1UGHI

Crystal structure of human uracil-dna glycosylase in complex with a protein inhibitor: protein mimicry of dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
b'NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (URACIL-DNA GLYCOSYLASE)
publication title Crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor: protein mimicry of DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Glycosylase
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 1999-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1ughI00
1UGHI 1LQMB 1UDII 1UUGB 2J8XB 1EUIC 2UGIA 1UGIA 2ZHXB 2UUGC 4LYLB 1LQGC
chains in the Genus database with same CATH superfamily
1VQ73 1TTOA 4N6TA 2RGQA 5EQLA 1RRHA 3BNCA 1CYVA 1PFPA 3PGBA 3DGNA 1QAFA 1KWIA 2CFGA 1Q814 2XGLA 4R1KA 3CU3A 2W2CA 1BGSA 1RGAA 4H3UA 5M19A 1O7GB 4LEHA 1C7HA 5BU4A 1JZDA 3X3XA 2CWVA 2LYXA 1B2SA 5DREA 2Z6BA 3NX0A 1GY6A 4FCMA 1FUSA 1YJN3 1BUQA 2IMJA 1GMRA 2L1SA 3CCR3 2BU4A 2C11A 1IVXA 1M9GA 1JB2A 2KF3A 1Q42A 5CK6A 2RBIA 1A2PA 3K63A 4ZM8A 3OW22 3GAXA 3DGYA 3D5IA 4J8TA 3STDA 1UDII 3DUKA 3DGLA 1OPYA 1JKGA 3U97A 1IK3A 5D81A 6RNTA 2CG1A 3MSOA 3F8HA 4O2HA 1IV7A 1IT7A 5AIHA 5AEWB 1RCKA 3KN4A 5G1KA 2W0QA 1BVIA 3EQQB 1FZUA 2CIUA 2XEPA 3A5EA 1CQSA 1AQZA 5IG3A 2HMLB 3LTBA 2YX9A 2FNQA 2K0MA 1CYUA 1GOUA 1I2FA 3FZWA 3DH2A 2QIYA 1RTUA 2C10A 3CCV3 1VZZA 2WGOA 3K5TA 3BU4A 1HYFA 3WMDA 1O7WB 1SPUA 3D4AA 5AEUB 4RNYA 1W2B2 2J8XB 4AKYA 4EBGA 1FYSA 4H61A 4GHOA 1RN7A 3CC23 3T0UA 1Q40B 5EVHA 1WMPA 2P38A 2B1XB 1ROAA 3D3LA 1IV9A 1DMQA 1SJWA 1SIHA 1BANA 1U8CB 2F99A 1UI7A 3B8LA 1B2ZA 3AMOA 2Y73A 3MG1A 1QJGA 3KCHA 5IG5A 1VQ43 1OCVA 1T2IA 4O8SA 3J7Yd 1GS3A 2WO0A 2SBLA 1NO3A 4N3VA 1IVUA 3RGRA 3S5CA 1JB5A 2GU1A 1G96A 1B2UA 1UI8A 2BIRA 2XFSA 2B24B 2KRTA 3KSPA 1V58A 3T8NA 3G713 1GYBA 3Q3FA 1YJ93 3PCRA 1LOWA 2FGTA 2K54A 4LMIA 4NHFA 3F7SA 2H0HA 5IG4A 1VQN3 2F4YA 1TUHA 3FLJA 3ZG0A 2F86B 3F7XA 2XSHB 3WA3A 1PU4A 2CC3A 5HOHA 1BNGA 1RGKA 3LZAA 1M1XB 2IUKA 1BIRA 1ZO2A 3EC9A 1HU9A 1Q864 1K9M4 4HKVB 1YVBI 2ZHXB 5CF1A 1US1A 1VQQA 3N54B 1X1WA 2HMMB 2CX0A 3EX9A 3B7CA 1B27A 1NB3I 3DMCA 3WODG 3NV0A 1VQO3 3MG2A 8CHOA 1SQWA 