1UG6A

Structure of beta-glucosidase at atomic resolution from thermus thermophilus hb8
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
426
structure length
426
Chain Sequence
NAEKFLWGVATSAYQIEGATQEDGRGPSIWDAFAQRPGAIRDGSTGEPACDHYRRYEEDIALMQSLGVRAYRFSVAWPRILPEGRGRINPKGLAFYDRLVDRLLASGITPFLTLYHWDLPLALEERGGWRSRETAFAFAEYAEAVARALADRVPFFATLNEPWCSAFLGHWTGEHAPGLRNLEAALRAAHHLLLGHGLAVEALRAAGARRVGIVLNFAPAYGEDPEAVDVADRYHNRFFLDPILGKGYPESPFRDPPPVPILSRDLELVARPLDFLGVNYYAPVRVAPGTGTLPVRYLPPEGPATAMGWEVYPEGLYHLLKRLGREVPWPLYVTENGAAYPDLWTGEAVVEDPERVAYLEAHVEAALRAREEGVDLRGYFVWSLMDNFEWAFGYTRRFGLYYVDFPSQRRIPKRSALWYRERIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-glycosidase
publication title Structure of Beta-Glucosidase at Atomic Resolution from Thermus Thermophilus Hb8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 165
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2003-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ug6A00
2Y8VA 1BG4A 4H8UA 5CLTA 1BG9A 1G0CA 1MVYA 1UZ1A 4DUVA 5D9MA 1UD2A 2D1ZA 1CIUA 1XYFA 2WNWA 3CZKA 4PTWA 2OSYA 4W8BA 4J3WA 1B0IA 1H0IA 5FOOA 1OIMA 2J47A 2EEXA 1UH3A 1AVAA 5ABEA 1UR1A 4ACYA 4AEFA 3ARYA 5BROA 4LYPA 3EMZA 2XM1A 1PX8A 3J7HA 1WDSA 1QI4A 1GQKA 3WNLA 4MNKA 4UQAA 4P8XA 1GCYA 1M04A 2AMGA 2G41A 2JALA 2G3JA 5DO8A 1DTUA 1SR0A 3EMCA 1DWAM 2J7EA 4P8WA 5FD0A 1NWSA 3WDPP 4D6EA 1KCKA 1W1TA 3BSGA 5AYBA 3OBAA 3THDA 3W81A 2ZUVA 2WKGA 5JIWA 3A3HA 4IPLA 1K9EA 4ZEPA 4PTXA 4IUGA 1GOKA 4M80A 2GDVA 2WC4A 3PZIA 4MJ4A 2PWFA 1B90A 2QPUA 1R87A 2YA0A 2DDXA 3AMGA 1QBBA 1B3XA 2GDUA 4FF5A 4PTVA 3N11A 3L4VA 3WF0A 5I24A 5I79A 1UWQA 3ARWA 1HX0A 2WZEA 1QNQA 3DHUA 3AS2A 1CENA 4YPJA 1EO7A 3MS8A 4K68A 2X8RA 2AAAA 1JZ3A 1GHSA 1UR9A 5BCAA 2D3LA 4CU6A 4U2ZA 4M8UA 2WSKA 5C8BB 3WDHA 2CETA 4AZ5A 4KGLA 5E0FA 3L4ZA 1E43A 2PWGA 1BHGA 3S2CA 2E9BA 3GXIA 3AIBA 4DUWA 1QI0A 4JL2A 4UOQA 4C7FA 3VX0A 1E6SM 2NW0A 2YA1A 1BF2A 1H1NA 1CXEA 4YHGA 5DF0A 1GJUA 3WUGA 3ZJKA 5A94A 5BRQA 3RMEA 2BHUA 3L2LA 1OB0A 3MV11 4OJYA 1H49A 3EDJA 4BS0A 5CZKA 5E6YA 4WK9A 1E4MM 2D0FA 2ZE0A 2OWWA 3U7VA 3WF1A 4CCCA 2OWXA 3GZAA 3TOPA 2XWEA 2ZWYA 4LPCA 1CECA 1XH1A 2FH6A 3ALGA 5CGMA 3VGHA 5EBAA 1UQYA 4WSKA 1X6NA 2BNJA 2DIJA 2VZSA 5HBFA 4W87A 1LG1A 3AHZA 4PMDA 3RO8A 1YHTA 3MO4A 3VD7A 1M03A 3ZIZA 1CGUA 1D2KA 1WDPA 4AIOA 1V0MA 1JNEA 2X2YA 4W7WA 1VB9A 1V08A 5GQBA 3ZJ7A 1HF6A 2VI0A 2FHFA 4HU0A 1EH9A 3GNRA 2YLAA 3G6MA 3CH9A 4GQRA 3BAJA 4HA1A 3IANA 4W8LA 3RM4A 4EAMA 2BFGA 1VF8A 4MAVA 2WB5A 2D3NA 4WKFA 5E9AA 1BPLB 3GBDA 4ZFMA 4UFMA 4AYSA 4UFLA 3T0BA 3T08A 1JZ7A 1HP5A 1US3A 5HPOA 5CG0A 4TXEA 4RE3A 1E3XA 5A6SA 2E8YA 3VIOA 1OT2A 2CBJA 3W38A 2ZUWA 3AIQA 1E6PA 4PUEA 3MSDA 4CN4A 1D7FA 4BQ5A 7A3HA 7TAAA 1HKMA 3IJ8A 4AZCB 4IISA 1ODZA 1W3LA 1NWTA 1HVXA 3VD5A 4HOZA 3T0AA 4F66A 1E3ZA 4GKLA 4MJ2A 4OIFA 3VNZA 3WDQA 2WMKA 5BYWA 5LA2A 3DYMA 4LYRA 3OLDA 3U5UA 1GQJA 2XM2A 3OG2A 2WMJA 1K6AA 4IPNB 2J7HA 2Y2WA 1KR0A 4U5IA 3WH9A 5D9OA 3MMDA 3CUJA 4IM4A 3WNNA 3AQUA 4DWSC 2ESCA 3CO4A 3GH5A 2JE8A 4GI9A 3W27A 3VIKA 1TCMA 1EA9C 1SYTA 1XSKA 2EQDA 1NQ6A 4RL3A 1W3KA 1RD6A 3GXDA 3RJYA 1VFMA 1H0GA 6TAAA 3WD0A 2FGZA 4UZUA 1ZBWA 2Y24A 4PMXA 3L4UA 3BLPX 4P8VA 5D9PA 1XRVA 3K8LA 3AIRA 3ARPA 1PJ9A 2D20A 3KWXA 4KH2A 2YBTA 1H4PA 3HN3A 2DEPA 3B9EA 2DH2A 2EXOA 1CWYA 3UETA 4DWSB 5EB8A 1MFUA 3F4VA 5I5RA 3F5JA 2DT0A 2YLLA 3BAXA 2XHYA 2CERA 3NYDA 2DSKA 1NARA 3PBGA 1XCWA 4AD1A 3CZJA 3BH4A 2NSXA 2PBOA 1IT0A 1UH4A 2RGMA 4PN2A 1J10A 3VGEA 2VR4A 3VM5A 1D3CA 4J3SA 1FH9A 1BYBA 3K8MA 4WSJA 4V28A 4AZIA 1H2JA 8CGTA 1EXPA 2EPKX 3AS1A 3QHNA 1R85A 4NSBA 3I3BA 3PTKA 3FXYA 1NOFA 5C70A 2WMIA 2VQTA 1KCLA 3IK2A 1VRXA 3SCWA 2WMGA 2VC9A 4CGTA 5I2UA 3ZR5A 1MFVA 1XV8A 3CZGA 3MKKA 3NDZA 3SCSA 1TE1A 2XSBA 4RE4A 3ARZA 4X0NA 4PMYA 4KRUA 1BLIA 4AZ7A 1WKYA 2D0HA 4MPKA 3AYRA 5CPTA 4TX6A 2GK1B 3AOFA 2NT1A 1J0HA 1KB3A 4F8XA 9CGTA 1QHZA 3AHVA 5A8OA 1NOUA 4N0RA 1XSJA 1BSIA 2CKRA 1H41A 3SEPA 3GBEA 1VFFA 5IDIA 1HP4A 1B31A 4AZGA 2F8QA 3BAWA 4Z2HA 4R5EA 2XPKA 5D8ZA 3WBAA 2VVNA 4U3AA 2QHAA 4OBSA 4JFSA 1J0ZA 2ZUNA 3KL3A 4MNJA 3SCNA 4CN6A 4JCMA 1TMQA 2CIPA 2J7GA 2OSXA 4GXPA 4JFVA 3THCA 4E2OA 4QP0A 1CXHA 2WWCA 2VJXA 1W2VA 2CBVA 3EDDA 1VBRA 2JIEA 3CGTA 1K9DA 1WO2A 1LLOA 1Q6EA 3M07A 2F61A 3CZ8A 3W28A 3K1DA 4YHEA 4CCEA 1RPKA 2CYGA 2PWDA 1VFUA 1NM9A 2GUYA 3I3DA 1NWUA 1QPKA 1KGXA 1W9XA 1VAHA 2IXUA 3N18A 4HPHA 1ZJBA 3AMKA 4XZBA 3SUSA 3NSXA 2TAAA 1CGTA 1E71M 2C0HA 3ALFA 3L4YA 4UQ9A 3OLEA 3PZUA 1V3JA 3VOCA 3VINA 4TTUA 1OWQA 3VVGA 4M82A 3VIMA 1E5JA 4XZWA 1W9BM 2J78A 1W1PA 5IXEA 4GQQA 5FIPA 3WF2A 1U33A 4CD8A 4PMZA 2CEQA 4X9YA 5C71A 2O9PA 1VIWA 2PF0A 4HZ8A 1UD4A 1OGGA 1K9TA 4KMQA 1LG2A 5CGTA 5CQ1A 3VX1A 1CNVA 1OGBA 1JAEA 1MXDA 1V0NA 3TA9A 4GO9A 3LPOA 2WWDA 5ABFB 4MB3A 2XJ7A 3GH7A 2VTFA 2PC8A 1V6YA 3QHMA 1LJYA 4JZ5A 3IJ7A 3EBVA 3FW6A 5M3WA 4DM1A 4DUXA 4OZOA 3WH8A 1UWSA 1J9YA 1XC6A 1QW9A 1XHGA 5LA1A 2WHJA 1HJXA 3TTQA 1DWHM 3FHQA 1UA3A 1CGWA 1J0YA 2A3BA 3ZT6A 2J7BA 1B30A 2WZIA 1V6WA 4URIA 2O9OA 3MSGA 3NSNA 4XV0A 2XVPA 3FN9A 4B3LA 3GM8A 1E70M 4F79A 4RE2A 4CD4A 2V3EA 2CESA 1WCGA 4FLOA 1AQHA 1DEDA 3VM7A 3JUGA 1UG6A 2G3IA 1JDCA 4CVUA 