1UGHI

Crystal structure of human uracil-dna glycosylase in complex with a protein inhibitor: protein mimicry of dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
b'NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (URACIL-DNA GLYCOSYLASE)
publication title Crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor: protein mimicry of DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Glycosylase
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 1999-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1ughI00
1UGIA 2ZHXB 1LQGC 1UDII 2J8XB 1LQMB 2UGIA 1UUGB 1UGHI 4LYLB 1EUIC 2UUGC
chains in the Genus database with same CATH superfamily
1A2VA 2PZVA 1TFOA 3D5GA 1OHOA 1OCVA 4IPBA 1OHPA 1T3BA 1NO3A 3WODG 1JN5B 2Y73A 3T8NA 1YI23 1EA2A 1RCKA 4EV2A 1DMNA 1W5ZA 1CYUA 2XSHB 2WOFA 1RCLA 2W2CA 5DREA 1PYLA 1A2KA 3LT8A 4I5QA 1AVLA 2AADA 1W7CA 2BO9B 2R4IA 3X3YA 1QAKA 3SEDA 1DE3A 2HMKB 1BU4A 3S28A 4EYCA 5IG4A 4BL2A 1GOYA 5EEOA 2XEPA 5KP3A 3X3ZA 1RGCA 3I563 1TRQA 3V92A 1F8NA 2H0HA 5I97A 1TTOA 2CFDA 2K3DA 1IVUA 1TFKA 2KF4A 4XM4A 3EE1A 5HGRA 3WR2A 1RJOA 1GOUA 3SVAA 5CF1A 2W04A 1B2SA 3EF8A 3D9RA 3VSYA 3CME3 1O7HB 1X1UA 1RGFA 1RNTA 2CG0A 2GEYA 2KF5A 1KD14 1NB5I 1BNIA 3E99A 1JB5A 1TIJA 3JUQA 3NM7A 1MWRA 4WFOA 3IMAB 4BIRA 1IK3A 1YIJ3 1BUQA 2M7OA 4GSPA 3A5EA 4O2HA 1TUHA 1W6CA 3FCSB 2CKFB 3HX8A 3KZTA 1VZZA 4R9KA 3G8ZA 2CWTA 2W9PA 1VQ63 2C11A 1FGRA 1R4CA 1W2ZA 3GSPA 3GZBA 1VQQA 3OX9A 5BVBA 1DVDA 1FUSA 3DM8A 3NV0B 3FF0A 3CC73 1J2BA 2IYJA 1GS3A 5FGOA 2IUJA 3DUKA 4BL3A 2BMRB 3WOEB 3I553 5IEOA 3EC9A 1GSPA 2HMJB 1QVG2 3I0YA 8CHOA 1STDA 1JB2A 1W4NA 4MMZB 1O7PB 3BNEA 1RGAA 3UJMA 3FKAA 4N6MA 1VQ73 3PXMA 3H51A 3PCSA 1G02A 1OGZA 4DKIA 3CCQ3 1S723 3LT9A 3NHXA 1CH0A 1JZOA 2CWVA 2HMOB 2LQVA 3LTAA 2GXFA 3G0KA 3F7SA 4X2HA 2F86B 3MG2A 3IPTA 3H3HA 3CCL3 1B2ZA 1SPUA 4HBRA 2JDIH 3URPA 1WNHA 2XRXB 1K734 1JJ22 1JNQA 1LVNA 5ELUA 1OF5B 1UCKA 3PZWA 3CU3A 3BU4A 3K0ZA 4LMIA 4J9AA 2QGUA 4ORLA 1O7WB 1BRSA 1SQWA 1JKGA 4XDVA 2CFLA 4HZ9B 6STDA 3D79A 4CJNA 1MWUA 2CX1A 3MKIA 2RNTA 2W0QA 2XFTA 7GSPA 2ZA4A 3WOFB 1I3FA 1O7MB 4J5KA 2Z77A 4R4KA 3T8UA 4HM3B 3CXC2 