1I2EA 1OUNA 1S5AA 5M1AA 3T8UA 2CFDA 3ZFZA 1V57A 1UGIA 1I2GA 5AIIA 2GXFA 1MWUA 2ZDJA 7STDA 3I553 2RNTA 3CPOA 1JBTA 3DM8A 1FW7A 1WNHA 3N8BA 7GSPA 4XDWA 1W6GA 3SYUA 1I8VA 3FG3A 2AAEA 2OOVA 2RSXA 4EC6A 4HM7B 4XBXA 3NBRA 9RNTA 1Q824 3CCM3 3SXXA 5AIGA 3WDGB 5JPUA 3CMA3 3EE1A 4N6NB 5KP4A 1FUTA 2P05A 5A0OB 4R4KA 1YIJ3 1LNHA 1JNQA 2KF6A 3URPA 1RHLA 1RNBA 2W56A 4EV5A 3ECFA 2F5MA 3X3ZA 3NHXA 1O7NB 4KFFA 5G2GA 5BIRA 1JBSA 2V1LA 4CPKA 2E2TA 4FR9A 3RDEA 3DY5A 1BNIA 4IT7A 2UUGC 2IUJA 4HOHA 2O3OA 2PNCA 2CW9A 1BNRA 1K41A 1Z1SA 3SVAA 1TFKA 1LOYA 3DXOA 3ER7A 3PCSA 4ORLA 1MWTA 1VQK3 1NJI4 1BRJA 4EW5A 2GBXB 3CNXA 4EV2A 1YHQ3 4OUQA 1DMMA 1BSEA 3LH4A 3WR2A 3PS8A 3X41A 5AYRB 3FGYA 1G0TA 2HMJB 2P0XA 2E2UA 1X1XA 4U13A 2HMOB 2JDIH 1BSBA 2WOHA 2CH9A 3WHOA 1BUJA 3BLZA 1LRAA 1Q7HA 3B4OA 3WOFB 3CXC2 3JUNA 4EYCA 2BNGA 4N6UA 1RCLA 4I5QA 4HM0B 4HBRA 1B2XA 3HX8A 3OWSA 1TRQA 1J2BA 1OF5A 5LC6A 1A2KA 1YVSA 1I3IA 4PEJA 1TU5A 1GMPA 3EB8A 4HJLB 4L8PA 1ISKA 1DYUA 1W02A 3HZPA 4HM5B 1IVWA 1I3FA 3NQYA 5STDA 1YGWA 1O7HB 1N8QA 5D82A 3S67A 5JPPA 2W6JH 3WA2X 2CFWA 2KF4A 3VF1A 1WQLB 3JUQA 5G1LA 3X40A 3MYTA 1BSCA 1EG9B 2HOHA 2RFRA 3PZWA 1LQMB 4XB5A 1AR0A 2XF3A 4FCJA 5IEOA 3S29A 3SEDA 1NDOB 1RJOA 5IERA 1VQ93 1U5OA 5CF2A 3DGOA 3GRDA 4L7KA 3GZRA 1VQ83 1STFI 2W9QA 3MPHA 1X1YA 1F8NA 1MNLA 3N9HA 3NV0B 4R9KA 4WYKB 1YNVX 1NB5I 4BIRA 3SX1A 1N9JA 4FCZA 2GU3A 2O9UX 1A2VA 3GZXB 3CCL3 1GOYA 4N6MA 3KFQC 1V74A 3F8XA 2KAAA 1BSAA 1JBRA 3I0YA 1ULJB 1CEWI 1OACA 1TJDA 3OV4A 1GY7A 1S723 4AEQA 3FG4A 1R4CA 1ROVA 3IMAB 3CC43 4KT3B 3UNLA 2W04A 3M8CA 1R4YA 3JUOA 4CCVA 4BTWA 4NPBA 1BAOA 1LNIA 1W4NA 3TDGA 1I0XA 1Y4KA 1IQXA 1FUWA 2R4IA 4HAAA 1OGXA 1KQS2 3V98A 4WP5A 3G8ZA 4N6OB 1VQL3 4N6LA 1RMSA 4Q53A 1GD4A 2OQEC 4HVNA 1M904 4HM4B 1JB4A 3I563 1IU7A 1AY7A 1ZX2A 4JRFA 2YFIB 1WMOA 5DRVA 1GY5A 3G16A 4OK0A 3OXAA 3L0RA 3VSYA 1BU4A 5BXQA 5RNTA 2OTJ3 1O7MB 2IYJA 1M1K4 1IDPA 4RNTA 3CCS3 3GSPA 1YIT3 3SOYA 4K90B 1FA3A 3AGNA 2CKFB 3O8YA 3CME3 4HZBB 2F5WA 2KF5A 1IVVA 4HM1B 4GSPA 1N9EA 1JRQA 1MGWA 1W2ZA 2BO9B 2ZA4A 1YI23 1TIJA 3DZLA 1BRIA 3FF0A 4FMBA 3UL6A 1EA2A 1RGHA 2GEYA 1GMQA 2CWUA 1HKXA 2OTL3 1MWSA 1DVCA 