VX6A 3SFWA 4R9XA 2ZUUA 3TH6A 3WJZA 3IJ9A 4I5XA 4JIHA 4R5EA 5EMMA 1RQHA 3UCCA 3S1WA 4HPXA 4CQAA 3I7QA 2ISWA 3GHUA 3OLEA 4N7QA 1DJYA 1OIFA 4RL3A 5EMUA 4KKXA 3RUBL 2VX7A 4FLOA 3ICJA 2OR2A 1I60A 2JQXA 2O4MA 4MVAA 5T9BG 3KOYA 3H2NA 2PA6A 4WY0A 3TP4A 4JX5A 3VYLA 1BG4A 5D33A 4GIEA 2NXGA 2CBJA 5DBTA 2ZICA 4GI9A 2GFTA 3M46A 3LM3A 4GQ0A 1K8ZA 2YW4A 4K7VA 3C6CA 2RGMA 4IIDA 4IGNA 5D2WA 4O4WA 3WD0A 1DBTA 2Z7KA 2WVUA 4XZMX 2VCAA 5LGXA 3QZAA 1UWAA 3WQ6A 3W6LA 5G2IA 2HDJA 4MWAA 3MB9A 4ZSTA 2WM0A 1NOFA 3PTQA 2V2CA 3POCA 3GAYA 4UMAA 4RNJA 1J96A 2QUNA 4AFYA 3IUDA 3RHGA 4WGHA 4BK9A 3ITVA 2VELA 4LANA 2ZZ3A 4UWMA 4BFAA 1Y0EA 1Q8AA 1QU4A 2YL6A 3QV9A 4QCFA 4FF7A 5E0KA 3PFRA 4JDBA 3DFQA 4LV9A 5AZ0A 1FWRA 1LROA 1OSEA 1QNOA 1RJPA 4ONVA 3L21A 3W7OA 2O4QA 3H4XA 2Y61A 5IHSA 1DP0A 4UQEA 2D2JA 5C9UA 4C6OA 1A5OC 4PMZA 2CKRA 3CQKA 5FA5A 3LNPA 4DEFA 4C6MA 2ISSA 2W6RA 1EP1A 3L4TA 1V0NA 3CTLA 2E9LA 1FFRA 3QMSA