1UGQB

Crystal structure of apoenzyme of co-type nitrile hydratase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
228
structure length
228
Chain Sequence
b'MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile Hydratase alpha subunit
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 65
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugqB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugqB02
4FM4B 1UGQB 2DD4B 1AHJB 2ZPIB 2ZPHB 4ZGDB 2ZZDA 3QZ5B 2ZPFB 3QYGB 3A8MB 3VYGA 3X28B 1QP2A 2PUKB 2CZ1B 2DXCB 3VYHB 2D0QB 2DXBA 2PUOB 3QZ9B 4XK8E 3HHTB 2AHJB 3A8LB 3WVDB 2DD5A 1UGSB 2PVDB 3X26B 3A8HB 3LW5E 2QDYB 2ZPBB 3A8GB 3A8OB 2PVGB 4ZGEB 3WVEB 2ZZDB 4ZGJB 4KT0E 1UGRB 3VYGB 1IREB 2CYZB 1PSFA 2WSEE 1V29B 2ZPEB 2CZ7B 2PVOB 4OB3B 1QP3A 2WSFE 2DD4A 4RKUE 4OB1B 2O01E 2DPPB 4OB0B 3QYHB 3X20B 2ZPGB 2DXCA 2PU9B 1PSEA 3X24B 4Y28E 2CZ6B 1DJ7B 3QXEB 2ZCFB 4L6V5 2DXBB 4OB2B 1UGPB 5L8RE 2CZ0B 1JB0E 2DD5B 3X25B 1GXIE 2WSCE
chains in the Genus database with same CATH superfamily
3PVLA 3CCEQ 3FEOA 1QCOA 2DL8A 2R7GA 3CPWP 3MY5B 4JRKA 1XTDA 3OB9A 1MV3A 1PG5B 1KXUA 3UATA 1RI0A 4F14A 3L1AA 1CKAA 2HAXA 4F7UA 2E70A 1Q81R 2EFIA 1YI2T 4C0DC 2H8HA 1TUDA 3URGA 5LJ5h 1IZ6A 3L42A 3I9QA 1M8VA 4FYVB 2GF7A 4AI6A 1LJOA 2JN0A 2LP5A 2COWA 1ZX6A 2E6NA 3H6ZA 2EKHA 5LJ3d 3PT9A 1VQKT 3CMEA 5DQVA 1PM3A 4F7SB 4CFUB 2YLCA 5GMKi 1H1PB 4MZTA 1M2VB 3RMSA 2DVJA 2DKGA 4HNTA 2UZBB 1G8XA 3BY7A 2KVQG 3M0SA 3QDRB 4CI0C 1RAIB 5C6SA 3CPFA 4MZPA 2KSSA 3KFVA 3LWIA 3GLXA 1QMCA 5LJ5j 5I5ZB 2E5QA 1IRXA 4NL3A 3DKMA 2PVOB 4OB3B 4CC4B 4D8KA 3BG5A 2D1XA 2BS3A 2LZ6B 1K8AR 1K73R 2L0AA 4ELYC 2CT4A 3NHNA 2OJ2A 3CCVQ 4LDWA 4M78B 3TREA 1PSEA 4HL4A 2HSPA 5IN1A 1OU9A 2MYSA 3HRTA 3JCMh 2DTIA 4C5GA 4MFEA 3PIOA 2RQTA 4KRTA 2X51A 2VUBA 3OYYA 3SB2A 4PJOD 3CC2Q 1NM7A 1WIEA 2P0QA 3BFMA 4KBMB 3PFSA 4FM4B 1K73U 3DJBA 4HNVA 5AT1B 1H25B 3CBMA 1RAEB 5HK3A 2ZZDA 2X3XD 1D3UB 2V1RA 1AD5A 4HCCA 2RI2A 4DEXA 3QZ5B 4C8QD 2QEXQ 1LPLA 1KQ2A 5HVYB 4XU3A 1ZQ1A 2JJ9A 3M03A 3EG2A 3VYGA 3JCMc 2FZCB 1H26B 5KYXB 1VQNQ 5A0GA 1Q82U 2D8JA 3R6NA 4NC6A 2O2OA 2PUOB 4IUVA 1W6XA 2DEQA 4O5VA 2KMGA 1UECA 4QVDA 1RACB 1I07A 1B3QA 1ZSZB 1K9MC 4EOPB 4TTHA 1NBEB 4PKCC 3SFMA 5I11A 1RUWA 1GRIA 2NUPB 4EONB 1UJ0A 1BIAA 3VS5A 4CC7A 1M3AA 2ED0A 4BCOB 2DXTA 3CMAA 2G3RA 3QG1A 1IGQA 3QJYA 1GUXB 3CD6Q 5EFQB 4KUIA 1QVFS 4J8OA 3BW1A 1LOJA 1OPKA 3CCJA 1V76A 3OYJA 3GIBA 3DDPB 4A63B 1QVGS 3TN8B 3EOCB 1YJWQ 1VQMA 2FZGB 5DY9A 3KXTA 2CYZB 2HBWA 1NYFA 3FLGA 2B8AA 2EYYA 2DJZA 3LGLA 3CCUT 2C5XB 3QJ6A 5C0MA 2E4HA 1HD3A 3CXCS 2HNIA 1KG1A 4PJOA 3CC4Q 3QYHB 2WXVB 4R55A 3M55A 3CCMQ 5GAN3 2E10A 3JB9D 2LT1A 3G6ET 2DXCA 5CVIA 1OX8A 2A37A 2DXUA 3GOXA 5LJ5d 1H3ZA 3SWNC 1YCYA 3DTOA 3EHRA 4FT2A 2QQRA 2EQUA 4C8QA 2DYBA 1H24B 1UGPB 3ASKA 3NGPA 1JJ2P 2QAZA 1QMZB 1Y0MA 1JB0E 3M0RA 3INZA 3VS6A 1YJ9T 3ZFJA 2CP7A 3CCST 2XD0A 5GANe 2BE7D 3PIPA 2R58A 5D7UA 1M1KC 4NSTB 2DVEA 4M77F 5DM7R 3SHWA 2I40B 1Y07A 2YRCA 1KQSA 1JO8A 4V2SA 3BLQB 2QA4T 4NS5A 1BBZA 2CZ1B 2PUKB 5FU7B 2EGCA 4EOLB 2DZCA 5M9OA 4M7AC 4M77E 2EVRA 1WX6A 1UHFA 3UA7A 2XDBA 1FMVA 3HFNA 4OMOA 2DYIA 2LRQA 1HJDA 3FC3A 3BDUA 4X1VA 1VQ9A 1QQJA 5GAOq 4ZNXA 1JSTB 1E9HB 2V8KA 2F2WA 3VS2A 2EGAA 3JSCA 3OYMA 2BZYA 4BACA 3VUBA 1MUZA 1HK9A 2K2VA 3K7AM 4XQ3A 4RCBA 4RODA 1IGUA 2RQWA 3P8HA 1UGVA 2RJCA 4CC2A 4QQGA 4QT7A 3EFSA 2FG0A 3M9QA 2K4YA 3QWYA 1SG5A 4AG1C 1N8RC 2P0KA 4BCQB 1URCB 4QSHA 2A08A 2RNAA 2IPOB 5EC7A 1JSUB 4DA4A 1QVGA 1G5VA 4D8DA 3NMZC 4C5EA 2DO3A 2K9GA 4EC9B 4KGZB 1GFDA 2KT1A 1OYXA 4LUEA 1WXUA 4CFNB 2RQVA 4A4EA 2EYZA 2UUEB 4L6V5 3QSUA 2P0PA 4J7IA 1H4LD 1FX7A 5HBEB 3EH1A 3OMGA 3EG9B 1TU0B 2XKOC 4LE9A 4BY6C 5KYYA 5GAMj 3JAME 5GJVB 2DD4B 2ZPIB 4JS4A 4ZGDB 4QVCA 4JX4A 1YBYA 4AFSC 4M7DC 1T3LA 2ZPFB 1FMKA 1O9KB 4P5NA 1VQPQ 2KRNA 2XU8A 1PD0A 2EYXA 2P84A 2E1HA 3QWLA 1ZUUA 2HKNA 5IF1B 1BB9A 3HFOA 1ZP2A 2QQ9A 3QZ9B 4KUDK 4J9BA 1U8RA 3CCVA 4MZMA 2RH2A 4IMYB 3TNIB 2M0OA 4PJOG 4ZN3A 4YOOA 1GH6B 3RERA 2BUDA 1VOLA 5KYUB 1PRMC 4KRDB 3Q1JA 4E7KA 2OAWA 2IVWA 1VYWB 2XHCA 4HT8A 1WA7A 1SEMA 4LXCA 3J7AF 3CC2A 1D0ZA 4RTVA 1WGSA 1X6GA 3S3MA 4C8QG 1K73C 2WACA 4C92D 2V8IA 3H0FA 1UUEA 3REAB 1UGRB 3MP8A 3PMIA 4FT4A 3M0PA 1UE9A 3S3NA 4F7LB 3REBB 3T9NA 2WSEE 5DQWA 1IO6A 3L2UA 2QDJA 5IXFA 2EJFA 3S3OA 2EYWA 2LJ1A 4RKUE 1Q82C 5CKEA 3CCQT 1ZUKA 4Z89A 2DPPB 1MMDA 2ZAEA 4J9IA 2P4TA 1VQNA 5HY6A 2D0NA 5FRNA 4XU2A 1D3BA 2WPAB 5LQFB 1IHWA 1WNLA 4ORZA 3V8LA 2O4XB 2RJFA 3R6OA 3C94A 1TH7A 2CZ6B 4LN2A 4GLKA 1X43A 5J3BA 4BUGA 4F6SB 2KYMA 1YCSB 4J9HA 4YOZA 1P92A 1M3BA 2PK9B 4YTLA 3V7CA 2PHGA 3CCLQ 4CFUD 4O6JA 3CD6A 4F7UF 3EFOB 4M75B 3EGDB 1IXDA 2DD5B 1UNGD 5A0LA 4WCIA 1NEGA 3UPUA 4M7AE 2DBMA 2ROTA 2PQWA 3WXMB 1YJWA 3BG9A 4F7UE 2QQSA 1OI1A 1NYGA 1WHGA 4F6WB 2K3BA 4WF2A 5HK0A 2KRMA 1W2BA 2MI6A 1VA7A 5FU6C 4IURA 4HCKA 3H4CA 2JMCA 4J6XA 3JB9G 4HVUA 3QO3A 1GBQA 2COZA 3CMAQ 4AMCA 2AZVA 3BG3A 1PKSA 5HKCA 2YUNA 3CCJQ 2VGNA 3CEYA 5GAMd 3DL1A 4C92A 5CKDA 1ZHIA 2K6DA 3UT1A 4ELJA 4EMKA 1D1CA 3TW7A 4M78D 2BIVA 3VKGA 1M9SA 1UEBA 3V8KA 3E19A 2G77A 1NE8A 1JOWA 1ZBJA 3MP6A 4PFPA 3QYEA 1TTHB 4BBRM 2RHIA 5CKFA 2QQAA 4C0DB 2L3PA 2LQKA 4OMQA 1RABB 3LLRA 5GAN5 1EFNA 5FGKB 4C5HA 3P8DA 2KK4A 1VQOQ 2HL5C 2EQIA 2X9HA 4LD6A 1I5LA 3SEMA 1YIJQ 3FRNA 2C5VB 1WHMA 3E9FA 3BLRB 1Q86U 2WSFE 4JRIA 3VRZA 4EOSB 2LVMA 3CQTA 2X4YA 1OIUB 2CH4W 1AWWA 4B9WA 2UZLB 2O01E 1M4ZA 4M77B 3G71T 2OX7A 2J6KA 1U3OA 4OVAA 2GTJA 2K5FA 4XTZA 1M2VA 3AHUA 2RM4A 2MIOA 4KGXB 9ATCB 5GANh 2GQVA 