1UGHI

Crystal structure of human uracil-dna glycosylase in complex with a protein inhibitor: protein mimicry of dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor: protein mimicry of DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Glycosylase
molecule keywords PROTEIN (URACIL-DNA GLYCOSYLASE)
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 1999-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1ughI00
2ZHXB 1UGHI 4LYLB 1UUGB 1EUIC 2UUGC 1UDII 2J8XB 1UGIA 1LQGC 1LQMB 2UGIA
chains in the Genus database with same CATH superfamily
2Z76A 3FH1A 1VQK3 1I70A 1SIIA 2D1WA 1GY6A 3N9HA 1FGMA 2K3DA 1O7PB 1QALA 2QA43 3WMDA 1E3RA 1D6UA 2B1XB 5BIRA 3NV0B 4MJDA 3RGRA 1GD4A 5G1LA 5CF2A 1PU4A 3CMA3 1VQO3 5DRVA 4XBTA 1M1XB 3EX9A 1Q824 2WGQA 1OACA 1EA2A 1UUWB 4K1UA 3DGMA 1S5AA 2MC8A 1IYYA 1IQXA 1MGRA 2CFKA 2KAAA 4GB5A 4HVNA 2GEYA 1RN1A 8RNTA 3NX0A 4L7KA 2M7OA 3EN8A 4EC6A 3JUOA 2XGLA 1E3VA 3X3ZA 1YI23 1BRSA 1QMAA 2AADA 4KFEA 1B27A 1N9JA 4O3VA 1I8VA 2ML6A 4CCVA 5IEPA 1QVG2 3V99A 2CFLA 3IJEB 1TU5A 1HU9A 2IYJA 3VSYA 4GSPA 3FCSB 3Q90A 5G1KA 2P0MA 3LXUX 2KXGA 3LT8A 5IG4A 2J8XB 5IW9A 1BSCA 3LH4A 3VGNA 1Y4KA 1ZO2A 2F98A 1FUTA 3F40A 4R80A 1BNEA 3FF0A 3U97A 1MWRA 1VQP3 1LOVA 5CLKA 1MWTA 3B8LA 2WGOA 3CNMA 3MWZA 1BNJA 3IPTA 2ML5A 1B2XA 2HMMB 2B24B 4HM5B 3CCU3 3KFQC 2ZDJA 2CX1A 3K63A 1BIRA 3CCS3 2XRXB 3EE1A 3FG4A 1LQMB 1T2HA 3ZG0A 1IV9A 2INXA 3KIIA 4RNTA 4WYKA 4Q53A 5EQLA 3BNDA 1VQ53 1BNIA 2LYXA 1R4YA 4EV5A 1HYFA 4XBXA 4QWTA 3PGBA 1GY7A 3MG1A 2HMKB 5KP3A 3DGYA 1VQ43 3H3HA 4EV2A 4FMCA 4BTXA 1G96A 2L4VA 1US1A 1EEJA 3PS8A 5AEUB 1DVDA 1KD14 1FGOA 4O02B 3SEDA 1EG9B 1RDSA 1V58A 1RLSA 3GZRA 5ELUA 3PXMA 5GSPA 5IG0A 1C54A 4HM7B 5LC7A 4NPBA 3NBBA 4N3VA 3BNCA 3LTDA 1UW1A 3BIRA 2WOHA 1UDII 1W4NA 3GAXA 3OWUA 3V92A 2ZL8A 3UL6A 2D42A 1GMQA 3AHSA 3SOAA 4N6V0 1WMPA 1IK3A 1LNHA 4PEJA 2QEX3 3A5EA 2SBLA 3F9SA 3FZWA 4G1MB 3MG3A 5CXOA 1LRAA 3JUQA 1YGEA 2HMOB 1K41A 1TTOA 2YFIB 4BIRA 4L8PA 1DVCA 3FF2A 2BMOB 1BRNL 3HIGA 4O2HA 1GD3A 3SXXA 2KF4A 3CCQ3 3NM7A 2QIYA 1BNGA 1HKXA 3MSOA 3NQZA 2PZVA 4KFFA 1GSPA 1N8QA 3LTBA 4CDLA 1RHLA 3CCM3 4XB5A 