1UG6A

Structure of beta-glucosidase at atomic resolution from thermus thermophilus hb8
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
426
structure length
426
Chain Sequence
NAEKFLWGVATSAYQIEGATQEDGRGPSIWDAFAQRPGAIRDGSTGEPACDHYRRYEEDIALMQSLGVRAYRFSVAWPRILPEGRGRINPKGLAFYDRLVDRLLASGITPFLTLYHWDLPLALEERGGWRSRETAFAFAEYAEAVARALADRVPFFATLNEPWCSAFLGHWTGEHAPGLRNLEAALRAAHHLLLGHGLAVEALRAAGARRVGIVLNFAPAYGEDPEAVDVADRYHNRFFLDPILGKGYPESPFRDPPPVPILSRDLELVARPLDFLGVNYYAPVRVAPGTGTLPVRYLPPEGPATAMGWEVYPEGLYHLLKRLGREVPWPLYVTENGAAYPDLWTGEAVVEDPERVAYLEAHVEAALRAREEGVDLRGYFVWSLMDNFEWAFGYTRRFGLYYVDFPSQRRIPKRSALWYRERIARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Beta-Glucosidase at Atomic Resolution from Thermus Thermophilus Hb8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords beta-glycosidase
total genus 165
structure length 426
sequence length 426
ec nomenclature
pdb deposition date 2003-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1ug6A00
2WVUA 3WNPA 3VIMA 3F4VA 4DWSB 3GYCA 1WDRA 1JXKA 1QI2A 2ZX9A 1FFQA 2DT0A 2XHYA 4TOQA 1CXEA 2PWEA 1E71M 4ZFMA 1XYFA 5E9AA 2YA2A 1C8YA 1UD4A 2E9MA 1VEMA 1BQCA 1W3HA 1B3VA 1E6PA 2QHAA 2F8QA 2ZUSA 4HA3A 3W26A 3GBEA 2X05A 5DMYA 1J0IA 4MDOA 4Z2JA 1GPFA 1EO5A 4P8XA 1F4HA 1FH9A 3BGAA 1W9DM 1V3JA 4JL1A 2Y2WA 4U3AA 1VRXA 5ABGA 2BXYA 3VGGA 1ITCA 4TVUA 1K9FA 2VC9A 2VZTA 3MV01 1H49A 4PMXA 3EYPA 2WM0A 4NSBA 3WUFA 2E3ZA 3HU7A 1MWOA 4J3UA 3GNOA 3EDJA 3WY1A 4B9ZA 2Z1SA 5I0DA 3PTMA 1E0VA 1CXIA 2MANA 2Q8XA 1TMQA 4EANA 1WAWA 1GQLA 3ZR5A 3MUIA 1AQMA 4J27A 4CD5A 1E55A 3AZSA 5C70A 2O9PA 3EBVA 2FGZA 1QNSA 1I1WA 3APGA 4KH2A 1X6NA 2PWHA 3W29A 3M07A 4GZIA 1B90A 1VFUA 1UHVA 1D7FA 2XUCA 2Y8VA 3T2PA 3VIOA 1GOKA 3K8KA 4UOQA 1L0PA 1A47A 1QVBA 1CGUA 3MUAA 4X0NA 4HMEA 4UOZA 4GO9A 3DHPA 3SIMA 3S2CA 3MUZ1 5FL1A 4PMQA 3U57A 2ZXBA 1XV8A 4NRRA 1HX0A 2HVMA 2PBGA 1WCGA 3L4VA 1XSJA 4E8CA 3AHXA 2VX6A 1UOKA 1JFXA 1RD6A 5I78A 1GHRA 1QOXA 2CNCA 4AEFA 1CPUA 4D71A 5ABHA 4M80A 4CKQA 5JBFA 2XSBA 4HZ6A 2W62A 3VIHA 1PX8A 5D9OA 5ABFB 1MFUA 2WHKA 4A3HA 4QCFA 2CCRA 1H5VA 1V03A 4MB5A 2G41A 1JF5A 2DQXA 2QPSA 2ZXDA 3WBEA 4AZ7A 3AMDA 4TVDA 1PX3A 1BPLB 3BXWA 4CN6A 1MQQA 2D22A 3MMDA 4GXPA 4AD3A 4YHGA 4R27A 3SUWA 4BCEA 5FIPA 3W24A 1MQRA 3ZJKA 4CU8A 2VCAA 1ISZA 1RH9A 5A2BA 1R85A 2YDQA 1H0IA 4PRWA 4WJXA 3W6LA 5BWFA 3KE0A 3VDHA 4JFSA 4X0VA 1VEPA 3BSGA 3OGVA 1WKYA 3LPFA 1UR2A 1XSIA 4MNJA 1NQ6A 2VZSA 3GXDA 3ZIZA 1B3ZA 1QHPA 2YIHA 3BCDA 4U5KA 5D9PA 2NT0A 2WLYA 5KZ6A 1SMDA 1CNVA 1TUXA 1WE5A 4ZXOA 2BNJA 3CZEA 1UKPA 3GDBA 3AMCA 4PMNA 2FH6A 2BY2A 1XCWA 4W5ZA 3VM5A 3GZAA 3AFBA 3ZQ9A 3WNLA 3SCVA 3WH6A 3FHQA 3PZVA 1HNYA 1HVQA 2VOTA 4OKDA 2WWCA 3KL0A 4U33A 1EXPA 1E4LA 1W1PA 4W86A 3WD2A 4Q22A 5E09A 3KL5A 3U7BA 3VM7A 1W9VA 3JUGA 1VF8A 1K9EA 1QBAA 5IHSA 2V5DA 1JZ5A 3AHTA 3IK2A 1GQJA 2XVLA 4U3CA 4PCTA 1EIBA 4MNMA 1E6XM 3GXFA 3K46A 1V08A 4PMYA 4U5IA 1W3KA 3NDYA 2DDXA 2WC3A 4AZBA 4IPLA 2UY3A 2E9LA 1NOUA 4JFWA 5D8WA 4EKJA 2V38A 4PMUA 3NJ3A 3WDRA 5A6MA 1E6NA 2VT0A 5CQ1A 1JDCA 3PBGA 2ZWZA 2OWWA 1JI1A 4W88A 2A3HA 3VD9A 3RPMA 4AMCA 1UKQA 3W6MA 2NW0A 4HA1A 4K68A 3MU7A 3TTSA 4FK9A 3UERA 4W84A 3VILA 1UYQA 2CBVA 1TVNA 3BAYA 3N04A 1JI2A 1UD5A 1EDTA 1PZ3A 3ARVA 2J25A 5I77A 3AQUA 2BFGA 2DEPA 3BAJA 3GXMA 1SYTA 3IJ7A 3AZRA 5EB8A 5CG0A 2AMGA 2RGMA 4M56A 4UQDA 5A8OA 3WL0A 4F9JA 4PMVA 1MXGA 1L8NA 1OWQA 3WSUA 1BTCA 4CUCA 3W27A 1B3XA 4AIEA 1SR0A 2EPNA 5A8NA 1NP0A 2GK1B 4P7NA 1NH6A 1ZBCA 2WAGA 4JCLA 3CUGA 4D1JA 4OJYA 1UH2A 2D3LA 1E6SM 1JF6A 3EMCA 4JKKA 4DUWA 3EMQA 6TAAA 1XH1A 3PZUA 3WEZA 2WHMA 3WUEA 1K6AA 1O6IA 4KGJA 2XIIA 2ZUUA 3QHOA 1JG9A 3FXYA 5A8QA 3OA5A 1B1YA 2YLLA 3T0BA 1UWTA 1V0LA 2XYLA 1OCQA 1UKSA 2VX5A 3VDCA 5IXEA 5E0FA 3DHUA 4LGXA 5BRQA 1TE1A 4DUXA 2GJXB 1Q4NX 4Q7NA 4EK7A 3N9KA 5HOSA 3KL3A 2IXUA 3ECQA 2EXOA 1QI5A 1Q6FA 4HPGA 4HU8A 1MW2A 4ML4A 3BLPX 4D6DA 2FHBA 1J01A 3M7SA 2YDRA 3W53A 5A6BD 5D8ZA 1AVAA 1E3XA 3RM4A 3VVGA 4HPHA 3WMSA 1E9LA 5AC4A 3WQ5A 2WHLA 3VIIA 2DIJA 4IPNB 3A47A 2J74A 1M03A 2XVGA 3TTQA 1JXJA 3BCFA 2GJPA 1OIFA 4CD4A 1IT0A 1MXDA 1SMAA 3FNDA 1H4PA 1E70M 3CO4A 4J7RA 3GNRA 3MSGA 4D6IA 3WD0A 1EHAA 3FHAA 1V6WA 4PMDA 3VOCA 2CYGA 3VIFA 1V0MA 2DGAA 3VNYA 3RILA 3WF1A 1W1TA 2G3NA 3AIRA 1HKKA 4AWEA 3MO4A 4J28A 3OIHA 5A8PA 4LXFA 1V02A 3POHA 2GJRA 5CPSA 3VX0A 4AZ6A 5A8MA 4C7GA 3N1AA 2OWXA 2YDSA 1N82A 4OZOA 1H09A 4AZHA 2W63A 4M82A 2WCGA 2VQTA 4JKMA 3VIGA 1YHTA 3SUVA 4J3WA 1E5JA 2EPKX 4V27A 3PZNA 3GH5A 5AYBA 5HPOA 2W92A 4YHEA 4F9DA 1OGSA 4LYQA 3AXHA 1JAEA 4HZ7A 1DTUA 4PBGA 3GM8A 1LG2A 2BY0A 3ALGA 2YL6A 1LL7A 2O92A 3VINA 1CENA 1UWSA 5E70A 2PWFA 4E2OA 1S46A 1UR4A 3WF4A 1LG1A 1HJVA 2DH3A 2BV9A 1CDGA 2QLYA 2VQUA 1OGGA 1ZS2A 4OOZA 2A3CA 5GNZA 2ZX7A 3OLGA 1ZU8A 3VMNA 5I3DA 2G4FA 2FH8A 5CPTA 3W82A 3W28A 4KRUA 2WW5A 2OWCA 1BF2A 2UY5A 4AIOA 4HP5A 2G3IA 3AROA 3IAQA 3UG5A 2RGLA 2XM2A 2E40A 5A6JA 3SCUA 4QLJA 1KFWA 2J77A 1OT2A 4AZIA 1US2A 2EO7A 1J0YA 2GJXA 1ZB5A 1JIBA 3VDAA 2DSWA 1BVNP 3WNOA 4XV0A 3PZGA 1U30A 3ZO9A 1GVIA 1AMYA 1K9DA 5F7UA 4ZEPA 3WH7A 2FHCA 2E8ZA 3N15A 3ZJ6A 4TXEA 3QGVA 4IUGA 4OBSA 4BQ3A 5E6ZA 1B2YA 3ARZA 3OGSA 4CCEA 3EDKA 3ZT6A 