5KYWB 2HQXA 2BZ8A 2CKKA 3I56Q 1CSKA 2V1QA 5KH6A 1OQKA 1OKWB 1BKBA 2RMOA 2SEMA 3EGUA 3VKHA 1I1JA 1NLPC 4ME7A 2CUBA 1YITQ 1QLBA 2IVXA 5GAN4 3U23A 3HRSA 4HA8A 4XTXA 2DFUA 3CCRT 3PVQA 2OTLQ 2ENMA 1GXIE 3JCMQ 4IUTA 2X1NB 3KHIA 3RIRA 2VGMA 3DB3A 4ROCA 1ZSGA 2WEVB 3QKJA 1VQ9T 1WJSA 4M78A 5GANj 2HMAA 2XDPA 4J9DA 1Z9ZA 2FEIA 2HZYA 2E3HA 3ZEHA 2BS2A 4DBHA 1FKMA 2BS4A 1IHVA 1NJIU 2JM8A 2CSQA 1UG1A 4F70B 2M9UA 2ROLA 1WHKA 4N0AA 3CCET 1KIKA 2EWNA 2QFZA 3F70A 3L2RA 2X4XA 2HKQB 1KHIA 5IDNB 4E47A 3WVEB 2BE9B 2L3QA 2QGSA 1TUGB 1SHGA 1C0MA 3UA6A 4PJOF 2W99A 2MPXC 2DBKA 2HQHA 1KQSP 1YWOA 3GNGA 4A4GA 2KY9A 2DM1A 1OPLA 2ZPEB 4PL6A 1PKDB 2ATCB 1WJRA 1VQPA 1QKWA 1ZSZA 4PJOE 2M51A 2PMIB 2L8DA 2YLBA 4C8QF 2NUPA 4M77C 4E7HA 1M90R 5CIUA 4XAXB 2K3XA 2DAQA 4QQ6A 1NPPA 2RF0A 1G3WA 1X2QA 1NEBA 1GUXA 5ACBA 2LQNA 4C8QE 3GNFB 4QVZA 3J81E 3OW2S 4J9EA 2NUTA 4C92G 5FW9A 2GGRA 3V7SA 1GCQA 3V7RA 1YN8A 1VQ4Q 3RKWA 2EKOA 3JCMb 3MHXA 1ZBXA 2K57A 2LNVA 3PE0A 1YP5A 4EMHA 3HTRA 3OYGA 2RI5A 4ATOA 2AKKA 1M90U 3RKYA 2EJ9A 2VC8A 4PNOA 3QIIA 4ZTFA 4QKUA 1X27A 4A4FA 1YJNQ 4C5IA 3CCVT 3THKA 1JXMA 2J05A 4X9CA 3MI9B 5CO7A 3A8MB 1VQ7A 3QUIA 1Q82R 4BCQD 3SWNB 3MKDA 5HBHB 4BCNB 5LJ3f 3CC2T 1D09B 1B34B 2MAMA 5CYIB 3H8ZA 3CBOA 1WHHA 2RI3A 1WJQA 3ER0A 4F16A 2CCIB 3MEWA 1FXXA 3UF4A 1XO2A 1I81A 2QEXT 2ESWA 2L3SA 2A7YA 3CCLA 3BHTB 3I35A 4PK4A 1XQHA 4LNPA 4XTUA 3DLMA 1SSHA 1W70A 3M53A 4AFUC 3OYNA 2RJDA 2KT8A 2F5TX 1MGQA 4IUPA 2A36A 4M7AB 1VQNT 3DB4A 4F7UB 3QBYA 1LVKA 3BE3A 4EC8B 4DBFA 1T3SA 1ACMB 1V29B 2LCCA 2RHXA 3QWXX 4X34A 3TSZA 3EHQA 4R56A 3PTAA 1BIBA 2F2CA 4OB1B 2YUQA 4A54A 1M1FA 2X35A 5CK9A 4M78G 3CD6T 4Z6YA 4FW2A 4TVRA 3L2WA 1CKBA 2J7IA 4FCYA 2PTKA 1ENWA 2O88A 4XU0A 3QYBA 2A3LA 4BI8B 2ZCFB 2HD0A 2JS0A 5GAOl 3RGFB 2HEQA 4Z02A 4OR5B 1R8OB 2E6ZA 4LUDA 3M59A 4VUBA 3QDFA 1OGUB 1QLYA 4NL2A 4K11A 2VXFA 2L3RA 4B6MA 2PNIA 4LDYA 1UJYA 3ULRB 2HDAA 1UDLA 1FINB 1QKXA 4RTUA 5CAIA 3HL8A 3CC4T 1VQOA 1VUBA 7AT1B 4A53A 3CCMT 2X3WD 2DL3A 4HXJA 1VQLQ 3TQ7P 1Q86C 2VVKA 1YIJA 3JV3A 2PK2A 1TFBA 2DL4A 2EJGA 2KAFA 3H0HA 4BY1X 4JLGA 1JEGA 3OSVA 4KH0B 2JGZB 2LMJA 1VINA 2XDDA 1N9RA 1SKUB 4XK8E 1J3TA 2K3YA 3E1SA 5BNJB 1VQ5Q 4E7LA 4DOVA 2I53A 3MJXA 1AZEA 4BY6B 2PVDB 4RG2A 3OYFA 3X26B 1VQ6Q 3C4SA 3EG9A 3I56A 1ZA1B 2KR6A 1QCNA 1X75C 2QTXA 4M7DB 3LWHA 3FIFA 5IH2A 2PVGB 5L23A 3GP8A 1YITA 1X6BA 2ZZDB 1UNHD 4FYWB 2OTLA 1K0XA 2V22B 4M75D 3BHUB 4HCBA 1MNDA 1YHQA 3VYGB 1W2BP 2OTJQ 3VRYA 1PSFA 3RBBB 3HBLA 4E7ZA 2DF6A 2VASA 2A28A 4PJMA 1GL5A 4BCHB 1ZUYA 3UDCA 2VB6A 1QWFA 5KYUA 5IHKA 5GMKm 1NJIC 1K76A 4JX5A 2LDMA 3FDRA 4ZN1A 3JCMd 1D0YA 3HSBA 2MF2A 4AFQC 5LJ5f 4F7JB 1N5ZA 3DOGB 2DTHA 3CC7A 3CBPA 2CP5A 3F5XB 4BY7X 3MEUA 4Y72B 2DA9A 4DEYA 1QVFA 4HKEA 4BB7A 3D7SB 5KYNA 3JB9J 2CP2A 3M5AA 5J39A 2M16A 2V26A 2KDSA 4RG8A 2YHTA 5CQYA 4JS5A 4BXXX 2OAUA 3TW6A 3C95A 3MEAA 3LQ5B 2YWWA 4CRIA 1Z9QA 2H3EB 2VXEA 1JJ2S 1AHJB 1RLQC 1EZZB 3G1JA 2W96A 4C0FA 1BI2A 2LW4A 3M4GA 1X2KA 2DE0X 1YI2A 4PJOB 4JJBA 3CXCA 3A5ZB 4BE2A 1N4MA 2DXCB 4OMPA 5HQ0B 3OYLA 1OV3A 4E7SA 1M8MA 2FRYA 4KGVB 2Y90A 4E6RA 1UFFA 4M77D 2E12A 2AHJB 1VQKA 1AISB 5CEIB 4OGEA 1JU5C 3EFOA 2GQIA 2E64A 3EGDA 2DMOA 4M75A 4E2FB 1U1SA 2DD5A 1C9BA 3MPUB 2I0NA 3VKIA 3ZBDA 4JJCA 1PWTA 3MEVA 3LGFA 2QASA 3JB9I 3JCMf 3LH0A 5IT9E 3CMET 1VQ4A 1NG2A 3A8GB 1VQPT 5FU6B 2VWFA 2HQEA 5HCKA 3OQ5A 1M90C 2NWMA 1IB8A 1VYUA 4KT0E 1U1TA 2W10A 3RUXA 1QW1A 1WQ7A 1YWPA 2QYZA 3BLHB 1WDXA 1RL2A 2QXFA 2JVVA 1MHNA 3OS2A 2MMPA 1YJNA 1E6HA 2RJEA 4M4ZA 3OA6A 2K5IA 3MCAB 1E7OA 2AZSA 5GMKh 6AT1B 4J9FA 2KBTA 4WTOB 1KD1R 2C6TB 5EJCA 1Q7YU 2JTFA 3RMQA 4PFOA 3M57A 2FO0A 3AT1B 2C0IA 5KE3A 4B9XA 5A0DA 2BPMB 3HKSA 4AKGA 2O31A 3JB9H 4NOYA 2O9VA 4N4HA 1W1FA 4ELLA 3BDLA 3EIDB 2L89A 3G4SQ 3IQLA 1VQ7Q 4M78F 1B07A 4EOQB 1E6GA 2Y4XA 2FZKB 4FYXB 2NYSA 3X25B 1WI7A 2QTVA 1S72Q 5L2WB 4BDZA 1OIYB 1KD1U 2YSQA 4N4IA 4II5B 4M78E 5I2MA 3M56A 4AKIA 1V1CA 4PJJA 3HZJA 4PJOC 2V8JA 2EGEA 4JZ4A 3MY1B 4FSXA 4AKHA 2JW4A 2D8HA 1I8FA 1XJWB 4EOKB 3C0CA 5KYWA 3EFRA 2FYKA 1TUCA 2E41A 1MMGA 1FVVB 2D0QB 3N5BB 5GAN2 4PJLA 4C8QC 4N4GA 3VS7A 2BZXA 2YRDA 3WVDB 5GAN6 1OU8A 2EAYA 1UGSB 2FPEA 5LJ3g 1OEBA 3P8BB 1WPYA 3A8HB 2IW9B 3ME9A 1TXQA 1TG0A 1Y96A 3M0UA 4KULA 5D6WA 2Y4YA 1QVPA 2EW3A 2EQKA 2JMAA 4Y92A 3TSWA 1ZLMA 2ECZA 2LQ8A 2D6FA 3CMAT 2JOYA 3OYCA 2W0ZA 4BCFB 5DLOA 3MIAB 2DLPA 4ROEA 4JLIA 3EGXB 3CCJT 3VS3A 1PD1A 1RLPC 1IREB 1VQLA 1Q86R 2EBPA 1A0NB 2YRVA 3CCUA 4BI4A 1VQMT 1QP3A 2CP6A 2M0YA 3VUZA 4EOIB 4BCMB 2R5MA 1N9SA 1BCOA 2LCLA 1BI1A 2XK0A 5GAN8 1K0SA 3JRZA 5CCAA 1O9SA 2DNUA 3SD4A 4BCND 2DJQA 1VQ5A 1M30A 3EG0A 1VQ6A 1B7TA 2QK0A 4M75G 2DXBB 1YIJT 3GPLA 1G3TA 1GCPA 2QQBA 2DL7A 1D1AA 2KQWA 4CC3A 2RHYA 2DEUA 2JS2A 3OS1A 2AK5A 2OTJA 2EPDA 5GJWB 4M7AD 1AEYA 4QQDA 2M02A 2QA4A 1FWZA 2WFYB 2K5LA 3VS4A 3S6WA 4Y91A 2QQ8A 2CDTA 4X9DA 2NUZA 2WIHB 3MO8A 3I56T 3I55Q 3O8VA 4CRLB 3M0QA 5GAMf 2UZDB 4UN0A 2AT1B 1NJIR 1R77A 2DK3A 3FJPA 1M3CA 2DILA 2KROA 3HRUA 2IW8B 1X6OA 1YITT 1UHCA 3EG3A 2RK1A 4AT1B 4EORB 2OTLT 2J6OA 1YHQQ 4L59A 1Q95G 3VV0A 4XTWA 1M5Q1 4L5GA 1RAFB 2IIMA 1KC8U 4EOMB 1H1QB 2ZPBB 3FJ5A 4YC3B 4XU1A 4C0ZA 1TSFA 4R0KA 5IHNA 1OULA 4C0GA 1VYVA 2VV5A 4ZGJB 3O5ZA 2LC4A 2C4GB 3SWNA 3C12A 2LJ3A 4PLIA 3QHSA 4RCCA 2NLUA 3CC7Q 1Y71A 3TVTA 1C6VX 5FLXE 3POMA 4M77G 1K4US 3I5RA 5HBJB 1VQ8Q 1BCMA 2C5NB 5ECAA 4EMKB 1N27A 1LCKA 5I21A 2KE9A 2BKDN 5KYXA 5LJ5g 1RAAB 3QHWB 5I2SA 4M7AA 1NZ9A 4MDWA 2DZ9A 1YI2Q 1N8RU 4OB2B 2LTOA 8AT1B 1BU2A 2ED1A 5KCOA 3JCMP 1RAHB 