1UG8A

Nmr structure of the r3h domain from poly(a)-specific ribonuclease
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
87
structure length
87
Chain Sequence
b'GSSGSSGDQKKFIDQVIEKIEDFLQSEEKRSLELDPCTGFQRKLIYQTLSWKYPKGIHVETLETDKKERHIVISKVDEEERSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A)-specific Ribonuclease
molecule tags Hydrolase
source organism Mus musculus
publication title NMR structure of the R3H domain from Poly(A)-specific Ribonuclease
rcsb
total genus 16
structure length 87
sequence length 87
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 1ug8A00
1UG8A 2LRRA 2CPMA 3GKUA 2A1SA 1MSZA 1WHRA
chains in the Genus database with same CATH superfamily
2JA9A 2FPHX 3U1KA 4GKKH 1WE8A 4DV2H 1HR0H 1J5KA 3J80W 3EZJA 2CTKA 2ZM6H 2HHHH 2O4CA 3J7AK 1N36H 3JAMW 4AQYH 4JVYA 1SEIA 4JI5H 4DV6H 2VQFH 4B3TH 1N34H 1DT4A 4LFAH 1V9NA 1X4NA 3FAUA 4LIJA 1J5EH 5LMNH 3QD7X 1WVNA 2CTFA 4YY3H 2VKCA 2FMRA 1VBIA 1K1GA 1HNZH 3J81W 5DT9A 2CWHA 1PQXA 4X64H 5A2QW 3L7ZC 1IBKH 4JYAH 4DV1H 4JI1H 4DUYH 3VKEA 1KHMA 3RF2A 2QNDA 2JEAI 2HH3A 2BA0A 5IWAH 4DR6H 3V69A 4K0KH 2P2RA 4BA1I 4JI2H 2UU9H 1AN7A 2DGRA 4GKJH 5BR8H 2LTLA 3T1YH 4B3SH 2M8WA 2PY9A 2JE6I 1I6UA 1N32H 2UXCH 2E5LH 4X62H 1VIHA 1HNXH 3GKUA 4FJSA 4LF4H 4G08A 1XNQH 3UOEA 2PT7G 1N33H 3SB1A 2FFMA 2LRRA 5IT9W 2OPVA 2HH2A 4NBQA 4DR5H 1ZZIA 5K36G 2ZQEA 2E3UA 3GR5A 4E9JA 1F0XA 4QMFB 2VQEH 4AIMA 4DR7H 2MJHA 4JI3H 2Z0SA 3KDKA 4DUZH 4DV7H 3T1HH 4YHHH 1IBLH 2G8YA 1HNWH 4FJUA 1X0AA 3KDGA 2BL5A 1IBMH 4LF5H 1XRHA 4BA2I 2LF0A 4LFBH 4B3RH 1FJGH 1ZZKA 4OCHA 4LF9H 1X4MA 4LF7H 2NN6G 4PDBA 4NXMH 4JVHA 3NCVA 4AM3A 4JV5H 4DV0H 5LL6b 1NXUA 4LF6H 2OPUA 2F4VH 3OSSD 4DV3H 4DR3H 2M6QA 4LFCH 2PQUA 2CWFA 4NZTM 4B8TA 3AEVB 2CPQA 2AXYA 2CTEA 4IFDG 1V8CA 2UXBH 1ZTGA 2JVZA 4DR1H 5JEAG 1ZZJA 4JI0H 1S20A 4NXNH 4EC5A 2X06A 2CTLA 2D9IA 1WTJA 4LF8H 1TUAA 2UXDH 2ANNA 4DR4H 1WHRA 4B3MH 2YQRA 4JI4H 4X66H 4DV5H 1ODHA 1FKAH 4DR2H 4JI7H 2Y3MA 4WALA 4WANA 3GABA 4JI8H 1DTJA 5FLXW 1I94H 4DV4H 2UUBH 3OETA 1X9ZA 1XNRH 2CTJA 4KHPH 1MSZA 2UUAH 1UG8A 4JI6H 1XMQH 4OD6A 4B8CD 1J4WA 4H8AA 2JEBI 4NZRM 3OTOH 2CTMA 2K1HA 1S03G 2A1SA 1EC6A 4X65H 5LMUH 1Z2IA 2ANRA 1VIGA 4OO1G 2JZXA 2UUCH 5C0XG 4OX9H 3I0PA 2CPMA 1XMOH 2LTMA
chains in the Genus database with same CATH topology
1UG8A 2LRRA 2CPMA 3GKUA 2A1SA 1MSZA 1WHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UG8 A;  2LRR A;  2CPM A;  3GKU A;  2A1S A;  1MSZ A;  1WHR A; 
#chains in the Genus database with same CATH topology
