1UGHI

Crystal structure of human uracil-dna glycosylase in complex with a protein inhibitor: protein mimicry of dna
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
82
structure length
82
Chain Sequence
NLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor: protein mimicry of DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Glycosylase
molecule keywords PROTEIN (URACIL-DNA GLYCOSYLASE)
total genus 17
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 1999-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1ughI00
1UGIA 1UDII 4LYLB 2J8XB 2UGIA 1LQGC 1EUIC 2UUGC 1LQMB 1UUGB 2ZHXB 1UGHI
chains in the Genus database with same CATH superfamily
4HM1B 1UDII 3G713 1FZUA 1YIJ3 2HMNB 1YJW3 2HMMB 2GU3A 3LMLA 1LRAA 2CFGA 3GZYB 3LZAA 5BVBA 3UL6A 2LYXA 3X41A 3VSYA 2Q07A 1Q42A 2QA43 3FF0A 3GAXA 1Y4KA 4LSOA 1WMOA 4QWTA 1RGKA 2W04A 4FCMA 2XH9A 1YNVX 3D79A 4PEJA 3FGYA 1K8A4 1NB3I 5IG0A 1QVF2 1BUQA 2OOVC 4XDVA 3I0YA 3EE1A 1OF5A 5CXOA 3OW22 2FXTA 1NJI4 1G0TA 1YVSA 3GZRA 3CCL3 1E97A 3K0ZA 1I3FA 3J7Yd 1NWWA 1YGEA 4X2OA 3S29A 2XRXB 1BRJA 5HOHA 2R41A 2HMJB 2XFTA 1IYYA 1RMSA 3HOHA 2Z6BA 3MWZA 1B2MA 1TP6A 1QJGA 2KCDA 2JQ5A 2L1SA 1UUGB 1IVVA 3JUQA 4LEHA 4U13A 1JB4A 2R4IA 4OUQA 4L8OA 1GOUA 1PYLA 1JNQA 1AV4A 1MNLA 3FG4A 2SBLA 1B3SA 1B2ZA 1RGGA 1T5YA 1X1YA 1RLSA 3EQQB 1A67A 9RNTA 2E2UA 1OHPA 3CU3A 4I4KA 4OVMA 5G1KA 1I70A 3KN4A 3F8XA 2C4BA 3URPA 4ZM8A 1MGWA 1QAFA 3B8LA 3LTCA 1GSPA 5D83A 1HYFA 1TRQA 5AIFA 1ZS7A 2UX0A 1A2PA 4MMXB 1D6UA 3CPW2 1ULJB 1Q824 2CFWA 1N9EA 5AYSC 2UUGC 1UUWB 1BRGA 3H51A 1S723 1JBSA 1K41A 1YGWA 1JKGB 1RGLA 2HOHA 3PCSA 2OQEA 3D3LA 1BRNL 3SX1A 3ZG0A 2YFJB 1MGRA 4RBNA 1I2FA 3LOYA 3SEDA 1MWUA 3STDA 4N6UA 4N3VA 1IVXA 1UCJA 4HOHA 2XGLA 1JZDA 2RNTA 4L7KA 4BIRA 5CF2A 5IENA 1TU5A 2LQVA 1CQSA 1CYVA 1LOWA 5G1LA 3AGOA 1IT7A 6RNTA 4XB5A 1VQ83 1DVDA 5IERA 3WOFB 3EB8A 2HMLB 2KAAA 4FR9A 2GU1A 2XR8B 1IV9A 4HM8B 1Q7Y4 1BNEA 1QALA 1K734 2IUKA 2RCDA 1JN5B 3S5CA 3X3XA 1GYBA 5IW9A 3RGAA 3OWYA 2AAEA 3FH1A 1IK3A 5HGRA 3MKIA 4WYKA 1RHLA 3T8NA 1IVWA 2INXA 1VQ93 2CHCA 1BSBA 4N6V0 2GXFA 1D6YA 3F7XA 4X2HA 4FCZA 3B7CA 5IG3A 1SARA 2IUJA 