3X3XA 1UGIA 2KF3A 7RNTA 2E2TA 1VQQA 1CYVA 1IT8A 3G0KA 1UI8A 1W2ZA 3EHCA 1M1K4 5M1AA 1VQL3 4WFOA 1TRPA 2W2CA 4I4KA 2C4BA 3ALAA 3ROBA 4LZIA 3DM8A 4J9AA 3S27A 3STDA 4FCJA 4HJLB 4O8SA 3URPA 1IQ8A 3FG1A 1RCKA 2E2VA 3KN4A 1BSBA 4N6NB 4RBNA 3U1WA 1Q814 5EEOA 5AEWB 1CH0A 1TP6A 2H0IA 1JN5B 3WA2X 1AY7A 3FGYA 4WWUC 2CFGA 5EVHA 5I97A 3CC43 2FNQA 2RFRA 5A0OB 3NQYA 1JV2B 1W6GA 3PCSA 6GSPA 1N8R4 1B20A 1A67A 3WODG 1V57A 3I0YA 4JRFA 3E99A 1IVXA 1BSDA 5HOHA 3NUVA 1QVF2 1ROAA 1WTHA 2F99A 1JBRA 2RCDA 1ULIB 3KSPA 1KQS2 2P38A 3FKAA 1PFPA 3FLJA 4BTYA 5STDA 1O7MB 1RN7A 1MWSA 2C11A 1CEWI 2BT3A 1X1WA 1B3SA 1O7WB 4BU4A 3K0ZA 2XSHB 1FA3A 1AVKA 2KCDA 2W0QA 4R1KA 3WHOA 2RSXA 3JUMA 3S28A 1T3BA 1OHOA 4LSOA 2IA7A 2K54A 4RNZA 4X2OA 2YFJB 3GSPA 5AIHA 2FGTA 1OCVA 1RGLA 5IERA 1A90A 5JPUA 4AEQA 1DMQA 1F8NA 3G713 2PNCA 4XM4A 1FW7A 4HM4B 4XDVA 5JBSA 1GMRA 3X40A 4HM8B 3Q3FA 4OK0A 5ELJA 1YGWA 3DY5A 2IMJA 2MF7A 1N9EA 1R4CA 3JUPA 3QK9A 4HZ9B 5CF1A 3OV4A 8CHOA 1CQSA 4IIAA 2CH9A 3SOYA 3HZPA 1NJI4 2GBXB 4KFDA 1FGTA 1D6ZA 1T2IA 3LMLA 2CC3A 2OQEA 2BNGA 5LC6A 1RNTA 4LYLB 3M8CA 1IQYA 3G8ZA 3RDEA 3KKGA 4N6MA 4NHFA 1I2EA 2IY2A 3O8YA 1BSAA 1UCJA 2KF6A 3MG2A 4CPKA 5AYSC 2H0GA 1RGHA 3TDGA 2W03A 5DREA 1BVIA 1G02A 1W7CA 5M18A 2CG0A 2OWPA 2A15A 1RTUA 1YJ93 3G4S3 5D81A 1PYLA 1IVWA 3FG3A 1M904 1RGGA 2GSPA 2LQVA 1W2B2 5KP4A 3I563 2Z7AA 3RNTA 3WR2A 2O9UX 1QJGA 1SARA 1BU4A 1JRQA 4K90B 1JBSA 1UUGB 1GY5A 2P09A 1NB5I 1EQKA 1RGAA 1SJWA 1NU3A 1UCLA 3B4PA 2UGIA 1ROVA 2SARA 4HKVB 4CJNA 1O7HB 3FSDA 3SLUA 5CK6A 4J5GA 4MMZB 2Y74A 5AIFA 3UL5A 2F56A 1RGFA 4EBGA 2CW9A 3EC9A 3NM2A 1ZS7A 3UB1A 2AAEA 3I553 1GOUA 3BLZA 1BANA 3LT9A 3CME3 1I0VA 1ZX2A 3MYTA 1JB2A 3LOYA 1OF5A 1JB4A 4KZ1A 1RKYA 1N5PA 1OUNA 1YJN3 1VQ83 5FW5A 3F8XA 1U5OA 1KWIA 2E2UA 4LEHA 1Q7Y4 3GRDA 1I3FA 1OPYA 1VQM3 2P0XA 3F7XA 3HK4A 4WYKB 1ASKA 2W56B 3IMAB 3T8NA 1IDPA 3K7CA 5AIGA 3D5IA 3MHEA 3EQQB 1W5ZA 3AMOA 4NREA 1B2SA 1TFKA 2BO9B 1FGRA 2BHMA 4AKZA 1C7HA 3S67A 2K0MA 1WMOA 4GHOA 2GU1A 4J5KA 3PZWA 1RCLA 1E97A 3WA3A 1OH0A 5HGRA 1W00A 1RRLA 1BNFA 2F5MA 1IT7A 3CCV3 4H61A 3D4AA 1DYUA 3JUNA 6STDA 1J2BA 2OQEC 2C10A 2IUJA 1LOXA 