3G6E3 3CCQ3 1RNTA 2BMRB 5IW9A 1OF5B 3VGNA 3K7CA 4I4KA 4DKIA 1RKYA 1JN5A 1W01A 1RN1A 1BRHA 2JQ5A 3GZBA 3BNEA 3EBTA 1YJW3 4BTYA 1DVDA 4HM2B 2XR8B 3U1WA 4RBNA 1RGGA 1BRGA 4XBYA 3G0KA 4X2HA 1BNJA 4FMCA 1JKGB 1HZ1A 2YFLB 1FGTA 1IT8A 1RGCA 2CK3H 4GB5A 4LYLB 1DMNA 3CCE3 1OGZA 4ILFA 1RSNA 2CX1A 3EJVA 4J9AA 3D79A 1AVLA 2KXGA 3JUPA 2W03A 1BNFA 1DETA 2XSOB 1PYLA 1UUVB 2HMKB 3LOYA 3NXJA 1KD14 1SIIA 2I9WA 1EKMA 2BHMA 2IY2A 1LVNA 2SARA 2ML5A 3FKAA 4KZ1A 4RNZA 3X3YA 1A67A 2INXA 3OWYA 4BU4A 5I97A 1IQYA 5IENA 5IEPA 3ALAA 1RLSA 2AADA 1W6CA 3JUMA 3HK4A 1OHSA 3E99A 1K734 4BTXA 7RNTA 1UGHI 1RN4A 4L8OA 1ASKA 1EUIC 3D9RA 1SARA 4XBTA 6STDA 2BMOB 1E97A 1CH0A 1W7CA 2Q07A 2R41A 3GZYB 1AVKA 1JV2B 1TFOA 3AMOB 1N5PA 1RGLA 3AHWA 5HGRA 3CCJ3 2H0GA 3KE7A 2CHCA 2STDA 3IJEB 5CXOA 5AIFA 1BRKA 1PY3A 2GEXA 4LZIA 1EQKA 1X1UA 2F98A 2IA7A 4OVMA 3LMLA 1D6ZA 1C54A 2Y74A 3CNMA 3FG1A 3BB9A 3LXUX 3H51A 3NUVA 1NNVA 1Q7Y4 3FF2A 3OX9A 3PYJA 1QMAA 3CD63 2XH9A 1RRLA 1E3RA 4BL2A 1RGFA 1W00A 1B20A 1QALA 3AHSA 4K1UA 4MJDA 1FGQA 3QK9A 1A90A 2Z7AA 3F9SA 4MMZB 3KZTA 1UCLA 1WMNA 1N8R4 3LYGA 4CDLA 1UW1A 5BVBA 2K3DA 4GL6A 1OHPA 2Z77A 5IG0A 5ELJA 1TP6A 1GSPA 2XFTA 5AYSC 3S27A 2CG0A 1W5ZA 2YFJB 1STDA 2UX0A 2ML6A 1FGRA 3MHEA 3NM7A 4LGQA 2QGUA 1K28A 3NQZA 3UB1A 3LT8A 1LOVA 2BT3A 1VQM3 2ZL8A 1UUGB 2XGNA 2MF7A 3QRDA 4R9LA 1NU3A 5FW5A 2CWTA 5EEOA 2P0MA 5IF6A 4QWTA 4MMYB 2MC8A 1LOXA 4N6V0 3SOAA 1JN5B 2OWPA 3BNDA 1KSIA 1K8A4 4HM8B 1IQ8A 1OHOA 4HZ9B 1ULIB 1T3BA 3WOEB 1T2HA 4J5GA 4KVHA 4WFOA 3V99A 5KP1A 1OH0A 3LTCA 2P09A 2OCTA 3MKIA 3EF8A 3NBJA 1JZOA 2XRXB 1UCKA 3FH1A 5CLKA 1FGMA 3NBBA 3UL5A 2OOVC 3V92A 3X42A 2L4VA 1BRSA 2W56B 4STDA 3MG3A 1BRNL 4HM6B 3EN8A 4R80A 1B2MA 2E2VA 2WOFA 2M7OA 1BSDA 4KFDA 2QEX3 3AGOA 1GOVA 1WTHA 2GSPA 2CFKA 3JVCA 3RGAA 5JBSA 5ELUA 4J5KA 3B4PA 2HMNB 4IIAA 4FMAA 1I0VA 1N5HA 1YGEA 3MWZA 4MMXB 4XM4A 3Q2PA 4EXRA 3K9MC 3DGMA 2GBWB 3K0ZA 1UCJA 4NREA 2CFLA 2BMQB 1QVF2 3KIIA 3LTAA 3H3HA 4MEIA 4WWUC 1TRPA 5KP3A 4K61A 4O3VA 5M18A 3EBYA 3FSDA 3PXMA 3S28A 4CJNA 4WHAA 3D5GA 3ZG5A 4IPBA 3CPW2 4BL3A 1O7PB 4O02B 1D6YA 3HOHA 3UJMA 1RDSA 3G4S3 2A15A 1VQP3 2KCDA 2WGQA 2QA43 