3DGMA 3FF2A 2BNGA 1B2SA 1KC84 3DGYA 1UCLA 4K1UA 3U1WA 5BU4A 3G8ZA 3WMDA 3BNBA 2ML6A 4HM4B 4JRFA 1LNHA 2QEX3 4CDLA 3DMCA 1SPUA 1I8VA 4WWUC 4BTWA 3CNMA 4AKYA 1D6ZA 1LOVA 3H3HA 1IV7A 3JUNA 3PZWA 3NV0A 4HAAA 3CC23 1WQLB 4J8TA 2AADA 3Q3FA 3UL5A 5DRVA 1JRQA 1T2HA 2WOHA 3IPTA 4IT7A 2CC3A 1N8R4 1SIHA 3FZWA 2ZA4A 3RGRA 3HK4A 3MG3A 2F5MA 2B24B 2V1LA 1RCKA 3CD63 1PFPA 3MHEA 1E3RA 1W6YA 3QRDA 1VQ73 2KF5A 1OUNA 3FSDA 4TX4A 2WGQA 3N54B 1RGEA 3CC73 1BRHA 4K90B 3CME3 4FMDA 1W5ZA 5KP1A 1I2EA 1W02A 3DZLA 1R4YA 1CEWI 1CYUA 2FNQA 3PS8A 4LZIA 5LC6A 3OWSA 1W4NA 1HKXA 5KP3A 1W00A 2MC8A 6STDA 3N8BA 2CWTA 1GMRA 2CG0A 3WOEB 2CH9A 1N8QA 2YFLB 4AKZA 1BSCA 3OX9A 2QGUA 1N5PA 5IG5A 1BSDA 1RKYA 4CJNA 2BHMA 3CC43 2CIUA 2F99A 3D9RA 3NV0B 1STFI 2P09A 2F4YA 1VQM3 4WFOA 4GSPA 3EN1B 3HIIA 4H61A 1NB5I 2FGTA 1BSAA 4HJLB 1GS3A 5IG4A 3T8UA 3WA3A 3HI7A 4KFDA 5EEOA 2Y74A 3LXUX 4WYKB 3CCR3 4EV2A 1U5OA 3FLJA 5CF1A 1OHSA 2P0MA 2CK3H 5AEWB 1JKGA 2YX9A 1L5GB 3MG1A 4EXRA 3A5EA 5AIHA 1CH0A 1T3BA 2IY2A 1BRIA 2BMRB 3KIIA 3LTAA 1LOYA 1LVNA 3EC9A 3GSPA 4HZBB 3V99A 1X1UA 3B4OA 3LTBA 1YJN3 1M1K4 3MSOA 1U8CB 1W6CA 3CCV3 3L0RA 1W2B2 4HBRA 1GOVA 2IYJA 3MYTA 4GB5A 5CK6A 1VQN3 1FUTA 5AI1A 2F86B 1N5HA 4G1MB 1Q814 1HZ1A 5BIRA 1BAOA 2C11A 1LXEA 1DMNA 3UJMA 3CCM3 2BMQB 3PCRA 4BL2A 1UI8A 3A76A 1BNJA 3DM8A 3S28A 2QIYA 2KRTA 2CWUA 3OV4A 5EQLA 3ALAA 2KXGA 1I0XA 1S5AA 3DGLA 4KFFA 1WMNA 1IQ8A 3OWUA 2CFKA 1GD4A 4I5QA 2OTL3 3EHCA 1O7GB 1OF5B 4CPKA 2O9UX 1RNTA 1BSEA 2CWVA 2P0XA 3U97A 4MJDA 1WNHA 1PY3A 4KZ1A 3AHSA 2D1WA 1B27A 2JDIH 8CHOA 4HM0B 5M19A 2CKFB 1SQWA 1OPYA 3FCSB 1RN7A 4KFEA 4XBTA 2GBXB 2IMJA 4N6NB 1YI23 1TJDA 1UGIA 4Q53A 5IEOA 1V58A 4HVNA 3KCHA 4HYZA 3GRDA 1RNBA 1B21A 3F14A 2L4VA 1BRSA 2BO9B 1MWTA 1JN5A 1FA3A 1TFKA 3CMA3 3M8CA 3BIRA 1IVUA 1VQK3 3D5GA 4IIAA 2F5WA 1JJ22 1G02A 1EKMA 1QAKA 3WDGB 5G2GA 1TUHA 4EC6A 3V98A 5BXQA 1RN1A 4AEQA 3MG2A 1VZZA 1Q864 1UW1A 3IJEB 3LTDA 4EYCA 1FW7A 1DE3A 4O8SA 1UI7A 6GSPA 1VQO3 1BNFA 1MWRA 5AEUB 2RSXA 1BUJA 4N6TA 1UUVB 4FCJA 2CFDA 1KWIA 3EBTA 5GSPA 3ZG5A 3SYUA 1JZOA 1M9GA 1RRLA 1AY7A 1LNIA 1AQZA 2BMOB 2RBIA 2WOFA 3FG1A 3JUMA 4JF8A 1LQMB 2GBWB 1FGQA 