4N6LA 2P0XA 4IIAA 1U8CB 3M8CA 1MNLA 1DVCA 4KFEA 3KIIA 4N6V0 5BU4A 2OTL3 1FUWA 2XR8B 1WTHA 4L7KA 3UNLA 2CH9A 5GSPA 1NDOB 5AIIA 2I9WA 1GOVA 4XBYA 3NUVA 5CK6A 2Q07A 3DGOA 1B27A 2IMJA 3S27A 3DZLA 3MWZA 4KVHA 4XDWA 3BB9A 1D6ZA 4N6NB 2SBLA 1GMRA 1LOVA 4ILFA 3S29A 3F8HA 4OUQA 3HZPA 1BRNL 1X1YA 1RN4A 3B8LA 1FW7A 1YIT3 2F4YA 3CC23 1T2HA 1UI7A 4N6OB 1BIRA 3KSPA 4HM7B 3MPHA 2W56A 1IQXA 3PGBA 4HVNA 5KP1A 3G6E3 3OW22 2CG1A 2W03A 1M1XB 2BMOB 2QIYA 1QVF2 2R41A 3LYGA 3CMA3 2ML6A 2F56A 4QWTA 1PU4A 2OWPA 2IUKA 1VQO3 2RGQA 1ROVA 2ZL8A 2GBWB 4N6UA 5G1KA 3ROBA 1BVIA 1BNSA 1QJGA 2KF3A 3LXUX 2RBIA 2P05A 2CW9A 1BOXA 2C4BA 2YX9A 4XB5A 2F98A 3V98A 2Z6BA 3FG4A 1I70A 3FG3A 4FCMA 4KT3B 3T0UA 1IQ8A 1QAFA 3HI7A 4BU4A 1BSDA 3VF1A 1W00A 4O3VA 1O7GB 2OQEA 1EQKA 3OXAA 1FZUA 3EBTA 1OH0A 2STDA 3LMLA 1UI8A 3X3XA 3KFQC 1JV2B 4MMYB 4WWUC 1TRPA 2XH9A 3CC43 3DGYA 3K9MC 3MHEA 2UX0A 1YGWA 1RGEA 2BT3A 4TX4A 1YJ93 1GY7A 1UUVB 2UUGC 2ML5A 4GB5A 2OTJ3 3PS8A 1IT7A 5FW5A 2GBXB 5M18A 1HKXA 1NU3A 2SARA 2L4VA 3B7CA 3GRDA 2MF7A 1KWIA 3CCV3 2B24B 2CWUA 4NHFA 1ZO2A 3FH1A 3SOAA 1B2MA 3HOHA 4GHOA 1K8A4 1K41A 4EW5A 1GD3A 4BTYA 5AYSC 1GY5A 1VQP3 4FMAA 1FGMA 1BANA 4HM0B 3N9HA 1SIIA 2A15A 2W6JH 4HM8B 2FXTA 1IU7A 1I3IA 1LOWA 1WQLB 1W2B2 1C54A 1OPYA 2CX0A 1IT8A 1TP6A 2CFWA 1FGQA 5CLKA 3FSDA 3IJEB 3ZG5A 2CC3A 3AMOB 1N8R4 1VQ43 1BUJA 1HYFA 1RGHA 1BRKA 3X40A 2KXGA 2OOVC 3D3LA 2ZDJA 3CCJ3 1VQ53 1W02A 3CCM3 3EN8A 1AQZA 2KCDA 2H0IA 3CCU3 1BRJA 3FZWA 3G713 5G1LA 4EXRA 3UB1A 1QMAA 2JQ5A 1X1WA 8RNTA 3NBRA 1LQGC 2GU3A 2J8XB 4EV5A 3KE7A 1N5PA 5HOHA 1TU5A 1UUWB 1N9JA 1Q40A 1RMSA 1UDII 4WYKA 5AEWB 3ALAA 3U97A 1BRGA 3DGNA 4LSOA 3LZAA 3WA2X 1Q7HA 2K0MA 1UCJA 3D5IA 1JB4A 3OWUA 1PY3A 2HMNB 3QK9A 3V99A 4JRFA 1L5GB 1UCIA 1EUIC 1PFPA 2Z7AA 3GZXB 3SXXA 3JUOA 4Q53A 2KRTA 1ISKA 1E97A 2WGOA 1I0XA 5AIHA 2OOVA 4R1KA 2IA7A 5RNTA 3DY5A 3QRDA 1LQMB 3KSED 2UGIA 5EVHA 4KFDA 1ASKA 3SYUA 1BNGA 1AV4A 1IVVA 1D6UA 3F14A 1JBSA 1YVBI 5IG3A 2Z76A 3KN4A 4HM6B 4WP5A 5LC7A 3STDA 2K54A 3K7CA 3NXJA 2P09A 1JN5A 4H3UA 3CPOA 3EHCA 1IV9A 4KFFA 4BTXA 1YJW3 1LNIA 3WA3A 4L8PA 1K28A 4FCJA 1Q42A 3SOYA 2GSPA 1W6GA 2WGQA 1B21A 2CFKA 