5FCZA 3N17A 3SUTA 4B3LA 2WC7A 2WKLA 1VAHA 1GORA 1R7OA 2J75A 3IANA 1M01A 1JD9A 2J8FA 3U7VA 4AC1X 2J7DA 3BSHA 1UH4A 1CGWA 1PIGA 2VTFA 4B3KA 3VUPA 2ZUMA 1G9HA 3GNPA 2PF0A 1DWGM 2G3JA 1XD0A 1H2JA 3T2OA 2VMFA 4W8LA 4PN2A 1MW3A 1C91A 2V3FA 2QMJA 4CN1A 1NM9A 4DUVA 1TFVA 1VFMA 3EDEA 2XFFA 4PTVA 4OOUA 3D5HA 2WZHA 2CBIA 3BAXA 4FLOA 2VUYA 1HJQA 3VGHA 3PZMA 5BXSA 3SCNA 1VIWA 2XM1A 1EHNA 2YLAA 1Q6EA 5HXMA 3BAKA 3T08A 3WDHA 1V6UA 1KXTA 2BVYA 4CU7A 2PWGA 3WMCA 3N18A 1C8XA 1JFHA 4OUEA 1V3MA 3A4AA 5TD4A 5BROA 4RE2A 1HKIA 4H04A 2YBTA 2WVSA 3K8MA 1MVYA 1LWHA 3K1DA 3WF0A 1WDPA 2ZIDA 1P6WA 1UR0A 1ZBKA 3GH7A 4PEEA 4Z2LA 2CIPA 1H41A 2V3GA 4JKLA 3AHYA 5EMYA 6A3HA 8A3HA 2WSKA 3K4DA 3WQ6A 1J9YA 1JYVA 3SCWA 2ZUTA 1NWTA 4D6GA 2X2YA 4YN5A 3MV11 1NARA 5C71A 3UETA 2ZUNA 3K4AA 4PSRA 3ARUA 2D0FA 1WDSA 4LX4A 4WF7A 1C8QA 4M24A 3ALFA 2BY1A 4C7DA 4V2XA 3L2LA 4H7VA 1XD1A 2OYKA 4CD6A 1TVPA 4GPNA 2O9OA 2FDMA 5DT7A 1JYWA 3DYMA 1Q6CA 3NUKA 4YPJA 2VURA 9CGTA 4AD4A 1KXVA 2JEPA 1E56A 2EJ1A 4Z2GA 5A6KA 1V3IA 1W9BM 3W81A 4ZE4A 1WNOA 1CXLA 3ARXA 2OSXA 4GKLA 1HIZA 2CBUA 1XRVA 3AYSA 5LA2A 1V02E 1R86A 3GXIA 2W67A 3UG3A 3I3BA 2J79A 3RM8A 3TTYA 1PX4A 4W89A 4UQ9A 4KWUA 1CGXA 1VFOA 2CERA 2YA1A 5A6BA 4D6JA 2VR5A 4QLKA 4ZXLA 4D72A 5BRPA 3UCQA 3UG4A 1HF6A 3FW6A 4W5UA 3OZPA 1CLXA 3WL1A 1HJXA 2JFEX 3WH8A 1W2VA 4B9YA 1CYGA 2JIEA 4LYPA 3HN3A 5AY7A 1QHZA 3CHFA 3CZLA 1UWQA 1W3JA 1JYNA 1BG9A 2D0GA 5M17A 1WZMA 2OLHA 1VJZA 4UFLA 2XTKA 2XVKA 3CUFA 2E4TA 3IAPA 3WQ8A 3CMGA 4FLQA 4XX6A 3VKKA 2A3BA 3CUHA 1CGVA 4JZ5A 4D6EA 1C93A 1ISVA 2JE8A 4QAWA 5D9MA 1CXHA 5IFPA 4P7QA 3KEHA 1UG6A 2D0HA 3NSXA 2YL8A 4M29A 4AD5A 3WFZA 1J12A 1CLVA 2GK1A 1GZJA 4W7UA 2XSAA 3L4XA 2XG9A 2YOCA 4AD0A 4GZJA 1E6QM 3ARSA 1KGXA 4EAMA 2YA0A 2WMFA 4F8XA 2WMKA 3ARTA 1OINA 2WPGA 3N12A 1JYXA 2WB5A 4FLSA 4AZGA 1ISWA 2DT2A 1KXQA 4ACZA 2O9RA 2YL5A 1ECEA 1MW0A 2XWEA 3VIJA 2BHZA 3AISA 4P8VA 1RP9A 2JIWA 3AHVA 3GBDA 2EPOA 4PYSA 1LJYA 3UR8A 1M53A 1VENA 4JL2A 1XYZA 1KB3A 2CXGA 4HU0A 5CGTA 1AQ0A 5DO8A 3WEOA 3ZMRA 5A6AA 1GONA 4GINA 3LPGA 1EO7A 2VRKA 4HMCA 1GCYA 3N11A 2WYSA 5HDRA 1VJSA 1UKTA 2WKGA 2PWDA 3B9EA 2VZUA 4ZENA 3NYDA 2D1ZA 1NOFA 3A3HA 1PJ9A 4MTVA 1GJUA 4BF7A 4TTGA 4WKHA 3WBAA 5M03A 1LQ0A 2AAAA 3SCOA 1E4NA 4WKAA 1V3KA 1PBGA 4TUFA 2C8NA 1WDQA 3U5YA 1HKMA 3PZ9A 4M8UA 2ZUWA 2Y8KA 3A4XA 3OB8A 5BXRA 1KQYA 4HOZA 3J7HA 2JF6A 3THCA 5DT5A 3K8LA 3UR7A 4AZ5A 4GI9A 3ZJ8A 1JDAA 2GDUA 2DSKA 4N42A 2IXVA 4TVCA 1QNOA 1KCLA 1UWUA 3B9DA 1WZAA 4P8UA 5BYWA 3WQWA 3CZ8A 2W4XA 2YKKA 2XJ7A 2WCAA 3VGDA 3L2MA 3VPLA 2GDVA 1BYCA 3LPOA 3A4WA 1B30A 1IZKA 4CD7A 2PB1A 2J47A 1O7AA 3QHMA 5JUVA 4CD8A 5C8BB 1E72M 4IISA 3W4RA 5A95A 2WMJA 1UQZA 4BS0A 2WBGA 1UWIA 3BAWA 4KRTA 2ZX5A 4D1IA 3OZOA 3MSDA 5CGMA 4GO8A 1CECA 2WVVA 5M5DA 1IZJA 4RE4A 3SCQA 3HJEA 3SURA 2O9TA 1ESWA 1ZL1A 3FAWA 5IDIA 2VI0A 3VX1A 4UZSA 5I24A 1GOMA 1LL6A 2BXZA 3WNKA 2E9BA 1V3LA 3PN8A 2VVSA 1XGZA 4F66A 1H0GA 2ZOXA 1ODZA 1EH9A 2A3EA 2VO5A 3WUGA 2WSPA 1QI4A 2WBKA 3ARYA 3NIYA 4J3TA 3TOPA 3F5JA 1JZ2A 5JBDA 5AC5A 3B8SA 4AW7A 3L4YA 2HISA 4W85A 4PMRA 4Y7EA 5I79A 4NZCA 3PZQA 3D3AA 1QNQA 4AD2A 3WDIA 4FLRA 1EQCA 1FOBA 5I6SA 1UA3A 4PTXA 4ACZB 4Z2IA 1EQPA 4P8WA 2UY2A 2BS9A 1GOIA 4H8HA 1TG7A 4UZUA 1SFSA 1V3HA 1PZ2A 5A1AA 2C7FA 4H8VA 3CUJA 1TR1A 2ZUVA 4W8AA 2YL9A 1VFFA 1G5AA 1XSKA 3SCSA 3WD4A 4W87A 1R7AA 4GQRA 1QHOA 3AMGA 1QNRA 3MMUA 1W1YA 4UFKA 5JBEA 1B0IA 3AIUA 1B31A 3VD5A 2XIBA 3VU2A 4MJ4A 3AIVA 3CUIA 2PI6A 2WZEA 2VCCA 3WELA 2ESCA 4ACYA 1ZJBA 2CPUA 1BYBA 3TONA 1EA9C 2Z1KA 1OD0A 4JAWA 2D2OA 5A6SA 3RIKA 1DWAM 4HMDA 5A69A 1E40A 3BH4A 4UOJA 2EEXA 2ZXQA 1E0XA 3IJ8A 2J78A 4UR9A 4E4PA 3L4UA 2VCBA 1JNDA 3AS3A 2XGIA 1UKOA 1E73M 2DSUA 4PCSA 2UWFA 2CHOA 1VEOA 3SUUA 3L4WA 4JHZA 1KWKA 1WB0A 1E15A 2W61A 1HXJA 3AIBA 1GJWA 4X9YA 2Y4SA 3CTTA 1CXKA 1LF1A 1W9XA 1OBAA 3W25A 5CJ5A 1E0WA 1BHGA 1UUQA 3W0KA 1ZBWA 1UR8A 5CXPA 1Z32X 3NCOA 3WEMA 3VIKA 4CVWA 1HP5A 1W32A 2YJQA 1JNEA 3ZT7A 1ZBVA 4W93A 1A3HA 1UZ1A 4A4AA 1US3A 2WVTA 2EBNA 1BLIA 4XZBA 1C7TA 5EBAA 3WDPP 3CPUA 2D23A 4DWSA 1NOWA 5JIPA 1OGBA 4GI8A 1QPKA 2JF7A 1C3FA 3CZKA 1J0ZA 1HT6A 5LA1A 2X0HA 4AZCA 1D3CA 2PBOA 3EDDA 4C7FA 3FAXA 3PTQA 3HMCA 2NSXA 2C0HA 1DWHM 3VD3A 3BC9A 5JIWA 4BQ5A 1I1XA 2WMGA 2J62A 3AS0A 1G01A 3VGBA 5D9NA 1XH0A 2DSVA 1WZLA 4MDPA 4PUEA 1C92A 5FKYA 3TTOA 1HL8A 1PAMA 3BMWA 3WH9A 1G1YA 4UCFA 2J7BA 1W1VA 4HA4A 1J11A 1K9TA 1R87A 4PTWA 1OIMA 1B9ZA 2WNWA 1HJUA 1HJSA 3VO0A 2VNCA 2QF8A 4MB4A 2YBUA 1GHSA 1CXFA 1MYRA 1IV8A 4CCCA 4WKFA 3CH9A 4B16A 3EDFA 3VGFA 3B9AA 2XFYA 3II1A 1BG4A 2BVTA 1NP2A 2BY3A 2X0YA 3LPPA 7A3HA 2CKRA 3MS8A 2QMKA 3WDJA 5HNNA 3ZR6A 1GUVA 1EDQA 2WMIA 4ATLA 2Y24A 3S6TA 3RJYA 1BVZA 3G6LA 1GQKA 2EPLX 4E8DA 3PHAA 1HN1A 1KWGA 2XPKA 1W9PA 4Z2HA 1J18A 1FHDA 1J0HA 1EOKA 5E0CA 3QOMA 3CHEA 4RL3A 2WCSA 1FP9A 3T0DA 1J0KA 3CHCA 3TA9A 3WN6A 3TP4A 3AIQA 2GVYA 3T09A 4DM1A 2WWDA 3AS2A 2UY4A 4WSJA 1DWIM 1E1FA 1Y7VA 4TTUA 3FY1A 1CGYA 4UTFA 3SCRA 1UQYA 3PZOA 4UFJA 3CHDA 1TZ7A 4L4OA 4PMZA 1JZ3A 4UQAA 4UQBA 1F4AA 1H3GA 1W2PA 1HL9A 1KBKA 4H41A 1DWFM 2A3AA 1DP0A 2GUYA 5ABEA 1VBRA 5M3WA 3OLDA 4BZYA 1RPKA 2WC4A 3NSMA 1B3WA 3LMYA 1W91A 4QCEA 