4RNYA 1GY5A 1NU3A 1RGCA 1US1A 3CNXA 3GWRA 1ULIB 3D5IA 3EN8A 4K61A 4XBYA 1O7PB 3KSPA 2XEPA 3CXC2 1EUIC 4EBGA 3D4AA 1ROAA 3NBBA 3NQZA 5TGNA 3UB1A 3S27A 1QMAA 3BU4A 4HKVB 3G16A 3BNEA 1BNGA 2XF3A 1OGZA 1EEJA 3BB9A 3GZXB 3AMOB 1RTUA 3NXJA 3ZFZA 5IF6A 2GEYA 1O7WB 1V57A 4HZ9B 1BNIA 2OOVA 4ILFA 5STDA 1NNVA 2PNCA 2W9PA 4HM5B 2BT3A 1TIJA 3K9MC 4NPBA 4STDA 1VQL3 1J2BA 4XM4A 1PU4A 1M904 1DYUA 7STDA 4HM2B 1VQ63 1ZGXA 2F56A 3KKGA 1KSIA 2J8XB 2KF6A 2ZDJA 3O8YA 1VQ53 1UCIA 3ER7A 2KF4A 3F9SA 1O7MB 2W0QA 3VF1A 1C54A 1SIIA 5D81A 3CCQ3 2RGQA 1X1WA 1BNRA 2I9WA 3NM2A 5JPUA 2XFSA 1TTOA 4HM3B 4LMIA 4R80A 2CG1A 3DH2A 3HIGA 2ML5A 4GL6A 1OCVA 2KF3A 1TFOA 2P38A 2MF7A 4J5KA 2B1XB 1GD3A 4R1KA 4HM6B 4BL3A 3KSED 2M7OA 5D82A 5ELJA 4CCVA 1M1XB 5IEPA 1RGFA 3DGNA 5M18A 3G4S3 1GMPA 1B2UA 3EX9A 3LT9A 3SOYA 4N6OB 1DETA 3K5TA 1FGOA 5CLKA 5ELUA 1W2ZA 1W6GA 3WHOA 1BNSA 3CCU3 2K54A 1A2VA 5A0OB 1OHOA 3K7CA 2W9QA 4XDWA 3UNLA 1W7CA 1JBTA 5JBSA 2W03A 4R9LA 3CCE3 1I3IA 4BTXA 2D42A 3PXMA 4L8PA 3FG3A 1RGHA 1VQ43 1VQQA 1ZO2A 2W56A 2Z76A 1K28A 4N6MA 4OK0A 2HMOB 3Q1CA 1Q40B 1FGRA 2CX0A 1ZX2A 2Y73A 5EVHA 3WR2A 4KVHA 4BU4A 3NBJA 4O3VA 3LYGA 4NREA 1F8NA 3DUKA 3S67A 4IPBA 4J9AA 1EQKA 3I553 3IMAB 3AGNA 2YFIB 1BRKA 3LH4A 1O7HB 3V92A 1RSNA 2XSOB 2BIRA 3LT8A 5RNTA 4EV5A 1YJ93 3ROBA 7GSPA 3JUPA 3VGNA 4H3UA 3F40A 3ECFA 3F7SA 3G6E3 5FGOA 3NBRA 3TDGA 3JVCA 4HM7B 2GSPA 2K3DA 4RZMA 1QVG2 1DMQA 1RN4A 2K0MA 3X42A 1KQS2 1GOYA 4R4KA 2E2VA 2W56B 5I97A 2CW9A 1TRPA 3EJVA 3AHWA 1R4CA 1YHQ3 2ZL8A 1GY6A 1MWSA 3I563 1OGXA 1WMPA 2STDA 4MMZB 2E2TA 5JPPA 3PYJA 4LYLB 4MMYB 1IU7A 1FGTA 8RNTA 1FGMA 2BU4A 1RRHA 1DMMA 1Q9EA 1W01A 2PZVA 3Q90A 1BANA 1AVLA 3CCJ3 1K9M4 3GZBA 1ISKA 1ROVA 3AMOA 4LGQA 2XGNA 4EW5A 1E3VA 3BNCA 4O2HA 1IQYA 5M1AA 3KZTA 1RGAA 2WO0A 1A90A 3HX8A 1WTHA 3WODG 1G96A 3NQYA 4MEIA 1Z1SA 4WP5A 1IT8A 2W6JH 4RNTA 3RDEA 1HU9A 1AR0A 2A15A 2OCTA 1DVCA 3E99A 1O7NB 5DREA 1BOXA 2UGIA 3PGBA 1OH0A 4ORLA 1RCLA 4RNZA 4FMBA 1V74A 3Q2PA 3NX0A 3OXAA 4FMCA 2XSHB 2Z7AA 3EF8A 3DXOA 1LOXA 1JBRA 2C10A 2IA7A 1KD14 1AVKA 2CX1A 2W2CA 3CPOA 3SOAA 1MOLA 3SVAA 3CCS3 1Q40A 3DGOA 3SLUA 4R9KA 1STDA 4N6LA 4GHOA 2Z77A 