2XGNA 3PCRA 3TDGA 1NJI4 3LTDA 3BIRA 6RNTA 1Q7Y4 5D83A 4FCZA 3BLZA 1B2UA 2OQEC 1CEWI 1EEJA 1JZDA 3DH2A 3PYJA 4GL6A 3X42A 3K5TA 3BNBA 2O3OA 1ULIB 1CYVA 1RRLA 4HJLB 4RNTA 5A0OB 1K9M4 3SLUA 3LH4A 5JPUA 1AR0A 1QALA 1ZX2A 5STDA 1RKYA 1VQ83 7RNTA 1DMQA 1O7NB 1ULJB 1RTUA 1T5YA 1W6YA 4HM1B 2WO0A 3OV4A 3GAXA 2IY2A 1JBTA 2W9QA 3G4S3 1AY7A 1UW1A 2V1LA 4RNYA 4PEJA 2YFLB 3RNTA 3NBBA 3ZG0A 1I8VA 1GY6A 1RN7A 2XF3A 5AIFA 4AEQA 1MWSA 2XFSA 3HIGA 1I0VA 1GYBA 3JUMA 3NV0A 3CD63 3BNCA 3Q1CA 1YHQ3 1YGEA 4HM5B 3Q90A 5AEUB 4HKVB 4LZIA 3RGRA 1YNVX 3JVCA 3S5CA 4HM2B 1BGSA 1OHSA 3MG3A 2D42A 3MG1A 1M1K4 1OACA 3DXOA 4I4KA 4G1MB 4O8SA 4CPKA 1LOXA 3EBYA 3NQZA 5M1AA 3F40A 1FUTA 3HK4A 1X1XA 3AGNA 1R4YA 4STDA 1RN1A 4AKYA 5IERA 2P38A 3F8XA 2L1SA 3GZRA 1RGKA 3KKGA 1RGGA 3S67A 1N9EA 2RCDA 4LEHA 4K90B 3CPW2 3WMDA 1JKGB 3RDEA 2H0GA 1OF5A 1FYSA 2XSOB 5G2GA 5LC6A 1SIHA 3RGAA 1W01A 1BAOA 1Y4KA 1RSNA 2CIUA 3AHWA 1VQL3 1V74A 4R80A 3L0RA 3CCS3 1US1A 1UGHI 1TJDA 1BSEA 2F5MA 1I2EA 1N8QA 2FGTA 4H61A 4NREA 1BSBA 2CFGA 4WHAA 1UGIA 1ROAA 3FGYA 5CF2A 1NNVA 5IW9A 3O8YA 2MC8A 2GU1A 1I2FA 1KSIA 1STFI 3EJVA 1DMMA 3CCR3 4RBNA 5JPPA 3AGOA 2BNGA 3MYTA 3OWYA 4N6TA 2WOHA 4FMBA 3DMCA 2CK3H 4N3VA 2Y74A 4ZM8A 4L8OA 4X2OA 1E3RA 1OGXA 1NB3I 3EN1B 5D81A 4EBGA 5JBSA 3WDGB 3ER7A 4FMDA 1BNJA 1UUGB 1Q9EA 1BRHA 1SARA 4O02B 2QA43 1VQM3 1FA3A 2RFRA 5IG0A 3CCE3 4LYLB 5BIRA 2W56B 1IVWA 4FR9A 4OK0A 4U13A 1KQS2 1GMQA 2PNCA 3B4PA 3WHOA 2BHMA 2YFIB 5IEPA 3K63A 3EQQB 4XBXA 3HIIA 1WMNA 5M19A 5CXOA 1RGLA 1G0TA 3KCHA 1WMPA 2QEX3 1BRIA 1IDPA 3D4AA 3Q2PA 4J5GA 2AAEA 4BTWA 3BNDA 3J7Yd 3F9SA 1DETA 4IT7A 3B4OA 3CNXA 3A76A 5DRVA 4KZ1A 2GEXA 4HYZA 1LRAA 6GSPA 4HM4B 2XGLA 1VQK3 2F99A 1HU9A 9RNTA 2C10A 4FMCA 4MJDA 2BIRA 3N8BA 2HMLB 1YJN3 1VQN3 1EG9B 4NPBA 2RSXA 2E2TA 2LYXA 3LOYA 2INXA 3ZFZA 5IENA 5TGNA 7STDA 1YVSA 3ECFA 2KF6A 3LTCA 5ELJA 1V57A 1RNBA 1RLSA 3NM2A 3DGMA 1IV7A 1FGOA 3AHSA 5IF6A 5KP4A 2F5WA 1M904 5BXQA 2HMMB 2KAAA 1M9GA 1RDSA 3LTBA 3NQYA 3EX9A 2YFJB 4JF8A 1I2GA 5AYRB 4RZMA 1MGRA 1G96A 1BNEA 1RRHA 2FNQA 3FF2A 3VGNA 1IYYA 1B3SA 1GD4A 3CNMA 1VQ93 4RNZA 2D1WA 2E2VA 4LGQA 1V58A 1BNFA 2OCTA 1Q864 