1UGHI

Crystal structure of human uracil-dna glycosylase in complex with a protein inhibitor: protein mimicry of dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (URACIL-DNA GLYCOSYLASE)
publication title Crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor: protein mimicry of DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Glycosylase
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 1999-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1ughI00
1LQMB 1UUGB 1EUIC 1UDII 1LQGC 1UGHI 2ZHXB 2UGIA 1UGIA 2J8XB 2UUGC 4LYLB
chains in the Genus database with same CATH superfamily
2W56B 3AMOA 4GHOA 1Q9EA 1X1YA 2KF6A 3IMAB 1GMRA 1NO3A 1V74A 2OCTA 3LH4A 3LYGA 2KRTA 4QWTA 4Q53A 4CDLA 2W0QA 5IW9A 3F9SA 1DVCA 2RGQA 1ASKA 4O02B 4ZM8A 4JF8A 1RGHA 1RNBA 3B4PA 1FW7A 4XDVA 3HZPA 3GRDA 3K63A 3LTBA 1RNTA 1ROAA 4OUQA 3DMCA 2HMMB 1O7MB 3V92A 5BIRA 3ALAA 3CNMA 3X3ZA 2KF4A 2D1WA 4K90B 3N54B 4O3VA 1BGSA 2C10A 3G713 1GMPA 4HYZA 2B1XB 3B7CA 4X2OA 5AI1A 4BIRA 1OACA 4EV2A 4BTXA 5G1LA 3MYTA 3S27A 1EQKA 3ZG0A 2K0MA 2RCDA 3NV0A 4EBGA 3CPW2 1VQQA 2JDIH 1KD14 1PFPA 2A15A 2BT3A 4OVMA 1BRSA 1TRPA 2ZHXB 4RBNA 1R4CA 3EBTA 2I9WA 1GY5A 3EQQB 4HM7B 3GWRA 2IUJA 4STDA 2CH9A 2W9QA 4AEQA 4N3VA 5EQLA 4HM6B 3LTCA 2J8XB 6STDA 2XGNA 4I4KA 2STDA 5GSPA 2L4VA 3IPTA 3UL5A 5IF6A 1STDA 1DYUA 3WMDA 2E2VA 1UI8A 1I3FA 4RNYA 2OTL3 1US1A 3K7CA 3LMLA 3Q2PA 1SARA 1OHSA 4HBRA 4JRFA 1BSCA 2CFLA 1RN1A 1UGHI 4N6MA 4NPBA 3FG3A 1W6CA 1IT7A 4J5GA 1SJWA 1QVF2 2Z6BA 1TIJA 4U13A 3F40A 1BRNL 1HU9A 1ZX2A 3UJMA 3DGYA 3G4S3 1EG9B 2MF7A 3MPHA 1WMPA 1MWUA 2WOHA 3AGOA 4FCZA 3FF2A 1NDOB 2IMJA 1TU5A 3CMA3 3JVCA 1VQ63 3KZTA 2GEYA 3LZAA 4EXRA 2B24B 3D3LA 3N8BA 1W6YA 2HMLB 5AEUB 1UUVB 3AHWA 3MG2A 3IJEB 1BSAA 3AGNA 2GEXA 1I0XA 1UCLA 3EX9A 6RNTA 1VQ83 1JKGB 4RNTA 3AHSA 4EW5A 3BB9A 1MGRA 3MHEA 4MMZB 1RKYA 4FMAA 3FLJA 1K734 2R4IA 1OF5A 3NHXA 3B8LA 3JUNA 3CCU3 1JJ22 1YGEA 3NQZA 4BTYA 2AADA 1OHPA 3EJVA 2QEX3 1J2BA 1L5GB 5M18A 3CPOA 3WR2A 3OW22 2IUKA 1S5AA 3CCR3 1JNQA 3F7SA 2LYXA 3GAXA 1NU3A 2CW9A 4BL3A 7RNTA 1DMQA 3QRDA 3VGNA 1OCVA 3NM7A 3SYUA 4GB5A 2CG1A 2UUGC 3K5TA 1I70A 