3O9NA 1GOWA 5EFFA 1E6RA 3OBAA 2QV4A 5KEZA 1E4IA 2TAAA 3U5UA 1VB9A 1BFNA 2V3DA 5LYRA 1KBBA 3POCA 1JD7A 3WNMA 5DF0A 2NT1A 2WMHA 3WIJA 2ZXAA 3QR3A 1H11A 2VZOA 5FOOA 3L4ZA 4UQCA 4AEEA 3DECA 2F2HA 4JCMA 1ZJAA 2XFRA 4AXNA 5CLWA 4MAVA 1ITXA 2Y5EA 4N0RA 4ZE5A 3T2QA 1FA2A 4DWSD 3N13A 5D4YA 1FP8A 2WHJA 4MPKA 1W3LA 2E0PA 1I75A 3MUY1 1Q6DA 4GZEA 4JHOA 3WENA 2D20A 4QLLA 2CEQA 2OSWA 4W8BA 4MB3A 5DFAA 1XC6A 1MW1A 4CCDA 4QFUA 4AY1A 3EMZA 3VTRA 2IUZA 2VX4A 1KQZA 1Q6GA 3SCTA 1CEOA 3MKKA 4U31A 3ARWA 4P7LA 2OYLA 2D3NA 3W37A 3BLKA 3CIVA 4PTMA 3AMLA 2V3EA 7TAAA 2VR4A 2WZIA 1LL4A 2CHNA 5HPCA 1EGZA 3NSNA 4QDMA 2JALA 2OSYA 3VMPA 4MADA 4M81A 2QPUA 3DYPA 4TX8A 5A2AA 4U2ZA 3KWXA 4WLCA 1KGUA 1EOMA 2W66A 1M7XA 1KCKA 3WNNA 2XVNA 3SEPA 1CWYA 3VGEA 1J0JA 1J10A 2X1IA 1V6VA 4P7RA 3WD1A 1UD3A 1UD8A 2E8YA 3QHNA 1CGTA 1NWUA 1EDGA 3WMBA 1ISYA 4P7OA 1MQPA 1PIFA 2BVDA 4XZWA 3UEQA 4MB1A 1FH8A 2VJXA 3AIEA 2ZE0A 8CGTA 3M6DA 4ATDA 3DYOA 2WXDM 3FN9A 6CGTA 3OGRA 3ZM8A 4GI6A 4CN4A 4J3VA 1CTNA 1TCMA 2V5CA 4AD1A 1WZKA 4WK9A 2WMIB 1BGAA 1CZ1A 4OBRA 2ZWYA 4WSKA 3WFLA 1HVXA 4W7WA 3KZSA 2J8GA 4WIWA 3VD4A 4ATWA 5GNXA 3OG2A 1OSEA 5I2UA 1C90A 1KR1A 5CSUA 3CBWA 2G3MA 1KGWA 2CITA 1FH7A 2D24A 1BYDA 1TA3A 3GTNA 3I3DA 2J4GA 3SUSA 3E1F1 4S3KA 2J7HA 1FFRA 1QW8A 1BAGA 1QBBA 2VVNA 1JDDA 4TX6A 4XB3A 1E6ZA 5CZKA 2VX7A 4AIUA 3WKZA 3AI0A 1VBUA 2FHFA 1E1EA 4J3SA 4HZ8A 3VIPA 1OT1A 3O2LA 5A3HA 4J3XA 4UNIA 2DIEA 1PPIA 2CBJA 4UFHA 5FD0A 2BHUA 4KMQA 1H1NA 3ARRA 3RMEA 3BMVA 3QOKA 2DPEA 5LA0A 3CZGA 1DWJM 3I3EA 4M1RA 4PUDA 1GQIA 3CMJA 4AZCB 1CIUA 7CGTA 3AHZA 3OLIA 1QW9A 2DT3A 2FGLA 1UZ4A 4CU6A 1UR9A 3ARPA 4AYSA 4GIAA 4JFTA 3A6OA 3AICA 1LWJA 2VRJA 3WUBA 1QNPA 4AISA 1X6LA 4CVUA 1GW1A 4H2CA 3WF3A 2BHYA 4D6FA 2PC8A 2WANA 3T0AA 3ARQA 4PSPA 5A94A 4JFUA 3UESA 1E5NA 5A6LA 3W38A 4IM4A 3G6MA 2ZICA 3MMWA 3WDQA 3VMOA 1XH2A 3AXIA 1XCXA 1G94A 1BYAA 3WD3A 2X8RA 2ZX8A 3ZJ7A 3MANA 3AYRA 4R5EA 3PTKA 4KGLA 3RJXA 1PEZA 4HOWA 5I23A 1OD8A 1JZ7A 1WO2A 4U2YA 2X09A 1XHGA 1QI3A 1ODUA 2ZX6A 2XVPA 3ZT5A 3WF2A 4LPCA 1HJWA 1W9UA 4B15A 2W91A 2DSZA 3RDKA 4XUYA 4JIEA 1JGIA 2VL4A 5AYIA 1MFVA 4HTYA 3AOFA 2WLZA 4DWSC 5CPQA 1E43A 4MNKA 4D6CA 4MAZA 1BGGA 1JZ6A 3VDBA 2AOSA 1U2YA 4NRSA 4V28A 1WPCA 3AJ7A 1M04A 1QI0A 2GSJA 2XWDA 1JL8A 4FMVA 1GVYA 2J7EA 1DEDA 1UH3A 2F61A 1OM0A 4OIFA 5CLTA 4LYRA 1OB0A 3WQVA 3IJ9A 3AMKA 1RP8A 2EQDA 2J7CA 3SCPA 1LLOA 1ISXA 2J7GA 3CGTA 3RM9A 3BAIA 3F5KA 5GPRA 1NWSA 1GOQA 3PZTA 5BCAA 2GFTA 3M46A 4RE3A 4D6HA 4UFIA 3RO8A 1WP6A 5A2CA 4UFMA 2WK2A 2DT1A 2J7FA 4MNLA 4MJ2A 2CETA 1G0CA 4FF5A 1GNXA 1HKJA 3AIWA 3CLWA 4GQQA 4LQ1A 3WQ4A 4BQ4A 1DHKA 5DEZA 3F5LA 1UD2A 3CZJA 1R8LA 1D2KA 5BXPA 4CGTA 3O6AA 1UD6A 5EFDA 2JEQA 1V0KA 1KR0A 4NF7A 4NI3A 1CBGA 3RCNA 1V6YA 2CESA 4DM2A 1UR1A 3AZTA 1UWRA 4W7VA 3ZOAA 4A3YA 4EE9A 1E4MM 5IFTA 3AXXA 2EPMX 3AS1A 1KXHA 5E6YA 5ECUA 3VD7A 2W5FA 4QP0A 5HBFA 3PZIA 5IHRA 1BSIA 2G8ZA 1GOOA 2B31A 4PMOA 3GH4A 1TA3B 2VZVA 2WVVB 1HP4A 1YQ2A 4S3JA 2CKSA 5ABFA 3THDA 5GNYA 1JZ4A 1C7SA 2OYMA 1B3YA 1V6XA 3L4TA 4HOXA 3VNZA 3OLEA 4Z2KA 2XGBA 1NWRA 4BA0A 5GQBA 1AQHA 1E3ZA 5FL0A 1FHLA 1UA7A 3WH5A 5BXTA 1JZ8A 1V0NA 2DH2A 4F79A 4UQEA 4L4PA 5I5RA 2VRQA 5CSYA 3ZSSA 1JAKA 4URIA 1U33A 3NDZA 3DC0A 1X1NA 3ZSTA 4BQ2A 4JFVA 4H8UA
chains in the Genus database with same CATH superfamily
3SIZA 5F1UA 3VIMA 3WQEA 4C6PA 4JTRA 4DWSB 3MWAA 5CBIA 4XAPA 1JXKA 2WNQA 3URNA 3ES8A 2OX4A 3M41A 3UWYA 3GKAA 1CXEA 1IF2A 1C8YA 3VKCA 1L8PA 5M1TA 1TPH1 4DJDD 3UFYA 3U2ZA 1W3HA 3N4FA 1B3VA 3THQA 3EKZA 2F8QA 2ZUSA 4LV9A 1Q2RA 1J0IA 4LRTA 4I90A 5BU9A 1GPFA 5IRPA 1SJDA 1FH9A 5T91A 4KWWA 3E96A 3C2EA 2Y2WA 1NAL1 1QPQA 3S2LA 1KC7A 5ABGA 4DB7A 1XQKA 5HNUA 4WGHA 3VGGA 4FOJA 1ITCA 3EOUA 5HULA 3F4NA 3NPWA 3EZ4A 4G2DA 4IHCA 3EYPA 3SFKA 1KNWA 3WUFA 1XGDA 4IFOA 4J3UA 3LCXA 1R3TA 3WY1A 5I0DA 4S3BA 1FWJC 3GR7A 1FWDC 5KITA 3TN5A 5C9RA 4J27A 1KM4A 3NQVA 1N2VA 3AZSA 3RR4A 1XM3A 3EBVA 3APGA 1QNSA 1TIWA 1TR9A 4AQLA 4O8RA 4L1XA 1VFUA 1UHVA 5L9FA 2XUCA 3KVLA 4GABA 3K8KA 1OYAA 1L0PA 4PRRA 3R2GA 4JY9A 4EXBA 3JVAA 4YWIA 4X0NA 5AYXA 3DHPA 3SIMA 4RZ5A 3S2CA 3G1DA 5FL1A 1L9WA 4R9XA 2ZXBA 1HX0A 3TZFA 3RU6A 1W3NA 1ZAHA 3VCCA 3N3MA 2VX6A 8TIMA 2FYMA 1SFLA 3HPXA 5FF4A 5I78A 3DN5A 1QOXA 4LWWA 3UWVA 3PPHA 4D71A 2BG5A 3R12A 5D03A 4KFNA 5ABHA 4NI8A 2FMNA 5JBFA 4HZ6A 3VIHA 1PX8A 5D9OA 4GGBA 5ABFB 4FALA 4M19A 1JUEA 1UBPC 2Z27A 1JF5A 4ERIA 4AZ7A 1PKMA 3QEZA 4FNSA 2C13A 1H7OA 4I3GA 4NAFA 2IQ0A 3BXWA 3IIOA 2NQ5A 2D22A 3MMDA 2XZ9A 4IMAA 1IQ8A 4NU7A 3HZ3A 5FIPA 3EOEA 4DJDC 4DJFC 4O53A 1MQRA 4J40A 1K1DA 3UF9A 4CU8A 3KZPA 3LRMA 4AYGA 5A2BA 3HB9A 4AVFA 4YIWA 1OZMA 4GXMA 4PRWA 3W6LA 2X7WA 4MKVA 1Z69A 4Z1AA 5C55A 1NQ6A 5EMKA 3ZIZA 2YIHA 1QHPA 1S1PA 3AJXA 4TO8A 3MC5A 2WLYA 5MHBA 4ZXOA 4JIIX 4BF9A 5LZLA 1UKPA 3FA3A 2PP1A 2ASHA 3WNLA 4XIMA 3WQGA 3IV3A 2F6UA 4BKNA 2OODA 2VOTA 2A2IA 1PDZA 1CI1A 3WD2A 2YYUA 3TSDA 8XIMA 3U2EA 3UYCA 3JUGA 1QBAA 2V5DA 4O4WA 4A8RA 3UJFA 1GQJA 4WDWA 4U3CA 1Q8JA 3LNMA 3A4JA 4U5IA 4H8NA 3NDYA 2WJZA 2E68A 2ZZ6A 4JFWA 4EKJA 5C9XA 2V38A 3ABQA 2E28A 2VT0A 5CQ1A 1KBIA 2OWWA 3KBWA 3T05A 3R43A 3W1RA 5C7HA 4AMCA 5A8GA 2X16A 5FEPA 2PRMA 5DXYA 