1UG8A

Nmr structure of the r3h domain from poly(a)-specific ribonuclease
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
87
structure length
87
Chain Sequence
GSSGSSGDQKKFIDQVIEKIEDFLQSEEKRSLELDPCTGFQRKLIYQTLSWKYPKGIHVETLETDKKERHIVISKVDEEERSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A)-specific Ribonuclease
publication title NMR structure of the R3H domain from Poly(A)-specific Ribonuclease
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 16
structure length 87
sequence length 87
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 1ug8A00
1MSZA 1UG8A 2A1SA 3GKUA 1WHRA 2LRRA 2CPMA
chains in the Genus database with same CATH superfamily
3FAUA 4OO1G 1ZZJA 1UG8A 1TUAA 3OTOH 4LF4H 2PY9A 1XMQH 5IWAH 4X66H 2O4CA 4OX9H 2JVZA 4LF6H 2VQEH 1FKAH 1ZZKA 4WANA 2Z0SA 4LF8H 4IFDG 1WVNA 2CTEA 4DR5H 2JEBI 4B3RH 3I0PA 4X64H 4JI0H 5K36G 3J80W 4EC5A 4JI7H 2UUAH 1J4WA 3AEVB 4YHHH 3GR5A 3RF2A 1V8CA 2CPMA 2Y3MA 4LIJA 2UUBH 4LFAH 2BL5A 2PT7G 4OCHA 1ODHA 4DV3H 2CTFA 3T1YH 5DT9A 2CWFA 1AN7A 5LMUH 3OSSD 4FJSA 1N34H 2ANRA 2NN6G 1XNRH 4QMFB 3UOEA 3EZJA 4OD6A 2G8YA 4LF5H 1X4NA 3GKUA 4X62H 5FLXW 2UUCH 4JV5H 4E9JA 4DV0H 4DR3H 2E5LH 2HHHH 2UXBH 2MJHA 2BA0A 2AXYA 2LTLA 2YQRA 4DV4H 2OPUA 4NZTM 1J5KA 2P2RA 4JI5H 4BA2I 2FPHX 4PDBA 3OETA 1DTJA 1X4MA 1HNWH 3T1HH 1HNZH 4DV6H 4WALA 1J5EH 3J81W 2FFMA 4NXMH 4X65H 4JVHA 3JAMW 3KDKA 4FJUA 1MSZA 4DR4H 4AIMA 2JE6I 3NCVA 3U1KA 4LFBH 2CTLA 2D9IA 1I94H 5IT9W 4GKJH 4BA1I 4DV7H 4LF9H 4LF7H 4JI1H 4JYAH 1XMOH 1N36H 2CPQA 4G08A 4JVYA 4NXNH 2CTJA 2K1HA 5BR8H 1N32H 2M6QA 2M8WA 4DV2H 4DV1H 4GKKH 2PQUA 2A1SA 1ZTGA 4B3SH 1DT4A 5JEAG 2HH2A 4DR7H 5LMNH 1IBKH 3GABA 4JI8H 4KHPH 1N33H 1X9ZA 1XNQH 2OPVA 1WHRA 3QD7X 1VIHA 2JZXA 4B8CD 5C0XG 2FMRA 1ZZIA 3VKEA 1WE8A 4AQYH 2ZM6H 2CTKA 1IBLH 4B8TA 4JI3H 1S20A 5LL6b 5A2QW 4DUYH 1HNXH 4JI2H 1PQXA 1X0AA 2E3UA 1IBMH 4B3MH 4AM3A 3KDGA 2UXCH 2F4VH 3L7ZC 4NZRM 2UU9H 1F0XA 1EC6A 2CWHA 2X06A 1XRHA 1HR0H 2CTMA 1S03G 2LTMA 1NXUA 1K1GA 2DGRA 4NBQA 1KHMA 2ZQEA 2QNDA 2LF0A 4LFCH 4DV5H 2JEAI 2VKCA 4JI4H 2ANNA 1SEIA 2VQFH 2JA9A 3SB1A 1V9NA 1FJGH 1VBIA 2HH3A 4DUZH 4YY3H 2UXDH 3V69A 3J7AK 1WTJA 4H8AA 4B3TH 1VIGA 1Z2IA 4DR2H 4JI6H 2LRRA 4DR1H 4DR6H 4K0KH 1I6UA
chains in the Genus database with same CATH topology
1MSZA 1UG8A 2A1SA 3GKUA 1WHRA 2LRRA 2CPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSZ A;  1UG8 A;  2A1S A;  3GKU A;  1WHR A;  2LRR A;  2CPM A; 
#chains in the Genus database with same CATH topology