1LQMB 3SEDA 1TRQA 4WHAA 4HOHA 5ELUA 5A0OB 3GSPA 3DZLA 1BSBA 1JN5A 1I3IA 2CIUA 4FMCA 2UX0A 1FGQA 5IEOA 2E2UA 3WA3A 3MG3A 1VQP3 2BMOB 1AVKA 1BAOA 3EHCA 3MWZA 4HM4B 4K1VA 2YFIB 1UCJA 1RHLA 1Q7Y4 2YFLB 1JKGA 3JUMA 3EE1A 3NXJA 2F86B 1BSDA 1VQO3 1N8R4 5DREA 4N6V0 2E2TA 3KSPA 1YJ93 2OOVA 1YNVX 1TJDA 4HM2B 1UGIA 1FGMA 1NWWA 1GD4A 2HMOB 2GXFA 3G6E3 2P05A 4L8PA 1RGGA 1I2FA 3RNTA 3UB1A 1JB2A 3GZYB 3PXMA 3CC43 3KIIA 2BMQB 5D83A 4XBYA 1GMQA 1JBSA 1VQN3 5EEOA 5CF2A 1LOYA 2P0MA 5TGNA 3SXXA 3ZG5A 3EF8A 2CC3A 9RNTA 1X1XA 5KP4A 4WP5A 2K54A 4MEIA 1GOYA 2Y74A 1ROVA 1RGCA 3WOFB 1CH0A 4HM1B 1PYLA 2BO9B 3DGLA 4X2HA 5IG3A 1KSIA 1YVBI 3DGOA 4H61A 2OQEC 1WMOA 3F8XA 1KQS2 2R41A 3CCM3 1BRIA 1MGWA 1T3BA 1LQGC 1M1XB 5DRVA 1W01A 2QIYA 1MOLA 3BIRA 3CCL3 1QAKA 3DGMA 3T8NA 1ZS7A 1RSNA 3LOYA 1G02A 1U5OA 1K9M4 1N9JA 1Q864 1BSEA 1K8A4 1TFOA 2BIRA 3ECFA 1YJN3 3NBRA 1VQ93 3OX9A 1EA2A 1IT8A 1NB3I 4KFFA 3X41A 1A2PA 1VQ53 3DGNA 5AIHA 5FGOA 3SLUA 3D79A 1YIT3 3I553 3OV4A 1RGLA 2F99A 3Q90A 3PZWA 1BUJA 1OPYA 1M9GA 1QAFA 2YX9A 1OF5B 1STFI 3FG1A 4ORLA 3SOAA 3CC23 1CQSA 4KZ1A 5G2GA 1C54A 3S29A 2QGUA 1UUGB 3EC9A 3F8HA 4ILFA 4HKVB 2IY2A 1IVUA 3GZXB 2GBWB 2IA7A 2HMJB 1GY7A 1RJOA 2OWPA 3F7XA 3FG4A 2RBIA 3HIIA 5RNTA 2KAAA 1Q42A 5AYSC 1CYUA 1UW1A 1JV2B 1LNHA 1W02A 2CWUA 1WTHA 2D42A 3NX0A 1IK3A 5D81A 1JBRA 1K28A 1ZO2A 5IENA 1SPUA 1B3SA 1JN5B 2BHMA 2H0HA 1GS3A 1W4NA 3KKGA 1RRLA 2XRXB 1BVIA 4N6OB 1BRKA 1D6YA 5BU4A 1UI7A 4K61A 2CFDA 4N6UA 1YHQ3 3H3HA 3ROBA 1W2B2 3DY5A 3S28A 1B2SA 2F5WA 3KCHA 2GU1A 5AIIA 1W7CA 4KT3B 3M8CA 1O7NB 1GOUA 1N9EA 2GSPA 2WO0A 1I0VA 1Q40A 4LMIA 4N6NB 1VQ73 2BU4A 3HX8A 4LSOA 1IVXA 3DXOA 5KP3A 1X1UA 1T2IA 3CCJ3 2KF5A 4CPKA 3LTDA 2ZA4A 1LVNA 4HVNA 1QALA 1TTOA 2HMNB 1IDPA 1IVWA 4NREA 1RGFA 2K3DA 1LNIA 4FCJA 2CFWA 4IPBA 3LXUX 3PCSA 3NQYA 4H3UA 1BNIA 1RCKA 1RN7A 1GYBA 5EVHA 1DVDA 3GZBA 2O9UX 1OUNA 2CKFB 3KFQC 4XBXA 3UNLA 3V99A 5IERA 1RRHA 4EYCA 3A76A 1BOXA 3PYJA 4DKIA 5JBSA 3GZRA 1FUTA 3CC73 2FNQA 3H51A 1HZ1A 3BLZA 3D5GA 4O8SA 3BNDA 4WFOA 2AAEA 4EV5A 1B27A 4CJNA 1FUSA 1ISKA 2P0XA 4BL2A 3CME3 4FMBA 5IG4A 4J8TA 1NNVA 1RGKA 1QJGA 2CFKA 2KCDA 3N9HA 1Q814 