5AIGA 3NM7A 1LQGC 1IQXA 1BGSA 1A2KA 5AYRB 1NDOB 1ASKA 2P05A 2WGOA 1NO3A 1GY7A 1UCKA 4XBXA 4O02B 3DY5A 4KT3B 3G0KA 3RNTA 2H0IA 3BNDA 2GEXA 3EBYA 3KFQC 3SXXA 4DKIA 3NHXA 4WHAA 1SJWA 1Q7HA 2OWPA 3N9HA 4J5GA 1FUWA 1I0VA 1BIRA 2F98A 2SARA 1T2IA 1C7HA 1FUSA 1IDPA 1B2XA 4BTYA 1I2GA 3K63A 1FYSA 1X1XA 3KE7A 4FMAA 5KP4A 3JUOA 3QK9A 3X3ZA 2OQEC 3BLZA 4K1VA 3X40A 2OTJ3 3FKAA 1N9JA 1GMQA 1EG9B 1VQP3 1JB2A 3WA2X 1UGHI 3MPHA 1EA2A 3X3YA 1BU4A 1RJOA 3NUVA 2ZHXB 5FW5A 2CFLA 2O3OA 5LC7A 1RDSA 1B20A 3T0UA 3B4PA 1JV2B 1YVBI 1JB5A 2H0HA 3HZPA 4NHFA 2RFRA 1YIT3 7RNTA 1BVIA 1OACA 2H0GA 5AIIA 3F8HA 2HMKB
chains in the Genus database with same CATH topology
1UGIA 1UDII 4LYLB 2J8XB 2UGIA 1LQGC 1EUIC 2UUGC 1LQMB 1UUGB 2ZHXB 1UGHI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGI A;  1UDI I;  4LYL B;  2J8X B;  2UGI A;  1LQG C;  1EUI C;  2UUG C;  1LQM B;  1UUG B;  2ZHX B;  1UGH I; 
#chains in the Genus database with same CATH topology
 4HM1 B;  1UDI I;  3G71 3;  1FZU A;  1YIJ 3;  2HMN B;  1YJW 3;  2HMM B;  2GU3 A;  3LML A;  1LRA A;  2CFG A;  3GZY B;  3LZA A;  5BVB A;  3UL6 A;  2LYX A;  3X41 A;  3VSY A;  2Q07 A;  1Q42 A;  2QA4 3;  3FF0 A;  3GAX A;  1Y4K A;  4LSO A;  1WMO A;  4QWT A;  1RGK A;  2W04 A;  4FCM A;  2XH9 A;  1YNV X;  3D79 A;  4PEJ A;  3FGY A;  1K8A 4;  1NB3 I;  5IG0 A;  1QVF 2;  1BUQ A;  2OOV C;  4XDV A;  3I0Y A;  3EE1 A;  1OF5 A;  5CXO A;  3OW2 2;  2FXT A;  1NJI 4;  1G0T A;  1YVS A;  3GZR A;  3CCL 3;  1E97 A;  3K0Z A;  1I3F A;  3J7Y d;  1NWW A;  1YGE A;  4X2O A;  3S29 A;  2XRX B;  1BRJ A;  5HOH A;  2R41 A;  2HMJ B;  2XFT A;  1IYY A;  1RMS A;  3HOH A;  2Z6B A;  3MWZ A;  1B2M A;  1TP6 A;  1QJG A;  2KCD A;  2JQ5 A;  2L1S A;  1UUG B;  1IVV A;  3JUQ A;  4LEH A;  4U13 A;  1JB4 A;  2R4I A;  4OUQ A;  4L8O A;  1GOU A;  1PYL A;  1JNQ A;  1AV4 A;  1MNL A;  3FG4 A;  2SBL A;  1B3S A;  1B2Z A;  1RGG A;  1T5Y A;  1X1Y A;  1RLS A;  3EQQ B;  1A67 A;  9RNT A;  2E2U A;  1OHP A;  3CU3 A;  4I4K A;  4OVM A;  5G1K A;  1I70 A;  3KN4 A;  3F8X A;  2C4B A;  3URP A;  4ZM8 A;  1MGW A;  1QAF A;  3B8L A;  3LTC A;  1GSP A;  5D83 A;  1HYF A;  1TRQ A;  5AIF A;  