1VEPA 3D5HA 3SUUA 1XD1A 1QNOA 4B16A 2WCAA 3VDHA 2YOCA 3AZSA 1EDQA 1US2A 3IJ9A 1HKKA 1UKQA 4U5KA 1G1YA 1HJUA 1UKOA 3SCQA 1M01A 3SCVA 4LX4A 4H2CA 3VIGA 4AZBA 2WM0A 1K9FA 3PZMA 1UKTA 3WNPA 1KXHA 1BAGA 1XH0A 2BVDA 3VDCA 1JZ4A 4DM2A 1EO5A 3EYPA 4WJXA 4W85A 4B15A 2WLZA 3VMOA 5A8NA 1GORA 4P7NA 3BCDA 1WE5A 4QLJA 2PI6A 4J3XA 1OD0A 1HKJA 1FP8A 5BRPA 2DGAA 1CTNA 2BY0A 4CCDA 5CPQA 1G5AA 2E4TA 5FKYA 2ZWZA 4PRWA 5ABFA 4ACZB 3T2PA 3VU2A 4D1IA 1E4NA 1QOXA 1OSEA 2X09A 2ZXAA 1E6ZA 3CTTA 3K4AA 3U7BA 3HU7A 1JI2A 1CPUA 1JFHA 1VJSA 3FHAA 4AMCA 1E72M 2W62A 2CITA 5A6JA 2PBGA 3WMBA 2Q8XA 3ARRA 4ATDA 4GINA 4UNIA 1GQIA 3WIJA 1V3MA 1ISYA 4JKKA 1KXQA 5GNZA 5A6KA 1H3GA 1ZS2A 1JZ6A 1JGIA 2VCCA 1TG7A 4PEEA 3OIHA 1UKPA 3BXWA 1UWIA 4QFUA 2J8GA 2YL8A 4PSPA 5E6ZA 4PMUA 2VRKA 4XX6A 1U30A 1PIGA 3II1A 3ZMRA 4D6HA 4M1RA 1C92A 4P7LA 3BAIA 2D23A 2WC3A 1W3JA 3CZLA 3AIVA 3SCRA 4MB4A 3MU7A 4W5UA 4NI3A 3AHTA 1GOQA 1CGXA 1F4AA 5I77A 1UWTA 1FP9A 4UFJA 1R7OA 1WB0A 2J79A 3DHPA 1EOKA 2BS9A 4TVCA 3DC0A 3PZGA 2WANA 3TP4A 4BQ2A 1IZKA 2XVGA 1NH6A 4PSRA 4J3VA 3N12A 3PZVA 3W29A 3CMJA 1QNRA 2QF8A 1E1EA 1WP6A 1C8YA 3MMUA 2BXZA 1UHVA 2AOSA 2C8NA 5TD4A 3UERA 1EIBA 1MW2A 2D2OA 2VZUA 4OOUA 1NWRA 2XGBA 2VO5A 4P7QA 3VGFA 1E9LA 3W6LA 1MXGA 1WZLA 1ITCA 3VD3A 3WL1A 4BCEA 4LYQA 1XH2A 2QMKA 2OSWA 2W61A 1E6NA 4JCLA 3MUZ1 3IAQA 1V02A 4PMQA 1E15A 1UD6A 2A3EA 3AJ7A 2CNCA 2WMFA 5I23A 1JYXA 4M29A 3FY1A 1ISZA 1E0WA 2V3DA 1JYVA 3QR3A 1W3HA 2BXYA 4WIWA 3SCTA 1HJQA 1ZBCA 3WQ5A 3PZQA 3VDAA 1O6IA 3K4DA 3LPGA 3OB8A 4ML4A 1HJSA 2XYLA 3WDRA 5BXRA 4TOQA 4AD3A 1H09A 1B9ZA 1WNOA 4D6GA 4M81A 2BHZA 1C91A 2W67A 4ZE5A 2J75A 4W86A 4MB5A 3VUPA 2G3NA 4L4PA 5CXPA 1JNDA 1UA7A 3ZJ6A 4C7GA 3WELA 1Q6CA 1E0XA 5BXPA 1W32A 3SURA 1BQCA 1DHKA 1C93A 1W2PA 5IFPA 1CLVA 2O9RA 1XSIA 1UQZA 4B9ZA 1ZB5A 1PPIA 1UWUA 1JZ8A 3VIIA 1ZU8A 5I3DA 3WH5A 2J74A 4NF7A 4CN1A 5AY7A 5BXTA 1Y7VA 4AEEA 4FK9A 4AD0A 3UCQA 1JD9A 2VT0A 5HOSA 2VZOA 4XUYA 4W7VA 5JBEA 4UR9A 1TA3B 5JIPA 3RPMA 4C7DA 1GOMA 4UQEA 3UG3A 2WVVB 4ZXLA 1UR4A 3AIWA 3AFBA 2XSAA 1F4HA 1VFOA 1J01A 3VGGA 1JI1A 4D6CA 3ECQA 3UR7A 2WCGA 5HDRA 1CEOA 2GJXB 4UFKA 1P6WA 1J0JA 5DFAA 2D22A 4H8VA 1JL8A 1XCXA 4BZYA 4ZE4A 2CBUA 4AD5A 4JKLA 2J7FA 3SCUA 3ZO9A 3MMWA 5IFTA 5F7UA 3ZSSA 6CGTA 1KBBA 5A8PA 4ATWA 1PBGA 4UCFA 4Z2LA 3D3AA 2Z1KA 5JBFA 5FCZA 3OGSA 1QBAA 1WPCA 3VIFA 1JZ5A 2VURA 2WVTA 2EO7A 4WKHA 4JHOA 3UESA 2VCAA 1JYWA 2ZICA 2ZIDA 4QLLA 3TONA 4FLRA 1QNSA 1KWKA 3WL0A 4B9YA 2DSVA 3AMCA 1CZ1A 4GI8A 4BF7A 1W9VA 3DYOA 4HA4A 3WSUA 1HXJA 3WFZA 1UR2A 3PTQA 3RM9A 4PMNA 4AZCA 1GVYA 1I1XA 5ABHA 2OLHA 3WKZA 1BGGA 3L4WA 1OCQA 4V2XA 5ECUA 5FL1A 1E55A 1QHOA 1ZBVA 5DT7A 1R86A 5AYIA 3VO0A 2GJPA 4Y7EA 1V03A 5LA0A 3CHEA 2BY3A 1C90A 3KL0A 4UQCA 4BA0A 2FHCA 4QCEA 3A47A 3AIUA 3ZSTA 3AS0A 1GUVA 4MAZA 3WD4A 1G01A 1YQ2A 3K46A 3WH6A 1EQPA 3WNMA 1W1VA 3ZM8A 2CPUA 2BHYA 2HVMA 3AXHA 3K8KA 3POHA 1M53A 3VDBA 1LWJA 1HL9A 3WQ6A 2QPSA 1H5VA 2CCRA 1NOWA 2VCBA 4AD2A 4AD4A 2EPMX 2WSPA 2YL6A 1VEMA 3E1F1 4U3CA 3AZRA 2WHLA 1ITXA 3EDKA 1OGSA 3RCNA 3N17A 1JF6A 3CUGA 1EDTA 3ZR6A 1TR1A 4AWEA 4DWSA 3ARSA 1UD5A 5CJ5A 1JF5A 3IAPA 1W91A 1J12A 1LQ0A 1ECEA 1X1NA 1B3YA 3PTMA 4UZSA 2XGIA 3I3EA 1TUXA 2VX4A 2VL4A 5A6LA 4D1JA 4ATLA 1GONA 4U31A 2WZHA 1E1FA 1GVIA 5FL0A 3T2OA 2X0YA 2XUCA 2XVNA 2Y5EA 1JAKA 3WUFA 4JKMA 1HL8A 1UH2A 3VGDA 1UYQA 1DP0A 1WAWA 2X05A 2VZVA 1KQYA 3VD9A 1PZ3A 1HVQA 5GNXA 3W0KA 4H04A 1QHPA 2XFRA 1VBUA 5A6MA 4Q22A 2E9MA 1TFVA 3M46A 1E6RA 3VGBA 1QI3A 2JF7A 3BSHA 5EFDA 3NUKA 4H41A 2W66A 2FDMA 4MDPA 3WFLA 1ZBKA 3WENA 4AZHA 3OLIA 2XFFA 2IXVA 2GK1A 1V0KA 2JEPA 2YKKA 1AQ0A 2WHMA 2ZX6A 1BYAA 4MDOA 2X0HA 1NP2A 4MNLA 5AC5A 1KFWA 1OT1A 2EBNA 2G8ZA 4PTMA 1W9DM 3WQWA 3NDYA 2VUYA 2ZX9A 5DMYA 2DIEA 1ODUA 5GNYA 5KZ6A 2WMHA 5JUVA 2X1IA 3U5YA 1MW0A 4ZENA 3NSMA 1HKIA 1H11A 1B3VA 4GPNA 1ISXA 2B31A 2XFYA 2OYMA 1UD3A 4UQDA 1FH8A 4QLKA 3RILA 3AI0A 1HNYA 2RGLA 3CHDA 2UWFA 2WBKA 2ZXBA 3MUY1 1A3HA 2WPGA 4UQBA 1FHLA 4R27A 2BVTA 1JIBA 2WCSA 2Y8KA 3WBEA 4BQ3A 1Q6GA 3A4WA 2V38A 2JFEX 1JYNA 3UG4A 1UKSA 3NCOA 1OM0A 1OBAA 4W84A 4PCSA 1CXLA 1GJWA 1MWOA 4UTFA 3EDFA 3AXIA 3L4XA 2O92A 5HNNA 3CHFA 1EHNA 1JZ2A 3WH7A 1JD7A 4JAWA 4NRSA 5BWFA 1CGYA 2GJRA 4P7RA 3FNDA 1ISVA 4D71A 3W37A 3ZJ8A 4NRRA 2VQUA 5LYRA 3EDEA 3BCFA 4E8DA 1QW8A 2E8ZA 4UOZA 1Z32X 3QGVA 5CPSA 3WD3A 2D24A 2CHOA 2QV4A 2VVSA 4J7RA 1QVBA 1V3LA 3O2LA 1E4IA 3AISA 3APGA 3WN6A 5M5DA 4XB3A 3WNOA 1DWFM 3BGAA 4W89A 2WBGA 3RIKA 1UZ4A 3A4AA 4S3JA 3AYSA 2VRQA 3M7SA 1HN1A 2J77A 1PZ2A 3LPPA 4CD6A 4EK7A 4JL1A 1ISWA 2Z1SA 1CYGA 4HPGA 1JXJA 4N42A 3BC9A 3PZOA 4AC1X 2J7CA 2E3ZA 3WF4A 2WAGA 2WVSA 3O6AA 4F9DA 4GO8A 2ZUSA 2BY2A 4E8CA 1B3WA 1RH9A 1FA2A 4UFHA 4HZ6A 2E40A 3MUIA 1PEZA 2UY5A 3VIPA 1BYDA 3WNKA 4QDMA 3CZEA 2J8FA 2EJ1A 5AC4A 4PMVA 3SIMA 3GNPA 3WEOA 2YDSA 3CMGA 4J28A 7CGTA 1UR8A 1CLXA 1RP9A 3MV01 3CLWA 1C7SA 2XWDA 4LXFA 3VILA 4JFUA 1G9HA 1KBKA 4PMRA 4EANA 1W1YA 1WDQA 4PYSA 3UR8A 1UUQA 2W4XA 1E40A 1KR1A 2PB1A 1AQMA 2WLYA 2DT2A 2C7FA 1CGVA 2ZX7A 1V3HA 3KL5A 2WYSA 4OOZA 4MNMA 1R7AA 1VEOA 3GXMA 4H7VA 3AXXA 2EPOA 1FFRA 1MQQA 2EPLX 2WVUA 5CLWA 1B1YA 1DWIM 4P8UA 3OZPA 1ESWA 3W82A 3CIVA 