3F7XA 1JBRA 4HZBB 1RHLA 3FG1A 2P0MA 3MSOA 1FGTA 1A90A 1WMOA 1T2IA 1BSAA 1MGWA 1MWTA 1U5OA 4MMXB 1MOLA 3Q3FA 2BU4A 3UL6A 1SJWA 1Q824 3AMOA 3JUPA 1DYUA 5D82A 1BNRA 4K1UA 3DGLA 3EB8A 4XBTA 4MEIA 5AIGA 1Z1SA 5AI1A 1S5AA 3X41A 1B2XA 2HOHA 2E2UA 2ZHXB 4HAAA 4HOHA 4R9LA 1GMPA 1N5HA 4OVMA 1EKMA 4CCVA 1LXEA 4K61A 1B20A 1IQYA 1CQSA 1KC84 3N54B 1HZ1A 1UCLA 4J8TA 5IG5A 1Q814 1ZGXA 1NWWA 3OWSA 1OUNA 3UL5A 1C7HA 1Q40B 1IVXA 2BMQB 3NBJA 3G16A 4WYKB 1ZS7A 3NX0A 4EC6A 3U1WA 4K1VA 2O9UX 1A67A 1LNHA 1BSCA 3SX1A 4CDLA 2CHCA 2B1XB 3GZYB 1JRQA 3FLJA 3GWRA 1E3VA 1D6YA 1LOYA 4AKZA 1AVKA 3JUNA 1A2PA 5EQLA
chains in the Genus database with same CATH topology
1UGIA 2ZHXB 1LQGC 1UDII 2J8XB 1LQMB 2UGIA 1UUGB 1UGHI 4LYLB 1EUIC 2UUGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGI A;  2ZHX B;  1LQG C;  1UDI I;  2J8X B;  1LQM B;  2UGI A;  1UUG B;  1UGH I;  4LYL B;  1EUI C;  2UUG C; 
#chains in the Genus database with same CATH topology
 1A2V A;  2PZV A;  1TFO A;  3D5G A;  1OHO A;  1OCV A;  4IPB A;  1OHP A;  1T3B A;  1NO3 A;  3WOD G;  1JN5 B;  2Y73 A;  3T8N A;  1YI2 3;  1EA2 A;  1RCK A;  4EV2 A;  1DMN A;  1W5Z A;  1CYU A;  2XSH B;  2WOF A;  1RCL A;  2W2C A;  5DRE A;  1PYL A;  1A2K A;  3LT8 A;  4I5Q A;  1AVL A;  2AAD A;  1W7C A;  2BO9 B;  2R4I A;  3X3Y A;  1QAK A;  3SED A;  1DE3 A;  2HMK B;  1BU4 A;  3S28 A;  4EYC A;  5IG4 A;  4BL2 A;  1GOY A;  5EEO A;  2XEP A;  5KP3 A;  3X3Z A;  1RGC A;  3I56 3;  1TRQ A;  3V92 A;  1F8N A;  2H0H A;  5I97 A;  1TTO A;  2CFD A;  2K3D A;  1IVU A;  1TFK A;  2KF4 A;  4XM4 A;  3EE1 A;  5HGR A;  3WR2 A;  1RJO A;  1GOU A;  3SVA A;  5CF1 A;  2W04 A;  1B2S A;  3EF8 A;  3D9R A;  3VSY A;  3CME 3;  1O7H B;  1X1U A;  1RGF A;  1RNT A;  2CG0 A;  2GEY A;  2KF5 A;  1KD1 4;  1NB5 I;  1BNI A;  3E99 A;  1JB5 A;  1TIJ A;  3JUQ A;  3NM7 A;  1MWR A;  4WFO A;  3IMA B;  4BIR A;  1IK3 A;  1YIJ 3;  1BUQ A;  2M7O A;  4GSP A;  3A5E A;  4O2H A;  1TUH A;  1W6C A;  3FCS B;  2CKF B;  3HX8 A;  3KZT A;  1VZZ A;  4R9K A;  3G8Z A;  2CWT A;  2W9P A;  1VQ6 3;  2C11 A;  1FGR A;  1R4C A;  1W2Z A;  3GSP A;  3GZB A;  1VQQ A;  3OX9 A;  5BVB A;  1DVD A;  1FUS