1UG8A

Nmr structure of the r3h domain from poly(a)-specific ribonuclease
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
87
structure length
87
Chain Sequence
GSSGSSGDQKKFIDQVIEKIEDFLQSEEKRSLELDPCTGFQRKLIYQTLSWKYPKGIHVETLETDKKERHIVISKVDEEERSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A)-specific Ribonuclease
publication title NMR structure of the R3H domain from Poly(A)-specific Ribonuclease
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 16
structure length 87
sequence length 87
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01424 R3H R3H domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.50 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 R3H-like domain 1ug8A00
1WHRA 3GKUA 1MSZA 2A1SA 1UG8A 2LRRA 2CPMA
chains in the Genus database with same CATH superfamily
4LF8H 2CTEA 1HR0H 2UUBH 1HNWH 2JA9A 1X0AA 2Z0SA 3T1YH 1XNQH 4LF6H 4LFBH 4LF4H 2FFMA 1WVNA 1ZZKA 3GKUA 3GR5A 2X06A 4NZTM 5JEAG 4DR5H 2CTJA 2BA0A 2NN6G 2HH2A 3J7AK 5DT9A 4NXMH 2F4VH 2UU9H 2G8YA 3SB1A 4JV5H 4OD6A 1F0XA 2K1HA 1VIHA 1FJGH 2HHHH 3FAUA 4DV2H 4GKKH 4DV1H 2HH3A 2VKCA 1J5EH 1MSZA 4DR3H 1UG8A 2O4CA 1ZZJA 2CWHA 2FPHX 2CWFA 1DT4A 4DV7H 3L7ZC 2JVZA 4GKJH 2FMRA 3I0PA 2ZM6H 2M6QA 3KDGA 5C0XG 1WTJA 3OETA 2JE6I 4LFCH 2CTLA 2OPUA 2CTMA 2BL5A 2JEBI 2ZQEA 4DV4H 2A1SA 2PT7G 2LTLA 3KDKA 4B3SH 1DTJA 3J80W 4AM3A 4PDBA 1WHRA 4YHHH 5LL6b 1N32H 2CPQA 4DR1H 4B3RH 2PQUA 4KHPH 3RF2A 4B3MH 2CTKA 5FLXW 1N36H 4JI0H 1IBMH 3AEVB 4JYAH 3EZJA 1SEIA 1ZTGA 4JI8H 5IT9W 4FJUA 2ANNA 5LMUH 4IFDG 4E9JA 3VKEA 3JAMW 2UXBH 1XNRH 2VQFH 2UUAH 2LRRA 4JI1H 4B8TA 2CPMA 1IBLH 1PQXA 4JI4H 4LF9H 1IBKH 4DR2H 1XMOH 4NXNH 3NCVA 1X4NA 2M8WA 4FJSA 4WANA 1NXUA 1J4WA 4X66H 3U1KA 1XMQH 2PY9A 1X9ZA 1N33H 2JZXA 2OPVA 3UOEA 4DV6H 3GABA 1VBIA 1KHMA 2DGRA 1TUAA 2AXYA 1S03G 2YQRA 4NZRM 4G08A 4K0KH 2P2RA 2VQEH 2UUCH 4LF7H 3OSSD 4EC5A 4LF5H 3OTOH 4DUYH 4LFAH 4JVHA 4DV3H 1ZZIA 2E3UA 1I94H 1AN7A 4JI5H 4AIMA 4DUZH 1ODHA 4JI6H 3J81W 2LF0A 3T1HH 1N34H 2JEAI 1EC6A 5LMNH 2CTFA 1HNXH 3QD7X 4NBQA 2MJHA 4BA1I 5A2QW 1XRHA 4JI7H 4H8AA 4WALA 4X64H 4OX9H 4DR4H 2UXCH 5IWAH 1Z2IA 4OCHA 1HNZH 4X65H 2QNDA 2E5LH 4YY3H 1V8CA 4JVYA 2Y3MA 4BA2I 4DR6H 5BR8H 4DV5H 1VIGA 1J5KA 1FKAH 1V9NA 2LTMA 4B8CD 1WE8A 1I6UA 1X4MA 4DV0H 4QMFB 4LIJA 1K1GA 4JI2H 2UXDH 1S20A 4B3TH 4DR7H 4X62H 2D9IA 2ANRA 5K36G 3V69A 4AQYH 4JI3H 4OO1G
chains in the Genus database with same CATH topology
1WHRA 3GKUA 1MSZA 2A1SA 1UG8A 2LRRA 2CPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHR A;  3GKU A;  1MSZ A;  2A1S A;  1UG8 A;  2LRR A;  2CPM A; 