3A98A 4M7DD 1D0XA 2GNCA 4FW1A 1VQKQ 4JUVA 4J83A 1SRLA 1ZA2B 4DBQA 2R57A 2RO0A 1P5EB 2DX1A 2K79A 2L2PA 2DMEA 1F5QB 1JBMA 5AYFA 4JPBW 5GMKe 4JRPA 1AWXA 1Q7YC 4BCIB 3NTIA 3GTMS 2FVUA 1VQ4T 3G33B 2MOXA 3E2UA 1KQ1A 1Q81U 3HHTB 2RPNA 2L5QA 3M58A 1AOJA 4BI3A 1BI3A 1QVFP 2JXBA 3OYDA 4LD9K 2R5AA 3UWNA 5I22A 4OMMA 1JRIA 3RNJA 1QVGP 3EAEA 4IUQA 1PC0A 2RA2A 1YJNT 1N6AA 3O0GD 2FPFA 1GBRA 2LX9A 3G4SA 4CFXB 2DL5A 3HB9A 2GTOA 3CPWS 4FU6A 5CQXA 4F04B 5FROA 1VOMA 3JCMg 1KD1C 4LOCA 3TCJA 1S1NA 1S72A 2DIGA 4YOSA 1HSQA 3L2VA 1PKTA 2FRWA 2K7AA 2MWPA 4QW2A 3CXCP 1M1GA 5GAOm 2G6FX 2J06A 1E7PA 1RI9A 2F5KA 2HBPA 1R0CB 1UB4A 3JB9F 3OY9A 3CCQA 4C92C 3G7ZA 4PJNA 2IG0A 1EIFA 5GANd 4EMKC 2XICA 1OX9A 2JTMA 1KQSS 3VU3C 3OYHA 1K8AU 4M7DA 3NTHA 3V8JA 2ZPGB 1H1RB 4BCJB 1SPKA 3JCMV 3META 4PFZA 2WMAB 2JTEA 4M6VA 5DLQE 5CKHA 2DRKA 2GFUA 1H92A 2W2HA 2WHBB 2ABLA 3OYIA 5LJ3e 2CZ0B 2RB6A 1KK7A 2KNBB 3QPHA 1SHFA 2Z0WA 1UGQB 1G3SA 1R0BG 2ZGWA 4M75F 1YJWT 1OL1B 3KUFA 3SDZA 3QYGB 4KRCB 2LT4A 2WJ9A 4M75E 3DDQB 1BK2A 1H8KA 1UTIA 1H3HA 2CREA 2NUTB 2RQRA 1WXBA 1WHJA 3OW2A 2XI9A 3GBQA 3J80E 5GANf 2YUPA 3FB9A 3CCUQ 2HL3A 1VQLT 4JJNK 4G6LB 2AKLA 1AWJA 3H41A 2QF7A 2WIPB 4RTZA 4M7AG 4ZGEB 2X4WA 1WYXA 2A0FB 1TWBA 4CFWB 4F7UG 1G3YA 3G6EQ 2JZ2A 1OI9B 1W98B 1SSFA 1U06A 4M78C 4BDYA 1EX4A 4OGRB 2KXCA 4CXAB 3VS1A 2D9TA 3OMCA 2JUFA 3OBYA 2O9SA 1VQ5T 1KFZA 3CPWA 3KBGA 2C06A 3PGGA 3H0IA 2QDLA 1VQ6T 1RAGB 3I55A 4N0AC 3G71A 4E7IA 2UZEB 2DD4A 3M4YA 3TEEA 1YJ9Q 3CCSQ 1OKVB 3EH2A 1O9KA 4OB0B 3TNWB 1I5OB 1OZ2A 4E7JA 3ZL7C 1UNLD 3JCMJ 3RDVA 2EQJA 5ICPB 1I0CA 2PU9B 3NDQA 1BYMA 2OTJT 2QA4Q 1KC8C 2BTTA 3LH5A 3OS5A 3CCRA 2GFAA 3HPWA 5L8RE 2CH4A 1HYOA 2XMFA 3HP9A 1ZSZC 2WSCE 1MNEA 1ABQA 2FB7A 4HNUA 1JKWA 1QWEA 3L2QA 3MP1A 4GLMA 1F1BB 2YDLA 1VIFA 3LX7A 1VQ8A 4EOJB 3OBWA 4J7FA 1AVZC 3VYHB 1X69A 2QGGA 4BCMD 2KYBA 4OF1A 4I3ZB 3DLLA 1GCQC 4IKFA 4OGCA 1Y7XA 4D6WA 3CCEA 2H3JA 1H28B 5GAMg 1I4K1 2B86A 4XTYA 4M7DG 2MK5A 4C92F 1JXOA 3LW5E 4F6UB 5GAMh 1PNJA 2O4XA 5HNBB 2CP3A 2C0TA 4LDXA 2KEAA 2F69A 5LL6S 3NTKA 4C92E 5LJ5e 2KMTA 2CJMB 4HCZA 1OOTA 3VS0A 4FYYB 2RK2A 1AZGB 4MMLA 1AWOA 1WHLA 1YNZA 4EOOB 2CT3A 3BHVB 2EIFA 4C8QB 1PCXA 4DQ2A 2LX7A 2DTOA 5GAOn 2KXDA 1M27C 2JM9A 4FL6A 4BE0A 2CS7A 1AD6A 3GF5A 3PO3S 4ANJA 1Q7YR 1JQQA 1W2BS 2EUFA 1Q81C 2VKNA 3HO8A 4MFDA 2LJ0A 3E9GA 5GMKl 1W4SA 2RHZA 3X20B 8ATCB 1MMNA 2VYTA 1ARKA 1NPRA 4JRQA 3OYKA 4Y28E 2RHUA 3CMEQ 4J9CA 1DJ7B 4J6YA 4HVWA 3QXEB 1QCFA 1KSWA 3EGXA 5D6YA 5FU7C 4ZTJA 3M0TA 3OYBA 4ELZC 1H1SB 1SRMA 3OYEA 2WMBB 1PHTA 2F2VA 5A2QE 2W9FA 2HSEB 3EG1A 1LNXA 2RN8A 2COYA 2ZPHB 2J6FA 4RTTA 1U5SA 2DIQA 3JCMe 2IN3A 1WLPB 2CUDA 2CP0A 2PZ1A 2E3IA 3X28B 1OZ3A 1QP2A 4J5YA 2XG8D 1K8AC 2F1LA 3G4ST 1GFCA 4DOWA 1VQ7T 2B9RA 2DXBA 4J6WA 4IIMA 1WXTA 2LCSA 5GMKj 1RADB 3PMTA 5EG2A 3RR6A 1S72T 5IAYA 4M77A 2QEXA 1KJWA 2FHDA 3H9NA 4LDUA 2G9XB 2RQUA 4MMKA 1G2BA 4CFVB 4UC4A 3CCQQ 4BCKB 3I5SA 4II1A 2GBQA 2EYQA 5IHIA 2PJQA 1JJ2A 3CCLT 4OMLA 2EQMA 2K2MA 1H641 4OMFB 1K9MR 1WFWA 2DETA 4RUGA 5FRMA 4DBRA 3M54A 5LMKB 4IUUA 1M2OA 4Z88A 2M1HA 2IW6B 4M7AF 1VYTA 5KYYB 1PRLC 3VJPA 2I2LA 2CCHB 5J26A 1G3NC 3JCMX 1XOVA 5LJ3h 1ABOA 1C1AA 2AIRB 4A4KA 2E65A 1T0HA 1O75A 3A1PA 4BBSM 3X24B 4LDVA 1K9MU 3RKXA 5KCHA 2LNHB 4BE1A 1T0JA 1YFNA 2KR3A 2P4RA 1WZOA 4FSSA 4FX3B 5GAOp 3CC4A 3G6EA 3CCMA 3TU4K 2KGTA 4EDUA 3OYAA 4CFMB 4GBQA 1VQMQ 5KE2A 2SRCA 3QHRB 5LJ3j 3RESA 2JT4A 1X01A 1VQOT 3EJ1B 3LYIA 3OS0A 4PLLA 4A4HA 4RTXA 2XIDA 4Q5WA 1FMWA 5IHYA 2W9ZA 1YJ9A 3CCSA 4GY5A 2YUOA 4RTWA 3JCMW 4F17A 3A8LB 2OI3A 4OP0A 4XTVA 4ESRA 4EMGA 4HLQA 2CGHA 2MWOA 5FWCA 1M1KR 2KI7A 4JJDA 3NPFA 2QGFB 1KC8R 1SF9A 1FYNA 4HT9A 1BU1A 2QDYB 1TD6A 2DERA 5GAN7 1D3BB 5GANg 3G71Q 3A8OB 3NFCA 1Y57A 3I55T 2KRSA 1XNIA 1MV0B 2QI2A 4OMNA 2GCXA 2BKZB 3L2ZA 4MDXA 4M7DF 4EIKA 4J9GA 5FWBA 2MCNA 4RMOA 1K9AA 1D1BA 1KHCA 2YXYA 1TOVA 2JNGA 5IXBA 1YHQT 2E5KA 2CZ7B 4BD3A 1OL2B 2C0OA 2YT6A 5GAOr 1M1KU 4BCPB 1NLOC 5CR2A 4JX6A 4M75C 4M7DE 3CCRQ 5IDPB 1TS9A 2QG9B 3OW2P 1VIEA 1H27B 3B57A 5CKBA 1K1ZA 1AT1B 2X4JA 4JZ3A 2HCKA 3TNHB 1G83A 1Y96B 4JDSA 4RTYA 4EPCA 4FIBA 4IIOA 5D6XA 1VQ9Q 1N8RR 1WQWA 3OSSC 2RD1A 1HXDA 4HVVA 4KH1B 4MIMA 4F7NB 1MMAA 3CC7T 2LQWA 1B34A 4AFZC 5GAMe 1GY3B 1BI0A 3PNWC 2F2XA 2C5OB 4BCGB 4Z8AA 2FL7A 4C92B 4AG2C 2FPDA 1VQ8T 2DRMA 2CSIA
chains in the Genus database with same CATH topology
3FEOA 4CRIA 4M7AE 2PQWA 3WXMB 2VXEA 1YJWA 4JRKA 1UGQB 3BG9A 1JJ2S 1AHJB 1XTDA 3OB9A 1G3SA 2QQSA 4F7UE 1OI1A 2ZGWA 1BI2A 4M75F 4C0FA 4WF2A 5HK0A 3M4GA 1W2BA 1YJWT 1RI0A 3KUFA 2MI6A 3L1AA 1YI2A 3SDZA 3QYGB 5FU6C 4PJOB 4IURA 2HAXA 3H4CA 3CXCA 3A5ZB 4J6XA 3JB9G 4F7UA 4BE2A 3QO3A 2LT4A 3BG3A 2DXCB 2WJ9A 2E70A 2EFIA 1YI2T 4C0DC 4M75E 3OYLA 5HKCA 3URGA 2VGNA 1IZ6A 3L42A 5LJ5h 1M8VA 2GF7A 2Y90A 4AI6A 3CEYA 1LJOA 2E12A 2AHJB 2JN0A 2XI9A 4M77D 5GAMd 3OW2A 3DL1A 4C92A 4OGEA 5CKDA 1ZHIA 2E6NA 4M75A 2E64A 3H6ZA 3UT1A 1U1SA 3J80E 2DD5A 4ELJA 5LJ3d 3PT9A 4EMKA 5GANf 1VQKT 3CMEA 3TW7A 3FB9A 4M78D 2BIVA 3VKIA 3ZBDA 3VKGA 1M9SA 1UEBA 3LGFA 3MEVA 3V8KA 3JB9I 4JJNK 1VQLT 2YLCA 3E19A 2G77A 5GMKi 1NE8A 3JCMf 3LH0A 5IT9E 2QF7A 3CMET 1VQ4A 3MP6A 3A8GB 3QYEA 4MZTA 1VQPT 4M7AG 4ZGEB 5FU6B 2X4WA 4BBRM 2RHIA 3RMSA 4F7UG 1G3YA 2HQEA 3OQ5A 1M90C 5CKFA 2DKGA 2JZ2A 2QQAA 4KT0E 1SSFA 1U1TA 4HNTA 4M78C 2LQKA 4C0DB 3RUXA 4BDYA 1QW1A 1WQ7A 3LLRA 3BY7A 5GAN5 4C5HA 3P8DA 2KK4A 2KVQG 3QDRB 4CI0C 5C6SA 1RL2A 2QXFA 2JVVA 2D9TA 3CPFA 2KSSA 4MZPA 3OMCA 2JUFA 1MHNA 4LD6A 2MMPA 3OBYA 3GLXA 3OS2A 3LWIA 