1LWHA 3W4RA 3CPUA 5A3HA 1KXTA 2XIIA 4J3TA 3S6TA 1J18A 4D72A 1IZJA 4ACZA 3LPFA 1CXFA 5A8MA 3PZTA 1E4LA 1PIFA 2WKLA 3UEQA 5A2BA 2F2HA 1RP8A 4YN5A 2YDQA 3T09A 3CUFA 1HJWA 1GW1A 2FH8A 4A3YA 3UG5A 3SUWA 3NJ3A 4AY1A 4CKQA 2OWCA 1CDGA 2CKSA 3CUHA 1E73M 3T2QA 1C3FA 1X6LA 1E0VA 1JDDA 1U2YA 3OGVA 3ARQA 4JIEA 4MADA 4CVWA 2YJQA 1V6XA 4FLQA 2QMJA 2VRJA 4GZIA 1TVPA 3WUEA 5A6BA 1B3ZA 3AMLA 4TTGA 3N1AA 5I78A 3B8SA 5A6BD 3WMSA 3OLGA 4HMCA 4AZ6A 1ZJAA 2A3CA 1XYZA 2VMFA 3A4XA 1N82A 1L8NA 1V0LA 1J0IA 3CUIA 4QCFA 2VOTA 4A4AA 4Z2IA 1UWRA 2YL5A 1S46A 3GYCA 4HMDA 3WEZA 3B9DA 4D6FA 2YA2A 3VIJA 2JF6A 3PZNA 3U57A 4D6DA 2Y4SA 1BFNA 4LGXA 1A47A 1CXIA 2DT3A 4U2YA 2ZUMA 1OIFA 2VX5A 3WD2A 3HJEA 2YDRA 1WZMA 4AIUA 2A3HA 2W91A 3PN8A 2VR5A 3ARTA 2WC7A 1WDRA 2WMIB 3AMDA 3BLKA 2YL9A 2ZX8A 1E56A 2E9LA 5DEZA 4CUCA 2ZUUA 4Z2JA 1NP0A 3SUTA 1E6XM 3POCA 1FHDA 4UFIA 5M17A 4M56A 1J0KA 1PX4A 1PX3A 3G6LA 3KE0A 3WD1A 5GPRA 1AMYA 1FOBA 3VMPA 4V27A 3GH4A 2VX7A 1HJVA 2V3GA 2JIWA 4U33A 1BVZA 4HOXA 4EE9A 4QAWA 1FFQA 5IHRA 2FHBA 2CXGA 3CBWA 3DECA 1HT6A 2ZOXA 5A2AA 2XTKA 4WLCA 3AIEA 1VJZA 1WZAA 1BYCA 2XG9A 1BTCA 2ZUTA 3DYPA 3PHAA 1IV8A 1CXKA 3WY1A 4A3HA 1V3KA 1XD0A 3WDIA 3L2MA 3VPLA 2VX6A 3KZSA 3A6OA 4L4OA 4X0VA 4CD7A 2QLYA 2OYLA 4AW7A 3ZT5A 3GXFA 5HXMA 4OBRA 3NIYA 3WQVA 2ZXQA 4JFWA 1GOOA 3ARVA 4EKJA 3M6DA 2WXDM 3N9KA 4GZEA 1EDGA 3AHXA 3RM8A 5A69A 2J62A 4GZJA 1EQCA 4MB1A 3MANA 3KEHA 3PZ9A 4FLSA 2JEQA 3B9AA 4ZXOA 4PMOA 1DWGM 3T0DA 5CSUA 1I75A 4WKAA 2EPNA 2XIBA 1LL6A 4UOJA 1Q4NX 3N13A 3ZOAA 3ARXA 1DWJM 2DPEA 3F5LA 3QOMA 1FH7A 4GIAA 1MYRA 1TA3A 4E4PA 3AS3A 2DSUA 1C8QA 2BY1A 4AXNA 1M7XA 2GFTA 2WVVA 3QOKA 1BVNP 1TVNA 2J4GA 3WMCA 5A8QA 1KGUA 1UR0A 2W5FA 1C7TA 2GJXA 4BQ4A 2UY4A 2HISA 3MUAA 3WUBA 2GSJA 3W26A 4AIEA 4F9JA 3HMCA 2XVKA 3W24A 4W5ZA 2VNCA 3FAXA 4KWUA 4HA3A 3VIHA 1J11A 2BV9A 4WF7A 2VZTA 4HMEA 1HIZA 5EFFA 5IHSA 5DT5A 2XVLA 1G94A 2CHNA 3BMVA 1PAMA 4JFTA 3VKKA 4GI6A 1LF1A 4Q7NA 4W88A 2D0GA 1W9PA 4OUEA 3SUVA 5I6SA 3VMNA 3ARUA 3O9NA 4DWSD 2J7DA 1XGZA 3GTNA 3GDBA 1GOIA 1SFSA 5I0DA 4TVDA 3EMQA 2DSZA 5E70A 2OYKA 3CHCA 6A3HA 1LL7A 4CU8A 4HOWA 4KGJA 5E09A 3RJXA 4Z2GA 1O7AA 4FMVA 2V5DA 2W92A 1V3IA 1SMDA 1GPFA 4HTYA 1MW3A 4OKDA 3N04A 3WF3A 2ZX5A 3W25A 5JBDA 5M03A 1E5NA 1JFXA 3GNOA 1CBGA 1VENA 2DT1A 2ZXDA 1LL4A 2WK2A 4HP5A 2G4FA 2YIHA 3AICA 4J3UA 5A6AA 2UY2A 1E6QM 3N15A 1JG9A 1WZKA 5D8WA 3RDKA 1R8LA 2NT0A 4HZ7A 4P7OA 3WDJA 2V5CA 2BVYA 1QNPA 5CSYA 1GZJA 1MW1A 3LMYA 2DSWA 3TTSA 4JHZA 2DQXA 1QI5A 2GVYA 3AROA 3BAYA 4LQ1A 2E0PA 3ZT7A 3F5KA 2A3AA 3AZTA 1V6VA 5BXSA 3OZOA 4W8AA 1SMAA 4B3KA 3OA5A 8A3HA 5D9NA 1KGWA 1W9UA 4NZCA 3TTYA 4CU7A 4CD5A 3WQ4A 1MQRA 4TVUA 2YBUA 3ZQ9A 1KXVA 3QHOA 3W6MA 2W63A 1EGZA 3BAKA 1BGAA 5A1AA 2G3MA 5D4YA 3WQ8A 5ABGA 1ZL1A 2WW5A 3VTRA 3TTOA 4TUFA 1Q6FA 2J25A 4PUDA 1Q6DA 1V6UA 3OGRA 1B2YA 2WHKA 3FAWA 3L4TA 5A2CA 1EOMA 1GOWA 4HU8A 2FGLA 4MTVA 1KQZA 1GHRA 4S3KA 4M24A 2O9TA 5E0CA 2PWHA 1V02E 2MANA 4KRTA 4H8HA 2PWEA 4PCTA 3VNYA 1QI2A 1I1WA 5A95A 1OD8A 2V3FA 4W93A 3SCOA 3W53A 1GQLA 2CBIA 2UY3A 5EMYA 1C8XA 1KWGA 4Z2KA 2DH3A 4D6IA 4PBGA 5HPCA 3BMWA 1UOKA 4AISA 2IUZA 1GNXA 1L0PA 1EHAA 4W7UA 1TZ7A 3AHYA 1UD8A 1JXKA 4J27A 3SCPA 3WEMA 4D6JA 1JDAA 4TX8A 3VD4A 5KEZA 1MQPA 1OINA
chains in the Genus database with same CATH superfamily
5D9MA 4HTBA 3L7RA 2QYGA 3BVJA 3CZKA 2OSYA 4W8BA 3ITTA 4J3WA 2EEXA 1SJDA 2FTYA 1IEWA 1AVAA 3U4AA 3RLVA 3C2VA 4AEFA 5BROA 3UWUA 1PX8A 2RDTA 4GYJA 3J7HA 4YTRA 1WDSA 2A7RA 1GQKA 1TPFA 2Z2BA 5H91A 2VKZG 1EP1A 1S1RA 2AMGA 1SO3A 3IRSA 3CU2A 2G3JA 5C55A 3UCDA 3W1AA 4XZHA 1OZQA 3WDPP 2C91A 1KCKA 1W1TA 4L4MA 1OYBA 4UMBA 3BANA 2X30A 3E12A 3LERA 3THDA 1S5WA 3W81A 3C52A 3W01A 2WKGA 4IMGA 4ZEPA 2E67A 4M80A 2EAWA 4UTTA 4H9ZA 4R3UA 1V8EA 1OFEA 5C9RA 3PZIA 4MJ4A 3W6YA 1RJPA 1B90A 4H6KA 3MP4A 1R87A 2A79A 4DUOA 2DDXA 6REQB 2GDUA 1FWIC 3N11A 3HBLA 2OJPA 3STPA 4DJDA 2YW4A 5I79A 1ADSA 5J8LA 2DZXA 2Z1XA 1MZHA 2E7FA 1DIEA 1QNQA 5FF4A 4DJDD 4H7CA 1EO7A 4GACA 4NZ5A 3C4UA 2F6KA 3G1XA 2CWXA 1XLFA 3DG6A 2PRMA 2X8RA 2AAAA 2NWRA 1GHSA 4A3RA 2XDFA 4XD4A 2FJUB 2Y61A 4PRTA 3W7IA 5BCAA 4WDXA 4U2ZA 3WZ0E 3QFWA 3WDHA 4O54A 3Q94A 5HINA 3L4ZA 2EGZA 2PWGA 3LB0A 3R8HA 1IWBA 2E9BA 3UZJA 3ANUA 4JL2A 3KLLA 4C6EA 1Q8AA 3C8FA 3W87A 2FZ8A 2YA1A 3QW4B 1CXEA 4YHGA 1D3HA 1GJUA 5TAOA 4GIYA 2QPXA 3UBPC 3EDJA 4OFCA 4BS0A 3EGJA 5E6YA 1EPVA 2PE4A 4CCCA 3M1ZA 3B0UX 3TA6A 4IIFA 3HFTA 4LPCA 4PRRA 3E3HA 2FH6A 3RRXA 4AUBA 5CGMA 5EBAA 2NZLA 2BBFA 1Q2SA 1DXIA 4UTWA 2I5QA 2DIJA 5HBFA 4O8RA 4QE4A 1MO0A 5D33A 2J13A 3RO8A 3VD7A 4DO5A 1V0MA 1JNEA 1KM2A 1CW2A 2X40A 5GQBA 4NYYA 1J5TA 8XIAA 2C1IA 1FVPA 2YLAA 3UJSA 4GQRA 3UR5A 3KRZA 4ALDA 3N14A 3RM4A 1VF8A 2GUBA 3GBDA 3THQA 1XGDA 2VM8A 3W02A 3WLQA 4R9OA 3GD6A 1OFQA 5DCBA 1GKPA 1C29A 3TZNA 3BMXA 1ADDA 2CBJA 3IIZA 4MWAC 1E6PA 1O94A 4HT3A 1D7FA 2GOUA 5H2ZA 1NELA 3TW9A 1F3EA 3DX5A 3S6OA 3VD5A 4HBKA 4DZIA 2FYMA 2QVHA 1K70A 5FEPA 4LYRA 3OLDA 3U5UA 1GQJA 2UBPC 3KRBA 1W5NA 1FWJC 4B5WA 1UBPC 4IM4A 3AQUA 3WMLA 2YYTA 5I09A 1BVWA 3VIKA 1EA9C 3ISIX 1TR9A 2EQDA 3GXDA 3OYXA 1VFMA 3BARA 2V5KA 3CWHA 4QQ3A 1K8XA 1AJ2A 4XKMA 2Y24A 4OQVA 2P53A 1MNZA 5HANA 