1DMNA 2HOHA 3A5EA 1SIHA 1BNFA 4TX4A 2MC8A 2RFRA 1GSPA 3BNCA 3T0UA 4BTWA 1D6ZA 2IYJA 1BRGA 4L7KA 3VSYA 1JZOA 3UL6A 3NBJA 3WA2X 4EC6A 3D9RA 1BRJA 4CCVA 3CCQ3 1CEWI 2GBXB 1VQL3 4HM3B 1CYVA 2XFTA 3FKAA 2FGTA 1UCKA 1V57A 3CU3A 1YVSA 2V1LA 1JB5A 4AKZA 1NB5I 5JPPA 2CWVA 2WGOA 1X1WA 2ML5A 2OOVC 4L8OA 5ELJA 4RNZA 5FW5A 3WDGB 1A90A 1BUQA 1FA3A 2P09A 5CK6A 3KE7A 4LGQA 5M1AA 1A67A 1D6UA 2WOFA 1A2VA 5IG0A 1TUHA 1IQYA 1LOXA 3CCV3 4XBTA 4HZBB 3CCS3 1O7PB 1EEJA 1W2ZA 2YFJB 4R9KA 2CWTA 1K41A 1VQK3 1IU7A 2H0GA 4FR9A 1MWRA 4N6TA 5IEPA 3CNXA 5AIFA 1PU4A 3SOYA 3NBBA 2LQVA 3ZFZA 1NJI4 1WNHA 4GSPA 2XSHB 2KXGA 3OWUA 5HOHA 1AQZA 1O7GB 3G16A 3BU4A 1IV7A 2W6JH 3I0YA 1N5HA 2Z7AA 1ZGXA 3JUQA 1BNJA 2OQEA 1WMNA 2PZVA 1UCIA 3BNEA 3NUVA 4K1UA 1IV9A 5AYRB 5BVBA 1BNRA 4MMYB 1E97A 3MSOA 1YJW3 2W2CA 2Q07A 3DUKA 1KWIA 5CF1A 7GSPA 2BMRB 1IVVA 1JB4A 3OWYA 1B2XA 5KP1A 1S723 3EB8A 5CXOA 1BNSA 1Q40B 1WQLB 3MG1A 5I97A 3MKIA 1VQM3 3TDGA 3FZWA 4MJDA 3WHOA 3DH2A 1V58A 1E3VA 3RGRA 5AIGA 5D82A 3VF1A 1JZDA 1AR0A 2CX0A 2JQ5A 1FGTA 1IYYA 1RGAA 1OGXA 1YI23 1M904 1RLSA 2Y73A 1HKXA 3QK9A 1LXEA 1T2HA 2L1SA 1HYFA 4KFEA 4WYKB 2XF3A 3CCE3 1RGEA 1QMAA 3EBYA 3F14A 3U1WA 4FCMA 1FGRA 1RDSA 1RMSA 2W56A 5LC7A 2GU3A 2F4YA 3X3YA 4KVHA 1Y4KA 3URPA 3RDEA 1AV4A 1B2ZA 1BANA 1OH0A 3OXAA 2Z76A 1MWTA 3Q1CA 2INXA 1T5YA 1AY7A 3KSED 3ER7A 4R4KA 1LOVA 5JPUA 1BRHA 4HAAA 8RNTA 1R4YA 2CX1A 2F98A 2SARA 3D5IA 5CLKA 2XGLA 3U97A 2OTJ3 4BU4A 3CD63 3X40A 2BNGA 3X42A 3JUPA 4HM8B 3STDA 1TFKA 3T8UA 4HJLB 3HIGA 1W6GA 4AKYA 4XM4A 3D4AA 1I2GA 2P38A 4GL6A 1IQXA 1BNGA 4PEJA 2W03A 3S5CA 3X3XA 1UDII 4O2HA 1TP6A 1B20A 2UGIA 1ULJB 1G96A 3JUOA 1PY3A 3G8ZA 4KFDA 4NHFA 1AVLA 1VZZA 1RCLA 3EN8A 1ULIB 4R9LA 1A2KA 1IQ8A 2M7OA 1RTUA 3FCSB 4J5KA 5HGRA 3WODG 1C7HA 2QA43 2C11A 3E99A 1E3RA 3LT9A 4WWUC 5LC6A 1EUIC 3S67A 3EN1B 4J9AA 4I5QA 4WYKA 2C4BA 4HM5B 3WOEB 1RN4A 1GOVA 1GD3A 1YIJ3 2ML6A 3FSDA 1VQ43 1I2EA 4LZIA 1Z1SA 2SBLA 5STDA 4HZ9B 8CHOA 1F8NA 1Q824 1YGWA 1B21A 1O7HB 3FF0A 1O7WB 4XB5A 1BNEA 3I563 3L0RA 3DM8A 3SVAA 3BNBA 4XDWA 1W5ZA 3J7Yd 3K9MC 3G0KA 2FXTA 4OK0A 1B2MA 1W00A 1FUWA 2W9PA 5BXQA 1LRAA 2ZL8A 4LYLB 