1Q42A 1Q40B 4EXRA 2CHCA 2F4YA 1LXEA 1FUSA 1YVBI 1BNSA 5IENA 4I5QA 1OHPA 2XEPA 3X3YA 1UGHI 3DUKA 2CK3H 3CNXA 4H3UA 1BNRA 1G0TA 2FXTA 2OOVC 4LMIA 2BIRA 1JN5A 2W04A 1LNIA 1BGSA 1D6YA 4HYZA 1UCIA 2CX0A 4N6UA 5G2GA 3KZTA 1W02A 1BRGA 1O7NB 3CXC2 1GYBA 1TIJA 3NV0A 4MMYB 5AYRB 1HZ1A 1B2MA 1RGEA 4K1VA 1UCKA 1GMPA 1V74A 2CWVA 1TRQA 3D9RA 1X1XA 3K9MC 3WOFB 2P05A 4HM6B 1JKGA 1Q864 2XH9A 1ISKA 2CG1A 1NNVA 3ECFA 2KF5A 4U13A 4FCZA 2CWTA 1OHSA 2W56A 3GWRA 2HMNB 4GL6A 3EBYA 1TJDA 1BRIA 1NO3A 1MGWA 4WP5A 1B2ZA 4J8TA 1I0XA 2R41A 3DGOA 3WOEB 3CCL3 2RNTA 2F86B 3AHWA 1YNVX 4BTWA 2CFDA 4HAAA 4IPBA 4R4KA 1Z1SA 3NBJA 4FMAA 1FZUA 3B4OA 2BMRB 3LZAA 3OX9A 3X41A 3CD63 1W01A 1QAFA 1T5YA 3F7SA 2OOVA 1AVLA 1SIHA 3Q2PA 1JJ22 2HMJB 2L1SA 1LOWA 2Z6BA 4L8OA 4XBYA 4XDWA 1K28A 1IV7A 3BNEA 3EB8A 3EJVA 5IEOA 1EUIC 4HM3B 3CPOA 3D5GA 1BOXA 7STDA 1LQGC 2R4IA 5FGOA 1VZZA 1DMMA 1K734 1RSNA 2W9PA 2IUKA 1YIJ3 4MMXB 4KT3B 1AQZA 3OWYA 4JF8A 4N6LA 2V1LA 4BL3A 2CFWA 4BL2A 3KSED 3AGOA 1L5GB 3H51A 1S723 2Z77A 5AIIA 2JQ5A 1N5HA 2F5WA 2WOFA 3F14A 3RGAA 3DH2A 3S5CA 9RNTA 2XSOB 3LYGA 4N6OB 3G6E3 5AI1A 4R9KA 1EKMA 4ZM8A 1K9M4 1VQN3 3WDGB 2RGQA 5KP1A 1Q9EA 3NBRA 3N8BA 6RNTA 2OTL3 1DMNA 1GOVA 1KSIA 2WO0A 1IU7A 1BAOA 1Q40A 2XFSA 3A76A 3LTCA 4HM1B 1PY3A 1UUVB 2H0HA 2W6JH 2O3OA 3HOHA 3CC23 3OW22 2CWUA 4EYCA 1K8A4 1OF5B 1ULJB 3DXOA 3G16A 2ZHXB 1JBTA 3D3LA 3V98A 7GSPA 1I3IA 3CC73 2XFTA 3DMCA 3B7CA 1MWUA 2GBWB 3NXJA 3D79A 4FR9A 4ORLA 3T8UA 5JPPA 5RNTA 1U8CB 1TUHA 3HIIA 1NDOB 3JVCA 4FCMA 4HOHA 4TX4A 3S29A 3ZG5A 4AKYA 4OVMA 1FYSA 1M9GA 1Q7HA 2BU4A 2KRTA 5TGNA 5IF6A 2GU3A 1A2PA 1O7GB 4STDA 1VQ93 3MKIA 4R9LA 3DGNA 2CIUA 1BSEA 4HBRA 4EW5A 1YVSA 1RGKA 2STDA 4MEIA 1JKGB 1STDA 3ER7A 1BRHA 3BNBA 1X1YA 1MNLA 3K5TA 3KE7A 3CPW2 1DETA 4IT7A 4OUQA 3CCR3 3VF1A 3AMOB 3DZLA 2QGUA 2JDIH 1WQLB 3EBTA 1IVVA 3QRDA 1VQ63 3GZXB 5BU4A 3MPHA 2Q07A 1OGZA 2UUGC 2XGNA 3UJMA 3UNLA 1WNHA 1VQ73 1JNQA 4ILFA 1LOYA 1GS3A 1JZOA 3F8HA 5M19A 3J7Yd 1YJW3 1KC84 2CKFB 4RZMA 3PCRA 3Q1CA 1FGQA 3SYUA 2OCTA 1GOYA 1LVNA 1RGCA 2BMQB 2Y73A 1RNBA 4KVHA 3EN1B 3HX8A 4K61A 3SX1A 1BUQA 2GXFA 1A2VA 4WHAA 4N6TA 1YIT3 