2RJEA 1YJNA 5LJ5j 1I5LA 1VQ5T 2E5QA 4NL3A 3FRNA 3DKMA 3CPWA 3OA6A 3E9FA 2PVOB 3KBGA 2K5IA 3MCAB 1Q86U 4OB3B 2WSFE 2C06A 3PGGA 4JRIA 1VQ6T 2LVMA 2X4YA 3BG5A 4N0AC 3I55A 5GMKh 3G71A 2DD4A 3M4YA 4E7IA 4B9WA 2BS3A 3TEEA 4ELYC 2O01E 1M4ZA 5EJCA 1Q7YU 4M77B 3G71T 2JTFA 4OB0B 3RMQA 4OVAA 1OZ2A 4E7JA 2K5FA 4XTZA 3M57A 3JCMJ 3AHUA 2EQJA 2RM4A 4LDWA 4M78B 3TREA 5GANh 5KE3A 2PU9B 1PSEA 4HL4A 4B9XA 5A0DA 2GQVA 3HKSA 5IN1A 1BYMA 2HQXA 4AKGA 3JB9H 2OTJT 2CKKA 4NOYA 1KC8C 3HRTA 5KH6A 3JCMh 2DTIA 3BDLA 4N4HA 4C5GA 4MFEA 1BKBA 3PIOA 2L89A 3VKHA 3OS5A 3CCRA 2GFAA 2VUBA 3OYYA 3HPWA 4M78F 4ME7A 5L8RE 3SB2A 4PJOD 1QLBA 5GAN4 3HP9A 2Y4XA 3HRSA 4HA8A 4XTXA 2P0QA 3CCRT 3BFMA 4KBMB 3X25B 1GXIE 2WSCE 3PFSA 4FM4B 3JCMQ 1K73U 4HNVA 4BDZA 1KD1U 2FB7A 4IUTA 4N4IA 4M78E 4HNUA 3KHIA 3CBMA 5I2MA 3RIRA 3M56A 3L2QA 4AKIA 2VGMA 2ZZDA 5HK3A 3HZJA 3MP1A 4HCCA 3DB3A 4PJOC 2RI2A 3QZ5B 2V8JA 4C8QD 1KQ2A 1VIFA 4XU3A 1ZQ1A 3QKJA 3LX7A 1VQ9T 3VYGA 1WJSA 4FSXA 4AKHA 4M78A 3JCMc 1I8FA 5GANj 1VQ8A 2XDPA 3OBWA 3EFRA 2FYKA 4J7FA 3VYHB 2E41A 2D0QB 4OF1A 3N5BB 3DLLA 3ZEHA 2BS2A 5A0GA 5GAN2 1FKMA 1Q82U 4IKFA 2QA4A 4OGCA 4NC6A 1Y7XA 2PUOB 2BS4A 4IUVA 4C8QC 4D6WA 3CCEA 2DEQA 4O5VA 2KMGA 4N4GA 1NJIU 2H3JA 4QVDA 2M9UA 5GAMg 1K9MC 1I4K1 3WVDB 5GAN6 4PKCC 4XTYA 3SFMA 4N0AA 2EAYA 4M7DG 3CCET 4C92F 1UGSB 2EWNA 5LJ3g 2QFZA 1BIAA 3P8BB 1WPYA 3A8HB 3F70A 3ME9A 3LW5E 1Y96A 2DXTA 3L2RA 2G3RA 2O4XA 2X4XA 3QG1A 4KULA 5GAMh 5D6WA 2Y4YA 4LDXA 1KHIA 3QJYA 1QVPA 4KUIA 4E47A 2EQKA 3WVEB 2F69A 4J8OA 3BW1A 3NTKA 5LL6S 4C92E 1LOJA 5LJ5e 2LQ8A 3CCJA 2D6FA 3CMAT 2KMTA 2JOYA 3OYCA 4HCZA 3OYJA 3GIBA 5DLOA 2RK2A 4PJOF 4MMLA 1QVGS 4JLIA 3CCJT 1VQMA 5DY9A 2EIFA 1IREB 4C8QB 3KXTA 2CYZB 1VQLA 2YRVA 4DQ2A 3GNGA 4A4GA 2KY9A 3CCUA 2DTOA 5GAOn 2ZPEB 4FL6A 4BI4A 1VQMT 4PL6A 4BE0A 2CS7A 1WJRA 1VQPA 1QP3A 3FLGA 3GF5A 2B8AA 3VUZA 4PJOE 2DJZA 3LGLA 3CCUT 2R5MA 3QJ6A 2L8DA 2YLBA 4C8QF 5C0MA 4M77C 4E7HA 1W2BS 1N9SA 5CIUA 1Q81C 4XAXB 2LCLA 1QVFS 2K3XA 2DAQA 1BI1A 2XK0A 5GAN8 3HO8A 4MFDA 3CXCS 4QQ6A 1NPPA 2HNIA 3E9GA 3JRZA 5CCAA 4PJOA 5GMKl 1G3WA 3QYHB 1W4SA 4R55A 1KG1A 3M55A 1O9SA 2RHZA 3X20B 5GAN3 3SD4A 2VYTA 2E10A 3JB9D 2LT1A 3G6ET 1NPRA 2DXCA 5CVIA 4JRQA 1VQ5A 4C8QE 2DXUA 3GNFB 3OYKA 4Y28E 4QVZA 3GOXA 2RHUA 5LJ5d 1VQ6A 1H3ZA 3J81E 3OW2S 4C92G 1DJ7B 4J6YA 4M75G 3QXEB 3SWNC 3V7SA 1YCYA 3V7RA 5D6YA 5FU7C 4FT2A 4ZTJA 2DXBB 1YIJT 2QQRA 2EQUA 4C8QA 3GPLA 1UGPB 1G3TA 2QQBA 3ASKA 3OYBA 3RKWA 2EKOA 4ELZC 3OYEA 3JCMb 3MHXA 2KQWA 1JB0E 1ZBXA 5A2QE 3INZA 2K57A 2LNVA 2RHYA 4EMHA 3OYGA 2RI5A 3ZFJA 3CCST 1YJ9T 4ATOA 1M90U 2XD0A 3RKYA 1LNXA 5GANe 2EJ9A 3OS1A 2VC8A 4PNOA 2OTJA 3QIIA 4ZTFA 3PIPA 4M7AD 2ZPHB 4A4FA 2R58A 2DIQA 4QQDA 1FWZA 2K5LA 4C5IA 3JCMe 3CCVT 2DVEA 3S6WA 4Y91A 1M1KC 2QQ8A 4M77F 5DM7R 4X9DA 4X9CA 1Y07A 1KQSA 3MO8A 5CO7A 3A8MB 4V2SA 1VQ7A 3I56T 2QA4T 3X28B 1OZ3A 3QUIA 3O8VA 1QP2A 2PUKB 2CZ1B 4J5YA 4NS5A 3SWNB 2XG8D 5GAMf 5FU7B 2DK3A 2DZCA 5M9OA 3G4ST 1K8AC 3FJPA 4DOWA 1VQ7T 4M7AC 4M77E 3HRUA 1YITT 1X6OA 2DXBA 5LJ3f 4J6WA 3CC2T 2XDBA 2RK1A 3HFNA 1B34B 2MAMA 2LRQA 3H8ZA 5GMKj 2OTLT 3FC3A 3BDUA 3CBOA 4L59A 3PMTA 5EG2A 3VV0A 1S72T 4XTWA 2RI3A 1VQ9A 1M5Q1 5IAYA 4M77A 1WJQA 3ER0A 2QEXA 2FHDA 3MEWA 5GAOq 1FXXA 4L5GA 4LDUA 4MMKA 1I81A 2V8KA 4UC4A 1KC8U 2QEXT 2ZPBB 3JSCA 3OYMA 2A7YA 4XU1A 4C0ZA 3CCLA 4II1A 1XQHA 4XTUA 3DLMA 2EYQA 3M53A 4BACA 3VUBA 1JJ2A 1HK9A 2K2VA 4C0GA 2VV5A 4ZGJB 3CCLT 3OYNA 2EQMA 4XQ3A 1H641 2RJDA 4OMFB 4RCBA 2F5TX 1MGQA 2LC4A 4IUPA 4M7AB 1VQNT 3SWNA 3CMAA 3C12A 3DB4A 3P8HA 4PLIA 3QHSA 4F7UB 4RCCA 2NLUA 3QBYA 5FRMA 2RJCA 4QQGA 3M54A 1Y71A 3EFSA 5FLXE 1V29B 3M9QA 2K4YA 4IUUA 2LCCA 2RHXA 1N8RC 2M1HA 2P0KA 4X34A 4M77G 4M7AF 4QSHA 4R56A 4DA4A 1QVGA 3PTAA 1G5VA 1BIBA 3VJPA 4C5EA 4OB1B 4A54A 1M1FA 2I2LA 5J26A 2X35A 5CK9A 4M78G 4EMKB 2DO3A 3JCMX 1N27A 1XOVA 5LJ3h 3CD6T 4Z6YA 5I21A 4TVRA 3L2WA 4A4KA 2E65A 1O75A 4BBSM 1OYXA 2BKDN 3X24B 4LDVA 1K9MU 1VQKA 3RKXA 4A4EA 5KCHA 5LJ5g 5I2SA 4M7AA 4XU0A 1NZ9A 4BE1A 3QYBA 2A3LA 2DZ9A 2HD0A 2ZCFB 4L6V5 4MDWA 4BI8B 5GAOl 2P0PA 1N8RU 3QSUA 4OB2B 4J7IA 2LTOA 4Z02A 1FX7A 1R8OB 2E6ZA 3JCMP 5KCOA 4M7DD 3M59A 4VUBA 5GAOp 3OMGA 4NL2A 3G6EA 3CC4A 2VXFA 2L3RA 3CCMA 4LDYA 3TU4K 2XKOC 4BY6C 4EDUA 5GAMj 3OYAA 3JAME 4JUVA 5CAIA 1VQOA 3CC4T 3HL8A 4J83A 2DD4B 5KE2A 1VUBA 2ZPIB 4A53A 3CCMT 4JS4A 2R57A 4ZGDB 2RO0A 4JX4A 4QVCA 1YBYA 3RESA 5LJ3j 1Q86C 1YIJA 4M7DC 2ZPFB 1X01A 1VQOT 4P5NA 3LYIA 3OS0A 4PLLA 4A4HA 1JBMA 2XIDA 2EJGA 2XU8A 4Q5WA 2KAFA 5AYFA 5GMKe 4JRPA 1Q7YC 2E1HA 3QWLA 1YJ9A 3NTIA 4GY5A 3CCSA 4JLGA 2FVUA 1VQ4T 3OSVA 3HFOA 3JCMW 1KQ1A 2XDDA 2QQ9A 1N9RA 1Q81U 3QZ9B 4XK8E 3HHTB 2K3YA 3E1SA 3A8LB 2L5QA 3M58A 4OP0A 4XTVA 1U8RA 4BI3A 1BI3A 4KUDK 3CCVA 4EMGA 4E7LA 4MZMA 2RH2A 4HLQA 2CGHA 2MWOA 4DOVA 2M0OA 4PJOG 4ZN3A 3OYDA 4LD9K 4BY6B 2R5AA 2PVDB 4RG2A 2BUDA 3UWNA 3OYFA 3X26B 3RERA 3C4SA 1JRIA 3I56A 2KR6A 3EAEA 4IUQA 4HT9A 2QDYB 3Q1JA 2RA2A 5GAN7 4E7KA 1N6AA 1X75C 2QTXA 1YJNT 2LX9A 2IVWA 4HT8A 2XHCA 1D3BB 3LWHA 3G4SA 4M7DB 5GANg 3FIFA 3A8OB 2PVGB 3GP8A 1YITA 3J7AF 3HB9A 3NFCA 3CPWS 4FU6A 3CC2A 3I55T 2ZZDB 1WGSA 3S3MA 5CQXA 4C8QG 1K73C 5FROA 2WACA 2OTLA 1XNIA 2QI2A 3JCMg 2V8IA 4C92D 1KD1C 4LOCA 4M75D 3TCJA 2GCXA 3L2ZA 1S72A 2DIGA 4HCBA 4MDXA 4M7DF 1YHQA 1UGRB 3VYGB 3MP8A 3PMIA 4FT4A 4RMOA 3S3NA 3L2VA 1PSFA 2MWPA 3HBLA 4QW2A 3T9NA 1M1GA 1KHCA 5GAOm 2JNGA 2WSEE 1E7PA 1YHQT 2F5KA 2HBPA 2CZ7B 4BD3A 1UB4A 3JB9F 3OY9A 5GAOr 3CCQA 4C92C 1M1KU 3G7ZA 5CR2A 3L2UA 4JX6A 4M75C 4M7DE 