1XRVA 2O55A 1LZOA 4GXMA 4GYPA 4QX4A 3UZ5A 4J9JA 2YBTA 3HN3A 4WXYA 3MP5A 2DEPA 4FNPA 2EXOA 3LXBA 2PDCA 2DT0A 4XZLX 5FJJA 3T81A 3IARA 2QCGA 3V1PA 1CX9A 1XYBA 2DSKA 3OBKA 3KBMA 3ZLGA 2NSXA 3QY6A 1K77A 4XAPA 4DEFA 1IT0A 1YDYA 2RGMA 3HM7A 4PN2A 4HNTA 4GJ1A 4C91A 3TLQA 1XBZA 4J3SA 3AO0A 3ITVA 1FH9A 1BYBA 4WSJA 3DCPA 1H2JA 8CGTA 3AS1A 2O4QA 3QHNA 4H3DA 3I3BA 3R13A 1VRXA 3SCWA 4EPKA 3EX1A 2H3DA 3HG2A 3ZR5A 4MUZA 3CZGA 1TB3A 3SCSA 1TE1A 4RE4A 3LSCA 1AL8A 4IXXA 2DVTA 2DJXA 3N29A 4PMYA 4XO6A 4KRUA 1BLIA 5DCDA 1SJBA 1EEXA 1TX0A 2PDGA 1KB3A 4F8XA 1QHZA 5A8OA 4NAEB 3PG8A 2QCMA 1B31A 5D8ZA 3R79A 3NVDA 2VVNA 3SW6A 1J0ZA 3S47A 1SSDA 1UJQA 1HFBA 1CXHA 3W76A 3E9AA 1UUMA 4Z0JA 3S2LA 1FXQA 1K9DA 1UP3A 5KITA 3UXAA 2F61A 2IMRA 4CCEA 4IQEA 2CYGA 3W7RA 1NM9A 3D6NA 1WKEA 3P8JA 2GUYA 4IX0A 3TUUA 1KGXA 1W9XA 1VAHA 2FQIA 1TPH1 3QGAC 4F3HA 1UASA 2C0HA 1AK5A 3FYOA 4UQ9A 3SN1A 3OLEA 3PZUA 1NVMA 1I0BA 4NJKA 3H2NA 4O50A 4H6QA 4F40A 1E5JA 5IXEA 1XL9A 2P1FA 2WSYA 3V0TA 5KINA 2I1OA 3WF2A 1U33A 4CD8A 2NLIA 2CEQA 4ERGA 4TQTA 4Q32A 2OGYA 5M1TA 1VD6A 2HWGA 4NL1A 1OGGA 1LG2A 3DFOA 4Q8MA 3VX1A 3M9YA 1XUZA 3EWYA 2JK2A 1OGBA 4H1ZA 4B5NA 3M43A 3LPOA 4KFOA 3RLUA 2WWDA 2XJ7A 3GH7A 2VTFA 3QPEA 5LGZA 3IJ7A 3JVAA 4DM1A 4U4MA 1X7IA 1XC6A 1ICQA 5KZMA 1XHGA 2WHJA 3GUWA 1XBVA 4JPGA 3P14A 1CGWA 2A3BA 4XISA 3QLLA 4QEEA 3SY5A 3URAA 1VYPX 4JTDA 2OT0A 3MSGA 2P88A 5LKYA 3LHYA 4XV0A 3FN9A 1MUMA 1XW8A 5DX7A 3TROA 1E70M 3RK8A 2QCCA 2V67A 2V3EA 1P7TA 4WD0A 2CZFA 2DW6A 1E1CB 4PC8A 2VGBA 1AQHA 5FJRA 2HBVA 2E1DA 1WBJA 4IP4A 4Q4SA 4JICA 3O1NA 1VEPA 3WJZA 4BEUA 1EDQA 3GG0A 1JPDX 2W0UA 4C6MA 1TCDA 3CQKA 5FACA 1HJUA 4XD5A 3UXKA 1M01A 1YNPA 4FSAA 3EKLA 9XIAA 3NQEA 2WZTA 4H2CA 4AZBA 3BLDA 3VDCA 2CZDA 1JZ4A 4IPJA 1EO5A 1A5OC 4B15A 1XR2A 4DWDA 3ITCA 5I3FA 2PTWA 5A8NA 2F2KA 1WE5A 1POJA 1EC7A 2VC6A 2OKTA 4EACA 1OD0A 5KTLA 3WG6A 4ICCX 1R2SA 4CCDA 5CPQA 3VOJA 1A0EA 4EP8C 4HYRA 4BR1A 4D1IA 1QOXA 2X09A 2ZXAA 1I2PA 3PF3A 3RUBL 3CTTA 7REQA 2GWNA 3U7BA 1JFHA 1VJSA 1Z89A 4AMCA 1RA5A 1EWDA 1JDFA 5HUPA 2W62A 3H24A 1UMYA 2CITA 2F6XA 1FWWA 4GINA 1K7FA 4ZO8A 4QSFA 1ZPTA 3PAOA 4INFA 3WIJA 3TWBA 1GWJA 2YW3A 3P80A 2YX0A 1ZS2A 1YXDA 1PTAA 1FRBA 1UKPA 4IPIA 3GE7A 3H7VA 1OC7A 4KRZA 1F9CA 4QFUA 4ORIA 1A5UA 4PUKA 2OKOA 1C8VA 2YL8A 4JDBA 5E6ZA 1ZTVA 2R82A 3KDOA 2B81A 4LVAA 3NQAA 1OFAA 2OO6A 4IF2A 4JTAA 3HQOA 4GX9A 3H21A 3UWYA 4DJED 3TFXA 3ZMRA 5HAOA 1C92A 2WC3A 1W3JA 1US0A 5AN7A 3TC6A 2HXTA 3RPDA 4NI3A 1GOQA 1V7AA 1FP9A 4EIVA 4UFJA 2J79A 1J8VA 1AZ1A 2E6DA 3WBWA 3G0XA 4ZQMA 3DC0A 3PZGA 1U22A 1UOZA 3MMTA 3N4FA 1NH6A 3P74A 3KVMA 3PZVA 4AX6A 1ONEA 2ZKMX 3KZPA 1QNRA 3IGXA 3MMUA 2QGHA 2AOSA 1X39A 2C8NA 2FIQA 1F3TA 1ML1A 3GAYA 2XGBA 4WRHA 1E9LA 3W6LA 3VD3A 3ITYA 2E6AA 4FPSA 1VFSA 3T40A 2OSWA 3WLLA 4WVXA 3C3UA 4Q3MA 4MOZA 1P1XA 1E15A 2MUCA 3N34A 4V1XA 3W1PA 4DAFA 2JKEA 4CQDA 3LBCA 1T8QA 3I6TA 1W3HA 3SCTA 2VFGA 3WQ5A 3WLTA 3W2NA 1R2TA 3VDAA 3NR0A 4G2DA 4NJIA 3WDRA 4AD3A 1D8WA 1WNOA 4M81A 4QBXA 1JNDA 1W5OA 1AZ2A 4RDVA 3BK0A 3WELA 1ZAJA 1Q6CA 4E4UA 5BXPA 1W32A 3HO8A 1PVNA 3FKRA 1DHKA 2NVCA 1KV5A 4LVFA 2DP3A 5C6MA 3UT0A 1ZB5A 4PUNA 5AOUA 3U4FA 2H6RA 3WH5A 2J74A 4CN1A 3P0WA 5AY7A 1Y7VA 4V33A 5FSEC 3BL3A 2Z29A 4AD0A 3MPGA 4JTJA 2VT0A 2HDJA 2Z0IA 5HOSA 4NXKA 5JBEA 4BY3A 1RVGA 5HWNA 3BJSA 2PDBA 4RDZA 1GVOA 1Q13A 1SR9A 3S2MA 2XSAA 1F4HA 4O1CA 5DANA 1KCXA 3F1QA 4Q4KA 4AWUA 1ZHAA 1AD1A 2FPVA 2D22A 2IKGA 3W7PA 1XQKA 4ZE4A 2VC7A 1IWPA 5CC3A 4JKLA 5AZ0A 1SZRA 4E2DA 1OFPA 3B0PA 5A8PA 1LT8A 4ATWA 3OGSA 3CV6A 1NDVA 3S1UA 4DBSA 3MHFA 4I9AA 3TONA 3ANYA 3EXSA 4FLRA 3KBNA 3UD6A 1KWKA 3GVVA 3AMCA 3EEGA 3DN5A 1A5MC 1VBGA 4HK7A 3RNDA 4E3VA 3TYCA 3CIXA 1QATA 2ACUA 3VO0A 1KKRA 1H7WA 4Y7EA 5BW6A 1DXEA 1X7FA 3AIUA 1GUVA 3TJ4A 5EMMA 3WH6A 1YX1A 2BHYA 3AXHA 1UMLA 4RE0A 5FAJA 1W3NA 1H5VA 1NOWA 3P0XA 2I5IA 2YPIA 2WSPA 4U3CA 1XXXA 2D2GA 4QJ4B 1G7UA 1ITXA 1OGSA 1LT7A 1OF8A 3JS3A 3BLIA 4LCSA 4Y9OA 2NV2A 2ZZ6A 1TUFA 2Y6ZA 3FGCA 3SRHA 1LOLA 4DWSA 4CQAA 4BF9A 5T91A 3ARSA 1UD5A 1JF5A 3DHFA 1TJ2A 4AU0A 1J12A 1LQ0A 1ECEA 2PGEA 2G96A 1B3YA 3PTMA 2XGIA 3I3EA 1TUXA 5CKSA 2PS2A 4JIRA 1LCOA 2VL4A 2PLKA 3H2MA 1SZGA 1E1FA 4FS9A 2XUCA 3W7EA 2XVNA 4K1GA 2Y5EA 1JAKA 4JKMA 2EG8A 3N2CA 5BOFA 4C6IA 3CPGA 2C3ZA 4X2PA 1MMFA 3HQ1A 2X05A 1PZ3A 5GNXA 5D2YA 4O8AA 2XFRA 1VBUA 3TTEA 5A6MA 4Q22A 1YADA 3USZA 5AZ1A 3FSTA 4TO8A 2E6YA 1B57A 3ZLFA 3G1DA 2AMXA 4NP7A 3MB9A 1KFEA 1IZCA 1QI3A 2JF7A 2WO5A 5EFDA 3BJTA 3GU2A 4MDPA 4AZHA 5ENLA 2OG9A 1IGWA 1T5AA 2ZX6A 4X2RA 4N02A 3FKKA 1TTQA 1HG3A 4MNLA 4REQB 1KFWA 3AWOA 3L67A 3QVQA 1W9DM 3NDYA 4H01A 2VUYA 2ZX9A 4IHCA 2P50A 5U7SA 5KZ6A 2WMHA 1TPEA 4BWLC 5JUVA 3KVLA 4Y9PA 2QAPA 1R46A 1UCWA 4DJFC 4IZGA 3KWSA 1CB7B 1M9HA 2PWUA 2OYMA 2I56A 1UD3A 1JUKA 3O15A 4S2CA 3SQSA 1NDWA 2EG7A 2QS8A 3RILA 1EYEA 3AI0A 3CTLA 5TQLA 3CHDA 4JTFA 1A5SA 4B4FA 3GUGA 1RZMA 2BVTA 2Y8KA 3M5VA 5CZTA 4GVGA 3LTPA 1T40A 3NCOA 1OM0A 3KVKA 3OVQA 4ZQPA 2FMNA 1CXLA 1GJWA 4WUIA 1W6TA 3L4XA 3WH7A 3SADA 1JD7A 1FKWA 3V18A 3DKJA 1ITUA 1XKJA 3G3MA 1CGYA 4JTIA 1ISVA 4D71A 4KCTA 3NO1A 2XFWA 4NRRA 3EDEA 6TIMA 2WJZA 2DZBA 3GWQA 2E8ZA 1EB3A 1Z32X 4Q4PA 