3PCRA 4G1MB 3HK4A 3AMOB 2F5MA 2ZDJA 3B4OA 3PS8A 1Q7HA 3HOHA 1G0TA 2XFSA 1I8VA 3PGBA 1FYSA 2RSXA 4R80A 4RZMA 1FGOA 2CG0A 1GY6A 4HM0B 2WGQA 1B2UA 1JBTA 5M19A 2CHCA 4LEHA 1U8CB 6GSPA 2F56A 2Z77A 2CFGA 1BIRA 1OGZA 1N8QA 1SQWA 2XSOB 4IT7A 2O3OA 3HI7A 2PNCA 2XH9A 1KC84 3O8YA 1EKMA 3FH1A 1MWSA 4N6LA 1N5PA 3K0ZA 1M1K4 4FMDA 3SX1A 1LOWA 4MMXB 4IIAA 4R1KA 7STDA 1JRQA 3V98A 1QVG2 2RNTA 2KF3A 3Q3FA 3KN4A 2W04A 3NV0B 1OHOA 2CK3H 3FGYA 3CXC2 5G1KA 1BU4A 1SIIA 3OWSA 5IG5A 3LT8A 1DETA 2H0IA 1DMMA 2HMKB 2XEPA 3NM2A 1DE3A 1UUWB 1FZUA 3LTAA 5AEWB 2XR8B 3RGAA 1MNLA
chains in the Genus database with same CATH topology
1LQMB 1UUGB 1EUIC 1UDII 1LQGC 1UGHI 2ZHXB 2UGIA 1UGIA 2J8XB 2UUGC 4LYLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQM B;  1UUG B;  1EUI C;  1UDI I;  1LQG C;  1UGH I;  2ZHX B;  2UGI A;  1UGI A;  2J8X B;  2UUG C;  4LYL B; 
#chains in the Genus database with same CATH topology
 2W56 B;  3AMO A;  4GHO A;  1Q9E A;  1X1Y A;  2KF6 A;  3IMA B;  1GMR A;  1NO3 A;  1V74 A;  2OCT A;  3LH4 A;  3LYG A;  2KRT A;  4QWT A;  4Q53 A;  4CDL A;  2W0Q A;  5IW9 A;  3F9S A;  1DVC A;  2RGQ A;  1ASK A;  4O02 B;  4ZM8 A;  4JF8 A;  1RGH A;  1RNB A;  3B4P A;  1FW7 A;  4XDV A;  3HZP A;  3GRD A;  3K63 A;  3LTB A;  1RNT A;  1ROA A;  4OUQ A;  3DMC A;  2HMM B;  1O7M B;  3V92 A;  5BIR A;  3ALA A;  3CNM A;  3X3Z A;  2KF4 A;  2D1W A;  4K90 B;  3N54 B;  4O3V A;  1BGS A;  2C10 A;  3G71 3;  1GMP A;  4HYZ A;  2B1X B;  3B7C A;  4X2O A;  5AI1 A;  4BIR A;  1OAC A;  4EV2 A;  4BTX A;  5G1L A;  3MYT A;  3S27 A;  1EQK A;  3ZG0 A;  2K0M A;  2RCD A;  3NV0 A;  4EBG A;  3CPW 2;  1VQQ A;  2JDI H;  1KD1 4;  1PFP A;  2A15 A;  2BT3 A;  4OVM A;  1BRS A;  1TRP A;  2ZHX B;  4RBN A;  1R4C A;  3EBT A;  2I9W A;  1GY5 A;  3EQQ B;  4HM7 B;  3GWR A;  2IUJ A;  4STD A;  2CH9 A;  2W9Q A;  4AEQ A;  4N3V A;  5EQL A;  4HM6 B;  3LTC A;  2J8X B;  6STD A;  2XGN A;  4I4K A;  2STD A;  5GSP A;  2L4V A;  3IPT A;  3UL5 A;  5IF6 A;  1STD A;  1DYU A;  3WMD A;  2E2V A;  1UI8 A;  1I3F A;  4RNY A;  2OTL 3;  1US1 A;  3K7C A;  3LML A;  3Q2P A;  1SAR A;  1OHS A;  4HBR A;  4JRF A;  1BSC A;  2CFL