1ZS7 A;  2UX0 A;  1A2P A;  4MMX B;  1D6U A;  3CPW 2;  1ULJ B;  1Q82 4;  2CFW A;  1N9E A;  5AYS C;  2UUG C;  1UUW B;  1BRG A;  3H51 A;  1S72 3;  1JBS A;  1K41 A;  1YGW A;  1JKG B;  1RGL A;  2HOH A;  3PCS A;  2OQE A;  3D3L A;  1BRN L;  3SX1 A;  3ZG0 A;  2YFJ B;  1MGR A;  4RBN A;  1I2F A;  3LOY A;  3SED A;  1MWU A;  3STD A;  4N6U A;  4N3V A;  1IVX A;  1UCJ A;  4HOH A;  2XGL A;  1JZD A;  2RNT A;  4L7K A;  4BIR A;  5CF2 A;  5IEN A;  1TU5 A;  2LQV A;  1CQS A;  1CYV A;  1LOW A;  5G1L A;  3AGO A;  1IT7 A;  6RNT A;  4XB5 A;  1VQ8 3;  1DVD A;  5IER A;  3WOF B;  3EB8 A;  2HML B;  2KAA A;  4FR9 A;  2GU1 A;  2XR8 B;  1IV9 A;  4HM8 B;  1Q7Y 4;  1BNE A;  1QAL A;  1K73 4;  2IUK A;  2RCD A;  1JN5 B;  3S5C A;  3X3X A;  1GYB A;  5IW9 A;  3RGA A;  3OWY A;  2AAE A;  3FH1 A;  1IK3 A;  5HGR A;  3MKI A;  4WYK A;  1RHL A;  3T8N A;  1IVW A;  2INX A;  1VQ9 3;  2CHC A;  1BSB A;  4N6V 0;  2GXF A;  1D6Y A;  3F7X A;  4X2H A;  4FCZ A;  3B7C A;  5IG3 A;  1SAR A;  2IUJ A;  3DGM A;  3FF2 A;  2BNG A;  1B2S A;  1KC8 4;  3DGY A;  1UCL A;  4K1U A;  3U1W A;  5BU4 A;  3G8Z A;  3WMD A;  3BNB A;  2ML6 A;  4HM4 B;  4JRF A;  1LNH A;  2QEX 3;  4CDL A;  3DMC A;  1SPU A;  1I8V A;  4WWU C;  4BTW A;  3CNM A;  4AKY A;  1D6Z A;  1LOV A;  3H3H A;  1IV7 A;  3JUN A;  3PZW A;  3NV0 A;  4HAA A;  3CC2 3;  1WQL B;  4J8T A;  2AAD A;  3Q3F A;  3UL5 A;  5DRV A;  1JRQ A;  1T2H A;  2WOH A;  3IPT A;  4IT7 A;  2CC3 A;  1N8R 4;  1SIH A;  3FZW A;  2ZA4 A;  3RGR A;  3HK4 A;  3MG3 A;  2F5M A;  2B24 B;  2V1L A;  1RCK A;  3CD6 3;  1PFP A;  3MHE A;  1E3R A;  1W6Y A;  3QRD A;  1VQ7 3;  2KF5 A;  1OUN A;  3FSD A;  4TX4 A;  2WGQ A;  3N54 B;  1RGE A;  3CC7 3;  1BRH A;  4K90 B;  3CME 3;  4FMD A;  1W5Z A;  5KP1 A;  1I2E A;  1W02 A;  3DZL A;  1R4Y A;  1CEW I;  1CYU A;  2FNQ A;  3PS8 A;  4LZI A;  5LC6 A;  3OWS A;  1W4N A;  1HKX A;  5KP3 A;  1W00 A;  2MC8 A;  6STD A;  3N8B A;  2CWT A;  1GMR A;  2CG0 A;  3WOE B;  2CH9 A;  1N8Q A;  2YFL B;  4AKZ A;  1BSC A;  3OX9 A;  2QGU A;  1N5P A;  5IG5 A;  1BSD A;  1RKY A;  4CJN A;  2BHM A;  3CC4 3;  2CIU A;  2F99 A;  3D9R A;  3NV0 B;  1STF I;  2P09 A;  2F4Y A;  