3TTSA 2RJHA 4FK9A 1Z7AA 2RUSA 3BAYA 4K7VA 4Q4MA 3EA2A 2YZRA 1JI2A 3C0SA 3ARVA 1DHPA 1WV2A 4FOKA 1FWAC 2V68A 3AQUA 3GXMA 1D3GA 3WLOA 3HFTA 2ZRWA 3C8NA 3DU0A 3AZRA 5EB8A 4YCPA 4O10A 1PYFA 4M56A 1MDRA 3UR5A 1OWQA 4PULA 4PZVA 4CUCA 1B3XA 3I4EA 1NH6A 4JCLA 4D1JA 1JF6A 4DUWA 3MVIA 2VEMA 3WEZA 2QV5A 3THAA 1O6IA 5D32A 3U2CA 4RV3A 4RKAA 2VC6A 4BK9A 3T0BA 1V0LA 1EL3A 2VX5A 1XS2A 2QJIA 1YXDA 1DJHA 3VNIA 4V15A 3PWAA 5XIAA 5BRQA 1TE1A 2DZUA 1GG0A 1Q4NX 4Q7NA 3KL3A 1YX1A 3V16A 1Q6FA 4JN7A 3OYXA 1C8VA 5I3IA 4ML4A 2WNZA 2BX7A 2ZQ0A 1XLEA 4BWLA 3W53A 4MY1A 1GYLA 1EJTC 2JGYA 3RM4A 1E9LA 4J5NA 5CPNA 3DGBA 2DIJA 3C86A 1M03A 3LHZA 3TTQA 1JXJA 1OIFA 4H00A 1OFDA 3TJXA 5I3FA 3GNRA 1JRBA 1V7YA 3MSGA 1EHAA 1DIEA 3FHAA 4US6A 1Q6LA 1RQEA 3PSWA 2GGJA 4PMDA 4Q8PA 3VIFA 2DGAA 3RILA 1VCGA 2G3NA 3QSTA 4MG4A 5TIMA 2E1WA 3G2GA 3ABXA 4J28A 3OIHA 3ITCA 4MLRA 3POHA 4IPPA 3VX0A 4LANA 4C7GA 4JIRA 4C6BA 3LHWA 1N82A 4P2VA 4AZHA 2W63A 3VIGA 3GD6A 4QG8A 1YHTA 1R3VA 4N9CA 1EC8A 1MNZA 1B5TA 3JU2A 3PZNA 3BANA 2NUYA 4HSHA 4HZ7A 1YKWA 3GM8A 3ALGA 4DZHA 2IPGA 1LL7A 1J93A 2FB3A 2PPGA 3GB6A 1EJ7L 4L4MA 1GVEA 3Q65A 1LG1A 2V2CA 2BV9A 2QLYA 4GIRA 1AK5A 2A3CA 3OLGA 1YE6A 4UR8A 5HAOA 4Y6GA 3FKRA 4KRUA 2GGIA 2WW5A 7XIMA 2OWCA 1SFJA 3RHGA 4D9PA 5B7ZA 1UIOA 4HP5A 3IAQA 4HHHA 4WJEA 2X1RA 2EGZA 2Y7EA 3C2YA 3GTIA 1US2A 1J0YA 2OELA 2H3BA 4WVXA 3O8AA 1AMYA 1QASA 3PBMA 4ZA0A 1QW7A 2IMRA 5DANA 3EOSA 1PV8A 3QGVA 2HVOA 1S2WA 4OBSA 5E6ZA 3OGSA 3ARZA 4CCEA 3WLRA 3GIYA 4S38A 4OT7A 3SUTA 4B3LA 1GORA 2J75A 2R1MA 3IANA 4DI8A 3WYZA 2J7DA 3BSHA 5DY2A 2HS6A 1OG0A 1CGWA 4QISA 3W3OA 3WG6A 3LSCA 4O57A 3NPUA 2ZUMA 1G9HA 1DWGM 1DXEA 3MJMA 1H2JA 4BFAA 3T2OA 4N9EA 4W8LA 3KW3A 4PN2A 4AVOA 2HS8A 3WLPA 4JDBA 3RCYA 1MW3A 2OQHA 1OX4A 4WDUA 2RDTA 1RBLA 3ME3A 4S1FA 1O5XA 4V33A 1DIDA 2BGSA 1YPFA 3VZZA 1NM9A 1TFVA 1B4EA 4DLMA 2QAFA 4REQA 5KSWA 3W2NA 2CBIA 3BAXA 4GX8A 2QYGA 1V77A 3SCNA 1VIWA 2XM1A 1EHNA 1DJIA 1W5PA 2J27A 1VYSX 2NVCA 3TN6A 3CJPA 4M51A 2FVMA 3CASA 1LRTA 5BW6A 1JFHA 2JGQA 4OUEA 3BVJA 1HGWA 3LBCA 4IIEA 2XN1A 1I0DA 1PHQA 3BOFA 4H04A 2YBTA 1M1BA 4I7UA 3U6WA 3UW6A 3K1DA 1NSJA 4AG0A 3GHTA 4KW2A 4KWOA 4C6MA 2G3FA 1XXXA 2CIPA 4JKLA 1PSCA 5EMYA 1J6PA 4NNCA 1J9YA 3SCWA 2ZUTA 2W6RA 2X2YA 3MV11 4O15A 3UETA 1RY0A 2ZUNA 4PSRA 3G0SA 1E0UA 1C8QA 3DERA 4GJIA 4M24A 3ALFA 3E74A 3UXIA 3HPZA 1JPKA 1AMKA 1ZY9A 4ZOAA 2O9OA 1O5QA 4M5PA 2FDMA 1VHNA 1PCWA 3L9CA 1JYWA 1Q6CA 2PU0A 5T9BG 4RNFA 2MUCA 3GW3A 1LYXA 2P53A 2DVUA 2EJ1A 2VDGA 3NM1A 3W81A 1WNOA 2Y89A 4GKLA 1CXLA 3ARXA 3VOIA 2PGFA 2CBUA 3G77A 3NQ7A 3DFOA 5TF0A 3GXIA 3TJ4A 4HPNA 2ZE3A 3UG3A 3I3BA 3HQPA 1PX4A 2B7NA 2C1HA 4UQ9A 1SZFA 3F1QA 1CGXA 1YBQA 4ROQA 4S2BA 3K4WA 4LVGA 4ZXLA 4D72A 5BRPA 3UG4A 4W5UA 4CNPA 2VFHA 1JPDX 3LLDA 2GSHA 2JIEA 1QHZA 4DNMA 4QQ3A 4M6QA 4LALA 1JYNA 1P43A 2V5JA 3H54A 1G4EA 5M17A 4IPJA 3QZAA 3NO1A 4LUYA 3XISA 2ZKMX 2OLHA 5D2YA 3RLHA 4YJ5A 3M0HA 3CUFA 4JD4A 2E4TA 3SN0A 3U48A 4XO7A 2QUMA 4XSLA 3CUHA 1CGVA 3GFYA 4EXQA 4QAWA 1TTIA 5D9MA 1PIIA 1JUKA 4P7QA 2O4MA 2GOUA 1YXYA 1FWHC 1K70A 3M5ZA 1CLVA 4UTJA 2XSAA 4E0CA 3KOFA 4O1CA 2ADAA 1AJ2A 2OOFA 3ARSA 1KGXA 4NIRA 2Q8ZA 1PZ0A 1ZJIA 3BJTA 1K7XA 4F8XA 3S83A 3ARTA 3KAOA 3P82A 1VFHA 2Z25A 1FWTA 1XP3A 3BURA 3UZJA 1KXQA 2QCDB 1MW0A 3VOGA 2XWEA 5I06A 4P8VA 2O55A 3QGKC 1RP9A 1RALA 3GBDA 3SB0A 4PYSA 2RHGA 3UCCA 3UR8A 1NU5A 4JL2A 4HU0A 3QY7A 1OFPA 1AQ0A 3WEOA 5A6AA 3LPGA 1IEXA 2GZXA 1AZ2A 1GCYA 2C18A 2WYSA 3WLTA 2QUVA 2XH2A 1A0DA 5FSDC 3GIQA 5DQPA 3LHTA 4ZENA 3T8LA 1HO4A 1EJXC 4MTVA 1GJUA 4BF7A 5M03A 1VKFA 4ICCX 1IEVA 4WKAA 1V3KA 1LWIA 1PBGA 4TUFA 1WDQA 4JPGA 3FCPA 4TU1A 3U5YA 4BI7A 1UR3M 4HOZA 2JF6A 3OBEA 4JY8A 4U28A 2OQLA 3THCA 4M6UA 1PKNA 2RDWA 4AZ5A 3ZJ8A 2Z1BA 1JDAA 2GDUA 2P1FA 1MSSA 3VC6A 3UYIA 4N42A 1QNOA 4C65A 5J5DA 4C1NA 3SR7A 5BYWA 3WQWA 4AU0A 3BQ6A 2ZA3A 2XJ7A 3L2MA 4GH3A 3LPOA 4I9JA 4F2UA 4J9JA 2TMDA 4ZVJA 3UCDA 3QHMA 5F2IA 3W4RA 5A95A 3EX6A 4S3DA 1I2RA 1UQZA 3CQHA 1RR2A 1WBJA 5G4EA 3BAWA 3PULA 4D1IA 1VLIA 1UC4A 2XN2A 4QSHA 3HTWA 3LCFA 3SCQA 4HNCA 3PPGA 2O9TA 5EPDA 2ZA2A 3FAWA 3MUCA 5FF0A 3QH2A 1DE5A 4AB4A 1FRBA 3GDTA 2E9BA 1YDYA 1XGZA 1CB7B 1H0GA 2ZOXA 4RV8A 3A12A 4JX6A 4GC3A 2VO5A 3WUGA 5LIXX 3TQVA 1L6GA 3NIYA 4MGGA 4J3TA 3VE9A 1AL7A 4BEQA 5JBDA 5AC5A 3HPFA 4YTQA 3EXTA 4LEQA 1AW2A 2WKJA 4W85A 5I79A 1ZNNA 1OJXA 3WK3A 2LLEA 3PZQA 1PWMA 1LDCA 4MYAA 3WDIA 4A8LA 1TWZA 1YIXA 3QQ0A 1KKOA 3KDOA 2UZ9A 3SJNA 4NVTA 2AKZA 2VGGA 4MYXA 3PBYA 4XZHA 3VKAA 2EHHA 3I4KA 2OEMA 2FB2A 4OHQA 1SU5A 2ZADA 1GTEA 2PDYA 1F05A 3PUGA 4GQRA 1QHOA 3AMGA 1XF0A 1UCWA 4DRSA 4JTCA 3ITYA 4UFKA 1EGVA 1B0IA 1HGYA 2F6XA 4ECLA 4XK2A 3I6TA 3SAZA 3VD5A 1Q45A 3EWXA 3VU2A 3S9YA 2GUUA 2WZEA 4W9TA 4K8EA 4WZHA 4ZO9A 1BYBA 3BO9A 4LB3A 4J35A 2JKPA 1POJA 2NWRA 2H90A 2PCQA 4GISA 1QR7A 3KCLA 5A69A 4UOJA 1W17A 4UXDA 3V5CA 3L4UA 1O94A 3M0YA 2VCBA 3U4FA 1N55A 2GVLA 1Q65A 4PCSA 1XUUA 1V5XA 3A9IA 4ES4A 4MZ8A 3OVRA 3S5OA 2HXUA 4KWSA 3L4WA 4JHZA 6ALDA 4ZB5A 1ADDA 3NO5A 1K8XA 4KIRA 3UJ2A 2I17A 3PF3A 3AIBA 1Z44A 4A6GA 1IEQA 4F40A 1UJQA 2FDSA 1E0WA 1BHGA 1FXPA 1UUQA 4Y9NA 5FAJA 3KTSA 2Z1XA 4WDTA 2CLPA 1EP1A 3P81A 2YJQA 1JNEA 2QDGA 