1FGOA 1KC84 1QAKA 3IPTA 1D6UA 1LXEA 2PZVA 1RGEA 3Q1CA 4RZMA 5D83A 3A76A 3F40A 2FXTA 4K1VA 5AI1A 1DE3A 3Q90A 1BOXA 1I70A 1B3SA 1B21A 1EEJA 1W6YA 2W9PA 1IYYA 2LQVA 2UGIA 4AKZA 1E3VA 3EN1B 1ZS7A 1NWWA 3OWUA 1G02A 4WYKA 5FGOA 3ROBA 3HI7A 1JJ22 1MWRA 1UCIA 1AV4A 3SLUA 1BNEA 1Q40A 4HYZA 3FCSB 4LSOA 4X2OA 2C4BA 3KSED 3LTDA 3NM2A 2D1WA 5TGNA 1BNSA 1UUWB 2Z76A 4JF8A 4TX4A 1QVG2 3RNTA 1MGRA 1Q9EA 1L5GB 2H0IA 1LQGC 5GSPA 6GSPA 3HIIA 3BNBA 4FMDA 4KFEA 1VQ63 2OQEA 1T5YA 1VQ53 2RCDA 3LT9A 3CC73 2F56A 3HIGA 4G1MB 5LC7A 4XDVA 1ZGXA 3CCU3 3F14A 2D42A 3GWRA 4HM3B 3BIRA 1GD3A 1MOLA 3EHCA 3KKGA 8RNTA
chains in the Genus database with same CATH topology
1UGHI 1LQMB 1UDII 1UUGB 2J8XB 1EUIC 2UGIA 1UGIA 2ZHXB 2UUGC 4LYLB 1LQGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGH I;  1LQM B;  1UDI I;  1UUG B;  2J8X B;  1EUI C;  2UGI A;  1UGI A;  2ZHX B;  2UUG C;  4LYL B;  1LQG C; 
#chains in the Genus database with same CATH topology
 1VQ7 3;  1TTO A;  4N6T A;  2RGQ A;  5EQL A;  1RRH A;  3BNC A;  1CYV A;  1PFP A;  3PGB A;  3DGN A;  1QAF A;  1KWI A;  2CFG A;  1Q81 4;  2XGL A;  4R1K A;  3CU3 A;  2W2C A;  1BGS A;  1RGA A;  4H3U A;  5M19 A;  1O7G B;  4LEH A;  1C7H A;  5BU4 A;  1JZD A;  3X3X A;  2CWV A;  2LYX A;  1B2S A;  5DRE A;  2Z6B A;  3NX0 A;  1GY6 A;  4FCM A;  1FUS A;  1YJN 3;  1BUQ A;  2IMJ A;  1GMR A;  2L1S A;  3CCR 3;  2BU4 A;  2C11 A;  1IVX A;  1M9G A;  1JB2 A;  2KF3 A;  1Q42 A;  5CK6 A;  2RBI A;  1A2P A;  3K63 A;  4ZM8 A;  3OW2 2;  3GAX A;  3DGY A;  3D5I A;  4J8T A;  3STD A;  1UDI I;  3DUK A;  3DGL A;  1OPY A;  1JKG A;  3U97 A;  1IK3 A;  5D81 A;  6RNT A;  2CG1 A;  3MSO A;  3F8H A;  4O2H A;  1IV7 A;  1IT7 A;  5AIH A;  5AEW B;  1RCK A;  3KN4 A;  5G1K A;  2W0Q A;  1BVI A;  3EQQ B;  1FZU A;  2CIU A;  2XEP A;  3A5E A;  1CQS A;  1AQZ A;  5IG3 A;  2HML B;  3LTB A;  2YX9 A;  2FNQ A;  2K0M A;  1CYU A;  1GOU A;  1I2F A;  3FZW A;  3DH2 A;  2QIY A;  1RTU A;  2C10 A;  3CCV 3;  1VZZ A;  2WGO A;  3K5T A;  3BU4 A;  1HYF A;  3WMD A;  1O7W B;  1SPU A;  3D4A A;  5AEU B;  4RNY A;  1W2B 2;  2J8X B;  4AKY A;  4EBG A;  1FYS A;  4H61 A;  4GHO A;  1RN7 A;  3CC2 