A;  1RN1 A;  1UGH I;  4N6M A;  4NPB A;  3FG3 A;  1W6C A;  1IT7 A;  4J5G A;  1SJW A;  1QVF 2;  2Z6B A;  1TIJ A;  4U13 A;  3F40 A;  1BRN L;  1HU9 A;  1ZX2 A;  3UJM A;  3DGY A;  3G4S 3;  1EG9 B;  2MF7 A;  3MPH A;  1WMP A;  1MWU A;  2WOH A;  3AGO A;  4FCZ A;  3FF2 A;  1NDO B;  2IMJ A;  1TU5 A;  3CMA 3;  3JVC A;  1VQ6 3;  3KZT A;  2GEY A;  3LZA A;  4EXR A;  2B24 B;  3D3L A;  3N8B A;  1W6Y A;  2HML B;  5AEU B;  1UUV B;  3AHW A;  3MG2 A;  3IJE B;  1BSA A;  3AGN A;  2GEX A;  1I0X A;  1UCL A;  3EX9 A;  6RNT A;  1VQ8 3;  1JKG B;  4RNT A;  3AHS A;  4EW5 A;  3BB9 A;  1MGR A;  3MHE A;  4MMZ B;  1RKY A;  4FMA A;  3FLJ A;  1K73 4;  2R4I A;  1OF5 A;  3NHX A;  3B8L A;  3JUN A;  3CCU 3;  1JJ2 2;  1YGE A;  3NQZ A;  4BTY A;  2AAD A;  1OHP A;  3EJV A;  2QEX 3;  1J2B A;  1L5G B;  5M18 A;  3CPO A;  3WR2 A;  3OW2 2;  2IUK A;  1S5A A;  3CCR 3;  1JNQ A;  3F7S A;  2LYX A;  3GAX A;  1NU3 A;  2CW9 A;  4BL3 A;  7RNT A;  1DMQ A;  3QRD A;  3VGN A;  1OCV A;  3NM7 A;  3SYU A;  4GB5 A;  2CG1 A;  2UUG C;  3K5T A;  1I70 A;  1LQM B;  3SED A;  1TRQ A;  4WHA A;  4HOH A;  5ELU A;  5A0O B;  3GSP A;  3DZL A;  1BSB A;  1JN5 A;  1I3I A;  2CIU A;  4FMC A;  2UX0 A;  1FGQ A;  5IEO A;  2E2U A;  3WA3 A;  3MG3 A;  1VQP 3;  2BMO B;  1AVK A;  1BAO A;  3EHC A;  3MWZ A;  4HM4 B;  4K1V A;  2YFI B;  1UCJ A;  1RHL A;  1Q7Y 4;  2YFL B;  1JKG A;  3JUM A;  3EE1 A;  3NXJ A;  2F86 B;  1BSD A;  1VQO 3;  1N8R 4;  5DRE A;  4N6V 0;  2E2T A;  3KSP A;  1YJ9 3;  2OOV A;  1YNV X;  1TJD A;  4HM2 B;  1UGI A;  1FGM A;  1NWW A;  1GD4 A;  2HMO B;  2GXF A;  3G6E 3;  2P05 A;  4L8P A;  1RGG A;  1I2F A;  3RNT A;  3UB1 A;  1JB2 A;  3GZY B;  3PXM A;  3CC4 3;  3KII A;  2BMQ B;  5D83 A;  4XBY A;  1GMQ A;  1JBS A;  1VQN 3;  5EEO A;  5CF2 A;  1LOY A;  2P0M A;  5TGN A;  3SXX A;  3ZG5 A;  3EF8 A;  2CC3 A;  9RNT A;  1X1X A;  5KP4 A;  4WP5 A;  2K54 A;  4MEI A;  1GOY A;  2Y74 A;  1ROV A;  1RGC A;  3WOF B;  1CH0 A;  4HM1 B;  1PYL A;  2BO9 B;  3DGL A;  4X2H A;  5IG3 A;  1KSI A;  1YVB I;  3DGO A;  4H61 A;  2OQE C;  1WMO A;  3F8X A;  1KQS 2;  2R41 A;  3CCM 3;  1BRI A;  1MGW A;  1T3B A;  1LQG C;  1M1X