2PDMA 1US3A 4TMBA 1W5QA 2V81A 4HA0A 4XZBA 1C7TA 4DQWA 4ENLA 2D23A 3GSMA 4DWSA 1OGBA 4JTQA 1KRBC 3OIXA 1QPKA 3WQPA 2XH4A 1KFCA 3E2RA 3R8HA 3LX9A 2PBOA 2BMBA 1XLBA 3FAXA 3HMCA 3VD3A 2ONEA 3BC9A 3K5XA 1I1XA 2WMGA 3GZ3A 3T44A 1G01A 5C9UA 1R3YA 2C1IA 4MDPA 3USZA 1ONEA 1C92A 2RDXA 1PAMA 3WH9A 4Y9AA 1G1YA 1MDLA 2J7BA 4UCFA 3TQPA 3W1TA 1VJIA 2DFAA 1K9TA 4PTWA 4HPXA 2CLKA 2WNWA 4C6QA 1S2VA 2I57A 4WKFA 4B16A 3EDFA 1PTGA 3B9AA 3GYEA 3NL3A 2BVTA 3EAUA 2BY3A 4S3FA 3LPPA 1T6MA 2CKRA 2XIMA 3NOYA 3MS8A 3CYVA 5HNNA 1X96A 3G0UA 5F2LA 2WMIA 4MY9A 2IPJA 3S6TA 4KWVA 3G6LA 1OVDA 1GQKA 3FJNA 1G69A 4E8DA 3UWEA 3TN4A 1GQNA 1UIPA 1UPPA 1VP5A 4HK7A 2YCIX 3L12A 3S5SA 4MFDA 4B5WA 3T0DA 1J0KA 3DKJA 4J2MA 3UJRA 2HE5A 4NXSA 4F4RA 3GVRA 4X3ZA 1GVQA 3AS2A 3KFTA 1H7PA 4WSJA 4B5UA 1E1FA 1XLIA 3C3UA 1CGYA 3M64A 1JVNA 1TV4A 1UQYA 4OGZA 1K6WA 3S5YA 4IIHA 1JZ3A 3N2CA 4IIDA 5D2XA 1REQB 1AW5A 3SSJA 2C1GA 4NYYA 3LLFA 2A7PA 4H41A 1WBHA 4N6FA 4KRZA 3NWRA 1DWFM 5FAGA 4ZBCA 2PGRA 2WSRA 4O1FA 4LSBA 2GUYA 4HHLA 4IGSA 4DBWA 3RLGA 3OLDA 4BZYA 4DIAA 1TYGA 2FGBA 1M7JA 1B3WA 3NSMA 5TNVA 3LMYA 1W91A 3O9NA 3R89A 5FSEC 1TPUA 1ZCOA 3OBAA 1VRDA 4XVDA 1BFNA 2HCVA 3H8AA 3POCA 3P93A 2NT1A 3WIJA 4IJBA 5FOOA 2XFWA 1GG1A 3DECA 1ADOA 2I1OA 4PEKA 1F73A 1VCVA 4GYKA 4MAVA 4RDYA 1NFBA 1FA2A 3B05A 3P0WA 2ZFAA 2ANUA 1EPXA 5D4YA 1V79A 2WHJA 1U5JA 2AMXA 1Q6DA 4PB3A 2CEQA 2OSWA 1XC6A 2G0WA 4L7ZA 3B9NA 1TUFA 1PO9A 4UTLA 3LXCA 4QJ5B 4RZ6A 4YYCA 4MWAB 2C91A 4LUTB 2OYLA 2D3NA 4IXHA 3ID7A 3AMLA 2NQZA 2V3EA 1PVNA 1F6KA 1QPNA 2HSAA 1KFJA 3B0VC 3MI6A 3KRZA 4ALDA 3HGSA 3RO6A 5KMYA 2YYTA 4QDMA 2JALA 4HCDA 4LAZA 2XZ7A 4MVAA 1YDNA 4TX8A 1TRDA 4H9YA 3KWXA 4L6DA 4EPEC 2BP1A 4AXKA 4DO4A 4Q7IA 4AX6A 5HQEA 4X63A 2E5BA 3SEPA 1DE6A 2X1IA 3WD1A 1UD3A 3CNYA 1Q5MA 1XLGA 2E8YA 3BLFA 3NL5A 2X41A 4V1XA 2PTDA 2BVDA 4XZWA 4Y90A 4PRTA 3P60A 5DBTA 1FH8A 2ZE0A 4Y9PA 3B3DA 1ICSA 2WXDM 1I2PA 3OGRA 1OYBA 4GI6A 4ROPA 1CTNA 1XYCA 1TCMA 2V5CA 3MO7A 2V2DA 5AHNA 1CZ1A 3KLLA 3WFLA 1HVXA 3H2OA 3SI9A 1OSEA 1VBJA 5I2UA 3CIXA 3N34A 1D9EA 3CBWA 2A1YA 1BYDA 1RVGA 3W71A 1W1B1 3GTNA 3R7MA 3I3DA 3SUSA 2BZNA 3IIXA 4TX6A 3A22A 2P76A 4WDXA 4A8NA 4AIUA 4JIHA 3F2DA 3SGUA 1OT1A 4J3XA 1XLMA 1FVPA 3G8RA 3RCMA 3ARRA 3KP1A 2DPEA 2Z0IA 4PUDA 3I3EA 4LNYA 4AZCB 2OZ0A 3RG6A 1VPXA 1CIUA 4JX5A 3OLIA 3E0VA 3UG8A 2PDGA 1UR9A 3N6QA 3CWHA 3NOEA 4QG6A 2ZBTA 3ARPA 1HG3A 2NX1A 3AICA 4ZSTA 3WUBA 3NQ8A 1F3WA 1O1ZA 3E3HA 1X6LA 4LUTA 3V3WA 4S23A 1RBAA 2UBPC 2NXHA 4H2CA 2FTPA 3WF3A 1E9ZB 2BHYA 1EFZA 4D6FA 3G0XA 2AL2B 3OQEA 4RXGA 4PE8A 1IT7A 4FXSA 3ARQA 4PSPA 3EXRA 3W7QA 4IM4A 1SZRA 2ZZ2A 1XCXA 2XIQA 4NZFA 2JBMA 3WD3A 3ZJ7A 3MANA 3FJLA 1PE1A 3PTKA 3APYA 1OFRA 2FVKA 3P3BA 1JCNA 1JZ7A 3LK6A 3UR2A 3S9ZA 1XHGA 2D2HA 4R53A 2XVPA 3ZT5A 4LUIA 3PNUA 2OU4A 2NQJA 2W91A 2GUBA 4QXIA 1VYRA 2I7GA 1P0NA 1DQXA 2NZLA 3WMLA 1Z9AA 1TZ9A 2VL4A 4K8GA 2BOGX 1BEUA 4US5A 3AOFA 4H6RA 4XD6A 1TMHA 2FJKA 4DWSC 4DNHA 4HQVA 4RNIA 1EB3A 3U8GA 3VDBA 1TO3A 2Y70A 4NRSA 1WPCA 3AJ7A 1Y5WA 1QI0A 1WXZA 1EPVA 1DEDA 3R8GA 4OIFA 3PB2A 3UNTA 3LTSA 5DXXA 1Z89A 1KFLA 2J7GA 3H4GA 3CGTA 3N2XA 3WK2A 3F5KA 5LSMA 1PUDA 4XUGA 3AUOA 2J13A 4J4KA 5KETA 1W0MA 4PH6A 5CPOA 4NJJA 4D6HA 1NFGA 2FQIA 3M0XA 3NYZA 1Y8BA 1IXNA 5FJUA 2QCDA 1G0CA 3M6YA 4FF5A 3G24A 4IMGA 3F5LA 3URBA 4CGTA 2CLHA 1XYMA 5ENLA 1CBGA 2BWGA 3DG7A 4O16A 1EXBA 1I2OA 1V6YA 1UR1A 3ZOAA 3K30A 1B54A 3R0DA 4R9OA 3AS1A 4LUJA 3VD7A 4UTWA 5CKSA 3PZIA 5IHRA 2E6FA 1TV2A 1GOOA 3S2NA 1YQ2A 5AHIA 4WY0A 1EJUC 3L4TA 1TSIA 4PFMA 3RF9A 5B7YA 1D8WA 3N25A 3UVAA 2XGBA 3HV9A 2NLIA 4BA0A 5GQBA 2HROA 1FHLA 5HINA 1V0NA 4F79A 3BSMA 4CNOA 4ZL1A 2PLCA 1RUSA 1KCXA 5J8LA 1RXOB 1XX1A 1M5WA 2Z1WA 3ZSSA 2Y61A 1PZ1A 2E77A 3DC0A 1X1NA 3ZSTA 5I3KA 3WNPA 3W76A 4HMNA 4CQDA 3FJ6A 1QI2A 3BGJA 2ZRVA 5TAOA 3I7SA 2PWEA 1E71M 3QPZA 5E9AA 2TYSA 3EA3A 2VOMA 3NQMA 3F4CA 1HKVA 1EEXA 3QTPA 1VEMA 5LHEA 4G7EB 2QHAA 3O6CA 2A6NA 3W26A 1TX2A 3GBEA 2X05A 3LZ5A 4UNLA 4FA3A 4P8XA 3ERPA 1M65A 3BGAA 1W9DM 1V3JA 2QIIA 4JL1A 2DUZA 1X1ZA 4NT0A 7REQA 4U3AA 3LB0A 1VRXA 2E67A 2B81A 5GJMA 4TVUA 3GHUA 1H49A 2BB0A 4I9MA 1V6TA 5XIMA 4PMXA 2R94A 1EP2A 3HU7A 1MWOA 3EDJA 1HW6A 1IWAA 2YCJA 4B9ZA 2Z1SA 5D09A 1DXIA 1EWDA 4IP4A 3T1GA 4PCFA 2P88A 1CXIA 2MANA 2Q8XA 3SADA 4PMJA 4LY4A 1GQLA 5LIWX 1AQMA 4CD5A 4HHPA 4EACA 1E55A 5DN1A 5FEWA 5C70A 3RN6A 1ZENA 2O9PA 1UJPA 1WA3A 4XIAA 3ANVA 3RPTA 1TV5A 4GBUA 2Y63A 1B90A 3NZGA 4IGHA 4IG2A 1D7FA 3BE7A 5AHEA 3TJLA 1FWWA 1QVBA 2ODOA 3MUAA 4LW7A 1FBAA 3IWPA 1EWEA 3HMJG 1H63A 2FZBA 3MUZ1 2NLYA 3P61A 3P74A 1GZ1A 4DAFA 2WV8A 3ORWA 2Q8LA 3LM7A 4JTKA 3L4VA 2F7FA 3TQKA 1RLCL 5BZAA 1P1XA 4XD3A 4ILSA 5F2MA 4ZMGA 4O11A 1RD6A 3R11A 2X7VA 4O17A 4Q3MA 1RA5A 1GHRA 3BDKA 4AEFA 3GAYA 4O19A 3PR2A 4MWAD 1LBMA 1JJKA 5FACA 4M80A 2XSBA 4DYJA 2WHKA 4A3HA 3H7RA 4QCFA 3ATYA 2REQB 3RMJA 1V03A 4MB5A 2DQXA 1OF6A 2QPSA 2ZXDA 2DZPA 4XAYA 3LBMA 4TVDA 3R5EA 4ZO7A 1BPLB 4CN6A 3R4IA 2PU1A 3C0LA 4AD3A 4YHGA 5JH2A 1BKHA 4GYPC 4UCGA 4R27A 3ES7A 4BCEA 3W24A 3I65A 1S5NA 1P0KA 1L2QA 3T4CA 5KZMA 2VCAA 1ISZA 3P14A 1OADA 1RH9A 2ZDSA 3O06A 1LP6A 1XISA 1NY1A 1R85A 1QATA 1CCWB 2YDQA 1TPDA 2C6QA 3KE0A 