A;  3DM8 A;  3NV0 B;  3FF0 A;  3CC7 3;  1J2B A;  2IYJ A;  1GS3 A;  5FGO A;  2IUJ A;  3DUK A;  4BL3 A;  2BMR B;  3WOE B;  3I55 3;  5IEO A;  3EC9 A;  1GSP A;  2HMJ B;  1QVG 2;  3I0Y A;  8CHO A;  1STD A;  1JB2 A;  1W4N A;  4MMZ B;  1O7P B;  3BNE A;  1RGA A;  3UJM A;  3FKA A;  4N6M A;  1VQ7 3;  3PXM A;  3H51 A;  3PCS A;  1G02 A;  1OGZ A;  4DKI A;  3CCQ 3;  1S72 3;  3LT9 A;  3NHX A;  1CH0 A;  1JZO A;  2CWV A;  2HMO B;  2LQV A;  3LTA A;  2GXF A;  3G0K A;  3F7S A;  4X2H A;  2F86 B;  3MG2 A;  3IPT A;  3H3H A;  3CCL 3;  1B2Z A;  1SPU A;  4HBR A;  2JDI H;  3URP A;  1WNH A;  2XRX B;  1K73 4;  1JJ2 2;  1JNQ A;  1LVN A;  5ELU A;  1OF5 B;  1UCK A;  3PZW A;  3CU3 A;  3BU4 A;  3K0Z A;  4LMI A;  4J9A A;  2QGU A;  4ORL A;  1O7W B;  1BRS A;  1SQW A;  1JKG A;  4XDV A;  2CFL A;  4HZ9 B;  6STD A;  3D79 A;  4CJN A;  1MWU A;  2CX1 A;  3MKI A;  2RNT A;  2W0Q A;  2XFT A;  7GSP A;  2ZA4 A;  3WOF B;  1I3F A;  1O7M B;  4J5K A;  2Z77 A;  4R4K A;  3T8U A;  4HM3 B;  3CXC 2;  4N6L A;  2P0X A;  4IIA A;  1U8C B;  3M8C A;  1MNL A;  1DVC A;  4KFE A;  3KII A;  4N6V 0;  5BU4 A;  2OTL 3;  1FUW A;  2XR8 B;  1WTH A;  4L7K A;  3UNL A;  2CH9 A;  5GSP A;  1NDO B;  5AII A;  2I9W A;  1GOV A;  4XBY A;  3NUV A;  5CK6 A;  2Q07 A;  3DGO A;  1B27 A;  2IMJ A;  3S27 A;  3DZL A;  3MWZ A;  4KVH A;  4XDW A;  3BB9 A;  1D6Z A;  4N6N B;  2SBL A;  1GMR A;  1LOV A;  4ILF A;  3S29 A;  3F8H A;  4OUQ A;  3HZP A;  1BRN L;  1X1Y A;  1RN4 A;  3B8L A;  1FW7 A;  1YIT 3;  2F4Y A;  3CC2 3;  1T2H A;  1UI7 A;  4N6O B;  1BIR A;  3KSP A;  4HM7 B;  3MPH A;  2W56 A;  1IQX A;  3PGB A;  4HVN A;  5KP1 A;  3G6E 3;  3OW2 2;  2CG1 A;  2W03 A;  1M1X B;  2BMO B;  2QIY A;  1QVF 2;  2R41 A;  3LYG A;  3CMA 3;  2ML6 A;  2F56 A;  4QWT A;  1PU4 A;  2OWP A;  2IUK A;  1VQO 3;  2RGQ A;  1ROV A;  2ZL8 A;  2GBW B;  4N6U A;  5G1K A;  3ROB A;  1BVI A;  1BNS A;  1QJG A;  2KF3 A;  3LXU X;  2RBI A;  2P05 A;  2CW9 A;  1BOX A;  2C4B A;  2YX9 A;  4XB5 A;  2F98 A;  3V98 A;  2Z6B A;  3FG4 A;  1I70 A;  3FG3 A;  4FCM A;  4KT3 B;  3T0U A;  1IQ8 A;  1QAF A;  3HI7 A;  4BU4 A;  1BSD A;  3VF1 A;  1W00 A;  4O3V A;  1O7G B;  