1VQM 3;  4WFO A;  4GSP A;  3EN1 B;  3HII A;  4H61 A;  1NB5 I;  2FGT A;  1BSA A;  4HJL B;  1GS3 A;  5IG4 A;  3T8U A;  3WA3 A;  3HI7 A;  4KFD A;  5EEO A;  2Y74 A;  3LXU X;  4WYK B;  3CCR 3;  4EV2 A;  1U5O A;  3FLJ A;  5CF1 A;  1OHS A;  2P0M A;  2CK3 H;  5AEW B;  1JKG A;  2YX9 A;  1L5G B;  3MG1 A;  4EXR A;  3A5E A;  5AIH A;  1CH0 A;  1T3B A;  2IY2 A;  1BRI A;  2BMR B;  3KII A;  3LTA A;  1LOY A;  1LVN A;  3EC9 A;  3GSP A;  4HZB B;  3V99 A;  1X1U A;  3B4O A;  3LTB A;  1YJN 3;  1M1K 4;  3MSO A;  1U8C B;  1W6C A;  3CCV 3;  3L0R A;  1W2B 2;  4HBR A;  1GOV A;  2IYJ A;  3MYT A;  4GB5 A;  5CK6 A;  1VQN 3;  1FUT A;  5AI1 A;  2F86 B;  1N5H A;  4G1M B;  1Q81 4;  1HZ1 A;  5BIR A;  1BAO A;  2C11 A;  1LXE A;  1DMN A;  3UJM A;  3CCM 3;  2BMQ B;  3PCR A;  4BL2 A;  1UI8 A;  3A76 A;  1BNJ A;  3DM8 A;  3S28 A;  2QIY A;  2KRT A;  2CWU A;  3OV4 A;  5EQL A;  3ALA A;  2KXG A;  1I0X A;  1S5A A;  3DGL A;  4KFF A;  1WMN A;  1IQ8 A;  3OWU A;  2CFK A;  1GD4 A;  4I5Q A;  2OTL 3;  3EHC A;  1O7G B;  1OF5 B;  4CPK A;  2O9U X;  1RNT A;  1BSE A;  2CWV A;  2P0X A;  3U97 A;  4MJD A;  1WNH A;  1PY3 A;  4KZ1 A;  3AHS A;  2D1W A;  1B27 A;  2JDI H;  8CHO A;  4HM0 B;  5M19 A;  2CKF B;  1SQW A;  1OPY A;  3FCS B;  1RN7 A;  4KFE A;  4XBT A;  2GBX B;  2IMJ A;  4N6N B;  1YI2 3;  1TJD A;  1UGI A;  4Q53 A;  5IEO A;  1V58 A;  4HVN A;  3KCH A;  4HYZ A;  3GRD A;  1RNB A;  1B21 A;  3F14 A;  2L4V A;  1BRS A;  2BO9 B;  1MWT A;  1JN5 A;  1FA3 A;  1TFK A;  3CMA 3;  3M8C A;  3BIR A;  1IVU A;  1VQK 3;  3D5G A;  4IIA A;  2F5W A;  1JJ2 2;  1G02 A;  1EKM A;  1QAK A;  3WDG B;  5G2G A;  1TUH A;  4EC6 A;  3V98 A;  5BXQ A;  1RN1 A;  4AEQ A;  3MG2 A;  1VZZ A;  1Q86 4;  1UW1 A;  3IJE B;  3LTD A;  4EYC A;  1FW7 A;  1DE3 A;  4O8S A;  1UI7 A;  6GSP A;  1VQO 3;  1BNF A;  1MWR A;  5AEU B;  2RSX A;  1BUJ A;  4N6T A;  1UUV B;  4FCJ A;  2CFD A;  1KWI A;  3EBT A;  5GSP A;  3ZG5 A;  3SYU A;  1JZO A;  1M9G A;  1RRL A;  1AY7 A;  1LNI A;  1AQZ A;  2BMO B;  2RBI A;  2WOF A;  3FG1 A;  3JUM A;  4JF8 A;  1LQM B;  2GBW B;  1FGQ A;  4RNY A;  1GY5 A;  1NU3 A;  1RGC A;  1US1 A;  3CNX A;  3GWR A;  1ULI B;  