2QDJA 2EJFA 3S3OA 2IG0A 1EIFA 4RKUE 5GANd 4EMKC 2XICA 3UDCA 1Q82C 2JTMA 5CKEA 3CCQT 2DPPB 1KQSS 1NJIC 3VU3C 2P4TA 1VIEA 5GMKm 4JX5A 1VQNA 2LDMA 3FDRA 5HY6A 4ZN1A 5FRNA 3JCMd 4XU2A 5CKBA 3OYHA 1K8AU 2MF2A 3HSBA 4M7DA 1D3BA 5LJ5f 2X4JA 3NTHA 3V8JA 2ZPGB 1WNLA 1Y96B 2DTHA 4JDSA 3V8LA 2O4XB 4EPCA 4FIBA 3JCMV 3CC7A 3CBPA 5D6XA 2RJFA 3META 3R6OA 3C94A 1TH7A 2CZ6B 1WQWA 3MEUA 3OSSC 2RD1A 4GLKA 1HXDA 5J3BA 4BUGA 1QVFA 4M6VA 4MIMA 4HKEA 4BB7A 3JB9J 3CC7T 5DLQE 1B34A 1P92A 5GAMe 3M5AA 5CKHA 5J39A 1BI0A 3PNWC 4YTLA 3V7CA 2M16A 2GFUA 4RG8A 2KDSA 2YHTA 4O6JA 3CD6A 2FL7A 5CQYA 4F7UF 4C92B 4JS5A 5LJ3e 2CZ0B 2OAUA 2RB6A 4M75B 3TW6A 3C95A 3MEAA 3QPHA 1VQ8T 2DD5B 5A0LA 3OYIA 3UPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FM4 B;  1UGQ B;  2DD4 B;  1AHJ B;  2ZPI B;  2ZPH B;  4ZGD B;  2ZZD A;  3QZ5 B;  2ZPF B;  3QYG B;  3A8M B;  3VYG A;  3X28 B;  1QP2 A;  2PUK B;  2CZ1 B;  2DXC B;  3VYH B;  2D0Q B;  2DXB A;  2PUO B;  3QZ9 B;  4XK8 E;  3HHT B;  2AHJ B;  3A8L B;  3WVD B;  2DD5 A;  1UGS B;  2PVD B;  3X26 B;  3A8H B;  3LW5 E;  2QDY B;  2ZPB B;  3A8G B;  3A8O B;  2PVG B;  4ZGE B;  3WVE B;  2ZZD B;  4ZGJ B;  4KT0 E;  1UGR B;  3VYG B;  1IRE B;  2CYZ B;  1PSF A;  2WSE E;  1V29 B;  2ZPE B;  2CZ7 B;  2PVO B;  4OB3 B;  1QP3 A;  2WSF E;  2DD4 A;  4RKU E;  4OB1 B;  2O01 E;  2DPP B;  4OB0 B;  3QYH B;  3X20 B;  2ZPG B;  2DXC A;  2PU9 B;  1PSE A;  3X24 B;  4Y28 E;  2CZ6 B;  1DJ7 B;  3QXE B;  2ZCF B;  4L6V 5;  2DXB B;  4OB2 B;  1UGP B;  5L8R E;  2CZ0 B;  1JB0 E;  2DD5 B;  3X25 B;  1GXI E;  2WSC E; 
#chains in the Genus database with same CATH topology
 3PVL A;  3CCE Q;  3FEO A;  1QCO A;  2DL8 A;  2R7G A;  3CPW P;  3MY5 B;  4JRK A;  1XTD A;  3OB9 A;  1MV3 A;  1PG5 B;  1KXU A;  3UAT A;  1RI0 A;  4F14 A;  3L1A A;  1CKA A;  2HAX A;  4F7U A;  2E70 A;  1Q81 R;  2EFI A;  1YI2 T;  4C0D C;  2H8H A;  1TUD A;  3URG A;  5LJ5 h;  1IZ6 A;  3L42 A;  3I9Q A;  1M8V A;  4FYV B;  2GF7 A;  4AI6 A;  1LJO A;  2JN0 A;  2LP5 A;  2COW A;  1ZX6 A;  2E6N A;  3H6Z A;  2EKH A;  5LJ3 d;  3PT9 A;  1VQK T;  3CME A;  5DQV A;  1PM3 A;  4F7S B;  4CFU B;  2YLC A;  5GMK i;  1H1P B;  4MZT A;  1M2V B;  3RMS A;  2DVJ A;  2DKG A;  4HNT A;  2UZB B;  1G8X A;  3BY7 A;  2KVQ G;  3M0S A;  3QDR B;  4CI0 C;  1RAI B;  5C6S A;  3CPF A;  4MZP A;  2KSS A;  3KFV A;  3LWI A;  3GLX A;  1QMC A;  5LJ5 j;  5I5Z B;  2E5Q A;  1IRX A;  4NL3 A;  3DKM A;  2PVO B;  4OB3 B;  4CC4 B;  4D8K A;  3BG5 A;  2D1X A;  2BS3 A;  2LZ6 B;  1K8A R;  1K73 R;  2L0A A;  4ELY C;  2CT4 A;  3NHN A;  2OJ2 A;  3CCV Q;  4LDW A;  4M78 B;  3TRE A;  1PSE A;  4HL4 A;  2HSP A;  5IN1 A;  1OU9 A;  2MYS A;  3HRT A;  3JCM h;  2DTI A;  4C5G A;  4MFE A;  3PIO A;  2RQT A;  4KRT A;  2X51 A;  2VUB A;  3OYY A;  3SB2 A;  4PJO D;  3CC2 Q;  1NM7 A;  1WIE A;  2P0Q A;  3BFM A;  4KBM B;  3PFS A;  4FM4 B;  1K73 U;  3DJB A;  4HNV A;  5AT1 B;  1H25 B;  3CBM A;  1RAE B;  5HK3 A;  2ZZD A;  2X3X D;  1D3U B;  2V1R A;  1AD5 A;  4HCC A;  2RI2 A;  4DEX A;  3QZ5 B;  4C8Q D;  2QEX Q;  1LPL A;  1KQ2 A;  5HVY B;  4XU3 A;  1ZQ1 A;  2JJ9 A;  3M03 A;  3EG2 A;  3VYG A;  3JCM c;  2FZC B;  1H26 B;  5KYX B;  1VQN Q;  5A0G A;  1Q82 U;  2D8J A;  3R6N A;  4NC6 A;  2O2O A;  2PUO B;  4IUV A;  1W6X A;  2DEQ A;  4O5V A;  2KMG A;  1UEC A;  4QVD A;  1RAC B;  1I07 A;  1B3Q A;  1ZSZ B;  1K9M C;  4EOP B;  4TTH A;  1NBE B;  4PKC C;  3SFM A;  5I11 A;  1RUW A;  1GRI A;  2NUP B;  4EON B;  1UJ0 A;  1BIA A;  3VS5 A;  4CC7 A;  1M3A A;  2ED0 A;  4BCO B;  2DXT A;  3CMA A;  2G3R A;  3QG1 A;  1IGQ A;  3QJY A;  1GUX B;  3CD6 Q;  5EFQ B;  4KUI A;  1QVF S;  4J8O A;  3BW1 A;  1LOJ A;  1OPK A;  3CCJ A;  1V76 A;  3OYJ A;  3GIB A;  3DDP B;  4A63 B;  1QVG S;  3TN8 B;  3EOC B;  1YJW Q;  1VQM A;  2FZG B;  5DY9 A;  3KXT A;  2CYZ B;  2HBW A;  1NYF A;  3FLG A;  2B8A A;  2EYY A;  2DJZ A;  3LGL A;  3CCU T;  2C5X B;  3QJ6 A;  5C0M A;  2E4H A;  1HD3 A;  3CXC S;  2HNI A;  1KG1 A;  4PJO A;  3CC4 Q;  3QYH B;  2WXV B;  4R55 A;  3M55 A;  3CCM Q;  5GAN 3;  2E10 A;  3JB9 D;  2LT1 A;  3G6E T;  2DXC A;  5CVI A;  1OX8 A;  2A37 A;  2DXU A;  3GOX A;  5LJ5 d;  1H3Z A;  3SWN C;  1YCY A;  3DTO A;  3EHR A;  4FT2 A;  2QQR A;  2EQU A;  4C8Q A;  2DYB A;  1H24 B;  1UGP B;  3ASK A;  3NGP A;  1JJ2 P;  2QAZ A;  1QMZ B;  1Y0M A;  1JB0 E;  3M0R A;  3INZ A;  3VS6 A;  1YJ9 T;  3ZFJ A;  2CP7 A;  3CCS T;  2XD0 A;  5GAN e;  2BE7 D;  3PIP A;  2R58 A;  5D7U A;  1M1K C;  4NST B;  2DVE A;  4M77 F;  5DM7 R;  3SHW A;  2I40 B;  1Y07 A;  2YRC A;  1KQS A;  1JO8 A;  4V2S A;  3BLQ B;  2QA4 T;  4NS5 A;  1BBZ A;  2CZ1 B;  2PUK B;  5FU7 B;  2EGC A;  4EOL B;  2DZC A;  5M9O A;  4M7A C;  4M77 E;  2EVR A;  1WX6 A;  1UHF A;  3UA7 A;  2XDB A;  1FMV A;  3HFN A;  4OMO A;  2DYI A;  2LRQ A;  1HJD A;  3FC3 A;  3BDU A;  4X1V A;  1VQ9 A;  1QQJ A;  5GAO q;  4ZNX A;  1JST B;  1E9H B;  2V8K A;  2F2W A;  3VS2 A;  2EGA A;  3JSC A;  3OYM A;  2BZY A;  4BAC A;  3VUB A;  1MUZ A;  1HK9 A;  2K2V A;  3K7A M;  4XQ3 A;  4RCB A;  4ROD A;  1IGU A;  2RQW A;  3P8H A;  1UGV A;  2RJC A;  4CC2 A;  4QQG A;  4QT7 A;  3EFS A;  2FG0 A;  3M9Q A;  2K4Y A;  3QWY A;  1SG5 A;  4AG1 C;  1N8R C;  2P0K A;  4BCQ B;  1URC B;  4QSH A;  2A08 A;  2RNA A;  2IPO B;  5EC7 A;  1JSU B;  4DA4 A;  1QVG A;  1G5V A;  4D8D A;  3NMZ C;  4C5E A;  2DO3 A;  2K9G A;  4EC9 B;  4KGZ B;  1GFD A;  2KT1 A;  1OYX A;  4LUE A;  1WXU A;  4CFN B;  2RQV A;  4A4E A;  2EYZ A;  2UUE B;  4L6V 5;  3QSU A;  2P0P A;  4J7I A;  