B;  5DRV A;  1W01 A;  2QIY A;  1MOL A;  3BIR A;  3CCL 3;  1QAK A;  3DGM A;  3T8N A;  1ZS7 A;  1RSN A;  3LOY A;  1G02 A;  1U5O A;  1K9M 4;  1N9J A;  1Q86 4;  1BSE A;  1K8A 4;  1TFO A;  2BIR A;  3ECF A;  1YJN 3;  3NBR A;  1VQ9 3;  3OX9 A;  1EA2 A;  1IT8 A;  1NB3 I;  4KFF A;  3X41 A;  1A2P A;  1VQ5 3;  3DGN A;  5AIH A;  5FGO A;  3SLU A;  3D79 A;  1YIT 3;  3I55 3;  3OV4 A;  1RGL A;  2F99 A;  3Q90 A;  3PZW A;  1BUJ A;  1OPY A;  1M9G A;  1QAF A;  2YX9 A;  1OF5 B;  1STF I;  3FG1 A;  4ORL A;  3SOA A;  3CC2 3;  1CQS A;  4KZ1 A;  5G2G A;  1C54 A;  3S29 A;  2QGU A;  1UUG B;  3EC9 A;  3F8H A;  4ILF A;  4HKV B;  2IY2 A;  1IVU A;  3GZX B;  2GBW B;  2IA7 A;  2HMJ B;  1GY7 A;  1RJO A;  2OWP A;  3F7X A;  3FG4 A;  2RBI A;  3HII A;  5RNT A;  2KAA A;  1Q42 A;  5AYS C;  1CYU A;  1UW1 A;  1JV2 B;  1LNH A;  1W02 A;  2CWU A;  1WTH A;  2D42 A;  3NX0 A;  1IK3 A;  5D81 A;  1JBR A;  1K28 A;  1ZO2 A;  5IEN A;  1SPU A;  1B3S A;  1JN5 B;  2BHM A;  2H0H A;  1GS3 A;  1W4N A;  3KKG A;  1RRL A;  2XRX B;  1BVI A;  4N6O B;  1BRK A;  1D6Y A;  5BU4 A;  1UI7 A;  4K61 A;  2CFD A;  4N6U A;  1YHQ 3;  3H3H A;  3ROB A;  1W2B 2;  3DY5 A;  3S28 A;  1B2S A;  2F5W A;  3KCH A;  2GU1 A;  5AII A;  1W7C A;  4KT3 B;  3M8C A;  1O7N B;  1GOU A;  1N9E A;  2GSP A;  2WO0 A;  1I0V A;  1Q40 A;  4LMI A;  4N6N B;  1VQ7 3;  2BU4 A;  3HX8 A;  4LSO A;  1IVX A;  3DXO A;  5KP3 A;  1X1U A;  1T2I A;  3CCJ 3;  2KF5 A;  4CPK A;  3LTD A;  2ZA4 A;  1LVN A;  4HVN A;  1QAL A;  1TTO A;  2HMN B;  1IDP A;  1IVW A;  4NRE A;  1RGF A;  2K3D A;  1LNI A;  4FCJ A;  2CFW A;  4IPB A;  3LXU X;  3PCS A;  3NQY A;  4H3U A;  1BNI A;  1RCK A;  1RN7 A;  1GYB A;  5EVH A;  1DVD A;  3GZB A;  2O9U X;  1OUN A;  2CKF B;  3KFQ C;  4XBX A;  3UNL A;  3V99 A;  5IER A;  1RRH A;  4EYC A;  3A76 A;  1BOX A;  3PYJ A;  4DKI A;  5JBS A;  3GZR A;  1FUT A;  3CC7 3;  2FNQ A;  3H51 A;  1HZ1 A;  3BLZ A;  3D5G A;  4O8S A;  3BND A;  4WFO A;  2AAE A;  4EV5 A;  1B27 A;  4CJN A;  1FUS A;  1ISK A;  2P0X A;  4BL2 A;  3CME 3;  4FMB A;  5IG4 A;  4J8T A;  1NNV A;  1RGK A;  1QJG A;  2CFK A;  2KCD A;  3N9H A;  1Q81 4;  1DMN A;  2HOH