3GZBA 1RRHA 1ZGXA 2YX9A 4HM0B 3HI7A 1X1UA 3AGNA 1TFOA 1W6CA 1BRKA 4HZBB 1MOLA 3PYJA 4RNYA 2UX0A 1YHQ3 1CYUA 1JB5A 3BB9A 4DKIA 3CCE3 1W6YA 5IG3A 2ZA4A 3BU4A 4X2HA 5D82A 4FMBA 5BXQA 2OTJ3 4FMDA 3CCJ3 1OGXA 1BRJA 2HOHA 3DGLA 1QAKA 1IVUA 1STFI 2HMLB 1NB3I 1RJOA 4LGQA 1AR0A 5D83A 1NWWA 1UI7A 5IG5A 3ZFZA 1I2GA 5BVBA 2GEXA 2YFLB 2W9QA 1SQWA 3NHXA 3KCHA 3SVAA 1BUJA 3OXAA 3EF8A 3OWSA 1RMSA 1A2KA 1FUWA 3LTAA 1I2FA 1RN4A 3N54B 1JZDA 4HM2B 2I9WA 3L0RA 1SPUA 2XR8B 3T0UA 1DE3A 3CU3A 3GZYB 1B21A 3X42A 1B2UA 2XF3A 1AV4A 2RBIA 1WMNA
chains in the Genus database with same CATH topology
2ZHXB 1UGHI 4LYLB 1UUGB 1EUIC 2UUGC 1UDII 2J8XB 1UGIA 1LQGC 1LQMB 2UGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZHX B;  1UGH I;  4LYL B;  1UUG B;  1EUI C;  2UUG C;  1UDI I;  2J8X B;  1UGI A;  1LQG C;  1LQM B;  2UGI A; 
#chains in the Genus database with same CATH topology
 2Z76 A;  3FH1 A;  1VQK 3;  1I70 A;  1SII A;  2D1W A;  1GY6 A;  3N9H A;  1FGM A;  2K3D A;  1O7P B;  1QAL A;  2QA4 3;  3WMD A;  1E3R A;  1D6U A;  2B1X B;  5BIR A;  3NV0 B;  4MJD A;  3RGR A;  1GD4 A;  5G1L A;  5CF2 A;  1PU4 A;  3CMA 3;  1VQO 3;  5DRV A;  4XBT A;  1M1X B;  3EX9 A;  1Q82 4;  2WGQ A;  1OAC A;  1EA2 A;  1UUW B;  4K1U A;  3DGM A;  1S5A A;  2MC8 A;  1IYY A;  1IQX A;  1MGR A;  2CFK A;  2KAA A;  4GB5 A;  4HVN A;  2GEY A;  1RN1 A;  8RNT A;  3NX0 A;  4L7K A;  2M7O A;  3EN8 A;  4EC6 A;  3JUO A;  2XGL A;  1E3V A;  3X3Z A;  1YI2 3;  1BRS A;  1QMA A;  2AAD A;  4KFE A;  1B27 A;  1N9J A;  4O3V A;  1I8V A;  2ML6 A;  4CCV A;  5IEP A;  1QVG 2;  3V99 A;  2CFL A;  3IJE B;  1TU5 A;  1HU9 A;  2IYJ A;  3VSY A;  4GSP A;  3FCS B;  3Q90 A;  5G1K A;  2P0M A;  3LXU X;  2KXG A;  3LT8 A;  5IG4 A;  2J8X B;  5IW9 A;  1BSC A;  3LH4 A;  3VGN A;  1Y4K A;  1ZO2 A;  2F98 A;  1FUT A;  3F40 A;  4R80 A;  1BNE A;  3FF0 A;  3U97 A;  1MWR A;  1VQP 3;  1LOV A;  5CLK A;  1MWT A;  3B8L A;  2WGO A;  3CNM A;  3MWZ A;  1BNJ A;  3IPT A;  2ML5 A;  1B2X A;  2HMM B;  2B24 B;  4HM5 B;  3CCU 3;  3KFQ C;  2ZDJ A;  2CX1 A;  3K63 A;  1BIR A;  3CCS 3;  2XRX B;  3EE1 A;  3FG4 A;  1LQM B;  1T2H A;  3ZG0 A;  