2VVSA 3BZGA 2NVAA 3EPMA 4GFIA 3AISA 1JJKA 4IMFA 4JYDA 2J27A 3ABRA 5M5DA 1DWFM 1R9ZA 2Z1BA 4Q8NA 4W89A 2WBGA 3VOHA 1UZ4A 2PP3A 3M7SA 3TYAA 1HN1A 2YXGA 4WEVX 2GGIA 4QTGA 1UZHA 4CQCA 4JL1A 1TYGA 4GE8A 4C1KA 1EX1A 3WLNA 2GQ3A 3NTYA 1G6CA 1JXJA 4N42A 4GUGA 3PZOA 2E3ZA 2E77A 1Q6RA 3Q45A 1WXZA 4IG2B 4WY0F 2GOKA 2ZUSA 1U1JA 4IMAA 4GQBA 4UFHA 2RFGA 1QR7A 1PEZA 3TYDA 1WUEA 1BYDA 3CZEA 2J8FA 2A3LA 4AVOA 4PMVA 4XBJA 2GGEA 1A49A 1UR8A 4O12A 3MV01 5KSWA 4ZOAA 4FXJA 1DXFA 4V1YA 1G9HA 4M51A 2KX9A 4J5NA 2CU0A 3PB0A 2PPGA 4LFYA 1TE6A 4XZNX 4FB7A 2PB1A 3GW0A 1CGVA 2C71A 3DFPA 3W2LA 4BFAA 3KL5A 4MY8A 1OF6A 4DYEA 3M0YA 4ZA0A 3AXXA 4UTJA 3G2GA 1FFRA 4JY9A 1PZ0A 2BLEA 3BSMA 1ESWA 1LOSA 3CIVA 3PG9A 5LSMA 1W31A 1XDMA 3E02A 5A3HA 4BHYA 4RZ4A 1J18A 5EPDA 1TJRA 1XLMA 3S5ZA 2HE8A 1EKOA 3TOYA 5EMKA 1E4LA 1B4EA 4O17A 1RP8A 2YDQA 3ELFA 2YXXA 4HB7A 1HJWA 3FCPA 4F2UA 1W5PA 1D9EA 1KM3A 3CUHA 2V68A 4IG2A 1E73M 3KRSA 3ZZ1A 1X6LA 5XIAA 3NDOA 1QUMA 1VC4A 4YYFA 1LP6A 4E5TA 2YJQA 3UU0A 1V6XA 4YMZA 1RBAA 4F0HA 3LCGA 5A6BA 5A6TC 3DERA 5H8PA 4YLWA 4HYWA 3N6JA 3B8SA 5A6BD 3OLGA 4HMCA 1SPQA 5DXXA 1L8NA 2UV8G 5HK4A 4MM1A 4L9ZA 3GC4A 2VOTA 4K8GA 1KLYA 5HWJA 1TV3A 3GYCA 2VDHA 1J79A 3WEZA 4D6FA 5JVLA 2YA2A 3U57A 1MEIA 2PD5A 4D6DA 4MG4A 1XLDA 2DT3A 3TZFA 2BOGX 2OLAA 5BU6A 4E3TA 1EIXA 4ZB2A 3L12A 3WD2A 1WZMA 3JZUA 3B04A 4L6HA 1JVNA 4AWTA 1WKDA 1RK6A 3ARTA 2Z6JA 4HU3A 2P5NA 1DORA 2E9LA 5DEZA 2ZUUA 3HFYA 4HJFA 1Y8BA 3CXOA 1TTJA 1PX4A 3VKCA 3E5BA 6XIAA 2GSHA 4CLMA 3OEXA 1DJWA 5AYXA 5G5IA 3KE0A 2ATMA 4NI8A 1FWEC 3BUVA 3GNXA 2JQXA 2XISA 4IX2A 3FLUA 3EAUA 2RDXA 3CK5A 4U33A 1BVZA 4QAWA 1E0TA 5IHRA 3CBWA 2OGJA 3DECA 4H9UA 3TAKA 2ZOXA 5A2AA 3IIOA 4AIBA 3GQYA 2ZUTA 5H6HA 2D73A 1V3KA 4ZQNA 5FA5A 4XKYA 4X0VA 1HKWA 3ZT5A 3GXFA 5HXMA 4OBRA 4C6NA 3MYOA 3WLMA 2ZXQA 4JFWA 3NOYA 4EKJA 3M6DA 3AHXA 3CPRA 2C18A 3WLPA 4R9XA 2OB3A 1BWKA 4KFNA 1EQCA 1OK4A 1HO4A 5G2WA 1A5AA 4RX0A 1NFBA 4EXBA 1G4PA 4C65A 2VC5A 2P8CA 1UBSA 3LHTA 2JEQA 5D2WA 3M5ZA 3W2JA 3LZ3A 3FK4A 5CSUA 4XSLA 4R34A 3TKFA 2XIBA 4WJEA 4PB4A 2P0OA 3S9YA 1H62A 4G56A 2PGRA 4UOJA 1JQXA 3IS4A 2IKHA 1M5WA 3HURA 3W22A 2X41A 1XLGA 4O11A 3L9CA 1AUSL 2CC0A 4AXNA 1VYSX 4FZIA 3QOKA 4MWAA 3N2OA 4PODA 4H9XA 4PTNA 3R6IA 1IXPA 4GBDA 5IRPA 4MWAD 2V2DA 3DIPA 4K2SA 3CV2A 3B8TA 4HN4A 2HISA 5E0KA 4JN7A 4F9JA 5C54A 2BG5A 1IIGA 3NYZA 5U4NA 5CC6A 3N9SA 4C1NA 1LM1A 2V6AA 3QY8A 3UJFA 4HA3A 4WF7A 5IHSA 1QO2A 3VKKA 1LF1A 3EOUA 4RXFA 1NQKA 4C90A 3ARUA 2J7DA 1XGZA 2Y85A 3SGZA 4ZZ9A 1GOIA 3EZ4A 2VHLA 3GHUA 3A9IA 2PTZA 2DJLA 1R3RA 4IGMA 4LYKA 6A3HA 2E5BA 4XZMX 4KGJA 1AJ0A 3BURA 2DORA 1NU5A 1V3IA 1GPFA 5FF7A 4GHRA 3B0VC 3S2NA 3DH7A 5D32A 4M6PA 2ZX5A 5HNTA 5JBDA 3PSWA 3S1XA 1CBGA 1VENA 3MVIA 2DT1A 4PUUA 3NQCA 3PM6A 4ICNA 4FHAA 3TN3A 4OWGA 3EX4A 3AICA 5AHMA 1UC5A 4FOJA 5AFDA 4PFHA 2UY2A 4O4WA 1R3QA 1OK6A 2Y7EA 2PD9A 1R8LA 4P7OA 2V5CA 4OVXA 1QNPA 5CSYA 4F0KA 3L5LA 3BAYA 4IGNA 5BXSA 2GZXA 3RLGA 2C16A 4JYEA 1KGWA 1W9UA 4CNNA 4DNHA 4CD5A 1P1MA 1MQRA 2C1HA 3OTRA 3V0SA 3ZQ9A 3K5XA 3FA4A 3SR7A 3W6MA 2KAUC 2W63A 4OGZA 3G8RA 1EUNA 5ABGA 2WW5A 3SAZA 2FDSA 1KFBA 3OG3A 1Q6FA 3OGRA 1B2YA 3G1SA 3MQTA 4JD4A 4JXCA 1KQZA 4QHRA 4M24A 2O9TA 4PB5A 1Q5MA 1OD8A 2V3FA 3E5PA 4W93A 4DPQA 3T6CA 4AY7A 2UY3A 1C8XA 1KWGA 2Q09A 1EJTC 3BMWA 3GFYA 4NUWA 3N2XA 2Y88A 3LOTA 4GYKA 2CLPA 3BW2A 4W7UA 3TX9A 3VOFA 1TZ7A 3WEMA 4OT7A 4TX8A 5KEZA 3NM1A 1MQPA 5EFFA 3UXLA 3DYOA 1OINA 1BG4A 1G0CA 1MVYA 3S1WA 3CEPA 1KRAC 4RLIA 4PTWA 4IH3A 4TMCA 1H0IA 1L2QA 3C2YA 3VZXA 3NL6A 3W00A 3CJPA 5ABEA 5F4XA 4ACYA 3EMZA 2XM1A 4DO4A 4HSNA 4GKTA 1QI4A 2VP8A 1VRDA 3WNLA 3H54A 4P8XA 1D7KA 1M04A 1J2BA 3GR7A 4S3CA 1VP5A 1F61A 1DTUA 3P84A 3EMCA 5BU9A 3BSGA 3LHWA 1I45A 2FLIA 4ILSA 2P8BA 1I2RA 3WQGA 2ISWA 2HV5A 1K9EA 4PUJA 3THAA 2G5WA 3GU1A 4IUGA 4M7SA 1GOKA 4G7EA 2GDVA 1XRSA 2HROA 2WC4A 2ISVA 2QPUA 4O1BA 1OC5A 1B3XA 3KOXA 4PUMA 1A3WA 1CCWB 4HD5A 2HS6A 1A5LC 3ARWA 2QW5A 2R1NA 3DESA 4AVNA 1Q3NA 5LIUX 2IQDA 4KF1A 2FVKA 4K68A 4HN8A 1KW1A 4N4PA 3SY8A 1DE6A 5HJYA 3AJXA 3H53A 4B5TA 2D69A 1XIIA 2DQWA 4NQ1A 4CU6A 2PDIA 2VGIA 1FWFC 4GQGA 3SN4A 3T0CA 2WSKA 4LBRA 3QV9A 3B8WA 1Q45A 1IEXA 1TIMA 3CYVA 1BHGA 4ML9A 3W7HA 2PU0A 1GJPA 2ISSA 2BSLA 4DUWA 4MLJA 1X38A 3E0IA 4C7FA 3HA1A 4A2RA 4PCPA 4GLEA 2WOQA 5K7JA 1H1NA 2CXEA 4LH8A 4LF1A 3WUGA 3ZJKA 1R38A 5BRQA 3RMEA 3L2LA 1FWGC 3AYTA 2REQB 3TU9A 1E4MM 2TODA 3BG9A 4F0SA 3GZAA 3TOPA 3LV5A 3DGBA 3VNMA 1LQ2A 4O19A 4LBUA 4JTUA 3HB9A 3CHVA 1RCXB 4H4IA 4S3BA 2VZSA 2QNEA 3TLLA 1JR1A 3A5FA 4PMDA 1YHTA 4QR6A 2B7OA 4KBXA 1M03A 1D2KA 4AIOA 3FFSA 4I7UA 4IIBA 2X2YA 4W7WA 3NQ7A 2VFEA 3N25A 4C6LA 1V08A 3O6CA 4N2YA 1I4NA 1YLVA 1HF6A 3NFUA 2WNQA 5FJIA 3NQGA 2FHFA 1EH9A 3MCNA 3VE9A 3LLFA 3WX7A 4FA3A 3IANA 3S46A 5HJLA 2D3NA 5E9AA 1BPLB 4R85A 4Q8QA 2NWSA 4HNOA 3IPWA 1HP5A 3IIVA 1US3A 4TXEA 1DOSA 3QF0A 3H70A 2E8YA 3VIOA 1OT2A 3CAQA 3W38A 2ZUWA 4F4RA 4PUEA 4CN4A 7A3HA 1R9YA 1HKMA 3E96A 3GHRA 3IJ8A 1ODZA 3DU0A 3GC2A 4IICA 4RNHA 3T0AA 1QO5A 1VFLA 3KVJA 1CT5A 1DL3A 1ECQA 4LTSA 2V63A 3VC6A 3RF9A 4L6DA 2WMJA 4Z1YA 3PVFA 1RQEA 2WSRA 2Y2WA 3CQIA 2ANUA 3CUJA 2ESCA 3CO4A 3GH5A 1M68A 1W54A 1TCMA 