A;  3A5E A;  1SIH A;  1BNF A;  4TX4 A;  2MC8 A;  2RFR A;  1GSP A;  3BNC A;  3T0U A;  4BTW A;  1D6Z A;  2IYJ A;  1BRG A;  4L7K A;  3VSY A;  1JZO A;  3UL6 A;  3NBJ A;  3WA2 X;  4EC6 A;  3D9R A;  1BRJ A;  4CCV A;  3CCQ 3;  1CEW I;  2GBX B;  1VQL 3;  4HM3 B;  1CYV A;  2XFT A;  3FKA A;  2FGT A;  1UCK A;  1V57 A;  3CU3 A;  1YVS A;  2V1L A;  1JB5 A;  4AKZ A;  1NB5 I;  5JPP A;  2CWV A;  2WGO A;  1X1W A;  2ML5 A;  2OOV C;  4L8O A;  5ELJ A;  4RNZ A;  5FW5 A;  3WDG B;  1A90 A;  1BUQ A;  1FA3 A;  2P09 A;  5CK6 A;  3KE7 A;  4LGQ A;  5M1A A;  1A67 A;  1D6U A;  2WOF A;  1A2V A;  5IG0 A;  1TUH A;  1IQY A;  1LOX A;  3CCV 3;  4XBT A;  4HZB B;  3CCS 3;  1O7P B;  1EEJ A;  1W2Z A;  2YFJ B;  4R9K A;  2CWT A;  1K41 A;  1VQK 3;  1IU7 A;  2H0G A;  4FR9 A;  1MWR A;  4N6T A;  5IEP A;  3CNX A;  5AIF A;  1PU4 A;  3SOY A;  3NBB A;  2LQV A;  3ZFZ A;  1NJI 4;  1WNH A;  4GSP A;  2XSH B;  2KXG A;  3OWU A;  5HOH A;  1AQZ A;  1O7G B;  3G16 A;  3BU4 A;  1IV7 A;  2W6J H;  3I0Y A;  1N5H A;  2Z7A A;  1ZGX A;  3JUQ A;  1BNJ A;  2OQE A;  1WMN A;  2PZV A;  1UCI A;  3BNE A;  3NUV A;  4K1U A;  1IV9 A;  5AYR B;  5BVB A;  1BNR A;  4MMY B;  1E97 A;  3MSO A;  1YJW 3;  2W2C A;  2Q07 A;  3DUK A;  1KWI A;  5CF1 A;  7GSP A;  2BMR B;  1IVV A;  1JB4 A;  3OWY A;  1B2X A;  5KP1 A;  1S72 3;  3EB8 A;  5CXO A;  1BNS A;  1Q40 B;  1WQL B;  3MG1 A;  5I97 A;  3MKI A;  1VQM 3;  3TDG A;  3FZW A;  4MJD A;  3WHO A;  3DH2 A;  1V58 A;  1E3V A;  3RGR A;  5AIG A;  5D82 A;  3VF1 A;  1JZD A;  1AR0 A;  2CX0 A;  2JQ5 A;  1FGT A;  1IYY A;  1RGA A;  1OGX A;  1YI2 3;  1M90 4;  1RLS A;  2Y73 A;  1HKX A;  3QK9 A;  1LXE A;  1T2H A;  2L1S A;  1HYF A;  4KFE A;  4WYK B;  2XF3 A;  3CCE 3;  1RGE A;  1QMA A;  3EBY A;  3F14 A;  3U1W A;  4FCM A;  1FGR A;  1RDS A;  1RMS A;  2W56 A;  5LC7 A;  2GU3 A;  2F4Y A;  3X3Y A;  4KVH A;  1Y4K A;  3URP A;  3RDE A;  1AV4 A;  1B2Z A;  1BAN A;  1OH0 A;  3OXA A;  2Z76 A;  1MWT A;  3Q1C A;  2INX A;  1T5Y A;  1AY7 A;  3KSE D;  3ER7 A;  4R4K A;  1LOV A;  5JPU A;  1BRH A;  4HAA A;  8RNT A;  1R4Y A;  2CX1 A;  2F98 A;  2SAR A;  3D5I A;  5CLK A;  2XGL A;  3U97 A;  2OTJ 