1H4L D;  1FX7 A;  5HBE B;  3EH1 A;  3OMG A;  3EG9 B;  1TU0 B;  2XKO C;  4LE9 A;  4BY6 C;  5KYY A;  5GAM j;  3JAM E;  5GJV B;  2DD4 B;  2ZPI B;  4JS4 A;  4ZGD B;  4QVC A;  4JX4 A;  1YBY A;  4AFS C;  4M7D C;  1T3L A;  2ZPF B;  1FMK A;  1O9K B;  4P5N A;  1VQP Q;  2KRN A;  2XU8 A;  1PD0 A;  2EYX A;  2P84 A;  2E1H A;  3QWL A;  1ZUU A;  2HKN A;  5IF1 B;  1BB9 A;  3HFO A;  1ZP2 A;  2QQ9 A;  3QZ9 B;  4KUD K;  4J9B A;  1U8R A;  3CCV A;  4MZM A;  2RH2 A;  4IMY B;  3TNI B;  2M0O A;  4PJO G;  4ZN3 A;  4YOO A;  1GH6 B;  3RER A;  2BUD A;  1VOL A;  5KYU B;  1PRM C;  4KRD B;  3Q1J A;  4E7K A;  2OAW A;  2IVW A;  1VYW B;  2XHC A;  4HT8 A;  1WA7 A;  1SEM A;  4LXC A;  3J7A F;  3CC2 A;  1D0Z A;  4RTV A;  1WGS A;  1X6G A;  3S3M A;  4C8Q G;  1K73 C;  2WAC A;  4C92 D;  2V8I A;  3H0F A;  1UUE A;  3REA B;  1UGR B;  3MP8 A;  3PMI A;  4FT4 A;  3M0P A;  1UE9 A;  3S3N A;  4F7L B;  3REB B;  3T9N A;  2WSE E;  5DQW A;  1IO6 A;  3L2U A;  2QDJ A;  5IXF A;  2EJF A;  3S3O A;  2EYW A;  2LJ1 A;  4RKU E;  1Q82 C;  5CKE A;  3CCQ T;  1ZUK A;  4Z89 A;  2DPP B;  1MMD A;  2ZAE A;  4J9I A;  2P4T A;  1VQN A;  5HY6 A;  2D0N A;  5FRN A;  4XU2 A;  1D3B A;  2WPA B;  5LQF B;  1IHW A;  1WNL A;  4ORZ A;  3V8L A;  2O4X B;  2RJF A;  3R6O A;  3C94 A;  1TH7 A;  2CZ6 B;  4LN2 A;  4GLK A;  1X43 A;  5J3B A;  4BUG A;  4F6S B;  2KYM A;  1YCS B;  4J9H A;  4YOZ A;  1P92 A;  1M3B A;  2PK9 B;  4YTL A;  3V7C A;  2PHG A;  3CCL Q;  4CFU D;  4O6J A;  3CD6 A;  4F7U F;  3EFO B;  4M75 B;  3EGD B;  1IXD A;  2DD5 B;  1UNG D;  5A0L A;  4WCI A;  1NEG A;  3UPU A;  4M7A E;  2DBM A;  2ROT A;  2PQW A;  3WXM B;  1YJW A;  3BG9 A;  4F7U E;  2QQS A;  1OI1 A;  1NYG A;  1WHG A;  4F6W B;  2K3B A;  4WF2 A;  5HK0 A;  2KRM A;  1W2B A;  2MI6 A;  1VA7 A;  5FU6 C;  4IUR A;  4HCK A;  3H4C A;  2JMC A;  4J6X A;  3JB9 G;  4HVU A;  3QO3 A;  1GBQ A;  2COZ A;  3CMA Q;  4AMC A;  2AZV A;  3BG3 A;  1PKS A;  5HKC A;  2YUN A;  3CCJ Q;  2VGN A;  3CEY A;  5GAM d;  3DL1 A;  4C92 A;  5CKD A;  1ZHI A;  2K6D A;  3UT1 A;  4ELJ A;  4EMK A;  1D1C A;  3TW7 A;  4M78 D;  2BIV A;  3VKG A;  1M9S A;  1UEB A;  3V8K A;  3E19 A;  2G77 A;  1NE8 A;  1JOW A;  1ZBJ A;  3MP6 A;  4PFP A;  3QYE A;  1TTH B;  4BBR M;  2RHI A;  5CKF A;  2QQA A;  4C0D B;  2L3P A;  2LQK A;  4OMQ A;  1RAB B;  3LLR A;  5GAN 5;  1EFN A;  5FGK B;  4C5H A;  3P8D A;  2KK4 A;  1VQO Q;  2HL5 C;  2EQI A;  2X9H A;  4LD6 A;  1I5L A;  3SEM A;  1YIJ Q;  3FRN A;  2C5V B;  1WHM A;  3E9F A;  3BLR B;  1Q86 U;  2WSF E;  4JRI A;  3VRZ A;  4EOS B;  2LVM A;  3CQT A;  2X4Y A;  1OIU B;  2CH4 W;  1AWW A;  4B9W A;  2UZL B;  2O01 E;  1M4Z A;  4M77 B;  3G71 T;  2OX7 A;  2J6K A;  1U3O A;  4OVA A;  2GTJ A;  2K5F A;  4XTZ A;  1M2V A;  3AHU A;  2RM4 A;  2MIO A;  4KGX B;  9ATC B;  5GAN h;  2GQV A;  5KYW B;  2HQX A;  2BZ8 A;  2CKK A;  3I56 Q;  1CSK A;  2V1Q A;  5KH6 A;  1OQK A;  1OKW B;  1BKB A;  2RMO A;  2SEM A;  3EGU A;  3VKH A;  1I1J A;  1NLP C;  4ME7 A;  2CUB A;  1YIT Q;  1QLB A;  2IVX A;  5GAN 4;  3U23 A;  3HRS A;  4HA8 A;  4XTX A;  2DFU A;  3CCR T;  3PVQ A;  2OTL Q;  2ENM A;  1GXI E;  3JCM Q;  4IUT A;  2X1N B;  3KHI A;  3RIR A;  2VGM A;  3DB3 A;  4ROC A;  1ZSG A;  2WEV B;  3QKJ A;  1VQ9 T;  1WJS A;  4M78 A;  5GAN j;  2HMA A;  2XDP A;  4J9D A;  1Z9Z A;  2FEI A;  2HZY A;  2E3H A;  3ZEH A;  2BS2 A;  4DBH A;  1FKM A;  2BS4 A;  1IHV A;  1NJI U;  2JM8 A;  2CSQ A;  1UG1 A;  4F70 B;  2M9U A;  2ROL A;  1WHK A;  4N0A A;  3CCE T;  1KIK A;  2EWN A;  2QFZ A;  3F70 A;  3L2R A;  2X4X A;  2HKQ B;  1KHI A;  5IDN B;  4E47 A;  3WVE B;  2BE9 B;  2L3Q A;  2QGS A;  1TUG B;  1SHG A;  1C0M A;  3UA6 A;  4PJO F;  2W99 A;  2MPX C;  2DBK A;  2HQH A;  1KQS P;  1YWO A;  3GNG A;  4A4G A;  2KY9 A;  2DM1 A;  1OPL A;  2ZPE B;  4PL6 A;  1PKD B;  2ATC B;  1WJR A;  1VQP A;  1QKW A;  1ZSZ A;  4PJO E;  2M51 A;  2PMI B;  2L8D A;  2YLB A;  4C8Q F;  2NUP A;  4M77 C;  4E7H A;  1M90 R;  5CIU A;  4XAX B;  2K3X A;  2DAQ A;  4QQ6 A;  1NPP A;  2RF0 A;  1G3W A;  1X2Q A;  1NEB A;  1GUX A;  5ACB A;  2LQN A;  4C8Q E;  3GNF B;  4QVZ A;  3J81 E;  3OW2 S;  4J9E A;  2NUT A;  4C92 G;  5FW9 A;  2GGR A;  3V7S A;  1GCQ A;  3V7R A;  1YN8 A;  1VQ4 Q;  3RKW A;  2EKO A;  3JCM b;  3MHX A;  1ZBX A;  2K57 A;  2LNV A;  3PE0 A;  1YP5 A;  4EMH A;  3HTR A;  3OYG A;  2RI5 A;  4ATO A;  2AKK A;  1M90 U;  3RKY A;  2EJ9 A;  2VC8 A;  4PNO A;  3QII A;  4ZTF A;  4QKU A;  1X27 A;  4A4F A;  1YJN Q;  4C5I A;  3CCV T;  3THK A;  1JXM A;  2J05 A;  4X9C A;  3MI9 B;  5CO7 A;  3A8M B;  1VQ7 A;  3QUI A;  1Q82 R;  4BCQ D;  3SWN B;  3MKD A;  5HBH B;  4BCN B;  5LJ3 f;  3CC2 T;  1D09 B;  1B34 B;  2MAM A;  5CYI B;  3H8Z A;  3CBO A;  1WHH A;  2RI3 A;  1WJQ A;  3ER0 A;  4F16 A;  2CCI B;  3MEW A;  1FXX A;  3UF4 A;  1XO2 A;  1I81 A;  2QEX T;  2ESW A;  2L3S A;  2A7Y A;  3CCL A;  3BHT B;  3I35 A;  4PK4 A;  1XQH A;  4LNP A;  4XTU A;  3DLM A;  1SSH A;  1W70 A;  3M53 A;  4AFU C;  3OYN A;  2RJD A;  2KT8 A;  2F5T X;  1MGQ A;  4IUP A;  2A36 A;  4M7A B;  1VQN T;  3DB4 A;  4F7U B;  3QBY A;  1LVK A;  3BE3 A;  4EC8 B;  4DBF A;  1T3S A;  1ACM B;  1V29 B;  2LCC A;  2RHX A;  3QWX X;  4X34 A;  3TSZ A;  3EHQ A;  4R56 A;  3PTA A;  1BIB A;  2F2C A;  4OB1 B;  2YUQ A;  4A54 A;  1M1F A;  2X35 A;  5CK9 A;  4M78 G;  3CD6 T;  4Z6Y A;  4FW2 A;  4TVR A;  3L2W A;  1CKB A;  2J7I A;  4FCY A;  2PTK A;  1ENW A;  2O88 A;  4XU0 A;  3QYB A;  2A3L A;  4BI8 B;  2ZCF B;  2HD0 A;  2JS0 A;  5GAO l;  3RGF B;  2HEQ A;  