1SYTA 4J3ZA 4DQWA 1XSKA 1NQ6A 1XI3A 1KRCC 1RD6A 1JRCA 3WD0A 4E8GA 4P8VA 3M5XA 3KOWA 3N2BA 3WK1A 3ARPA 5D09A 3ZFHA 4KH2A 1H4PA 3W7MA 3WLKX 1CWYA 1T96A 4FR6A 3UETA 5EB8A 3H7RA 3ZR4A 3ICJA 5I5RA 3BAXA 4ENLA 2OZ0A 2CERA 2AL2B 5EL1A 3FYYA 3PBGA 4AD1A 3H23A 4B90A 1YE6A 5B80A 1JCYA 1F5ZA 4QITA 3LA4A 2NQ5A 1J10A 4BKNA 3VM5A 3PJTA 3AYVA 4HJWA 3F4WA 3G1VA 2XIMA 3LGEA 3MVTA 2EPKX 4O1EA 4O1FA 1I60A 3PTKA 3ZXWA 5C70A 1W0MA 2WMIA 2VQTA 1N8WA 4GD0A 4U10A 3STCA 3AXKA 3QYQA 1GVQA 4CGTA 4AHOA 1PTGA 1XV8A 4RZ5A 3ARZA 3WLRA 2QCEA 5FF3A 5K9CA 4AZ7A 2D0HA 5CPTA 1P0DA 5ECVA 5PTDA 4A8IA 4A35A 4DF1A 2GK1B 1OY0A 1XRTA 9CGTA 2PU1A 1VCFA 4NG3A 3LCLA 3LXCA 1LRQA 4DLMA 1VFFA 1HP4A 4ZQOA 2XPKA 3WBAA 1EF3A 4MVAA 4JFSA 3MT1A 4MNJA 1G67A 4CN6A 5TNVA 1LQAA 4K8HA 3NZGA 4JFVA 4E2OA 1Z44A 3ANVA 2CBVA 1VJIA 3EDDA 1VBRA 2JIEA 3BQ5A 1AH3A 4KEUA 5LIWX 3NQFA 4I9MA 1J96A 1LLOA 3M07A 3CZ8A 3U48A 3W28A 1QRQA 4YHEA 4JS3A 4HNVA 1UPMB 2ZTKA 3T07A 1G7VA 4LVGA 3HTWA 2IXUA 3HMJG 4XSMA 5REQB 2RDWA 1ZJBA 3AMKA 3U6WA 3CB3A 2YCLA 4LALA 3B0YA 4MLRA 5DQPA 1V3JA 3C2OA 4WDUA 4TTUA 4UC5A 4QROA 1TV4A 1UROA 2HRWA 1W9BM 3IJDA 3OP2A 4GQQA 1PWLA 2BOFX 3ES7A 1RBLA 4GUFA 3K30A 2O9PA 4KCWA 1YDVA 3R10A 3SDOA 2YCKX 1OCBA 4HZ8A 3OODA 2RUSA 4LAUA 1T41A 3UY7A 4QG9A 3QPZA 4A21A 4ZFCA 4KMQA 4JEQA 5CGTA 5CQ1A 3O63A 4KERA 1CNVA 3F7JA 1W1A1 1JAEA 1V0NA 4WCJA 3TA9A 4GH3A 4LSBA 4JTLA 5ABFB 4L4LA 2F38A 5CGQA 4I5XA 2R24A 4DUXA 3TDFA 8RUCA 4MHBA 3WLJA 4K39A 3EWZA 2YBVA 4ZO7A 1KFKA 3UPWA 4DZAA 1HJXA 1SQ7A 1DWHM 1UA3A 2ZBTA 2J7BA 1K6WA 1RLCL 4URIA 4OUIA 5E9XA 4LEFA 1XLBA 4B3LA 3BW4A 4RE2A 3LNPA 4CD4A 2GVJA 2POZA 1PS9A 1WCGA 1NSJA 1Q63A 4P2VA 3SZ8A 1BRLA 3LEPA 1QU4A 2QJGA 3FVMA 1JDCA 4GUIA 1XD1A 1P43A 4B16A 3TW7A 4E2BA 3IJ9A 1HKKA 4U5KA 1DJIA 3NO3A 5G1TA 1TZZA 2C19A 3VZYA 4GCAA 1UKTA 3WNPA 5CAKA 1KXHA 2ZA3A 2ZRVA 3TWAA 4DM2A 4C6CA 2NX1A 3EYPA 3VK5A 4YU1A 2ZDSA 2FVMA 4YTUA 1RJQA 2W3ZA 3BCDA 4IGSA 4QLJA 4DBDA 1BWLA 1FP8A 4LVBA 7ODCA 3H22A 2BY0A 5JH2A 1G5AA 2E4TA 3C5QA 2WM1A 5ABFA 1EWEA 1O66A 3UJ2A 1AQFA 1OSEA 1VZWA 1JGMA 1Q6QA 1E6ZA 3ITGA 2Z6IA 1NJJA 3L65A 1QK2A 4HHMA 1PDZA 1E72M 2QF7A 4Z42C 3ARRA 3QSRA 4H9MA 2J66A 4JKKA 3EKGA 4XAFA 1EJVC 1UW9A 1Z7AA 1NFGA 3I68A 1JGIA 2VCCA 1TG7A 2OOGA 3NPWA 2VEPA 3NXFA 4PSPA 4GXWA 2VRKA 1WA3A 5HMEA 4FXRA 4XD3A 3TSMA 3E38A 1U30A 1PYFA 4DJFD 3UY8A 1Z42A 3TN6A 1WOBA 3BAIA 1FWSA 6ENLA 3U8GA 4MB4A 3AHTA 9XIMA 2VOMA 1CGXA 1F4AA 5I77A 3EKZA 1R7OA 1XPYA 1EOKA 2Q01A 4XTDA 2WANA 4ZODA 5L6UA 1Z41A 4PSRA 5E5CA 4US6A 1EJ7L 1HTIA 4QS5A 3N12A 4BI5A 1H51A 4MWAE 2QF8A 1WP6A 3NAVA 2BXZA 4J4KA 4WHBA 2FB3A 3HGJA 1EIBA 1MW2A 1FWAC 3NEVA 3GDTA 4S3GA 2AGKA 3H2CA 4YIWA 2DZUA 1MXGA 4OHQA 1FUYA 2XIOA 3NURA 3PNZA 2VD8A 1IE7C 1V02A 1UD6A 3FV9A 1DJQA 3ZS4A 1NF0A 3BOFA 2CNCA 2OO0A 1WYIA 3LZ5A 5I23A 1JYXA 3FY1A 4OTKA 1E0WA 2V3DA 4WIWA 1HJQA 2FVLA 2PMQA 3MA8A 3LPGA 5AC6A 1HJSA 3LQGA 2XYLA 3UVIA 5EMJA 1CI1A 4LY4A 4D6GA 4ZE5A 1C91A 2W67A 5AVNA 4MB5A 3VUPA 4QISA 3CL7A 3MCOA 1R47A 1C93A 3ABQA 1K03A 1UQZA 3H7UA 4B9ZA 3W1MA 3VIIA 5I3DA 5DMNA 3BOLA 4NF7A 1XLLA 5C2CA 2VZOA 3NPVA 3N9RA 1UIOA 4W7VA 3GDLA 4UR9A 4KW2A 5F4SA 2I17A 3HG3A 4Q6JA 5JIPA 4HPNA 2G95A 1GOMA 1GZGA 4EF9A 3KBWA 4J2PA 3U9IA 2QCNA 1VFOA 3NQBA 4H9TA 3VGGA 1VBJA 3UR7A 1W56A 4UTHA 5DXYA 1P6WA 1J0JA 1MSSA 4H8VA 3VCNA 1XIEA 1XCXA 4ZTYA 1L8PA 2CBUA 2OZ3A 1U1UA 3REQA 1TV7A 1ZSXA 4G7FA 1AW1A 3T1GA 1PBGA 5G1YA 1I0DA 1IXNA 5JBFA 3JU2A 1JZ5A 4EF8A 5BOEA 3LCFA 4JHOA 5XINA 3UESA 1JYWA 5G4HC 1DKWA 4PBEA 2HXUA 4JQAA 1DVJA 3H4WA 2ALDA 3RCYA 3WL0A 3S2JA 3KAOA 1RV8A 3E2VA 2J9YA 1ZAHA 1TPB1 1W9VA 3B05A 3WSUA 3IUHA 2AKZA 3PTQA 4PMNA 4PBFA 4AZCA 1I1XA 3LN3A 1F2JA 1DJGA 1Q85A 4NZJA 3VAVA 5ABHA 1TPVA 3LCWA 4XG1A 2OLHA 2QJJA 1NIUA 4FOUA 2E1WA 2GQ8A 3L4WA 2V30A 4FX7A 1ZCCA 3A64A 5FL1A 2B0MA 2ZVIA 1ZBVA 4TX9A 1TVLA 1R86A 5AYIA 4DF2A 5IBXC 1V03A 2A85A 5TBOA 2GVEA 3KL0A 3M64A 4QCEA 2FPTA 3ME3A 2AGTA 3FOKA 1GYNA 1G01A 1YQ2A 2OOFA 1TELA 3ZM8A 4QNWA 2HVMA 4L1WA 4LBSA 3K8KA 3POHA 3VDBA 3WQ6A 2ZA1A 1IYXA 2GDQA 3S5NA 2CCRA 4AD2A 3GTIA 4GC4A 1VEMA 3A9BA 3E1F1 5LIKX 3AZRA 1IEQA 1K02A 3EDKA 3N17A 1TR1A 4LEQA 3MKVA 4AWEA 2ZRUA 3QV6A 2OZ8A 5F2LA 2EPHA 5CBBA 2A0NA 3IAPA 2VWTA 3VKDA 4ERIA 2EF9A 4MYAA 1QTWA 1EZ2A 3W71A 5F4WA 4M3PA 1ZENA 3AUOA 1GONA 1GVIA 4JQ3A 2X0YA 3WUFA 5AVHA 2BASA 1UH2A 4UR8A 2HNEA 4JTEA 4RW3A 1JCXA 4ZSTA 1KQYA 3Q65A 3IGSA 3VD9A 3W0KA 3EWUA 2PLJA 4MMWA 3L0NA 3CEUA 3BGJA 4L1GA 4QGCA 1SJCA 2XN1A 4D8ZA 1Q7MA 2ON3A 4UTTC 2VFDA 3VGBA 4R7OA 1JRBA 3DGRA 3BO9A 2Y62A 3BSHA 3NUKA 1N7KA 1R3TA 1Q66A 4UIOA 2W66A 3WFLA 1XLHA 1ZBKA 5HQLA 4Q8VA 4MKVA 2QV5A 5FF2A 2JEPA 4DJDC 1QK0A 1DBTA 1NP2A 4X61A 1A4MA 5AC5A 4C5ZA 4JTCA 1OT1A 2G8ZA 4PTMA 1J6PA 1SM9A 3IIPA 1YKWA 2DIEA 4O14A 3V16A 2X1IA 3ABOA 3WJSA 2QULA 3UNDA 1OADA 5H8UA 3I7QA 4EX4A 3OYZA 5DCEA 3B97A 3CO8A 3W1LA 3GVRA 4H6RA 3M44A 3CT2A 2RGLA 2ZRXA 1MDLA 2UWFA 5K2ZA 1QPQA 2VGGA 4LY8A 2CLLA 4R27A 1OC6A 3CAVA 1JIBA 3WBEA 4BQ3A 3NWRA 2JFEX 1JYNA 1UKSA 4LCQA 1OBAA 4UTFA 3EDFA 3AXIA 3MSRA 1JZ2A 3I10A 1EFZA 2QZRA 2HZGA 3CV7A 4NRSA 2XN0A 3ZVHA 5BWFA 2CLHA 2GJRA 4P7RA 3FNDA 3W37A 3ONCA 2OQHA 1A5CA 3QMTA 