3;  4BU4 A;  3CD6 3;  3X40 A;  2BNG A;  3X42 A;  3JUP A;  4HM8 B;  3STD A;  1TFK A;  3T8U A;  4HJL B;  3HIG A;  1W6G A;  4AKY A;  4XM4 A;  3D4A A;  1I2G A;  2P38 A;  4GL6 A;  1IQX A;  1BNG A;  4PEJ A;  2W03 A;  3S5C A;  3X3X A;  1UDI I;  4O2H A;  1TP6 A;  1B20 A;  2UGI A;  1ULJ B;  1G96 A;  3JUO A;  1PY3 A;  3G8Z A;  4KFD A;  4NHF A;  1AVL A;  1VZZ A;  1RCL A;  3EN8 A;  1ULI B;  4R9L A;  1A2K A;  1IQ8 A;  2M7O A;  1RTU A;  3FCS B;  4J5K A;  5HGR A;  3WOD G;  1C7H A;  2QA4 3;  2C11 A;  3E99 A;  1E3R A;  3LT9 A;  4WWU C;  5LC6 A;  1EUI C;  3S67 A;  3EN1 B;  4J9A A;  4I5Q A;  4WYK A;  2C4B A;  4HM5 B;  3WOE B;  1RN4 A;  1GOV A;  1GD3 A;  1YIJ 3;  2ML6 A;  3FSD A;  1VQ4 3;  1I2E A;  4LZI A;  1Z1S A;  2SBL A;  5STD A;  4HZ9 B;  8CHO A;  1F8N A;  1Q82 4;  1YGW A;  1B21 A;  1O7H B;  3FF0 A;  1O7W B;  4XB5 A;  1BNE A;  3I56 3;  3L0R A;  3DM8 A;  3SVA A;  3BNB A;  4XDW A;  1W5Z A;  3J7Y d;  3K9M C;  3G0K A;  2FXT A;  4OK0 A;  1B2M A;  1W00 A;  1FUW A;  2W9P A;  5BXQ A;  1LRA A;  2ZL8 A;  4LYL B;  3PCR A;  4G1M B;  3HK4 A;  3AMO B;  2F5M A;  2ZDJ A;  3B4O A;  3PS8 A;  1Q7H A;  3HOH A;  1G0T A;  2XFS A;  1I8V A;  3PGB A;  1FYS A;  2RSX A;  4R80 A;  4RZM A;  1FGO A;  2CG0 A;  1GY6 A;  4HM0 B;  2WGQ A;  1B2U A;  1JBT A;  5M19 A;  2CHC A;  4LEH A;  1U8C B;  6GSP A;  2F56 A;  2Z77 A;  2CFG A;  1BIR A;  1OGZ A;  1N8Q A;  1SQW A;  2XSO B;  4IT7 A;  2O3O A;  3HI7 A;  2PNC A;  2XH9 A;  1KC8 4;  3O8Y A;  1EKM A;  3FH1 A;  1MWS A;  4N6L A;  1N5P A;  3K0Z A;  1M1K 4;  4FMD A;  3SX1 A;  1LOW A;  4MMX B;  4IIA A;  4R1K A;  7STD A;  1JRQ A;  3V98 A;  1QVG 2;  2RNT A;  2KF3 A;  3Q3F A;  3KN4 A;  2W04 A;  3NV0 B;  1OHO A;  2CK3 H;  3FGY A;  3CXC 2;  5G1K A;  1BU4 A;  1SII A;  3OWS A;  5IG5 A;  3LT8 A;  1DET A;  2H0I A;  1DMM A;  2HMK B;  2XEP A;  3NM2 A;  1DE3 A;  1UUW B;  1FZU A;  3LTA A;  5AEW B;  2XR8 B;  3RGA A;  1MNL A; 
#chains in the Genus database with same CATH homology
 1LQM B;  1UUG B;  1EUI C;  1UDI I;  1LQG C;  1UGH I;  2ZHX B;  2UGI A;  1UGI A;  2J8X B;  2UUG C;  4LYL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...