1VEPA 3BSGA 3OGVA 2WPBA 1P7TB 3KBMA 1XSIA 5BOOA 1VC4A 2HBVA 4LOCA 4WD0A 1VIZA 1EF2A 5E5CA 3D6NA 3LQLA 5KZ6A 1CNVA 1WE5A 3N14A 2BNJA 4ZQOA 1UMLA 2PAJA 3TJIA 3GDBA 4PMNA 1XCWA 4W5ZA 3VM5A 2YBVA 4H7ZA 3SY8A 3SCVA 3FHQA 5HA7A 3W86A 1HVQA 4OKDA 1NF0A 4IGNA 4ONVA 1K03A 4Q8QA 1EXPA 3VM7A 3E2QA 4NQ1A 1VF8A 4ZO6A 3B0XA 1K9EA 1U5HA 1JZ5A 3IK2A 4B92A 2XVLA 2BGNE 4MNMA 1XPGA 1E6XM 3L67A 5CC5A 1IIGA 1R3QA 3GXFA 1WUFA 1W3KA 2DDXA 3UNDA 4IPLA 1KM2A 1NOUA 5D8WA 4PMUA 3W22A 3WDRA 1E6NA 3P6LA 2ZWZA 1JI1A 1XC4A 4W88A 2GQ9A 3DDMA 3VD9A 3RPMA 3QV9A 4HYRA 4LC6A 2NW0A 2ZZ5A 1LRNA 2AQOA 3M5VA 1QPOA 4LTSA 3R0UA 4W84A 1UYQA 1TVNA 3WO8A 3QN3A 4WQ6A 1AODA 4O28A 2KX9A 3N04A 3ZXWA 2PCEA 2J25A 4DEFA 1W1A1 3G1RA 4R7JA 4ZO8A 3WLNA 2OPJA 2BFGA 2DEPA 2REQA 4NX0A 3PFMA 3G1VA 2RGMA 2PDIA 3H2FA 4UQDA 5A8OA 3WL0A 2FIQA 1MEHA 2CZFA 3NZ1A 3WSUA 3W27A 1YTDA 4H9ZA 3TXVA 3NEHA 1ZBCA 4F2BA 3CUGA 5AVNA 5BMWA 3UPWA 4OJYA 4IJCA 1UH2A 3GG0A 1LUCB 3RLUA 2INZA 4DO7A 2VDHA 1OFOA 1GPWA 2FMOA 3W07A 1JG9A 3W1QA 3FXYA 5A8QA 3OA5A 3AYTA 1B1YA 4GYFA 3TC3A 1OCQA 3RR1A 4XD4A 5DRIA 3UA3A 3ZR4A 4AX7A 1T41A 5E0FA 1XDJA 1RAKA 2V9DA 2GJXB 3WBWA 3IGSA 2EXOA 1JPMA 5HNTA 3GHSA 1QI5A 4IQDA 4EPBC 4HU8A 4E5TA 3ANUA 4LVFA 1XI3A 1MW2A 4NZ5A 3M7SA 4R3UA 4GK8A 3UD6A 3RLVA 5D8ZA 1B57A 1E3XA 2VGBA 4XISA 4HPHA 3DI1A 4DXVA 3WQ5A 3VIIA 2AL1A 2XVGA 2Z28A 3MW7A 2GJPA 3HGOA 1WOAA 3D3FA 1MXDA 1SMAA 1H4PA 1U22A 4J7RA 3CO4A 3S6DA 2Z4GA 4O0QA 4D6IA 4LCQA 4EOUA 3VOCA 3W00A 3ZLGA 3WF1A 1UP0A 2OEKA 3LRKA 3OVGA 3AIRA 5RUBA 5EBUA 3BJSA 4AWEA 5A8PA 2QQ6A 1A5LC 3KBJA 3CAQA 4AZ6A 3PUEA 5A8MA 3N1AA 2OWXA 4GI4A 1P6CA 3BK0A 5DX7A 1IHIA 3IJIA 4J3WA 4V27A 3KM8A 1AA1B 3IARA 2YXOA 2W92A 3UZWA 2ZRYA 2ACSA 2PEVA 4K36A 1LG2A 2BY0A 2QCGA 1SW3A 1G4PA 2O92A 1T8QA 2PDUA 3IGXA 3SZ8A 1CENA 4KEUA 4EX4A 1S46A 1UR4A 1DJXA 3VC5A 3RYSA 1XLLA 1HJVA 2DH3A 4LU0A 1V7AA 4UTKA 1OGGA 4MWAA 2DQWA 4HPJA 1JQVA 4C1KA 4BR1A 2ZX7A 3VMNA 4Z0JA 2V5BA 2G4FA 2CLOA 2GVGA 2FH8A 2ISFA 1GEQA 2A5HA 5EMMA 5CPTA 3W82A 2FPTA 3W28A 3FYYA 4LRSA 5AOUA 3WX7A 4LV4A 2UY5A 3K2GA 1M9HA 4FIQA 1TELA 4QJ4B 2E40A 1NEYA 2YFNA 5G4HC 4PUKA 4QLJA 1L6YA 3C56A 4A3QA 2F9RA 4AC7C 1OT2A 5H6HA 3BV4A 3NQCA 3GVGA 2EO7A 1TJ2A 1TJRA 3LCLA 1JIBA 2QNEA 2BDQA 4FPSA 3VNLA 3VDAA 3PBUA 1BXCA 1BVNP 4XV0A 3ZO9A 3TYZA 4QHRA 1K9DA 4QEEA 5F7UA 4ZEPA 2ZDRA 3HPAA 1UP2A 3N15A 4LVAA 3QFEA 2PZNA 5AHMA 4IUGA 3ZVHB 3VCNA 3B8UA 4Y9MA 1Q7ZA 3ZT6A 1CX9A 1SFTA 4GLEA 1KM1A 2WKLA 1R7OA 4X9SA 4JTUA 3BW3A 3JRKA 4AIBA 4C1LA 4DZ5A 4AC1X 1I4NA 3YPIA 1PIGA 2WZTA 2VTFA 3N6JA 3LHYA 4B3KA 2BSLA 2XGZA 2PF0A 3E0FA 4GJJA 3D46A 4QSFA 3M0JA 3B06A 2V3FA 5AYYA 3CQ0A 1F8MA 3L5LA 2FTYA 4XAGA 3EDEA 4O12A 1J2BA 2RDUA 4IP7A 4PTVA 4B5TA 2WZHA 4DBDA 4WEVX 3CL7A 4IT1A 3VGHA 2QKFA 2YLAA 4IFKB 4PB5A 3L65A 1T7LA 3MI3A 1KXTA 3MY9A 3LGEA 2OVLA 4CU7A 5L6UA 3WMCA 2PDFA 3N18A 4L1WA 1M6JA 1JDFA 3A4AA 3N73A 4JBRA 5AN7A 1XIIA 2WVSA 3K8MA 3IS4A 2TRSA 3WF0A 3NA8A 1WDPA 2W0UA 1ZBKA 3GH7A 1H7NA 4JGDA 4PEEA 4C6KA 4Z2LA 4EF8A 8A3HA 1A53A 4JS3A 5T26A 3OZYA 3IACA 3CXOA 1QJWA 2VFDA 3S8HA 1SZEA 4NP7A 4AWSA 1VH7A 1Y5VA 4YN5A 2AL2A 2YB4A 3VOHA 3GIPA 1TTPA 2FZ8A 3K4AA 3ARUA 3HG5A 2VEIA 4A21A 5I02A 4GVHA 4C7DA 4AFYA 1DJZA 1YPIA 1R3WA 1S3HA 3MP3A 4QEHA 1XD1A 3L21A 3PANA 3CO8A 4KIEA 2H9AB 1E9IA 4IX2A 4GPNA 3TWAA 5DT7A 3DYMA 3DGRA 3FK4A 1KXVA 4Z2GA 1V3IA 2PODA 2V5KA 2V0TA 4ZE4A 1X38A 2FZMA 3QR1A 1HIZA 2OLSA 2O0TA 4LUSA 1V02E 5AC6A 1IR1A 3B8WA 4K6AA 2J79A 3RM8A 3W1AA 2Y6ZA 4KERA 2F6KA 4ZCWA 1FX6A 3GU2A 3BTNA 4KWUA 2ZCGA 2CERA 5G1YA 5HJXA 1GYNA 3DIPA 1SZGA 2V5LA 5LNRA 1RK5A 3UCQA 1R38A 3NQGA 3OZPA 1CLXA 1M7OA 3WL1A 2JFEX 3WH8A 2GOKA 2R1NA 4MJMA 1CYGA 4RLIA 1DVJA 3HN3A 4G6CA 3UZXA 2ALDA 2RH9A 2DZVA 3BLIA 1FWNA 1MI3A 5GJNA 5KTLA 1OCBA 4JTEA 3GDMA 3S3GA 4Q6JA 1R5YA 4JNZA 3ZWTA 2FZDA 4UB9A 4FS9A 3CMGA 1KRAC 3KBVA 4YMZA 2C15A 4D6EA 1C93A 1F9CA 1CXHA 5IFPA 3KEHA 4LS2A 1UG6A 3LD5A 1PXGA 4M29A 3WFZA 1KKRA 4JN6A 1XBVA 1Q4WA 2PTWA 1TIMA 3SJ3A 1E9YB 1JPHA 4JICA 2HPMA 2VWTA 1OX4B 4AD0A 1US0A 2BXVA 3BG3A 1XKYA 1EUAA 3IJDA 2QDHA 2WMFA 3N4EA 4I9TA 2WMKA 4OVXA 1OINA 1JYXA 4AZGA 2AQWA 2DT2A 3URQA 1XINA 3GRIA 2QGYA 2VEPA 3LGGA 4KCTA 5D37A 3UXDA 3STFA 2E6YA 2BHZA 4JDYA 1ELSA 4HGXA 3AHVA 3WLIA 3FGCB 3C8FA 1KB3A 5CGTA 4X61A 3ELFA 3ZMRA 1MRAA 4GINA 3TSMA 3W2JA 2A0NA 3NXFA 3W01A 1VJSA 5DMNA 3ZFHA 4LBSA 2WKGA 3T78A 1JUBA 3B9EA 3AC0A 2VZUA 2R91A 1SGJA 3L0NA 1NOFA 1Z8AA 3CWNA 4TTGA 4WKHA 1OYCA 3WBAA 5FEXA 3SCOA 1L2UA 1VLWA 4RDWA 4LC8A 4WUIA 3UZYA 4M8UA 1EKOA 4KPLA 1TPEA 3OB8A 4QRNA 1HTIA 1JRCA 3BOLA 4EPDC 2Q6ZA 1R0MA 4LBRA 1ZSXA 2Q3RA 1A0EA 3HF3A 3CV1A 3HQOA 4GI9A 1UBSA 1SW7A 2PUZA 3Q45A 1UOZA 4YCOA 1XFCA 4YYFA 3A5VA 3MDUA 3QBUA 3G1FA 4P8UA 2DORA 3CZ8A 3VNKA 5JU6A 4OECA 1H61A 4B5VA 4A2RA 5H8PA 1XIFA 4PC8A 3VPLA 3A4WA 1B30A 4C1NB 2J47A 5JUVA 4CD8A 3LHUA 3EB3A 2WMJA 1FWIC 3S9IA 4LBUA 2IS7A 1UWIA 5AZ1A 1KBJA 4GACA 1W54A 1MEIA 2RKXA 5IBXC 1QPRA 4H9XA 4Q4OA 1IZJA 1Q6OA 1ZAJA 3HJEA 2NXIA 1ZL1A 5IDIA 4Q4SA 1P7TA 4UZSA 5I24A 2I16A 4H3DA 3KHDA 3GUGA 3LUTA 4JR5A 2VVSA 5ECVA 4F66A 1KLYA 1QNVA 5LGXA 1EH9A 2A3EA 2WSPA 1S2CA 3ARYA 2B4GA 5AC8A 3W7HA 3HG4A 1UWAA 