2OQE A;  1EQK A;  3OXA A;  1FZU A;  3EBT A;  1OH0 A;  2STD A;  3LML A;  1UI8 A;  3X3X A;  3KFQ C;  1JV2 B;  4MMY B;  4WWU C;  1TRP A;  2XH9 A;  3CC4 3;  3DGY A;  3K9M C;  3MHE A;  2UX0 A;  1YGW A;  1RGE A;  2BT3 A;  4TX4 A;  1YJ9 3;  1GY7 A;  1UUV B;  2UUG C;  2ML5 A;  4GB5 A;  2OTJ 3;  3PS8 A;  1IT7 A;  5FW5 A;  2GBX B;  5M18 A;  1HKX A;  1NU3 A;  2SAR A;  2L4V A;  3B7C A;  3GRD A;  2MF7 A;  1KWI A;  3CCV 3;  2B24 B;  2CWU A;  4NHF A;  1ZO2 A;  3FH1 A;  3SOA A;  1B2M A;  3HOH A;  4GHO A;  1K8A 4;  1K41 A;  4EW5 A;  1GD3 A;  4BTY A;  5AYS C;  1GY5 A;  1VQP 3;  4FMA A;  1FGM A;  1BAN A;  4HM0 B;  3N9H A;  1SII A;  2A15 A;  2W6J H;  4HM8 B;  2FXT A;  1IU7 A;  1I3I A;  1LOW A;  1WQL B;  1W2B 2;  1C54 A;  1OPY A;  2CX0 A;  1IT8 A;  1TP6 A;  2CFW A;  1FGQ A;  5CLK A;  3FSD A;  3IJE B;  3ZG5 A;  2CC3 A;  3AMO B;  1N8R 4;  1VQ4 3;  1BUJ A;  1HYF A;  1RGH A;  1BRK A;  3X40 A;  2KXG A;  2OOV C;  3D3L A;  2ZDJ A;  3CCJ 3;  1VQ5 3;  1W02 A;  3CCM 3;  3EN8 A;  1AQZ A;  2KCD A;  2H0I A;  3CCU 3;  1BRJ A;  3FZW A;  3G71 3;  5G1L A;  4EXR A;  3UB1 A;  1QMA A;  2JQ5 A;  1X1W A;  8RNT A;  3NBR A;  1LQG C;  2GU3 A;  2J8X B;  4EV5 A;  3KE7 A;  1N5P A;  5HOH A;  1TU5 A;  1UUW B;  1N9J A;  1Q40 A;  1RMS A;  1UDI I;  4WYK A;  5AEW B;  3ALA A;  3U97 A;  1BRG A;  3DGN A;  4LSO A;  3LZA A;  3WA2 X;  1Q7H A;  2K0M A;  1UCJ A;  3D5I A;  1JB4 A;  3OWU A;  1PY3 A;  2HMN B;  3QK9 A;  3V99 A;  4JRF A;  1L5G B;  1UCI A;  1EUI C;  1PFP A;  2Z7A A;  3GZX B;  3SXX A;  3JUO A;  4Q53 A;  2KRT A;  1ISK A;  1E97 A;  2WGO A;  1I0X A;  5AIH A;  2OOV A;  4R1K A;  2IA7 A;  5RNT A;  3DY5 A;  3QRD A;  1LQM B;  3KSE D;  2UGI A;  5EVH A;  4KFD A;  1ASK A;  3SYU A;  1BNG A;  1AV4 A;  1IVV A;  1D6U A;  3F14 A;  1JBS A;  1YVB I;  5IG3 A;  2Z76 A;  3KN4 A;  4HM6 B;  4WP5 A;  5LC7 A;  3STD A;  2K54 A;  3K7C A;  3NXJ A;  2P09 A;  1JN5 A;  4H3U A;  3CPO A;  3EHC A;  1IV9 A;  4KFF A;  4BTX A;  1YJW 3;  1LNI A;  3WA3 A;  4L8P A;  1K28 A;  4FCJ A;  1Q42 A;  3SOY A;  2GSP A;  1W6G A;  2WGQ A;  1B21 A;  2CFK A;  2XGN A;  3PCR A;  3TDG A;  1NJI 4;  3LTD A;  3BIR A;  6RNT A;  