4AX7A 5DRCA 3EPNA 1QW8A 2XIJA 5CPSA 3XISA 2CHOA 3RX4A 4CNTA 3GDKA 1QVBA 3LGGA 4X63A 1WAUA 3APGA 1RQBA 1D3GA 2D2JA 3WQPA 3PR2A 2YSWA 2INZA 1L2UA 3BGAA 1Z8AA 3WQEA 1LLZA 3RIKA 1BXBA 4GIEA 4DELA 4NAFA 3EX2A 3IVUA 5AB3A 3CMFA 2YR1A 3M6YA 4N9BA 4KFPA 3LPPA 4EK7A 1GVFA 4RV8A 1Q65A 1GZ1A 1V4YA 1FCBA 4XK2A 1YIXA 3VZZA 1TQXA 3BC9A 2Y7DA 2OX4A 1GG0A 4DO6A 2J7CA 1ZNNA 2WAGA 3MHUA 3QTGA 3PWIA 4GO8A 1S2VA 2BY2A 3MHGA 1FA2A 5DLCA 3SRKA 3QKZA 3MUIA 2UY5A 4LUTA 3EXRA 4B92A 4NU7A 3URBA 4DNMA 2V8ZA 4I90A 2R1PA 2YDSA 4B2DA 3CMGA 1CLXA 1C7SA 1RHCA 3VILA 3EX3A 4B2DD 3HQNA 4WDWA 6ALDA 1V6TA 1KBKA 1ZJHA 5AECA 1W1YA 3QLDA 4NZFA 4MKSA 3NZQA 3SGGA 2OELA 3UR8A 1B9BA 1UUQA 3QQ0A 1AQMA 3NL3A 1XRFA 2E68A 2AQVA 3PPGA 1Y5VA 1XF0A 4CCZA 4Q7BA 1SU5A 2WYSA 2R14A 1BKSA 1R7AA 5E1QA 3LTYA 3APYA 1QPRA 3GXMA 3TEVA 4RPPA 3TAOA 4H7VA 4QJ1A 2EPOA 1F05A 2RJGA 1EJRC 4PULA 3CM4A 1DWIM 3EPOA 3OZPA 1LWHA 4I3GA 1BEUA 5D03A 2VGFA 3GLCA 4FNTA 3NA8A 4D72A 1A3XA 3LHZA 4ACZA 3C0SA 4CNOA 1V79A 5A8MA 4AF0A 2ZZ4A 5CPLA 3VKBA 3GNNA 5SWUA 3PK7A 2WKLA 3UEQA 5A2BA 1ZAIA 2F2HA 3W7QA 5JMUA 2DY3A 3CUFA 1DV7A 3Q67A 4KESA 1TMLA 3QMRA 3UJRA 1GW1A 3BLEA 5FJTA 3N2TA 1XYMA 1U2YA 2B4GA 3OGVA 3URQA 1XLCA 4CVWA 1DJYA 3UA3A 3RRAA 3OPSA 3WUEA 3S5OA 2QGYA 3AMLA 4WY0B 3N1AA 4QDWA 2YCIX 1FWCC 2ACSA 3CC1A 4AZ6A 2A3CA 3COTA 2VMFA 3A4XA 3SFKA 3RHGA 2BX7A 4KCUA 1S46A 4HMDA 1FY6A 4YWIA 4LCRA 1I6NA 3OO2A 3VKJA 3PZNA 4QJ5B 1BFNA 3EWWA 2OZTA 4RR4A 3NQVA 3NZPA 4PL1A 1EF2A 1S2WA 3TW6A 2ZUMA 2VX5A 4HZMA 3HF3A 3EWDA 2VR5A 4OBTA 2A7PA 3GK0A 5I3IA 2VUNA 2G4JA 3EX6A 3BLKA 3C0QA 1Z48A 4CUCA 1TPDA 1AD4A 5CPMA 1VLIA 1NP0A 4Z2JA 5DN1A 2NXIA 4M56A 2QUNA 1B5TA 1F6KA 5CC7A 2NUXA 3ABZA 3GC5A 3VMPA 3BOXA 3R0KA 2QJIA 4V27A 1HJVA 2V3GA 4GG9A 3V4BA 4F2TA 2Z25A 5B7YA 1FFQA 2FHBA 1TREA 3RU6A 3P60A 1S5VA 5C2GA 1VJZA 4QE5A 1BYCA 3SQMA 2BGNE 1AH0A 3DYPA 3UXDA 1IV8A 4A3HA 3F4NA 2YCJA 3OHIA 4LS2A 1OJXA 3A6OA 1M7OA 5CZSA 2NXHA 2QLYA 1EX5A 3SQLA 3NIYA 4O16A 4QM1A 1GT8A 1YXYA 1Z9AA 3DFYA 1FWRA 2WXDM 1YDNA 1VHNA 4WY0A 4ZSUA 3Q58A 3G5EA 3B03A 3MJYA 2J62A 4GZJA 1YNQA 3TFCA 2NQJA 2YFNA 4FLSA 3M16A 5HQEA 3OOQA 1EC9A 2I14A 4QJ3B 4LVDA 1I75A 4LU0A 2PCQA 2EPNA 1LL6A 3LMZA 5T8GA 3KP0A 3TN4A 5JH1A 2Q71A 4FO4A 1VBHA 2DPEA 1S2AA 1VR6A 2PDLA 2PDXA 3K13A 4ASTA 1MYRA 1TA3A 3D3FA 4E4PA 5AC8A 1EUAA 1E0UA 5RUBA 2GFTA 2WVVA 3QTPA 2ZCGA 1TVNA 3C0JA 1ZP3A 3WMCA 2X7VA 5HMDA 4C6BA 4YCOA 3M0LA 3WJYA 3NNTA 4HQVA 3UWWA 2GJXA 4CQBA 4GCXA 4IFOA 3WUBA 3W26A 4ZQRA 4ZTXA 1RR2A 4O10A 3W24A 4RUBA 1XJBA 5J5DA 1KKOA 5F2GA 4JIIX 4GOAA 4KWUA 1J11A 2BV9A 5LHEA 1HIZA 4AVFA 1JQVA 3C86A 5DT5A 2XVLA 1G94A 1X1ZA 3BMVA 1PAMA 4K7VA 1W9PA 1AMKA 2DU2A 3VMNA 1O5QA 5HMFA 2NV1A 1SFSA 2QJNA 4LAKA 4TVDA 2AKMA 2I16A 1NTHA 2H9AA 3ONBA 3CHCA 4CU8A 3LRLA 1P7TB 5E09A 4AFYA 3DXIA 2W92A 3FJNA 1ZZMA 5EBUA 4C6PA 4HTYA 4YTQA 3UWEA 1MW3A 2YB1A 3HGSA 3N04A 1K7XA 3QBUA 3GSMA 3F2CA 3WF3A 3FXGA 4RK8A 1C9WA 3W25A 5M03A 1JFXA 4CEXC 2V2CA 3QSTA 2ZC8A 1LL4A 3UF9A 2WK2A 2G4FA 3PBVA 4EOUA 5LHFA 5A6AA 1MI3A 2FFIA 1JG9A 5CG7A 5I00A 3K4WA 5D8WA 4Y9MA 3P62A 1KBIA 3RDKA 1K4GA 4NILA 1V51A 3KUMA 3LMYA 4HK5A 3PUDA 4JHZA 2DQXA 2E0PA 3F5KA 1V6VA 3UG8A 2JBMA 1TRDA 3M0ZA 4UBPC 4B3KA 4LB4A 4IIEA 1Y65A 8A3HA 3AALA 3UNTA 1HKVA 4NZCA 3TTYA 1X1OA 1VYRA 3LS9A 2O56A 1VPXA 3TQPA 1LUCA 3STEA 4JIPA 4IQDA 1BGAA 5A1AA 3O6DA 4O18A 1OX5A 3UZYA 3QZAA 2WNZA 2NUWA 4TUFA 3NL5A 7REQB 1P0NA 1V6UA 4Y90A 5FJOA 4XUGA 3MP3A 5A2CA 1EOMA 2FGLA 3IGUA 2PWHA 3OZMA 1V02E 4F0MA 3BDKA 4H8HA 2PWEA 3CASA 3CS2A 1KNWA 3V35A 4Z2KA 3GKAA 4HPJA 2Q8LA 1UOKA 3W1NA 4V15A 3DENA 1EHAA 4NNBA 4HSHA 2PC4A 4J27A 4D6JA 2QIWA 3PWGA 4ZQCA 1UZ1A 4DUVA 4JR5A 1UD2A 1XYFA 3U2OA 4I8DA 2GSEA 2YB4A 3KP1A 1B0IA 1OIMA 2J47A 2DUAA 4M19A 1UH3A 2RAGA 1SFTA 2RJHA 3M0KA 1KCZA 1TZ9A 4ZB5A 4S23A 1PHQA 1HQTA 3G1RA 3E0VA 1SO6A 4IFRA 1I9CB 4UQAA 1GCYA 1YBQA 4QQUA 2ZQ0A 2JALA 3L0GA 4I8YA 2XH7A 4AY8A 2J7EA 4P8WA 5FD0A 4DYJA 2G50A 2HVOA 4D6EA 3W1XA 1WDWA 3ERPA 3IWPA 3OBAA 2ZUVA 3A3HA 2V81A 1H7PA 1JPKA 4PTXA 5HATA 3VNLA 4KT2A 4TMBA 2G3FA 2X7WA 1N8FA 3GFXA 4IFKB 4S3AA 4S39A 2PWFA 2IW0A 2YA0A 1ZP4A 3DFTA 4PE8A 1OVDA 3PBWA 3UGRA 4PTVA 3L4VA 3WF0A 5C7HA 1WDDA 5GJNA 1X6UA 1VPYA 4AH7A 5BOOA 2WZEA 3DHUA 3CIWA 3P82A 1XIMA 2A7NA 3EOSA 3E74A 1TO3A 3BTNA 3FSUA 4OECA 3IJQA 1EC8A 4YVXA 1VIZA 1JZ3A 3PBUA 2I57A 4XTIA 4XAYA 4DJEA 5MKGA 4A22A 1U1HA 3R2GA 2CETA 4AZ5A 5HQMA 1K8CA 1UC4A 1VHCA 2QIIA 3KOFA 1A50A 4HHPA 3S2CA 3WQCA 1XGEA 3H4XA 2Z27A 2OQYA 3W84A 4ZL1A 4KS0A 2A4AA 3BV4A 3VX0A 1E6SM 2QDHA 3FJLA 2NW0A 4M0XA 1ONXA 3CLMA 4A6GA 5DF0A 3S8HA 3V5OA 1TQJA 2JKPA 1Z6KA 1OB0A 3MV11 2ASHA 4IMCA 4AQLA 3ABSA 2Q02A 3DOPA 5CZKA 2CW6A 3N19B 2D0FA 3DG7A 5KZDA 2OWWA 3U7VA 5J04A 2OWXA 3HGRA 2Q6ZA 2VEMA 2XWEA 2QKFA 4UUIA 1CECA 3VUSA 3T8QA 2CHRA 2HBXA 1ALDA 1PDYA 2WSQA 3NO5A 1XIFA 1YW1A 1UQYA 1XDJA 3FA3A 1VLWA 1F3XA 2TSYA 3OZYA 3NZ1A 3AHZA 4IFKA 3MO4A 4DRSA 3R4IA 1HUVA 4A3UA 3MBDA 3UPBA 3ZIZA 3HIJA 1CGUA 3IJIA 1ELSA 2OXNA 2JGQA 4IOTA 3TXZA 1NY1A 1VB9A 2ZA2A 2QXWA 4LUSA 1VCVA 2FKPA 2VFIA 3FEQA 3GY1A 1MRQA 3W1TA 3GNRA 2OMAA 3FX4A 2NX9A 2NQLA 3TJLA 3IRDA 1SJAA 1S2TA 4W8LA 4EAMA 3L23A 