1VQTA 3VYLA 1Q63A 1ZRQA 1JZ2A 3ZS4A 3E5BA 4Q6XA 3MZNA 2PDBA 3TROA 2J88A 4XBKA 1TV3A 4Y7EA 2PA6A 3EX1A 4O0ZA 2Y0FA 5FESA 2X40A 1TQXA 3GVQA 3IJLA 4AD2A 1FCUA 3B40A 3MJYA 5D2WA 8RUCA 4FLRA 3CMFA 1K4HA 2PGEA 4PTXA 3BWWA 5FF2A 1VYPX 1R2SA 2RAGA 3CAVA 3GXPA 2J24A 3TE9A 1GOIA 3L23A 3B8VA 3E2SA 1IIHA 1PZ2A 5A1AA 5I00A 1K8ZA 4H8VA 4WHBA 4DZAA 1OC7A 3GC5A 2GVJA 1XSKA 3SCSA 4GIYA 1ONXA 2CLIA 3KVMA 3QV6A 4E38A 4NAEA 1OZQA 1B31A 3V1HA 1U5VA 1MRQA 3GDLA 3W7GA 2XIBA 1AL8A 2OGJA 3IGUA 4MJ4A 3AIVA 3CUIA 2VCCA 3WELA 2ESCA 4CQBA 2CPUA 1I6NA 3SFWA 1XIBA 4JAWA 5A6SA 4AEOA 3RIKA 4HMDA 2Z29A 5ABTA 2YCEA 3BH4A 2ZXQA 3LA4A 1YPXA 2GVEA 2XGIA 1ZAIA 1UKOA 3EEGA 1E73M 3LCHA 1TX0A 2CHOA 3H53A 1VS1A 4L1GA 1WB0A 1E15A 3H12A 1X8CA 5D33A 3E0WA 5TBOA 1W9XA 1XFBA 3S46A 5LNUA 2VFFA 3EWZA 1IXPA 1ZBWA 1UR8A 1Z32X 3WEMA 2DJXA 3VIKA 1THFD 1HP5A 4LUSB 4U10A 1ZBVA 3KRSA 1Y5XA 4KT2A 3AAMA 4DYEA 4LAKA 4Y8EA 2NV9A 3T55A 1V51A 3WDPP 5EBAA 3Q58A 2VGIA 1IXQA 1P1MA 4GI8A 4F0LA 1DKWA 3HURA 3UWQA 2JF7A 4FR1A 2GDQA 3WQDA 1TREA 2SFPA 3MYPA 5LA1A 4WGXA 4GH1A 1W8GA 3PTQA 2DVTA 1GKRA 2C0HA 5CGQA 4E2DA 5JIWA 4BQ5A 7ODCA 3N2MA 4H1ZA 3ONBA 4NAEB 3MCOA 4Q8OA 1PCKA 3BLDA 4UTHA 2DSVA 3CU2A 1WZLA 2HPIA 4LAUA 3NQDA 3B4YA 5FKYA 4O50A 3DUGA 3DFYA 1DTNA 3L0GA 2ICSA 2NX9A 1HJUA 3VO0A 2VNCA 4MB4A 3V36A 3TU9A 1CXFA 1A5BA 1BG4A 1ML1A 4DBEA 3LNPA 2X0YA 1F74A 2GWNA 3CEUA 7A3HA 4ZTYA 2QCFA 4C6LA 1P0EA 4JTDA 3VFCA 3WDJA 2OEJA 4QE4A 3C2VA 3FYPA 3ZR6A 4ATLA 2Y24A 4ML9A 1K3UA 3WJXA 2DV0A 4G7FA 4AVNA 2EPLX 1LRQA 3PHAA 5EGRA 4BI6A 1HN1A 2XPKA 5G1TA 2VFIA 3CLMA 1J0HA 2A3LA 1EOKA 3HPSA 5CPLA 3CHEA 2WCSA 4A8IA 5CEWA 1I2QA 3CHCA 3W7CA 2WWDA 3ENLA 3W85A 1ECQA 3W6YA 1P5BA 1Y7VA 4TTUA 1A5CA 4YWSA 4DJFD 4EP8C 4FI4A 1Q85A 3FA4A 4H9UA 1ME9A 4L4OA 2AQVA 1RA0A 1W1IE 4UQAA 1OCNA 4JNMA 1F4AA 1LOLA 4LY8A 1GKPA 1H7WA 3PPFA 3TC6A 2DW6A 4PB4A 1HL9A 1KBKA 2DZXA 2NV1A 4F0RA 5DBUA 1DP0A 3B0YA 3TYDA 2EG6A 2AGTA 3B03A 5ABEA 4JNYA 1VBRA 1SJCA 1RPKA 5MF5A 2ISWA 1K7FA 2Z1VA 1OG6A 1W3TA 2P0OA 1E6RA 1O4UA 3H22A 2IKJA 1YADA 2TAAA 3U5UA 1H7RA 1JD7A 2XH0A 3PY2A 2WMHA 4I8YA 4OWGA 1WQ5A 1H11A 1MMFA 4AEEA 3BLLA 2F2HA 4JCMA 1ZJAA 3O0FA 2XFRA 4AXNA 2Y7FA 2PDPA 1ITXA 2Y5EA 1H5YA 4DWSD 4QNEA 6TIMA 3QYQA 4MPKA 2Z2AA 3WENA 4K2SA 2HK0A 2D20A 4QLLA 4AWTA 3U0HA 3O07A 1MW1A 1M68A 4CQ9A 2ISVA 3LMZA 4XG1A 1BXNA 5XINA 3UQNA 5I3HA 2PTXA 4AY1A 2X2GA 4HN4A 2VX4A 1KQZA 3CQKA 1LORA 2QCCA 2YXGA 1CEOA 3MKKA 3NVDA 2NVDA 4CLMA 3ARWA 3RAOA 5U4NA 3W37A 3BLKA 5FA5A 3KTXA 4L6HA 4MM1A 4B5NA 2WZIA 3A9BA 2ZRXA 1EGZA 1FHVA 3NSNA 2BOEX 1XR2A 2OSYA 3VMPA 3IRSA 3STPA 4M81A 2QPUA 3CS2A 5A2AA 4U2ZA 5IOBA 1KGUA 3GNXA 1M7XA 2OT1A 3P84A 3E5PA 6ENLA 3FEQA 1TJ0A 3VGEA 3B4UA 4NG3A 5CBJA 1UD8A 1YDVA 1K4GA 4WOQA 1LQ2A 3LBOA 3W7MA 2VWSA 1TWIA 4KFPA 4R7OA 1P48A 2C0AA 1MQPA 1A5MC 5C5YA 3R8RA 4LYKA 3AIEA 4J2PA 3OTRA 4RJEA 3FN9A 4IH3A 3LENA 4CN4A 5C2CA 4NJGA 4WK9A 4DO6A 3GY1A 1BGAA 3W2KA 4OBRA 2TODA 3EWDA 3OZMA 4B3ZA 3HFYA 1EA0A 3W72A 4ATWA 5GNXA 1C90A 1J2WA 1Y0EA 4HKPA 1KGWA 2D24A 5IBXA 1TA3A 1FWCC 6PTDA 2J7HA 4DY1A 2ZVIA 3W84A 4KCVA 4HNUA 4AHQA 3AI0A 5F4SA 1BKSA 1VBUA 1E51A 1E1EA 3DH7A 1S2TA 3VIPA 3O2LA 1PPIA 4YVXA 9XIAA 4HYWA 4HNNA 4GBDA 1NJJA 2GQAA 3BMVA 4KF1A 5LA0A 3CZGA 4M1RA 1GQIA 2Z6IA 2VEKA 2XSXA 3W1MA 4D8ZA 2OZ8A 1ZALA 2GGGA 1QW9A 1UZ4A 5I7GA 1OHLA 1C29A 1K77A 4JFTA 3A6OA 3I6RA 4INFA 4QTGA 1LWJA 2VRJA 4TV6A 4NJHA 1MEWA 2WNNA 4GKTA 3GO2A 3AU2A 1GW1A 3QLLA 3IVUA 4MJZA 1R3RA 2WJEA 2NX3A 4JFUA 1H1ZA 1E5NA 4Y9OA 5A6LA 3W7IA 3G6MA 5TQLA 3VMOA 3AXIA 4GQ0A 1BYAA 1RSCA 3AYRA 1G4TA 3I6EA 2VD8A 4AF0B 4JTLA 3EWCA 2WSYA 4HOWA 1OD8A 2VENA 4N9BA 5F4WA 4F2TA 3WF2A 4PCPA 1F5ZA 3MYOA 1EEPA 1W9UA 4Z1CA 2P8BA 3LU2A 4H2HA 1GJPA 5HQLA 5EU9A 4HTYA 5CPQA 1E43A 3CH0A 3FSUA 3TLQA 2ZTJA 1JZ6A 1TWSA 3ZWSA 1U2YA 1ME7A 1M04A 4JYEA 4C6DA 1UH3A 1OM0A 4I7WA 5CLTA 3WQVA 3OYZA 4JIPA 3UWZA 3IJ9A 1RP8A 3REQB 1LLOA 4ZTXA 3LM3A 4C6IA 1A3XA 5GPRA 1SPQA 3FIGA 2X1UA 3VOJA 2GFTA 3M46A 3SM0A 3QF0A 2VEFA 3EPNA 4HD5A 2DT1A 4PGLA 4R88A 1GNXA 3AIWA 4GQQA 4ZODA 1HZYA 2WJFA 1UD2A 2J9ZA 1UW9A 1DQUA 1D2KA 4I5XA 2JEQA 2HQAA 1OY0A 1A80A 4NI3A 3TXZA 3RCNA 2X30A 4IIBA 3AZTA 4W7VA 3IJ6A 2J6VA 2PRLA 5IFTA 6REQA 2Z2UA 3VA8A 4NAFB 3W7OA 5E6YA 3SQSA 4PTNA 3OJGA 2W5FA 5FJJA 4A35A 5DCDA 3MI2A 1RJQA 2G8ZA 3V35A 4PMOA 3GH4A 2WVVB 1QAPA 3FFSA 4EWJA 5CC6A 5JVLA 3ABOA 4RZ4A 3KVJA 1C7SA 1B3YA 1V6XA 1KO0A 1OQFA 4L56A 4XZNX 3G1HA 4PFHA 5BOEA 3OLEA 5CZSA 4L9ZA 5FL0A 1TV8A 4D2JA 1UA7A 4UQEA 4L4PA 3APTA 3OG3A 5CSYA 4RW3A 2E1DA 3SN1A 3D47A 3VZXA 1U33A 1X39A 1DV7A 4NHVA 2EKGA 2DU2A 1JCMP 1IEIA 2WVUA 1SJBA 3A21A 3NVTA 3F4VA 4DBSA 4DJDA 2H3DA 2DIKA 1WDRA 3F4DA 1R46A 4X2PA 2EKCA 3IJQA 2ZX9A 2DT0A 3NO3A 2XHYA 4TOQA 4XAZA 3HA1A 1OK4A 2XH7A 4N4QA 2YA2A 1TV7A 4DJFA 2PDXA 4QE1A 4FIRA 1UD4A 1IEWA 3BUVA 4Z08A 4OTKA 3Q67A 1F6PA 3QKZA 2VYOA 3PJUA 3V4BA 1S5MA 1E6PA 4HA3A 3BG9A 3MDWA 3NR0A 5DMYA 4OU1A 4MDOA 4Z2JA 2HDJA 3PJXA 1EO5A 3MKCA 4FOUA 3USBA 4J1OA 4XQ6A 2FFIA 3DFQA 4ZB0A 1DORA 2BBFA 4M7TA 1XWYA 1QT1A 2VZTA 3MV01 3KBNA 4M0XA 4NSBA 3GNOA 2OR2A 4K8HA 1JCYA 4HSNA 1E0VA 3RX2A 3TVAA 2HJPA 4EANA 1WAWA 2D2JA 4R34A 4DAIA 5T8GA 