 3FAU A;  4OO1 G;  1ZZJ A;  1UG8 A;  1TUA A;  3OTO H;  4LF4 H;  2PY9 A;  1XMQ H;  5IWA H;  4X66 H;  2O4C A;  4OX9 H;  2JVZ A;  4LF6 H;  2VQE H;  1FKA H;  1ZZK A;  4WAN A;  2Z0S A;  4LF8 H;  4IFD G;  1WVN A;  2CTE A;  4DR5 H;  2JEB I;  4B3R H;  3I0P A;  4X64 H;  4JI0 H;  5K36 G;  3J80 W;  4EC5 A;  4JI7 H;  2UUA H;  1J4W A;  3AEV B;  4YHH H;  3GR5 A;  3RF2 A;  1V8C A;  2CPM A;  2Y3M A;  4LIJ A;  2UUB H;  4LFA H;  2BL5 A;  2PT7 G;  4OCH A;  1ODH A;  4DV3 H;  2CTF A;  3T1Y H;  5DT9 A;  2CWF A;  1AN7 A;  5LMU H;  3OSS D;  4FJS A;  1N34 H;  2ANR A;  2NN6 G;  1XNR H;  4QMF B;  3UOE A;  3EZJ A;  4OD6 A;  2G8Y A;  4LF5 H;  1X4N A;  3GKU A;  4X62 H;  5FLX W;  2UUC H;  4JV5 H;  4E9J A;  4DV0 H;  4DR3 H;  2E5L H;  2HHH H;  2UXB H;  2MJH A;  2BA0 A;  2AXY A;  2LTL A;  2YQR A;  4DV4 H;  2OPU A;  4NZT M;  1J5K A;  2P2R A;  4JI5 H;  4BA2 I;  2FPH X;  4PDB A;  3OET A;  1DTJ A;  1X4M A;  1HNW H;  3T1H H;  1HNZ H;  4DV6 H;  4WAL A;  1J5E H;  3J81 W;  2FFM A;  4NXM H;  4X65 H;  4JVH A;  3JAM W;  3KDK A;  4FJU A;  1MSZ A;  4DR4 H;  4AIM A;  2JE6 I;  3NCV A;  3U1K A;  4LFB H;  2CTL A;  2D9I A;  1I94 H;  5IT9 W;  4GKJ H;  4BA1 I;  4DV7 H;  4LF9 H;  4LF7 H;  4JI1 H;  4JYA H;  1XMO H;  1N36 H;  2CPQ A;  4G08 A;  4JVY A;  4NXN H;  2CTJ A;  2K1H A;  5BR8 H;  1N32 H;  2M6Q A;  2M8W A;  4DV2 H;  4DV1 H;  4GKK H;  2PQU A;  2A1S A;  1ZTG A;  4B3S H;  1DT4 A;  5JEA G;  2HH2 A;  4DR7 H;  5LMN H;  1IBK H;  3GAB A;  4JI8 H;  4KHP H;  1N33 H;  1X9Z A;  1XNQ H;  2OPV A;  1WHR A;  3QD7 X;  1VIH A;  2JZX A;  4B8C D;  5C0X G;  2FMR A;  1ZZI A;  3VKE A;  1WE8 A;  4AQY H;  2ZM6 H;  2CTK A;  1IBL H;  4B8T A;  4JI3 H;  1S20 A;  5LL6 b;  5A2Q W;  4DUY H;  1HNX H;  4JI2 H;  1PQX A;  1X0A A;  2E3U A;  1IBM H;  4B3M H;  4AM3 A;  3KDG A;  2UXC H;  2F4V H;  3L7Z C;  4NZR M;  2UU9 H;  1F0X A;  1EC6 A;  2CWH A;  2X06 A;  1XRH A;  1HR0 H;  2CTM A;  1S03 G;  2LTM A;  1NXU A;  1K1G A;  2DGR A;  4NBQ A;  1KHM A;  2ZQE A;  2QND A;  2LF0 A;  4LFC H;  4DV5 H;  2JEA I;  2VKC A;  4JI4 H;  2ANN A;  1SEI A;  2VQF H;  2JA9 A;  3SB1 A;  1V9N A;  1FJG H;  1VBI A;  2HH3 A;  4DUZ H;  4YY3 H;  2UXD H;  3V69 A;  3J7A K;  1WTJ A;  4H8A A;  4B3T H;  1VIG A;  1Z2I A;  4DR2 H;  4JI6 H;  2LRR A;  4DR1 H;  4DR6 H;  4K0K H;  1I6U A; 
#chains in the Genus database with same CATH homology
 1MSZ A;  1UG8 A;  2A1S A;  3GKU A;  1WHR A;  2LRR A;  2CPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...