3;  3T0U A;  1Q40 B;  5EVH A;  1WMP A;  2P38 A;  2B1X B;  1ROA A;  3D3L A;  1IV9 A;  1DMQ A;  1SJW A;  1SIH A;  1BAN A;  1U8C B;  2F99 A;  1UI7 A;  3B8L A;  1B2Z A;  3AMO A;  2Y73 A;  3MG1 A;  1QJG A;  3KCH A;  5IG5 A;  1VQ4 3;  1OCV A;  1T2I A;  4O8S A;  3J7Y d;  1GS3 A;  2WO0 A;  2SBL A;  1NO3 A;  4N3V A;  1IVU A;  3RGR A;  3S5C A;  1JB5 A;  2GU1 A;  1G96 A;  1B2U A;  1UI8 A;  2BIR A;  2XFS A;  2B24 B;  2KRT A;  3KSP A;  1V58 A;  3T8N A;  3G71 3;  1GYB A;  3Q3F A;  1YJ9 3;  3PCR A;  1LOW A;  2FGT A;  2K54 A;  4LMI A;  4NHF A;  3F7S A;  2H0H A;  5IG4 A;  1VQN 3;  2F4Y A;  1TUH A;  3FLJ A;  3ZG0 A;  2F86 B;  3F7X A;  2XSH B;  3WA3 A;  1PU4 A;  2CC3 A;  5HOH A;  1BNG A;  1RGK A;  3LZA A;  1M1X B;  2IUK A;  1BIR A;  1ZO2 A;  3EC9 A;  1HU9 A;  1Q86 4;  1K9M 4;  4HKV B;  1YVB I;  2ZHX B;  5CF1 A;  1US1 A;  1VQQ A;  3N54 B;  1X1W A;  2HMM B;  2CX0 A;  3EX9 A;  3B7C A;  1B27 A;  1NB3 I;  3DMC A;  3WOD G;  3NV0 A;  1VQO 3;  3MG2 A;  8CHO A;  1SQW A;  1I2E A;  1OUN A;  1S5A A;  5M1A A;  3T8U A;  2CFD A;  3ZFZ A;  1V57 A;  1UGI A;  1I2G A;  5AII A;  2GXF A;  1MWU A;  2ZDJ A;  7STD A;  3I55 3;  2RNT A;  3CPO A;  1JBT A;  3DM8 A;  1FW7 A;  1WNH A;  3N8B A;  7GSP A;  4XDW A;  1W6G A;  3SYU A;  1I8V A;  3FG3 A;  2AAE A;  2OOV A;  2RSX A;  4EC6 A;  4HM7 B;  4XBX A;  3NBR A;  9RNT A;  1Q82 4;  3CCM 3;  3SXX A;  5AIG A;  3WDG B;  5JPU A;  3CMA 3;  3EE1 A;  4N6N B;  5KP4 A;  1FUT A;  2P05 A;  5A0O B;  4R4K A;  1YIJ 3;  1LNH A;  1JNQ A;  2KF6 A;  3URP A;  1RHL A;  1RNB A;  2W56 A;  4EV5 A;  3ECF A;  2F5M A;  3X3Z A;  3NHX A;  1O7N B;  4KFF A;  5G2G A;  5BIR A;  1JBS A;  2V1L A;  4CPK A;  2E2T A;  4FR9 A;  3RDE A;  3DY5 A;  1BNI A;  4IT7 A;  2UUG C;  2IUJ A;  4HOH A;  2O3O A;  2PNC A;  2CW9 A;  1BNR A;  1K41 A;  1Z1S A;  3SVA A;  1TFK A;  1LOY A;  3DXO A;  3ER7 A;  3PCS A;  4ORL A;  1MWT A;  1VQK 3;  1NJI 4;  1BRJ A;  4EW5 A;  2GBX B;  3CNX A;  4EV2 A;  1YHQ 3;  4OUQ A;  1DMM A;  1BSE A;  3LH4 A;  3WR2 A;  3PS8 A;  3X41 A;  5AYR B;  3FGY A;  1G0T A;  2HMJ B;  2P0X A;  2E2U A;  1X1X A;  4U13 A;  2HMO B;  2JDI H;  1BSB A;  2WOH A;  