#chains in the Genus database with same CATH topology
 4LF8 H;  2CTE A;  1HR0 H;  2UUB H;  1HNW H;  2JA9 A;  1X0A A;  2Z0S A;  3T1Y H;  1XNQ H;  4LF6 H;  4LFB H;  4LF4 H;  2FFM A;  1WVN A;  1ZZK A;  3GKU A;  3GR5 A;  2X06 A;  4NZT M;  5JEA G;  4DR5 H;  2CTJ A;  2BA0 A;  2NN6 G;  2HH2 A;  3J7A K;  5DT9 A;  4NXM H;  2F4V H;  2UU9 H;  2G8Y A;  3SB1 A;  4JV5 H;  4OD6 A;  1F0X A;  2K1H A;  1VIH A;  1FJG H;  2HHH H;  3FAU A;  4DV2 H;  4GKK H;  4DV1 H;  2HH3 A;  2VKC A;  1J5E H;  1MSZ A;  4DR3 H;  1UG8 A;  2O4C A;  1ZZJ A;  2CWH A;  2FPH X;  2CWF A;  1DT4 A;  4DV7 H;  3L7Z C;  2JVZ A;  4GKJ H;  2FMR A;  3I0P A;  2ZM6 H;  2M6Q A;  3KDG A;  5C0X G;  1WTJ A;  3OET A;  2JE6 I;  4LFC H;  2CTL A;  2OPU A;  2CTM A;  2BL5 A;  2JEB I;  2ZQE A;  4DV4 H;  2A1S A;  2PT7 G;  2LTL A;  3KDK A;  4B3S H;  1DTJ A;  3J80 W;  4AM3 A;  4PDB A;  1WHR A;  4YHH H;  5LL6 b;  1N32 H;  2CPQ A;  4DR1 H;  4B3R H;  2PQU A;  4KHP H;  3RF2 A;  4B3M H;  2CTK A;  5FLX W;  1N36 H;  4JI0 H;  1IBM H;  3AEV B;  4JYA H;  3EZJ A;  1SEI A;  1ZTG A;  4JI8 H;  5IT9 W;  4FJU A;  2ANN A;  5LMU H;  4IFD G;  4E9J A;  3VKE A;  3JAM W;  2UXB H;  1XNR H;  2VQF H;  2UUA H;  2LRR A;  4JI1 H;  4B8T A;  2CPM A;  1IBL H;  1PQX A;  4JI4 H;  4LF9 H;  1IBK H;  4DR2 H;  1XMO H;  4NXN H;  3NCV A;  1X4N A;  2M8W A;  4FJS A;  4WAN A;  1NXU A;  1J4W A;  4X66 H;  3U1K A;  1XMQ H;  2PY9 A;  1X9Z A;  1N33 H;  2JZX A;  2OPV A;  3UOE A;  4DV6 H;  3GAB A;  1VBI A;  1KHM A;  2DGR A;  1TUA A;  2AXY A;  1S03 G;  2YQR A;  4NZR M;  4G08 A;  4K0K H;  2P2R A;  2VQE H;  2UUC H;  4LF7 H;  3OSS D;  4EC5 A;  4LF5 H;  3OTO H;  4DUY H;  4LFA H;  4JVH A;  4DV3 H;  1ZZI A;  2E3U A;  1I94 H;  1AN7 A;  4JI5 H;  4AIM A;  4DUZ H;  1ODH A;  4JI6 H;  3J81 W;  2LF0 A;  3T1H H;  1N34 H;  2JEA I;  1EC6 A;  5LMN H;  2CTF A;  1HNX H;  3QD7 X;  4NBQ A;  2MJH A;  4BA1 I;  5A2Q W;  1XRH A;  4JI7 H;  4H8A A;  4WAL A;  4X64 H;  4OX9 H;  4DR4 H;  2UXC H;  5IWA H;  1Z2I A;  4OCH A;  1HNZ H;  4X65 H;  2QND A;  2E5L H;  4YY3 H;  1V8C A;  4JVY A;  2Y3M A;  4BA2 I;  4DR6 H;  5BR8 H;  4DV5 H;  1VIG A;  1J5K A;  1FKA H;  1V9N A;  2LTM A;  4B8C D;  1WE8 A;  1I6U A;  1X4M A;  4DV0 H;  4QMF B;  4LIJ A;  1K1G A;  4JI2 H;  2UXD H;  1S20 A;  4B3T H;  4DR7 H;  4X62 H;  2D9I A;  2ANR A;  5K36 G;  3V69 A;  4AQY H;  4JI3 H;  4OO1 G; 
#chains in the Genus database with same CATH homology
 1WHR A;  3GKU A;  1MSZ A;  2A1S A;  1UG8 A;  2LRR A;  2CPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...