1IV9 A;  2INX A;  3KII A;  4RNT A;  4WYK A;  4Q53 A;  5EQL A;  3BND A;  1VQ5 3;  1BNI A;  2LYX A;  1R4Y A;  4EV5 A;  1HYF A;  4XBX A;  4QWT A;  3PGB A;  1GY7 A;  3MG1 A;  2HMK B;  5KP3 A;  3DGY A;  1VQ4 3;  3H3H A;  4EV2 A;  4FMC A;  4BTX A;  1G96 A;  2L4V A;  1US1 A;  1EEJ A;  3PS8 A;  5AEU B;  1DVD A;  1KD1 4;  1FGO A;  4O02 B;  3SED A;  1EG9 B;  1RDS A;  1V58 A;  1RLS A;  3GZR A;  5ELU A;  3PXM A;  5GSP A;  5IG0 A;  1C54 A;  4HM7 B;  5LC7 A;  4NPB A;  3NBB A;  4N3V A;  3BNC A;  3LTD A;  1UW1 A;  3BIR A;  2WOH A;  1UDI I;  1W4N A;  3GAX A;  3OWU A;  3V92 A;  2ZL8 A;  3UL6 A;  2D42 A;  1GMQ A;  3AHS A;  3SOA A;  4N6V 0;  1WMP A;  1IK3 A;  1LNH A;  4PEJ A;  2QEX 3;  3A5E A;  2SBL A;  3F9S A;  3FZW A;  4G1M B;  3MG3 A;  5CXO A;  1LRA A;  3JUQ A;  1YGE A;  2HMO B;  1K41 A;  1TTO A;  2YFI B;  4BIR A;  4L8P A;  1DVC A;  3FF2 A;  2BMO B;  1BRN L;  3HIG A;  4O2H A;  1GD3 A;  3SXX A;  2KF4 A;  3CCQ 3;  3NM7 A;  2QIY A;  1BNG A;  1HKX A;  3MSO A;  3NQZ A;  2PZV A;  4KFF A;  1GSP A;  1N8Q A;  3LTB A;  4CDL A;  1RHL A;  3CCM 3;  4XB5 A;  3X3X A;  1UGI A;  2KF3 A;  7RNT A;  2E2T A;  1VQQ A;  1CYV A;  1IT8 A;  3G0K A;  1UI8 A;  1W2Z A;  3EHC A;  1M1K 4;  5M1A A;  1VQL 3;  4WFO A;  1TRP A;  2W2C A;  4I4K A;  2C4B A;  3ALA A;  3ROB A;  4LZI A;  3DM8 A;  4J9A A;  3S27 A;  3STD A;  4FCJ A;  4HJL B;  4O8S A;  3URP A;  1IQ8 A;  3FG1 A;  1RCK A;  2E2V A;  3KN4 A;  1BSB A;  4N6N B;  4RBN A;  3U1W A;  1Q81 4;  5EEO A;  5AEW B;  1CH0 A;  1TP6 A;  2H0I A;  1JN5 B;  3WA2 X;  1AY7 A;  3FGY A;  4WWU C;  2CFG A;  5EVH A;  5I97 A;  3CC4 3;  2FNQ A;  2RFR A;  5A0O B;  3NQY A;  1JV2 B;  1W6G A;  3PCS A;  6GSP A;  1N8R 4;  1B20 A;  1A67 A;  3WOD G;  1V57 A;  3I0Y A;  4JRF A;  3E99 A;  1IVX A;  1BSD A;  5HOH A;  3NUV A;  1QVF 2;  1ROA A;  1WTH A;  2F99 A;  1JBR A;  2RCD A;  1ULI B;  3KSP A;  1KQS 2;  2P38 A;  3FKA A;  1PFP A;  3FLJ A;  4BTY A;  5STD A;  1O7M B;  1RN7 A;  1MWS A;  2C11 A;  1CEW I;  2BT3 A;  1X1W A;  1B3S A;  1O7W B;  4BU4 A;  3K0Z A;  2XSH B;  1FA3 A;  1AVK A;  2KCD A;  2W0Q A;  4R1K A;  3WHO A;  2RSX A;  3JUM A;  3S28 