 2JA9 A;  2FPH X;  3U1K A;  4GKK H;  1WE8 A;  4DV2 H;  1HR0 H;  1J5K A;  3J80 W;  3EZJ A;  2CTK A;  2ZM6 H;  2HHH H;  2O4C A;  3J7A K;  1N36 H;  3JAM W;  4AQY H;  4JVY A;  1SEI A;  4JI5 H;  4DV6 H;  2VQF H;  4B3T H;  1N34 H;  1DT4 A;  4LFA H;  1V9N A;  1X4N A;  3FAU A;  4LIJ A;  1J5E H;  5LMN H;  3QD7 X;  1WVN A;  2CTF A;  4YY3 H;  2VKC A;  2FMR A;  1VBI A;  1K1G A;  1HNZ H;  3J81 W;  5DT9 A;  2CWH A;  1PQX A;  4X64 H;  5A2Q W;  3L7Z C;  1IBK H;  4JYA H;  4DV1 H;  4JI1 H;  4DUY H;  3VKE A;  1KHM A;  3RF2 A;  2QND A;  2JEA I;  2HH3 A;  2BA0 A;  5IWA H;  4DR6 H;  3V69 A;  4K0K H;  2P2R A;  4BA1 I;  4JI2 H;  2UU9 H;  1AN7 A;  2DGR A;  4GKJ H;  5BR8 H;  2LTL A;  3T1Y H;  4B3S H;  2M8W A;  2PY9 A;  2JE6 I;  1I6U A;  1N32 H;  2UXC H;  2E5L H;  4X62 H;  1VIH A;  1HNX H;  3GKU A;  4FJS A;  4LF4 H;  4G08 A;  1XNQ H;  3UOE A;  2PT7 G;  1N33 H;  3SB1 A;  2FFM A;  2LRR A;  5IT9 W;  2OPV A;  2HH2 A;  4NBQ A;  4DR5 H;  1ZZI A;  5K36 G;  2ZQE A;  2E3U A;  3GR5 A;  4E9J A;  1F0X A;  4QMF B;  2VQE H;  4AIM A;  4DR7 H;  2MJH A;  4JI3 H;  2Z0S A;  3KDK A;  4DUZ H;  4DV7 H;  3T1H H;  4YHH H;  1IBL H;  2G8Y A;  1HNW H;  4FJU A;  1X0A A;  3KDG A;  2BL5 A;  1IBM H;  4LF5 H;  1XRH A;  4BA2 I;  2LF0 A;  4LFB H;  4B3R H;  1FJG H;  1ZZK A;  4OCH A;  4LF9 H;  1X4M A;  4LF7 H;  2NN6 G;  4PDB A;  4NXM H;  4JVH A;  3NCV A;  4AM3 A;  4JV5 H;  4DV0 H;  5LL6 b;  1NXU A;  4LF6 H;  2OPU A;  2F4V H;  3OSS D;  4DV3 H;  4DR3 H;  2M6Q A;  4LFC H;  2PQU A;  2CWF A;  4NZT M;  4B8T A;  3AEV B;  2CPQ A;  2AXY A;  2CTE A;  4IFD G;  1V8C A;  2UXB H;  1ZTG A;  2JVZ A;  4DR1 H;  5JEA G;  1ZZJ A;  4JI0 H;  1S20 A;  4NXN H;  4EC5 A;  2X06 A;  2CTL A;  2D9I A;  1WTJ A;  4LF8 H;  1TUA A;  2UXD H;  2ANN A;  4DR4 H;  1WHR A;  4B3M H;  2YQR A;  4JI4 H;  4X66 H;  4DV5 H;  1ODH A;  1FKA H;  4DR2 H;  4JI7 H;  2Y3M A;  4WAL A;  4WAN A;  3GAB A;  4JI8 H;  1DTJ A;  5FLX W;  1I94 H;  4DV4 H;  2UUB H;  3OET A;  1X9Z A;  1XNR H;  2CTJ A;  4KHP H;  1MSZ A;  2UUA H;  1UG8 A;  4JI6 H;  1XMQ H;  4OD6 A;  4B8C D;  1J4W A;  4H8A A;  2JEB I;  4NZR M;  3OTO H;  2CTM A;  2K1H A;  1S03 G;  2A1S A;  1EC6 A;  4X65 H;  5LMU H;  1Z2I A;  2ANR A;  1VIG A;  4OO1 G;  2JZX A;  2UUC H;  5C0X G;  4OX9 H;  3I0P A;  2CPM A;  1XMO H;  2LTM A; 
#chains in the Genus database with same CATH homology
 1UG8 A;  2LRR A;  2CPM A;  3GKU A;  2A1S A;  1MSZ A;  1WHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...