1Q7Y 4;  5D83 A;  4FCZ A;  3BLZ A;  1B2U A;  2OQE C;  1CEW I;  1EEJ A;  1JZD A;  3DH2 A;  3PYJ A;  4GL6 A;  3X42 A;  3K5T A;  3BNB A;  2O3O A;  1ULI B;  1CYV A;  1RRL A;  4HJL B;  4RNT A;  5A0O B;  1K9M 4;  3SLU A;  3LH4 A;  5JPU A;  1AR0 A;  1QAL A;  1ZX2 A;  5STD A;  1RKY A;  1VQ8 3;  7RNT A;  1DMQ A;  1O7N B;  1ULJ B;  1RTU A;  1T5Y A;  1W6Y A;  4HM1 B;  2WO0 A;  3OV4 A;  3GAX A;  2IY2 A;  1JBT A;  2W9Q A;  3G4S 3;  1AY7 A;  1UW1 A;  2V1L A;  4RNY A;  4PEJ A;  2YFL B;  3RNT A;  3NBB A;  3ZG0 A;  1I8V A;  1GY6 A;  1RN7 A;  2XF3 A;  5AIF A;  4AEQ A;  1MWS A;  2XFS A;  3HIG A;  1I0V A;  1GYB A;  3JUM A;  3NV0 A;  3CD6 3;  3BNC A;  3Q1C A;  1YHQ 3;  1YGE A;  4HM5 B;  3Q90 A;  5AEU B;  4HKV B;  4LZI A;  3RGR A;  1YNV X;  3JVC A;  3S5C A;  4HM2 B;  1BGS A;  1OHS A;  3MG3 A;  2D42 A;  3MG1 A;  1M1K 4;  1OAC A;  3DXO A;  4I4K A;  4G1M B;  4O8S A;  4CPK A;  1LOX A;  3EBY A;  3NQZ A;  5M1A A;  3F40 A;  1FUT A;  3HK4 A;  1X1X A;  3AGN A;  1R4Y A;  4STD A;  1RN1 A;  4AKY A;  5IER A;  2P38 A;  3F8X A;  2L1S A;  3GZR A;  1RGK A;  3KKG A;  1RGG A;  3S67 A;  1N9E A;  2RCD A;  4LEH A;  4K90 B;  3CPW 2;  3WMD A;  1JKG B;  3RDE A;  2H0G A;  1OF5 A;  1FYS A;  2XSO B;  5G2G A;  5LC6 A;  1SIH A;  3RGA A;  1W01 A;  1BAO A;  1Y4K A;  1RSN A;  2CIU A;  3AHW A;  1VQL 3;  1V74 A;  4R80 A;  3L0R A;  3CCS 3;  1US1 A;  1UGH I;  1TJD A;  1BSE A;  2F5M A;  1I2E A;  1N8Q A;  2FGT A;  4H61 A;  4NRE A;  1BSB A;  2CFG A;  4WHA A;  1UGI A;  1ROA A;  3FGY A;  5CF2 A;  1NNV A;  5IW9 A;  3O8Y A;  2MC8 A;  2GU1 A;  1I2F A;  1KSI A;  1STF I;  3EJV A;  1DMM A;  3CCR 3;  4RBN A;  5JPP A;  3AGO A;  2BNG A;  3MYT A;  3OWY A;  4N6T A;  2WOH A;  4FMB A;  3DMC A;  2CK3 H;  4N3V A;  2Y74 A;  4ZM8 A;  4L8O A;  4X2O A;  1E3R A;  1OGX A;  1NB3 I;  3EN1 B;  5D81 A;  4EBG A;  5JBS A;  3WDG B;  3ER7 A;  4FMD A;  1BNJ A;  1UUG B;  1Q9E A;  1BRH A;  1SAR A;  4O02 B;  2QA4 3;  1VQM 3;  1FA3 A;  2RFR A;  5IG0 A;  3CCE 3;  4LYL B;  5BIR A;  2W56 B;  1IVW A;  4FR9 A;  4OK0 A;  4U13 A;  1KQS 2;  1GMQ A;  2PNC A;  3B4P A;  3WHO A;  2BHM A;  2YFI B;  5IEP A;  3K63 A;  3EQQ B;  