A;  1T3B A;  1OHO A;  4LSO A;  2IA7 A;  2K54 A;  4RNZ A;  4X2O A;  2YFJ B;  3GSP A;  5AIH A;  2FGT A;  1OCV A;  1RGL A;  5IER A;  1A90 A;  5JPU A;  4AEQ A;  1DMQ A;  1F8N A;  3G71 3;  2PNC A;  4XM4 A;  1FW7 A;  4HM4 B;  4XDV A;  5JBS A;  1GMR A;  3X40 A;  4HM8 B;  3Q3F A;  4OK0 A;  5ELJ A;  1YGW A;  3DY5 A;  2IMJ A;  2MF7 A;  1N9E A;  1R4C A;  3JUP A;  3QK9 A;  4HZ9 B;  5CF1 A;  3OV4 A;  8CHO A;  1CQS A;  4IIA A;  2CH9 A;  3SOY A;  3HZP A;  1NJI 4;  2GBX B;  4KFD A;  1FGT A;  1D6Z A;  1T2I A;  3LML A;  2CC3 A;  2OQE A;  2BNG A;  5LC6 A;  1RNT A;  4LYL B;  3M8C A;  1IQY A;  3G8Z A;  3RDE A;  3KKG A;  4N6M A;  4NHF A;  1I2E A;  2IY2 A;  3O8Y A;  1BSA A;  1UCJ A;  2KF6 A;  3MG2 A;  4CPK A;  5AYS C;  2H0G A;  1RGH A;  3TDG A;  2W03 A;  5DRE A;  1BVI A;  1G02 A;  1W7C A;  5M18 A;  2CG0 A;  2OWP A;  2A15 A;  1RTU A;  1YJ9 3;  3G4S 3;  5D81 A;  1PYL A;  1IVW A;  3FG3 A;  1M90 4;  1RGG A;  2GSP A;  2LQV A;  1W2B 2;  5KP4 A;  3I56 3;  2Z7A A;  3RNT A;  3WR2 A;  2O9U X;  1QJG A;  1SAR A;  1BU4 A;  1JRQ A;  4K90 B;  1JBS A;  1UUG B;  1GY5 A;  2P09 A;  1NB5 I;  1EQK A;  1RGA A;  1SJW A;  1NU3 A;  1UCL A;  3B4P A;  2UGI A;  1ROV A;  2SAR A;  4HKV B;  4CJN A;  1O7H B;  3FSD A;  3SLU A;  5CK6 A;  4J5G A;  4MMZ B;  2Y74 A;  5AIF A;  3UL5 A;  2F56 A;  1RGF A;  4EBG A;  2CW9 A;  3EC9 A;  3NM2 A;  1ZS7 A;  3UB1 A;  2AAE A;  3I55 3;  1GOU A;  3BLZ A;  1BAN A;  3LT9 A;  3CME 3;  1I0V A;  1ZX2 A;  3MYT A;  1JB2 A;  3LOY A;  1OF5 A;  1JB4 A;  4KZ1 A;  1RKY A;  1N5P A;  1OUN A;  1YJN 3;  1VQ8 3;  5FW5 A;  3F8X A;  1U5O A;  1KWI A;  2E2U A;  4LEH A;  1Q7Y 4;  3GRD A;  1I3F A;  1OPY A;  1VQM 3;  2P0X A;  3F7X A;  3HK4 A;  4WYK B;  1ASK A;  2W56 B;  3IMA B;  3T8N A;  1IDP A;  3K7C A;  5AIG A;  3D5I A;  3MHE A;  3EQQ B;  1W5Z A;  3AMO A;  4NRE A;  1B2S A;  1TFK A;  2BO9 B;  1FGR A;  2BHM A;  4AKZ A;  1C7H A;  3S67 A;  2K0M A;  1WMO A;  4GHO A;  2GU1 A;  4J5K A;  3PZW A;  1RCL A;  1E97 A;  3WA3 A;  1OH0 A;  5HGR A;  1W00 A;  1RRL A;  1BNF A;  2F5M A;  1IT7 A;  3CCV 3;  4H61 A;  3D4A A;  1DYU A;  3JUN A;  6STD A;  1J2B A;  2OQE C;  