3D5I A;  3EN8 A;  4K61 A;  4XBY A;  1O7P B;  3KSP A;  2XEP A;  3CXC 2;  1EUI C;  4EBG A;  3D4A A;  1ROA A;  3NBB A;  3NQZ A;  5TGN A;  3UB1 A;  3S27 A;  1QMA A;  3BU4 A;  4HKV B;  3G16 A;  3BNE A;  1BNG A;  2XF3 A;  1OGZ A;  1EEJ A;  3BB9 A;  3GZX B;  3AMO B;  1RTU A;  3NXJ A;  3ZFZ A;  5IF6 A;  2GEY A;  1O7W B;  1V57 A;  4HZ9 B;  1BNI A;  2OOV A;  4ILF A;  5STD A;  1NNV A;  2PNC A;  2W9P A;  4HM5 B;  2BT3 A;  1TIJ A;  3K9M C;  4NPB A;  4STD A;  1VQL 3;  1J2B A;  4XM4 A;  1PU4 A;  1M90 4;  1DYU A;  7STD A;  4HM2 B;  1VQ6 3;  1ZGX A;  2F56 A;  3KKG A;  1KSI A;  2J8X B;  2KF6 A;  2ZDJ A;  3O8Y A;  1VQ5 3;  1UCI A;  3ER7 A;  2KF4 A;  3F9S A;  1O7M B;  2W0Q A;  3VF1 A;  1C54 A;  1SII A;  5D81 A;  3CCQ 3;  2RGQ A;  1X1W A;  1BNR A;  2I9W A;  3NM2 A;  5JPU A;  2XFS A;  1TTO A;  4HM3 B;  4LMI A;  4R80 A;  2CG1 A;  3DH2 A;  3HIG A;  2ML5 A;  4GL6 A;  1OCV A;  2KF3 A;  1TFO A;  2P38 A;  2MF7 A;  4J5K A;  2B1X B;  1GD3 A;  4R1K A;  4HM6 B;  4BL3 A;  3KSE D;  2M7O A;  5D82 A;  5ELJ A;  4CCV A;  1M1X B;  5IEP A;  1RGF A;  3DGN A;  5M18 A;  3G4S 3;  1GMP A;  1B2U A;  3EX9 A;  3LT9 A;  3SOY A;  4N6O B;  1DET A;  3K5T A;  1FGO A;  5CLK A;  5ELU A;  1W2Z A;  1W6G A;  3WHO A;  1BNS A;  3CCU 3;  2K54 A;  1A2V A;  5A0O B;  1OHO A;  3K7C A;  2W9Q A;  4XDW A;  3UNL A;  1W7C A;  1JBT A;  5JBS A;  2W03 A;  4R9L A;  3CCE 3;  1I3I A;  4BTX A;  2D42 A;  3PXM A;  4L8P A;  3FG3 A;  1RGH A;  1VQ4 3;  1VQQ A;  1ZO2 A;  2W56 A;  2Z76 A;  1K28 A;  4N6M A;  4OK0 A;  2HMO B;  3Q1C A;  1Q40 B;  1FGR A;  2CX0 A;  1ZX2 A;  2Y73 A;  5EVH A;  3WR2 A;  4KVH A;  4BU4 A;  3NBJ A;  4O3V A;  3LYG A;  4NRE A;  1F8N A;  3DUK A;  3S67 A;  4IPB A;  4J9A A;  1EQK A;  3I55 3;  3IMA B;  3AGN A;  2YFI B;  1BRK A;  3LH4 A;  1O7H B;  3V92 A;  1RSN A;  2XSO B;  2BIR A;  3LT8 A;  5RNT A;  4EV5 A;  1YJ9 3;  3ROB A;  7GSP A;  3JUP A;  3VGN A;  4H3U A;  3F40 A;  3ECF A;  3F7S A;  3G6E 3;  5FGO A;  3NBR A;  3TDG A;  3JVC A;  4HM7 B;  2GSP A;  2K3D A;  4RZM A;  1QVG 2;  1DMQ A;  1RN4 A;  2K0M A;  3X42 A;  1KQS 2;  1GOY A;  4R4K A;  2E2V A;  2W56 B;  5I97 A;  2CW9 A;  1TRP A;  