2CH9 A;  3WHO A;  1BUJ A;  3BLZ A;  1LRA A;  1Q7H A;  3B4O A;  3WOF B;  3CXC 2;  3JUN A;  4EYC A;  2BNG A;  4N6U A;  1RCL A;  4I5Q A;  4HM0 B;  4HBR A;  1B2X A;  3HX8 A;  3OWS A;  1TRQ A;  1J2B A;  1OF5 A;  5LC6 A;  1A2K A;  1YVS A;  1I3I A;  4PEJ A;  1TU5 A;  1GMP A;  3EB8 A;  4HJL B;  4L8P A;  1ISK A;  1DYU A;  1W02 A;  3HZP A;  4HM5 B;  1IVW A;  1I3F A;  3NQY A;  5STD A;  1YGW A;  1O7H B;  1N8Q A;  5D82 A;  3S67 A;  5JPP A;  2W6J H;  3WA2 X;  2CFW A;  2KF4 A;  3VF1 A;  1WQL B;  3JUQ A;  5G1L A;  3X40 A;  3MYT A;  1BSC A;  1EG9 B;  2HOH A;  2RFR A;  3PZW A;  1LQM B;  4XB5 A;  1AR0 A;  2XF3 A;  4FCJ A;  5IEO A;  3S29 A;  3SED A;  1NDO B;  1RJO A;  5IER A;  1VQ9 3;  1U5O A;  5CF2 A;  3DGO A;  3GRD A;  4L7K A;  3GZR A;  1VQ8 3;  1STF I;  2W9Q A;  3MPH A;  1X1Y A;  1F8N A;  1MNL A;  3N9H A;  3NV0 B;  4R9K A;  4WYK B;  1YNV X;  1NB5 I;  4BIR A;  3SX1 A;  1N9J A;  4FCZ A;  2GU3 A;  2O9U X;  1A2V A;  3GZX B;  3CCL 3;  1GOY A;  4N6M A;  3KFQ C;  1V74 A;  3F8X A;  2KAA A;  1BSA A;  1JBR A;  3I0Y A;  1ULJ B;  1CEW I;  1OAC A;  1TJD A;  3OV4 A;  1GY7 A;  1S72 3;  4AEQ A;  3FG4 A;  1R4C A;  1ROV A;  3IMA B;  3CC4 3;  4KT3 B;  3UNL A;  2W04 A;  3M8C A;  1R4Y A;  3JUO A;  4CCV A;  4BTW A;  4NPB A;  1BAO A;  1LNI A;  1W4N A;  3TDG A;  1I0X A;  1Y4K A;  1IQX A;  1FUW A;  2R4I A;  4HAA A;  1OGX A;  1KQS 2;  3V98 A;  4WP5 A;  3G8Z A;  4N6O B;  1VQL 3;  4N6L A;  1RMS A;  4Q53 A;  1GD4 A;  2OQE C;  4HVN A;  1M90 4;  4HM4 B;  1JB4 A;  3I56 3;  1IU7 A;  1AY7 A;  1ZX2 A;  4JRF A;  2YFI B;  1WMO A;  5DRV A;  1GY5 A;  3G16 A;  4OK0 A;  3OXA A;  3L0R A;  3VSY A;  1BU4 A;  5BXQ A;  5RNT A;  2OTJ 3;  1O7M B;  2IYJ A;  1M1K 4;  1IDP A;  4RNT A;  3CCS 3;  3GSP A;  1YIT 3;  3SOY A;  4K90 B;  1FA3 A;  3AGN A;  2CKF B;  3O8Y A;  3CME 3;  4HZB B;  2F5W A;  2KF5 A;  1IVV A;  4HM1 B;  4GSP A;  1N9E A;  1JRQ A;  1MGW A;  1W2Z A;  2BO9 B;  2ZA4 A;  1YI2 3;  1TIJ A;  3DZL A;  1BRI A;  3FF0 A;  4FMB A;  3UL6 A;  1EA2 A;  1RGH A;  2GEY A;  1GMQ A;  2CWU A;  1HKX A;  2OTL 3;  1MWS A;  1DVC A;  3G6E 3;  3CCQ 3;  1RNT A;  2BMR B;  5IW9 A;  1OF5 B;  3VGN A;  