2C10 A;  2IUJ A;  1LOX A;  1Q42 A;  1Q40 B;  4EXR A;  2CHC A;  2F4Y A;  1LXE A;  1FUS A;  1YVB I;  1BNS A;  5IEN A;  4I5Q A;  1OHP A;  2XEP A;  3X3Y A;  1UGH I;  3DUK A;  2CK3 H;  3CNX A;  4H3U A;  1BNR A;  1G0T A;  2FXT A;  2OOV C;  4LMI A;  2BIR A;  1JN5 A;  2W04 A;  1LNI A;  1BGS A;  1D6Y A;  4HYZ A;  1UCI A;  2CX0 A;  4N6U A;  5G2G A;  3KZT A;  1W02 A;  1BRG A;  1O7N B;  3CXC 2;  1GYB A;  1TIJ A;  3NV0 A;  4MMY B;  5AYR B;  1HZ1 A;  1B2M A;  1RGE A;  4K1V A;  1UCK A;  1GMP A;  1V74 A;  2CWV A;  1TRQ A;  3D9R A;  1X1X A;  3K9M C;  3WOF B;  2P05 A;  4HM6 B;  1JKG A;  1Q86 4;  2XH9 A;  1ISK A;  2CG1 A;  1NNV A;  3ECF A;  2KF5 A;  4U13 A;  4FCZ A;  2CWT A;  1OHS A;  2W56 A;  3GWR A;  2HMN B;  4GL6 A;  3EBY A;  1TJD A;  1BRI A;  1NO3 A;  1MGW A;  4WP5 A;  1B2Z A;  4J8T A;  1I0X A;  2R41 A;  3DGO A;  3WOE B;  3CCL 3;  2RNT A;  2F86 B;  3AHW A;  1YNV X;  4BTW A;  2CFD A;  4HAA A;  4IPB A;  4R4K A;  1Z1S A;  3NBJ A;  4FMA A;  1FZU A;  3B4O A;  2BMR B;  3LZA A;  3OX9 A;  3X41 A;  3CD6 3;  1W01 A;  1QAF A;  1T5Y A;  3F7S A;  2OOV A;  1AVL A;  1SIH A;  3Q2P A;  1JJ2 2;  2HMJ B;  2L1S A;  1LOW A;  2Z6B A;  4L8O A;  4XBY A;  4XDW A;  1K28 A;  1IV7 A;  3BNE A;  3EB8 A;  3EJV A;  5IEO A;  1EUI C;  4HM3 B;  3CPO A;  3D5G A;  1BOX A;  7STD A;  1LQG C;  2R4I A;  5FGO A;  1VZZ A;  1DMM A;  1K73 4;  1RSN A;  2W9P A;  2IUK A;  1YIJ 3;  4MMX B;  4KT3 B;  1AQZ A;  3OWY A;  4JF8 A;  4N6L A;  2V1L A;  4BL3 A;  2CFW A;  4BL2 A;  3KSE D;  3AGO A;  1L5G B;  3H51 A;  1S72 3;  2Z77 A;  5AII A;  2JQ5 A;  1N5H A;  2F5W A;  2WOF A;  3F14 A;  3RGA A;  3DH2 A;  3S5C A;  9RNT A;  2XSO B;  3LYG A;  4N6O B;  3G6E 3;  5AI1 A;  4R9K A;  1EKM A;  4ZM8 A;  1K9M 4;  1VQN 3;  3WDG B;  2RGQ A;  5KP1 A;  1Q9E A;  3NBR A;  3N8B A;  6RNT A;  2OTL 3;  1DMN A;  1GOV A;  1KSI A;  2WO0 A;  1IU7 A;  1BAO A;  1Q40 A;  2XFS A;  3A76 A;  3LTC A;  4HM1 B;  1PY3 A;  1UUV B;  2H0H A;  2W6J H;  2O3O A;  3HOH A;  3CC2 3;  3OW2 2;  2CWU A;  4EYC A;  1K8A 4;  1OF5 B;  1ULJ B;  3DXO A;  3G16 A;  2ZHX B;  1JBT A;  3D3L A;  3V98 A;  7GSP A;  1I3I A;  3CC7 3;  