4Z02 A;  4OR5 B;  1R8O B;  2E6Z A;  4LUD A;  3M59 A;  4VUB A;  3QDF A;  1OGU B;  1QLY A;  4NL2 A;  4K11 A;  2VXF A;  2L3R A;  4B6M A;  2PNI A;  4LDY A;  1UJY A;  3ULR B;  2HDA A;  1UDL A;  1FIN B;  1QKX A;  4RTU A;  5CAI A;  3HL8 A;  3CC4 T;  1VQO A;  1VUB A;  7AT1 B;  4A53 A;  3CCM T;  2X3W D;  2DL3 A;  4HXJ A;  1VQL Q;  3TQ7 P;  1Q86 C;  2VVK A;  1YIJ A;  3JV3 A;  2PK2 A;  1TFB A;  2DL4 A;  2EJG A;  2KAF A;  3H0H A;  4BY1 X;  4JLG A;  1JEG A;  3OSV A;  4KH0 B;  2JGZ B;  2LMJ A;  1VIN A;  2XDD A;  1N9R A;  1SKU B;  4XK8 E;  1J3T A;  2K3Y A;  3E1S A;  5BNJ B;  1VQ5 Q;  4E7L A;  4DOV A;  2I53 A;  3MJX A;  1AZE A;  4BY6 B;  2PVD B;  4RG2 A;  3OYF A;  3X26 B;  1VQ6 Q;  3C4S A;  3EG9 A;  3I56 A;  1ZA1 B;  2KR6 A;  1QCN A;  1X75 C;  2QTX A;  4M7D B;  3LWH A;  3FIF A;  5IH2 A;  2PVG B;  5L23 A;  3GP8 A;  1YIT A;  1X6B A;  2ZZD B;  1UNH D;  4FYW B;  2OTL A;  1K0X A;  2V22 B;  4M75 D;  3BHU B;  4HCB A;  1MND A;  1YHQ A;  3VYG B;  1W2B P;  2OTJ Q;  3VRY A;  1PSF A;  3RBB B;  3HBL A;  4E7Z A;  2DF6 A;  2VAS A;  2A28 A;  4PJM A;  1GL5 A;  4BCH B;  1ZUY A;  3UDC A;  2VB6 A;  1QWF A;  5KYU A;  5IHK A;  5GMK m;  1NJI C;  1K76 A;  4JX5 A;  2LDM A;  3FDR A;  4ZN1 A;  3JCM d;  1D0Y A;  3HSB A;  2MF2 A;  4AFQ C;  5LJ5 f;  4F7J B;  1N5Z A;  3DOG B;  2DTH A;  3CC7 A;  3CBP A;  2CP5 A;  3F5X B;  4BY7 X;  3MEU A;  4Y72 B;  2DA9 A;  4DEY A;  1QVF A;  4HKE A;  4BB7 A;  3D7S B;  5KYN A;  3JB9 J;  2CP2 A;  3M5A A;  5J39 A;  2M16 A;  2V26 A;  2KDS A;  4RG8 A;  2YHT A;  5CQY A;  4JS5 A;  4BXX X;  2OAU A;  3TW6 A;  3C95 A;  3MEA A;  3LQ5 B;  2YWW A;  4CRI A;  1Z9Q A;  2H3E B;  2VXE A;  1JJ2 S;  1AHJ B;  1RLQ C;  1EZZ B;  3G1J A;  2W96 A;  4C0F A;  1BI2 A;  2LW4 A;  3M4G A;  1X2K A;  2DE0 X;  1YI2 A;  4PJO B;  4JJB A;  3CXC A;  3A5Z B;  4BE2 A;  1N4M A;  2DXC B;  4OMP A;  5HQ0 B;  3OYL A;  1OV3 A;  4E7S A;  1M8M A;  2FRY A;  4KGV B;  2Y90 A;  4E6R A;  1UFF A;  4M77 D;  2E12 A;  2AHJ B;  1VQK A;  1AIS B;  5CEI B;  4OGE A;  1JU5 C;  3EFO A;  2GQI A;  2E64 A;  3EGD A;  2DMO A;  4M75 A;  4E2F B;  1U1S A;  2DD5 A;  1C9B A;  3MPU B;  2I0N A;  3VKI A;  3ZBD A;  4JJC A;  1PWT A;  3MEV A;  3LGF A;  2QAS A;  3JB9 I;  3JCM f;  3LH0 A;  5IT9 E;  3CME T;  1VQ4 A;  1NG2 A;  3A8G B;  1VQP T;  5FU6 B;  2VWF A;  2HQE A;  5HCK A;  3OQ5 A;  1M90 C;  2NWM A;  1IB8 A;  1VYU A;  4KT0 E;  1U1T A;  2W10 A;  3RUX A;  1QW1 A;  1WQ7 A;  1YWP A;  2QYZ A;  3BLH B;  1WDX A;  1RL2 A;  2QXF A;  2JVV A;  1MHN A;  3OS2 A;  2MMP A;  1YJN A;  1E6H A;  2RJE A;  4M4Z A;  3OA6 A;  2K5I A;  3MCA B;  1E7O A;  2AZS A;  5GMK h;  6AT1 B;  4J9F A;  2KBT A;  4WTO B;  1KD1 R;  2C6T B;  5EJC A;  1Q7Y U;  2JTF A;  3RMQ A;  4PFO A;  3M57 A;  2FO0 A;  3AT1 B;  2C0I A;  5KE3 A;  4B9X A;  5A0D A;  2BPM B;  3HKS A;  4AKG A;  2O31 A;  3JB9 H;  4NOY A;  2O9V A;  4N4H A;  1W1F A;  4ELL A;  3BDL A;  3EID B;  2L89 A;  3G4S Q;  3IQL A;  1VQ7 Q;  4M78 F;  1B07 A;  4EOQ B;  1E6G A;  2Y4X A;  2FZK B;  4FYX B;  2NYS A;  3X25 B;  1WI7 A;  2QTV A;  1S72 Q;  5L2W B;  4BDZ A;  1OIY B;  1KD1 U;  2YSQ A;  4N4I A;  4II5 B;  4M78 E;  5I2M A;  3M56 A;  4AKI A;  1V1C A;  4PJJ A;  3HZJ A;  4PJO C;  2V8J A;  2EGE A;  4JZ4 A;  3MY1 B;  4FSX A;  4AKH A;  2JW4 A;  2D8H A;  1I8F A;  1XJW B;  4EOK B;  3C0C A;  5KYW A;  3EFR A;  2FYK A;  1TUC A;  2E41 A;  1MMG A;  1FVV B;  2D0Q B;  3N5B B;  5GAN 2;  4PJL A;  4C8Q C;  4N4G A;  3VS7 A;  2BZX A;  2YRD A;  3WVD B;  5GAN 6;  1OU8 A;  2EAY A;  1UGS B;  2FPE A;  5LJ3 g;  1OEB A;  3P8B B;  1WPY A;  3A8H B;  2IW9 B;  3ME9 A;  1TXQ A;  1TG0 A;  1Y96 A;  3M0U A;  4KUL A;  5D6W A;  2Y4Y A;  1QVP A;  2EW3 A;  2EQK A;  2JMA A;  4Y92 A;  3TSW A;  1ZLM A;  2ECZ A;  2LQ8 A;  2D6F A;  3CMA T;  2JOY A;  3OYC A;  2W0Z A;  4BCF B;  5DLO A;  3MIA B;  2DLP A;  4ROE A;  4JLI A;  3EGX B;  3CCJ T;  3VS3 A;  1PD1 A;  1RLP C;  1IRE B;  1VQL A;  1Q86 R;  2EBP A;  1A0N B;  2YRV A;  3CCU A;  4BI4 A;  1VQM T;  1QP3 A;  2CP6 A;  2M0Y A;  3VUZ A;  4EOI B;  4BCM B;  2R5M A;  1N9S A;  1BCO A;  2LCL A;  1BI1 A;  2XK0 A;  5GAN 8;  1K0S A;  3JRZ A;  5CCA A;  1O9S A;  2DNU A;  3SD4 A;  4BCN D;  2DJQ A;  1VQ5 A;  1M30 A;  3EG0 A;  1VQ6 A;  1B7T A;  2QK0 A;  4M75 G;  2DXB B;  1YIJ T;  3GPL A;  1G3T A;  1GCP A;  2QQB A;  2DL7 A;  1D1A A;  2KQW A;  4CC3 A;  2RHY A;  2DEU A;  2JS2 A;  3OS1 A;  2AK5 A;  2OTJ A;  2EPD A;  5GJW B;  4M7A D;  1AEY A;  4QQD A;  2M02 A;  2QA4 A;  1FWZ A;  2WFY B;  2K5L A;  3VS4 A;  3S6W A;  4Y91 A;  2QQ8 A;  2CDT A;  4X9D A;  2NUZ A;  2WIH B;  3MO8 A;  3I56 T;  3I55 Q;  3O8V A;  4CRL B;  3M0Q A;  5GAM f;  2UZD B;  4UN0 A;  2AT1 B;  1NJI R;  1R77 A;  2DK3 A;  3FJP A;  1M3C A;  2DIL A;  2KRO A;  3HRU A;  2IW8 B;  1X6O A;  1YIT T;  1UHC A;  3EG3 A;  2RK1 A;  4AT1 B;  4EOR B;  2OTL T;  2J6O A;  1YHQ Q;  4L59 A;  1Q95 G;  3VV0 A;  4XTW A;  1M5Q 1;  4L5G A;  1RAF B;  2IIM A;  1KC8 U;  4EOM B;  1H1Q B;  2ZPB B;  3FJ5 A;  4YC3 B;  4XU1 A;  4C0Z A;  1TSF A;  4R0K A;  5IHN A;  1OUL A;  4C0G A;  1VYV A;  2VV5 A;  4ZGJ B;  3O5Z A;  2LC4 A;  2C4G B;  3SWN A;  3C12 A;  2LJ3 A;  4PLI A;  3QHS A;  4RCC A;  2NLU A;  3CC7 Q;  1Y71 A;  3TVT A;  1C6V X;  5FLX E;  3POM A;  4M77 G;  1K4U S;  3I5R A;  5HBJ B;  1VQ8 Q;  1BCM A;  2C5N B;  5ECA A;  4EMK B;  1N27 A;  1LCK A;  5I21 A;  2KE9 A;  2BKD N;  5KYX A;  5LJ5 g;  1RAA B;  3QHW B;  5I2S A;  4M7A A;  1NZ9 A;  4MDW A;  2DZ9 A;  1YI2 Q;  1N8R U;  4OB2 B;  