3K7C A;  4I4K A;  4DKI A;  1RKY A;  1JN5 A;  1W01 A;  1RN1 A;  1BRH A;  2JQ5 A;  3GZB A;  3BNE A;  3EBT A;  1YJW 3;  4BTY A;  1DVD A;  4HM2 B;  2XR8 B;  3U1W A;  4RBN A;  1RGG A;  1BRG A;  4XBY A;  3G0K A;  4X2H A;  1BNJ A;  4FMC A;  1JKG B;  1HZ1 A;  2YFL B;  1FGT A;  1IT8 A;  1RGC A;  2CK3 H;  4GB5 A;  4LYL B;  1DMN A;  3CCE 3;  1OGZ A;  4ILF A;  1RSN A;  2CX1 A;  3EJV A;  4J9A A;  3D79 A;  1AVL A;  2KXG A;  3JUP A;  2W03 A;  1BNF A;  1DET A;  2XSO B;  1PYL A;  1UUV B;  2HMK B;  3LOY A;  3NXJ A;  1KD1 4;  1SII A;  2I9W A;  1EKM A;  2BHM A;  2IY2 A;  1LVN A;  2SAR A;  2ML5 A;  3FKA A;  4KZ1 A;  4RNZ A;  3X3Y A;  1A67 A;  2INX A;  3OWY A;  4BU4 A;  5I97 A;  1IQY A;  5IEN A;  5IEP A;  3ALA A;  1RLS A;  2AAD A;  1W6C A;  3JUM A;  3HK4 A;  1OHS A;  3E99 A;  1K73 4;  4BTX A;  7RNT A;  1UGH I;  1RN4 A;  4L8O A;  1ASK A;  1EUI C;  3D9R A;  1SAR A;  4XBT A;  6STD A;  2BMO B;  1E97 A;  1CH0 A;  1W7C A;  2Q07 A;  2R41 A;  3GZY B;  1AVK A;  1JV2 B;  1TFO A;  3AMO B;  1N5P A;  1RGL A;  3AHW A;  5HGR A;  3CCJ 3;  2H0G A;  3KE7 A;  2CHC A;  2STD A;  3IJE B;  5CXO A;  5AIF A;  1BRK A;  1PY3 A;  2GEX A;  4LZI A;  1EQK A;  1X1U A;  2F98 A;  2IA7 A;  4OVM A;  3LML A;  1D6Z A;  1C54 A;  2Y74 A;  3CNM A;  3FG1 A;  3BB9 A;  3LXU X;  3H51 A;  3NUV A;  1NNV A;  1Q7Y 4;  3FF2 A;  3OX9 A;  3PYJ A;  1QMA A;  3CD6 3;  2XH9 A;  1RRL A;  1E3R A;  4BL2 A;  1RGF A;  1W00 A;  1B20 A;  1QAL A;  3AHS A;  4K1U A;  4MJD A;  1FGQ A;  3QK9 A;  1A90 A;  2Z7A A;  3F9S A;  4MMZ B;  3KZT A;  1UCL A;  1WMN A;  1N8R 4;  3LYG A;  4CDL A;  1UW1 A;  5BVB A;  2K3D A;  4GL6 A;  1OHP A;  2Z77 A;  5IG0 A;  5ELJ A;  1TP6 A;  1GSP A;  2XFT A;  5AYS C;  3S27 A;  2CG0 A;  1W5Z A;  2YFJ B;  1STD A;  2UX0 A;  2ML6 A;  1FGR A;  3MHE A;  3NM7 A;  4LGQ A;  2QGU A;  1K28 A;  3NQZ A;  3UB1 A;  3LT8 A;  1LOV A;  2BT3 A;  1VQM 3;  2ZL8 A;  1UUG B;  2XGN A;  2MF7 A;  3QRD A;  4R9L A;  1NU3 A;  5FW5 A;  2CWT A;  5EEO A;  2P0M A;  5IF6 A;  4QWT A;  4MMY B;  2MC8 A;  1LOX A;  4N6V 0;  3SOA A;  1JN5 B;  2OWP A;  3BND A;  1KSI A;  1K8A 4;  4HM8 B;  1IQ8 A;  1OHO A;  4HZ9 B;  1ULI B;  