2XFT A;  3DMC A;  3B7C A;  1MWU A;  2GBW B;  3NXJ A;  3D79 A;  4FR9 A;  4ORL A;  3T8U A;  5JPP A;  5RNT A;  1U8C B;  1TUH A;  3HII A;  1NDO B;  3JVC A;  4FCM A;  4HOH A;  4TX4 A;  3S29 A;  3ZG5 A;  4AKY A;  4OVM A;  1FYS A;  1M9G A;  1Q7H A;  2BU4 A;  2KRT A;  5TGN A;  5IF6 A;  2GU3 A;  1A2P A;  1O7G B;  4STD A;  1VQ9 3;  3MKI A;  4R9L A;  3DGN A;  2CIU A;  1BSE A;  4HBR A;  4EW5 A;  1YVS A;  1RGK A;  2STD A;  4MEI A;  1JKG B;  1STD A;  3ER7 A;  1BRH A;  3BNB A;  1X1Y A;  1MNL A;  3K5T A;  3KE7 A;  3CPW 2;  1DET A;  4IT7 A;  4OUQ A;  3CCR 3;  3VF1 A;  3AMO B;  3DZL A;  2QGU A;  2JDI H;  1WQL B;  3EBT A;  1IVV A;  3QRD A;  1VQ6 3;  3GZX B;  5BU4 A;  3MPH A;  2Q07 A;  1OGZ A;  2UUG C;  2XGN A;  3UJM A;  3UNL A;  1WNH A;  1VQ7 3;  1JNQ A;  4ILF A;  1LOY A;  1GS3 A;  1JZO A;  3F8H A;  5M19 A;  3J7Y d;  1YJW 3;  1KC8 4;  2CKF B;  4RZM A;  3PCR A;  3Q1C A;  1FGQ A;  3SYU A;  2OCT A;  1GOY A;  1LVN A;  1RGC A;  2BMQ B;  2Y73 A;  1RNB A;  4KVH A;  3EN1 B;  3HX8 A;  4K61 A;  3SX1 A;  1BUQ A;  2GXF A;  1A2V A;  4WHA A;  4N6T A;  1YIT 3;  3GZB A;  1RRH A;  1ZGX A;  2YX9 A;  4HM0 B;  3HI7 A;  1X1U A;  3AGN A;  1TFO A;  1W6C A;  1BRK A;  4HZB B;  1MOL A;  3PYJ A;  4RNY A;  2UX0 A;  1YHQ 3;  1CYU A;  1JB5 A;  3BB9 A;  4DKI A;  3CCE 3;  1W6Y A;  5IG3 A;  2ZA4 A;  3BU4 A;  4X2H A;  5D82 A;  4FMB A;  5BXQ A;  2OTJ 3;  4FMD A;  3CCJ 3;  1OGX A;  1BRJ A;  2HOH A;  3DGL A;  1QAK A;  1IVU A;  1STF I;  2HML B;  1NB3 I;  1RJO A;  4LGQ A;  1AR0 A;  5D83 A;  1NWW A;  1UI7 A;  5IG5 A;  3ZFZ A;  1I2G A;  5BVB A;  2GEX A;  2YFL B;  2W9Q A;  1SQW A;  3NHX A;  3KCH A;  3SVA A;  1BUJ A;  3OXA A;  3EF8 A;  3OWS A;  1RMS A;  1A2K A;  1FUW A;  3LTA A;  1I2F A;  1RN4 A;  3N54 B;  1JZD A;  4HM2 B;  2I9W A;  3L0R A;  1SPU A;  2XR8 B;  3T0U A;  1DE3 A;  3CU3 A;  3GZY B;  1B21 A;  3X42 A;  1B2U A;  2XF3 A;  1AV4 A;  2RBI A;  1WMN A; 
#chains in the Genus database with same CATH homology
 2ZHX B;  1UGH I;  4LYL B;  1UUG B;  1EUI C;  2UUG C;  1UDI I;  2J8X B;  1UGI A;  1LQG C;  1LQM B;  2UGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...