3EJV A;  3AHW A;  1R4C A;  1YHQ 3;  2ZL8 A;  1GY6 A;  1MWS A;  3I56 3;  1OGX A;  1WMP A;  2STD A;  4MMZ B;  2E2T A;  5JPP A;  3PYJ A;  4LYL B;  4MMY B;  1IU7 A;  1FGT A;  8RNT A;  1FGM A;  2BU4 A;  1RRH A;  1DMM A;  1Q9E A;  1W01 A;  2PZV A;  3Q90 A;  1BAN A;  1AVL A;  3CCJ 3;  1K9M 4;  3GZB A;  1ISK A;  1ROV A;  3AMO A;  4LGQ A;  2XGN A;  4EW5 A;  1E3V A;  3BNC A;  4O2H A;  1IQY A;  5M1A A;  3KZT A;  1RGA A;  2WO0 A;  1A90 A;  3HX8 A;  1WTH A;  3WOD G;  1G96 A;  3NQY A;  4MEI A;  1Z1S A;  4WP5 A;  1IT8 A;  2W6J H;  4RNT A;  3RDE A;  1HU9 A;  1AR0 A;  2A15 A;  2OCT A;  1DVC A;  3E99 A;  1O7N B;  5DRE A;  1BOX A;  2UGI A;  3PGB A;  1OH0 A;  4ORL A;  1RCL A;  4RNZ A;  4FMB A;  1V74 A;  3Q2P A;  3NX0 A;  3OXA A;  4FMC A;  2XSH B;  2Z7A A;  3EF8 A;  3DXO A;  1LOX A;  1JBR A;  2C10 A;  2IA7 A;  1KD1 4;  1AVK A;  2CX1 A;  2W2C A;  3CPO A;  3SOA A;  1MOL A;  3SVA A;  3CCS 3;  1Q40 A;  3DGO A;  3SLU A;  4R9K A;  1STD A;  4N6L A;  4GHO A;  2Z77 A;  5AIG A;  3NM7 A;  1LQG C;  1IQX A;  1BGS A;  1A2K A;  5AYR B;  1NDO B;  1ASK A;  2P05 A;  2WGO A;  1NO3 A;  1GY7 A;  1UCK A;  4XBX A;  4O02 B;  3DY5 A;  4KT3 B;  3G0K A;  3RNT A;  2H0I A;  3BND A;  2GEX A;  3EBY A;  3KFQ C;  3SXX A;  4DKI A;  3NHX A;  4WHA A;  1SJW A;  1Q7H A;  2OWP A;  3N9H A;  4J5G A;  1FUW A;  1I0V A;  1BIR A;  2F98 A;  2SAR A;  1T2I A;  1C7H A;  1FUS A;  1IDP A;  1B2X A;  4BTY A;  1I2G A;  3K63 A;  1FYS A;  1X1X A;  3KE7 A;  4FMA A;  5KP4 A;  3JUO A;  3QK9 A;  3X3Z A;  2OQE C;  3BLZ A;  4K1V A;  3X40 A;  2OTJ 3;  3FKA A;  1N9J A;  1GMQ A;  1EG9 B;  1VQP 3;  1JB2 A;  3WA2 X;  1UGH I;  3MPH A;  1EA2 A;  3X3Y A;  1BU4 A;  1RJO A;  3NUV A;  2ZHX B;  5FW5 A;  2CFL A;  2O3O A;  5LC7 A;  1RDS A;  1B20 A;  3T0U A;  3B4P A;  1JV2 B;  1YVB I;  1JB5 A;  2H0H A;  3HZP A;  4NHF A;  2RFR A;  1YIT 3;  7RNT A;  1BVI A;  1OAC A;  2H0G A;  5AII A;  3F8H A;  2HMK B; 
#chains in the Genus database with same CATH homology
 1UGI A;  1UDI I;  4LYL B;  2J8X B;  2UGI A;  1LQG C;  1EUI C;  2UUG C;  1LQM B;  1UUG B;  2ZHX B;  1UGH I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...