2WB5A 3FVDA 4UFMA 3LSBA 4UFLA 1VS1A 2I7GA 3AUJA 5HPOA 4PL2A 1E3XA 4RE3A 4PFMA 4KCVA 2ZTJA 1MEHA 3EXTA 2Q8ZA 4HPXA 4IJRA 4XIMA 1NWTA 2GLKA 3LG3A 4H00A 4HOZA 4F66A 4MJ2A 4OIFA 3WDQA 3GU9A 3UXIA 2V82A 5BYWA 3DYMA 4HVXA 4XD6A 2ZFAA 3NOEA 2J88A 2Y7FA 2XM2A 3OG2A 4GABA 3MDWA 4U5IA 3WH9A 1REQA 8TIMA 5D9OA 4DWSC 1EEPA 2JE8A 1M41A 1KFJA 2ZADA 4RJEA 3U2ZA 2Y1HA 2HTMA 1V7YA 3DZ1A 1W17A 2PTYA 5GJPA 6TAAA 1SFLA 2HNHA 4AMAA 2VEKA 4UZUA 4A8LA 1ZBWA 1RXOB 3JRKA 4AEOA 4X60A 3BLPX 4RCXA 4IT1A 5D9PA 3ITOA 1XFCA 3G1HA 3CQJA 1BKHA 4IGHA 2DH2A 3VCCA 4I7VA 3FGCB 3USBA 4DWSB 4ZB0A 1IEIA 1IR2A 4O52A 3LU2A 3SECA 2YLLA 2XHYA 3RCMA 3CAKA 4L7ZA 7PTDA 1DQWA 1NAL1 3DHDA 1NARA 1XCWA 1YMYA 3C61A 4MY9A 3PWAA 2PBOA 4LS0A 1H1YA 4JHMA 1YPFA 3VABA 3UYIA 3VGEA 2VR4A 1EA0A 4POCA 1G69A 3LM7A 1C9DA 3K8MA 4M7TA 3KS6A 3UWVA 4H7ZA 1R85A 4YYCA 4NSBA 4TU1A 4C6DA 3PNUA 2GGHA 1QPOA 1NEYA 2QCDA 2E5CA 1TWSA 3QXBA 3NDZA 2Z1WA 2XSBA 2J9ZA 3TYBA 4AYGA 3TYEA 1SGJA 4ZOBA 4Q4RA 1F07A 4JN6A 1O95A 4TX6A 2FTWA 2ZRYA 3SM0A 1DIOA 3NQDA 1NOUA 1BSIA 2CKRA 1H41A 3A4JA 3GBEA 4JQ1A 4QXIA 2F8QA 3BAWA 4Z2HA 4R5EA 2IPJA 2QHAA 3PPFA 2ZUNA 3THCA 1YPIA 3EEZA 2PCEA 1DJXA 1W2VA 4NASA 4GK8A 3BV7A 4R7JA 4RDWA 4GIRA 1WO2A 1TSIA 5C9ZA 4S3FA 1Q6EA 4JBRA 3NQMA 3K1DA 3MZNA 1EJXC 2QCLA 4Y9NA 1SW7A 4F48A 5CZ0A 3E0LA 4IQJA 4BF5A 2BZNA 6PTDA 5H8MA 1QPKA 2CZVA 5I3JA 3N18A 1EBGA 2OPJA 3T4WA 1ME9A 2Z2AA 3BLLA 3BG5A 2BP1A 1OWQA 4M82A 1F76A 1R30A 2OEMA 4O13A 2R94A 4XZWA 1W1PA 2QEZA 2VFHA 2VWSA 2XH0A 1OX4A 4RNFA 4X9YA 3R0DA 1ZJIA 1XIGA 3B8UA 4AHPA 3UA4A 1FWDC 4Y6GA 4OU1A 4MZYA 1H7OA 3B40A 1K9TA 4H19A 3SSJA 3CWOX 1KBLA 1TV2A 1K1DA 1MXDA 4GO9A 3PC0A 3W07A 2ONEA 4G6CA 1W5QA 1VCGA 3XINA 1V6YA 3QHMA 3TXVA 3EBVA 4I7WA 1RSCA 3QN3A 4OZOA 4B5XA 3WH8A 2R1MA 2Z26A 1UWSA 5IBXA 3LD5A 2C79A 2NVDA 4BI7A 1QW9A 5LA1A 3TTQA 3FHQA 3SN0A 1J0YA 3ZT6A 3WLHA 2WZIA 3WBXA 1V6WA 3H4GA 4DBWA 2O9OA 1I8JA 2XVPA 4EPEC 2EJAA 3GM8A 1PIIA 3LBMA 4F79A 5G2IA 3KCLA 1RPXA 3M47A 2V2HA 1RLDA 3FS2A 1DEDA 3VM7A 3AU6A 1QAPA 1OYCA 3JUGA 4NZ3A 1UG6A 2X0SA 2ODOA 3G22A 4FX8A 3SUUA 1POKA 1ZRQA 2WCAA 3VDHA 2WJFA 4DBUA 3W7OA 5J5RA 1US2A 3MI2A 2PP1A 4FNUA 2Z2UA 4L1XA 3GTXA 3N2MA 3SCQA 3RMJA 1XIDA 3S3GA 1BSLA 4LANA 1P0BA 1XS2A 3VIGA 1K9FA 3PZMA 4IIHA 4K3ZA 4FIRA 3TVAA 4W85A 2WLZA 2WQDA 2E25A 3VMOA 4FI4A 4P7NA 1AODA 2Y7GA 2V0TA 3TMQA 2YFOA 2PI6A 4J3XA 4FXSA 4MJMA 1RD5A 3UP8A 1HKJA 3LCXA 4CNUA 4XWUA 4AXKA 1W1B1 1AH4A 2DGAA 2B7PA 8XIMA 4ZVJA 4FP1A 1XWYA 3WQDA 5FKYA 3KX6A 3T2PA 1A53A 4PZVA 1DJHA 1E4NA 4NHVA 4CNSA 3S42A 2CLIA 1CPUA 4WR3A 4E4FA 3N3MA 1JEZA 1S3TC 5F1UA 4DYKA 2PBGA 5T9CE 2O4MA 2HCVA 1GQIA 1V3MA 3QV7A 3DUGA 1JDEA 5GNZA 3UR2A 4XZ9A 1WXJA 4PEEA 4A05A 2Z24A 1R2RA 4YJ5A 3BXWA 4FR1A 1NF7A 1UWIA 5CCZA 2J8GA 1KV8A 2QVNA 3IV3A 1EP2A 4H9VA 3TCEA 3II1A 3KDNA 2Z7KA 4HGXA 4M1RA 3S1GA 3LK6A 4P7LA 2D23A 5KMYA 2VENA 3A13A 3OA3A 3V36A 3H8AA 5HR7A 2DZAA 3CZLA 4A8NA 2DZWA 4IP5A 4W5UA 3APTA 3BGGA 1SW3A 1WB0A 2V69A 4NKCA 3IACA 2BS9A 4TVCA 4N4QA 4IL0A 4X9SA 3TP4A 4DVOA 1KFCA 2P3ZA 4LF2A 5GJMA 3W29A 1IIHA 3CMJA 1E1EA 1C8YA 1DQXA 1UPPA 4AB4A 4FAMA 3PS7A 4YTTA 1Q7ZA 1XIJA 1UHVA 5TD4A 1UJPA 1QOQA 4GNKB 5BRBA 2VZUA 3MC5A 4FIQA 2H90A 3E2SA 2VO5A 4P7QA 3SBFA 3TR2A 1FWHC 1K8ZA 3WL1A 3SFWA 1N8IA 6REQA 3TJXA 3QMSA 4LUIA 3C2RA 2QMKA 1B54A 2W61A 5JXQA 3HV9A 4LAMA 3MUZ1 1XG3A 1JCMP 3R0UA 1FWNA 2OCZA 3IAQA 4PMQA 2FFCA 3P5ZA 2A3EA 3AJ7A 4AC7C 2WMFA 4XKYB 5LIXX 3QR3A 4HNLA 3GXPA 4C6FA 1ZBCA 1W8GA 4G8TA 2ZDRA 3PZQA 1Q7QA 4UTKA 4N7QA 4GGBA 1H09A 1B9ZA 5HNUA 1M1BA 2BHZA 2J75A 4W86A 1Q6OA 1OFDA 5CXPA 1QASA 1UA7A 4C7GA 1E0XA 1IF2A 1QXLA 3P8IA 1BQCA 2PEVA 2O9RA 1PUDA 4NY2A 2IPFA 4O1AA 1YEYA 1O1ZA 1UWUA 4LNCA 3V3WA 4LRSA 4FK9A 3PAJA 3UCQA 1JD9A 3KRUA 3UCCA 4LUJA 3HOJA 3V1HA 3DG3A 3S4TA 2CFFA 3MI6A 3UZZA 4EAYA 1EGVA 2QDDA 4UQEA 1E9ZB 3UG3A 4ZXLA 4MWAB 4Z08A 4IMEA 3TYZA 1UR4A 1ZUAX 3H2AA 2G0WA 1JI1A 3GG8A 2HVNA 5LNRA 3U2CA 3ECQA 2WCGA 1CEOA 4KPLA 3RYSA 5IOBA 4S3DA 2QUMA 4C1NB 2YZRA 3H26A 4AD5A 3CYJA 3MKCA 2J7FA 4JTKA 3ZO9A 5IFTA 3ZSSA 2IKIA 2QR6A 6CGTA 3GTHA 2NUYA 1KBBA 4UCFA 4R88A 2Z1KA 3KCOA 1XICA 3GKFA 1QBAA 2VELA 3WYZA 3IGHX 1PZ1A 1O60A 4ZR8A 2EO7A 4RPQA 1GTHA 2VCAA 4QLLA 1QNSA 4KEZA 2HQAA 1GVRA 4GMEA 2Y0FA 2E5DA 2TYSA 4WZHA 3W2UA 1CZ1A 4GI8A 4A8RA 4BF7A 5C2XA 3PUEA 3WFZA 1UR2A 2D2HA 3AXMA 4XBSA 4DX3A 1GK8A 1GVYA 1S3HA 2CWNA 1YNYA 4EXAA 5I06A 1OCQA 4C1LA 1ENUA 1NDZA 2PSNA 1Z69A 1E55A 1QHOA 1U83A 1F6YA 5DT7A 4LS1A 4Z1DA 3W23A 3QZEA 2Z1VA 1RALA 2HK0A 5KETA 1OHLA 1OQFA 2YCEA 3CHEA 2BY3A 1C90A 4BA0A 3IK4A 2FHCA 3UGVA 3RO6A 1V77A 3AS0A 1G4TA 1K4HA 2RDUA 2AQOA 3K46A 1V93A 2XH2A 1EQPA 3WNMA 1W1VA 2CPUA 1LRTA 3RITA 1LBFA 4RZ6A 1PCWA 4YNGA 3W7CA 3H55A 1RJRA 3R89A 5DY3A 3CB8A 1FX6A 3O6YX 5AKQA 4AD4A 1EJSC 1L6WA 1OG0A 2WHLA 2Z7GA 1EDTA 2R1KA 3ZR6A 3B9NA 1W3IA 3ZWSA 2GVLA 4FF7A 3MW7A 1PKMA 1J93A 4J35A 5CJ5A 1W91A 2JKAA 3GIQA 1X1NA 4GX8A 4YWSA 4UZSA 3MDUA 3TH6A 2VX4A 1J5SA 1KRMA 2PFHA 1JCNA 3FA5A 4H83A 5CSSA 3R43A 5A6LA 4ATLA 3A3WA 2WZHA 5FL0A 3T2OA 4GC3A 2GL5A 3T05A 1QMLA 1TWIA 4ORMA 1UYQA 4JQ2A 4O4VA 1DP0A 4KWSA 1RAKA 4H04A 2DZPA 1GYMA 1KD0A 2E9MA 4DPPA 5FSDC 5C0QA