4XBX A;  3HII A;  1WMN A;  5M19 A;  5CXO A;  1RGL A;  1G0T A;  3KCH A;  1WMP A;  2QEX 3;  1BRI A;  1IDP A;  3D4A A;  3Q2P A;  4J5G A;  2AAE A;  4BTW A;  3BND A;  3J7Y d;  3F9S A;  1DET A;  4IT7 A;  3B4O A;  3CNX A;  3A76 A;  5DRV A;  4KZ1 A;  2GEX A;  4HYZ A;  1LRA A;  6GSP A;  4HM4 B;  2XGL A;  1VQK 3;  2F99 A;  1HU9 A;  9RNT A;  2C10 A;  4FMC A;  4MJD A;  2BIR A;  3N8B A;  2HML B;  1YJN 3;  1VQN 3;  1EG9 B;  4NPB A;  2RSX A;  2E2T A;  2LYX A;  3LOY A;  2INX A;  3ZFZ A;  5IEN A;  5TGN A;  7STD A;  1YVS A;  3ECF A;  2KF6 A;  3LTC A;  5ELJ A;  1V57 A;  1RNB A;  1RLS A;  3NM2 A;  3DGM A;  1IV7 A;  1FGO A;  3AHS A;  5IF6 A;  5KP4 A;  2F5W A;  1M90 4;  5BXQ A;  2HMM B;  2KAA A;  1M9G A;  1RDS A;  3LTB A;  3NQY A;  3EX9 A;  2YFJ B;  4JF8 A;  1I2G A;  5AYR B;  4RZM A;  1MGR A;  1G96 A;  1BNE A;  1RRH A;  2FNQ A;  3FF2 A;  3VGN A;  1IYY A;  1B3S A;  1GD4 A;  3CNM A;  1VQ9 3;  4RNZ A;  2D1W A;  2E2V A;  4LGQ A;  1V58 A;  1BNF A;  2OCT A;  1Q86 4;  3F7X A;  1JBR A;  4HZB B;  1RHL A;  3FG1 A;  2P0M A;  3MSO A;  1FGT A;  1A90 A;  1WMO A;  1T2I A;  1BSA A;  1MGW A;  1MWT A;  1U5O A;  4MMX B;  1MOL A;  3Q3F A;  2BU4 A;  3UL6 A;  1SJW A;  1Q82 4;  3AMO A;  3JUP A;  1DYU A;  5D82 A;  1BNR A;  4K1U A;  3DGL A;  3EB8 A;  4XBT A;  4MEI A;  5AIG A;  1Z1S A;  5AI1 A;  1S5A A;  3X41 A;  1B2X A;  2HOH A;  2E2U A;  2ZHX B;  4HAA A;  4HOH A;  4R9L A;  1GMP A;  1N5H A;  4OVM A;  1EKM A;  4CCV A;  1LXE A;  4K61 A;  1B20 A;  1IQY A;  1CQS A;  1KC8 4;  3N54 B;  1HZ1 A;  1UCL A;  4J8T A;  5IG5 A;  1Q81 4;  1ZGX A;  1NWW A;  3OWS A;  1OUN A;  3UL5 A;  1C7H A;  1Q40 B;  1IVX A;  2BMQ B;  3NBJ A;  3G16 A;  4WYK B;  1ZS7 A;  3NX0 A;  4EC6 A;  3U1W A;  4K1V A;  2O9U X;  1A67 A;  1LNH A;  1BSC A;  3SX1 A;  4CDL A;  2CHC A;  2B1X B;  3GZY B;  1JRQ A;  3FLJ A;  3GWR A;  1E3V A;  1D6Y A;  1LOY A;  4AKZ A;  1AVK A;  3JUN A;  1A2P A;  5EQL A; 
#chains in the Genus database with same CATH homology
 1UGI A;  2ZHX B;  1LQG C;  1UDI I;  2J8X B;  1LQM B;  2UGI A;  1UUG B;  1UGH I;  4LYL B;  1EUI C;  2UUG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...