3ZR5A 4FB7A 2BGQA 3LI1A 3H2AA 4Q7BA 1WDDA 4PCNA 6XIMA 3PTDA 1Z42A 4KH2A 4C91A 4GRSA 3W29A 3CK5A 4QE5A 3M07A 3NGFA 4Q4QA 2Y8VA 4JN8A 3T2PA 3BLOA 3VIOA 4LVBA 1GOKA 2ZC8A 2QJNA 1TPWA 4A05A 1CGUA 2QCMA 4FAMA 2QJGA 3W73A 4HMEA 1NDWA 4YXGA 2WO5A 4PMQA 5F1VA 5GVJA 4D8LA 4DPQA 1Q6QA 1WCGA 4JXCA 4REQB 1ZP3A 1XSJA 3WJZA 4E8CA 3AHXA 5CJMA 3HV8A 1UOKA 4TV5A 1JFXA 4DXKA 3TKFA 2RFGA 2CNCA 1R3SA 4HSOA 3F4WA 3ONCA 2POZA 2PWVA 3UZ5A 4CKQA 2W62A 3TOYA 3B0UX 4QQUA 1S1RA 1S2AA 2BLEA 1FWRA 1HKWA 1B3OA 1FWBC 1EJVC 2NQ9A 2G41A 1YBQB 4GY1A 1BWVA 5KINA 3WBEA 4F48A 4ADSA 2DY3A 2ZA1A 4TX9A 3TFCA 4PA8A 1PX3A 2C14A 2Z6JA 4Z42C 1MQQA 4GXPA 4YTTA 1JQXA 2IQDA 4FSAA 2R14A 1RVKA 1LT7A 3W7EA 1FWEC 1EUNA 3S1WA 1AH3A 1YNQA 1E1CB 4EVZA 1H0IA 3I7QA 3QPEA 1B4KA 3P67A 1WKYA 1TCDA 1LOQA 1UR2A 3KOYA 1XIEA 4WX2A 1JCTA 1I9CB 4ZGYA 3BCDA 3KP0A 1TUXA 2QJHA 4GX9A 2QXWA 3CZEA 3CC1A 3EXSA 1X97A 1EJWC 2FH6A 2BY2A 3AFBA 4XAFA 5AECA 2R24A 1AG1O 3TUUA 4WR3A 3SGGA 1A5NC 1QUMA 3PZVA 2Q09A 2GL5A 1HNYA 3KOXA 3H2EA 2A7NA 4U33A 1W1PA 4W86A 1P6BA 5E09A 3RFAA 4HK5A 1R30A 1OX6A 2F2KA 3W7NA 1KFKA 5IHSA 5HR6A 2PDNA 4Q4PA 1EIBA 1XGEA 1GVOA 4MOZA 2XU2A 4H4IA 1V08A 4PMYA 3OODA 3RUBL 4AZBA 2UY3A 1O66A 2E9LA 4YTRA 3PJWA 3EOOA 3NJ3A 2YDAA 1ZPTA 1JDCA 3PBGA 4B4FA 4Q8VA 5AC7A 2A3HA 5AHFA 4WRHA 4HA1A 4K68A 3MU7A 4MUZA 2CBVA 3G8EA 4HT3A 4GZ7A 1G6CA 1QK2A 3VUSA 3UWUA 2PLMA 1EDTA 1PZ3A 4NZ4A 3N2BA 4B2DD 3E6EA 5I77A 4QS5A 5EMLA 4H19A 1XLJA 3IJ7A 4X22A 5CG0A 3VFLA 1GVRA 1JEZA 2KAUC 3GFXA 4PMVA 5CSSA 3Q37A 1L8NA 3BICA 4DF2A 1UP3A 5A8NA 1NP0A 2GK1B 4P7NA 3M4HA 1UZHA 2CWNA 3TN3A 3LSBA 2D3LA 1E6SM 3EMCA 4ADTA 3EMQA 3DHFA 3PZUA 2WHMA 4POCA 1K6AA 2XIIA 5PTDA 1XICA 2ZUUA 3FVMA 5BNKA 1UWTA 2C19A 2XYLA 1M41A 2CZ5A 3VDCA 4GVIA 5BWAA 3GS6A 3QC3A 4A3UA 1SSGA 1BWLA 2X1SA 3DHUA 4BY3A 3MSRA 3NZQA 1S5TA 3N9KA 5HOSA 1A0CA 4JEJA 3T4WA 4CNNA 4XVEA 1I45A 2ISDA 5LXXA 4LT9A 2UV8G 4D6DA 1DIOA 2VUNA 4S3CA 6XIAA 4HHMA 3RXZA 2Y8UA 4L4LA 4B5SA 4K1WA 5AC4A 3TYEA 4IPNB 1Q66A 5CJNA 3BCFA 4QG9A 4FHAA 1XBXA 3FNDA 1C9DA 3WD0A 4ICMA 1QWGA 3GG8A 3CPGA 1QXLA 2CYGA 1V0MA 4DF1A 4G5DA 3ITXA 3E0LA 4DHGA 4I6VA 1HKKA 2PLKA 4WXYA 3GG7A 3MO4A 3TW7A 4LXFA 1TQJA 3DFHA 1V02A 2GJRA 3U2OA 1YDOA 3MA8A 5H8UA 2YDSA 4OZOA 1H09A 3JZUA 1SM9A 4M82A 2J8TA 2WCGA 2VQTA 1ZFJA 4RZBA 3SUVA 4L9YA 3WK0A 3PM6A 2YB1A 1E5JA 2EPKX 4DO5A 2G95A 3GH5A 1KM5A 4YHEA 1OGSA 2HEJA 4LYQA 3RGTA 4PBFA 9XIMA 2INFA 3NXLA 2IKIA 2YL6A 4JQ3A 3VINA 2Y5JA 2CU0A 1N7KA 2VM8A 1DBTA 3G1AA 3WBYA 3C2RA 4OOZA 4IXXA 1ZU8A 4DWDA 3BL3A 2JKEA 4Q4RA 4AIOA 5DMLA 2G3IA 3AROA 3GQYA 3DOPA 3UG5A 2RGLA 3W7KA 1Q13A 4RUBA 2NVAA 4YVVA 1XLCA 3JR2A 2J77A 3MCNA 1K02A 3QY8A 4MIMA 1NF7A 2GJXA 1ZB5A 5D38A 2FPYA 2DSWA 3W83A 3WNOA 2FZNA 3PZGA 1U30A 1HQTA 3KXQA 1GVIA 1W37A 4BI5A 4XZLX 3TTEA 3WH7A 1EIXA 2E8ZA 1O95A 4JOMA 2ATSA 4Y2WA 2WOQA 4TXEA 3SY1A 1KV5A 3IPWA 4IMDA 1B2YA 3N2TA 3EDKA 1ADSA 5C54A 2WC7A 1WKEA 1VAHA 5K4XA 4FZIA 4MKSA 3FVDA 1M01A 3DXIA 3G1SA 1JPIA 2J8FA 1GW9A 1ZGDA 1UH4A 2HXTA 3ISIX 4DVOA 3UVIA 3VUPA 2DZAA 4O18A 4GXWA 3GNPA 1XD0A 3WQOA 2VMFA 3KCJA 2PP3A 4PUJA 3GE7A 2JK2A 3B97A 3GDRA 2QMJA 4C6CA 1N8IA 2FVLA 1XCFA 3EWYA 2QR6A 1IGSA 5U7SA 2Y7DA 3CYJA 3D5HA 4OOUA 3GXTA 3W1UA 1SUXA 2VUYA 3KDNA 4YNGA 3PZMA 1POKA 4TMCA 3H6OA 2GPTA 1Q6EA 4E4FA 3BAKA 3T6CA 3T08A 3WDHA 2BVYA 5HWMA 1AH4A 4XKMA 1EYEA 5TD4A 2BVWA 3W1PA 3RX3A 4N02A 4RE2A 3O63A 3T0CA 3ZVIA 1MVYA 1LWHA 3FJ4A 3LLXA 1WDWA 2ZIDA 4NZJA 1P6WA 1A5AA 3FDKA 6A3HA 3O7UA 3T9PA 3K4DA 1N8WA 3WQ6A 1JYVA 2Z7KA 2X1TA 1VFSA 1NWTA 4D6GA 2Q01A 4O1DA 2J9YA 2W3ZA 2R1LA 1NARA 1T99A 1KM3A 5C71A 3GKFA 1WDSA 4LX4A 4WF7A 1HFBA 3E0IA 2BY1A 1SVDA 2R8WA 4GYPA 4H7VA 3TCSA 3UT0A 3QQ1A 4H6KA 3MCMA 5C6MA 1RJPA 3CQIA 4HU3A 4Q4KA 3NUKA 9CGTA 4PBEA 1ONWA 2JEPA 1EF3A 3GVWA 1W9BM 3P0XA 5HNRA 5EY5A 4HNOA 3MBDA 1PYMA 4NZ3A 2OSXA 1XRVA 3AYSA 1GVSA 2GJLA 4A29A 4L65A 3DBNA 3GHRA 4Q8NA 4K7YA 5G5IA 3PPCA 1VFOA 5CZ0A 1BWKA 2HVNA 2VR5A 3WZ0E 5E9XA 3I10A 1RV8A 2MNRA 3QYSA 5DCBA 4PODA 4DYKA 3TX9A 2A7RA 1YXCA 4O8AA 1HF6A 3TDFA 1H51A 2ZZ1A 1AFSA 4IMFA 3M1ZA 2OZ3A 2Y7GA 4NY2A 1K8CA 1V8EA 3BV7A 3RRAA 5F4XA 1RBOB 3CZLA 1CB2A 2VP8A 3MHFA 4HVXA 4BEUA 3T0TA 1W56A 1BG9A 1K7EA 4FXJA 2D0GA 1VJZA 1R6WA 2CLFA 4UFLA 2XTKA 2XVKA 1ITUA 1ENUA 4FLQA 2A3BA 2XINA 4JZ5A 1RZMA 1ISVA 1O5KA 2JE8A 4JIQA 1I0BA 4L5ZA 3P80A 1UUMA 4AD5A 1OFBA 3N6HA 4K39A 4LF2A 1J12A 4LCSA 2GK1A 1GZJA 4U4MA 3KX6A 3FS2A 3QV8A 3G1YA 4EAMA 2YA0A 4HN8A 3LXAA 1GK8A 3KCOA 3EB2A 2WPGA 3LGDA 3LTYA 1WUEA 7TIMA 2WB5A 1MO0A 3E2VA 4ACZA 1J79A 3E02A 2O9RA 1ECEA 1UASA 2ABAA 1Q7QA 3AISA 4KCWA 3EEZA 3STEA 4NASA 4GOAA 2Y5SA 4IX0A 1LJYA 1XQLA 2CXGA 4PR4A 4W4QA 5DO8A 5G2IA 4HBKA 2VRKA 5HATA 2PS2A 3NFUA 2PSNA 1Z41A 1UKTA 1XRTA 2Y88A 3VXGA 3B9OA 2CZDA 1SO6A 1JGMA 1D3HA 2D1ZA 1QK0A 3A3HA 1PJ9A 3WJYA 4HCLA 3BW4A 5FJTA 1LQ0A 5LXEA 1E4NA 3LOTA 5CAKA 4K37A 2OTDA 1HKMA 3PZ9A 2ZUWA 2DZBA 2Y8KA 4FNPA 3A4XA 2YCLA 5BXRA 1KQYA 3J7HA 2XN0A 1LT8A 3K8LA 4JTGA 5D30A 4FP1A 1H50A 4NJKA 3UY7A 3U4AA 2IXVA 4TVCA 5LGZA 1UWUA 3B9DA 3KS6A 3EGJA 2YW3A 1UB3A 3UWWA 1NIUA 3E38A 3VGDA 4NUWA 2OZTA 5CPMA 3IIPA 1BYCA 4PUMA 3VKDA 2BASA 3GU9A 5HJLA 1S2UA