1T3B A;  3WOE B;  1T2H A;  4J5G A;  4KVH A;  4WFO A;  3V99 A;  5KP1 A;  1OH0 A;  3LTC A;  2P09 A;  2OCT A;  3MKI A;  3EF8 A;  3NBJ A;  1JZO A;  2XRX B;  1UCK A;  3FH1 A;  5CLK A;  1FGM A;  3NBB A;  3UL5 A;  2OOV C;  3V92 A;  3X42 A;  2L4V A;  1BRS A;  2W56 B;  4STD A;  3MG3 A;  1BRN L;  4HM6 B;  3EN8 A;  4R80 A;  1B2M A;  2E2V A;  2WOF A;  2M7O A;  1BSD A;  4KFD A;  2QEX 3;  3AGO A;  1GOV A;  1WTH A;  2GSP A;  2CFK A;  3JVC A;  3RGA A;  5JBS A;  5ELU A;  4J5K A;  3B4P A;  2HMN B;  4IIA A;  4FMA A;  1I0V A;  1N5H A;  1YGE A;  3MWZ A;  4MMX B;  4XM4 A;  3Q2P A;  4EXR A;  3K9M C;  3DGM A;  2GBW B;  3K0Z A;  1UCJ A;  4NRE A;  2CFL A;  2BMQ B;  1QVF 2;  3KII A;  3LTA A;  3H3H A;  4MEI A;  4WWU C;  1TRP A;  5KP3 A;  4K61 A;  4O3V A;  5M18 A;  3EBY A;  3FSD A;  3PXM A;  3S28 A;  4CJN A;  4WHA A;  3D5G A;  3ZG5 A;  4IPB A;  3CPW 2;  4BL3 A;  1O7P B;  4O02 B;  1D6Y A;  3HOH A;  3UJM A;  1RDS A;  3G4S 3;  2A15 A;  1VQP 3;  2KCD A;  2WGQ A;  2QA4 3;  1FGO A;  1KC8 4;  1QAK A;  3IPT A;  1D6U A;  1LXE A;  2PZV A;  1RGE A;  3Q1C A;  4RZM A;  5D83 A;  3A76 A;  3F40 A;  2FXT A;  4K1V A;  5AI1 A;  1DE3 A;  3Q90 A;  1BOX A;  1I70 A;  1B3S A;  1B21 A;  1EEJ A;  1W6Y A;  2W9P A;  1IYY A;  2LQV A;  2UGI A;  4AKZ A;  1E3V A;  3EN1 B;  1ZS7 A;  1NWW A;  3OWU A;  1G02 A;  4WYK A;  5FGO A;  3ROB A;  3HI7 A;  1JJ2 2;  1MWR A;  1UCI A;  1AV4 A;  3SLU A;  1BNE A;  1Q40 A;  4HYZ A;  3FCS B;  4LSO A;  4X2O A;  2C4B A;  3KSE D;  3LTD A;  3NM2 A;  2D1W A;  5TGN A;  1BNS A;  1UUW B;  2Z76 A;  4JF8 A;  4TX4 A;  1QVG 2;  3RNT A;  1MGR A;  1Q9E A;  1L5G B;  2H0I A;  1LQG C;  5GSP A;  6GSP A;  3HII A;  3BNB A;  4FMD A;  4KFE A;  1VQ6 3;  2OQE A;  1T5Y A;  1VQ5 3;  2RCD A;  3LT9 A;  3CC7 3;  2F56 A;  3HIG A;  4G1M B;  5LC7 A;  4XDV A;  1ZGX A;  3CCU 3;  3F14 A;  2D42 A;  3GWR A;  4HM3 B;  3BIR A;  1GD3 A;  1MOL A;  3EHC A;  3KKG A;  8RNT A; 
#chains in the Genus database with same CATH homology
 1UGH I;  1LQM B;  1UDI I;  1UUG B;  2J8X B;  1EUI C;  2UGI A;  1UGI A;  2ZHX B;  2UUG C;  4LYL B;  1LQG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...