2LTO A;  8AT1 B;  1BU2 A;  2ED1 A;  5KCO A;  3JCM P;  1RAH B;  3A98 A;  4M7D D;  1D0X A;  2GNC A;  4FW1 A;  1VQK Q;  4JUV A;  4J83 A;  1SRL A;  1ZA2 B;  4DBQ A;  2R57 A;  2RO0 A;  1P5E B;  2DX1 A;  2K79 A;  2L2P A;  2DME A;  1F5Q B;  1JBM A;  5AYF A;  4JPB W;  5GMK e;  4JRP A;  1AWX A;  1Q7Y C;  4BCI B;  3NTI A;  3GTM S;  2FVU A;  1VQ4 T;  3G33 B;  2MOX A;  3E2U A;  1KQ1 A;  1Q81 U;  3HHT B;  2RPN A;  2L5Q A;  3M58 A;  1AOJ A;  4BI3 A;  1BI3 A;  1QVF P;  2JXB A;  3OYD A;  4LD9 K;  2R5A A;  3UWN A;  5I22 A;  4OMM A;  1JRI A;  3RNJ A;  1QVG P;  3EAE A;  4IUQ A;  1PC0 A;  2RA2 A;  1YJN T;  1N6A A;  3O0G D;  2FPF A;  1GBR A;  2LX9 A;  3G4S A;  4CFX B;  2DL5 A;  3HB9 A;  2GTO A;  3CPW S;  4FU6 A;  5CQX A;  4F04 B;  5FRO A;  1VOM A;  3JCM g;  1KD1 C;  4LOC A;  3TCJ A;  1S1N A;  1S72 A;  2DIG A;  4YOS A;  1HSQ A;  3L2V A;  1PKT A;  2FRW A;  2K7A A;  2MWP A;  4QW2 A;  3CXC P;  1M1G A;  5GAO m;  2G6F X;  2J06 A;  1E7P A;  1RI9 A;  2F5K A;  2HBP A;  1R0C B;  1UB4 A;  3JB9 F;  3OY9 A;  3CCQ A;  4C92 C;  3G7Z A;  4PJN A;  2IG0 A;  1EIF A;  5GAN d;  4EMK C;  2XIC A;  1OX9 A;  2JTM A;  1KQS S;  3VU3 C;  3OYH A;  1K8A U;  4M7D A;  3NTH A;  3V8J A;  2ZPG B;  1H1R B;  4BCJ B;  1SPK A;  3JCM V;  3MET A;  4PFZ A;  2WMA B;  2JTE A;  4M6V A;  5DLQ E;  5CKH A;  2DRK A;  2GFU A;  1H92 A;  2W2H A;  2WHB B;  2ABL A;  3OYI A;  5LJ3 e;  2CZ0 B;  2RB6 A;  1KK7 A;  2KNB B;  3QPH A;  1SHF A;  2Z0W A;  1UGQ B;  1G3S A;  1R0B G;  2ZGW A;  4M75 F;  1YJW T;  1OL1 B;  3KUF A;  3SDZ A;  3QYG B;  4KRC B;  2LT4 A;  2WJ9 A;  4M75 E;  3DDQ B;  1BK2 A;  1H8K A;  1UTI A;  1H3H A;  2CRE A;  2NUT B;  2RQR A;  1WXB A;  1WHJ A;  3OW2 A;  2XI9 A;  3GBQ A;  3J80 E;  5GAN f;  2YUP A;  3FB9 A;  3CCU Q;  2HL3 A;  1VQL T;  4JJN K;  4G6L B;  2AKL A;  1AWJ A;  3H41 A;  2QF7 A;  2WIP B;  4RTZ A;  4M7A G;  4ZGE B;  2X4W A;  1WYX A;  2A0F B;  1TWB A;  4CFW B;  4F7U G;  1G3Y A;  3G6E Q;  2JZ2 A;  1OI9 B;  1W98 B;  1SSF A;  1U06 A;  4M78 C;  4BDY A;  1EX4 A;  4OGR B;  2KXC A;  4CXA B;  3VS1 A;  2D9T A;  3OMC A;  2JUF A;  3OBY A;  2O9S A;  1VQ5 T;  1KFZ A;  3CPW A;  3KBG A;  2C06 A;  3PGG A;  3H0I A;  2QDL A;  1VQ6 T;  1RAG B;  3I55 A;  4N0A C;  3G71 A;  4E7I A;  2UZE B;  2DD4 A;  3M4Y A;  3TEE A;  1YJ9 Q;  3CCS Q;  1OKV B;  3EH2 A;  1O9K A;  4OB0 B;  3TNW B;  1I5O B;  1OZ2 A;  4E7J A;  3ZL7 C;  1UNL D;  3JCM J;  3RDV A;  2EQJ A;  5ICP B;  1I0C A;  2PU9 B;  3NDQ A;  1BYM A;  2OTJ T;  2QA4 Q;  1KC8 C;  2BTT A;  3LH5 A;  3OS5 A;  3CCR A;  2GFA A;  3HPW A;  5L8R E;  2CH4 A;  1HYO A;  2XMF A;  3HP9 A;  1ZSZ C;  2WSC E;  1MNE A;  1ABQ A;  2FB7 A;  4HNU A;  1JKW A;  1QWE A;  3L2Q A;  3MP1 A;  4GLM A;  1F1B B;  2YDL A;  1VIF A;  3LX7 A;  1VQ8 A;  4EOJ B;  3OBW A;  4J7F A;  1AVZ C;  3VYH B;  1X69 A;  2QGG A;  4BCM D;  2KYB A;  4OF1 A;  4I3Z B;  3DLL A;  1GCQ C;  4IKF A;  4OGC A;  1Y7X A;  4D6W A;  3CCE A;  2H3J A;  1H28 B;  5GAM g;  1I4K 1;  2B86 A;  4XTY A;  4M7D G;  2MK5 A;  4C92 F;  1JXO A;  3LW5 E;  4F6U B;  5GAM h;  1PNJ A;  2O4X A;  5HNB B;  2CP3 A;  2C0T A;  4LDX A;  2KEA A;  2F69 A;  5LL6 S;  3NTK A;  4C92 E;  5LJ5 e;  2KMT A;  2CJM B;  4HCZ A;  1OOT A;  3VS0 A;  4FYY B;  2RK2 A;  1AZG B;  4MML A;  1AWO A;  1WHL A;  1YNZ A;  4EOO B;  2CT3 A;  3BHV B;  2EIF A;  4C8Q B;  1PCX A;  4DQ2 A;  2LX7 A;  2DTO A;  5GAO n;  2KXD A;  1M27 C;  2JM9 A;  4FL6 A;  4BE0 A;  2CS7 A;  1AD6 A;  3GF5 A;  3PO3 S;  4ANJ A;  1Q7Y R;  1JQQ A;  1W2B S;  2EUF A;  1Q81 C;  2VKN A;  3HO8 A;  4MFD A;  2LJ0 A;  3E9G A;  5GMK l;  1W4S A;  2RHZ A;  3X20 B;  8ATC B;  1MMN A;  2VYT A;  1ARK A;  1NPR A;  4JRQ A;  3OYK A;  4Y28 E;  2RHU A;  3CME Q;  4J9C A;  1DJ7 B;  4J6Y A;  4HVW A;  3QXE B;  1QCF A;  1KSW A;  3EGX A;  5D6Y A;  5FU7 C;  4ZTJ A;  3M0T A;  3OYB A;  4ELZ C;  1H1S B;  1SRM A;  3OYE A;  2WMB B;  1PHT A;  2F2V A;  5A2Q E;  2W9F A;  2HSE B;  3EG1 A;  1LNX A;  2RN8 A;  2COY A;  2ZPH B;  2J6F A;  4RTT A;  1U5S A;  2DIQ A;  3JCM e;  2IN3 A;  1WLP B;  2CUD A;  2CP0 A;  2PZ1 A;  2E3I A;  3X28 B;  1OZ3 A;  1QP2 A;  4J5Y A;  2XG8 D;  1K8A C;  2F1L A;  3G4S T;  1GFC A;  4DOW A;  1VQ7 T;  2B9R A;  2DXB A;  4J6W A;  4IIM A;  1WXT A;  2LCS A;  5GMK j;  1RAD B;  3PMT A;  5EG2 A;  3RR6 A;  1S72 T;  5IAY A;  4M77 A;  2QEX A;  1KJW A;  2FHD A;  3H9N A;  4LDU A;  2G9X B;  2RQU A;  4MMK A;  1G2B A;  4CFV B;  4UC4 A;  3CCQ Q;  4BCK B;  3I5S A;  4II1 A;  2GBQ A;  2EYQ A;  5IHI A;  2PJQ A;  1JJ2 A;  3CCL T;  4OML A;  2EQM A;  2K2M A;  1H64 1;  4OMF B;  1K9M R;  1WFW A;  2DET A;  4RUG A;  5FRM A;  4DBR A;  3M54 A;  5LMK B;  4IUU A;  1M2O A;  4Z88 A;  2M1H A;  2IW6 B;  4M7A F;  1VYT A;  5KYY B;  1PRL C;  3VJP A;  2I2L A;  2CCH B;  5J26 A;  1G3N C;  3JCM X;  1XOV A;  5LJ3 h;  1ABO A;  1C1A A;  2AIR B;  4A4K A;  2E65 A;  1T0H A;  1O75 A;  3A1P A;  4BBS M;  3X24 B;  4LDV A;  1K9M U;  3RKX A;  5KCH A;  2LNH B;  4BE1 A;  1T0J A;  1YFN A;  2KR3 A;  2P4R A;  1WZO A;  4FSS A;  4FX3 B;  5GAO p;  3CC4 A;  3G6E A;  3CCM A;  3TU4 K;  2KGT A;  4EDU A;  3OYA A;  4CFM B;  4GBQ A;  1VQM Q;  5KE2 A;  2SRC A;  3QHR B;  5LJ3 j;  3RES A;  2JT4 A;  1X01 A;  1VQO T;  3EJ1 B;  3LYI A;  3OS0 A;  4PLL A;  4A4H A;  4RTX A;  2XID A;  4Q5W A;  1FMW A;  5IHY A;  2W9Z A;  1YJ9 A;  3CCS A;  4GY5 A;  2YUO A;  4RTW A;  3JCM W;  4F17 A;  3A8L B;  2OI3 A;  4OP0 A;  4XTV A;  4ESR A;  4EMG A;  4HLQ A;  2CGH A;  2MWO A;  5FWC A;  1M1K R;  2KI7 A;  4JJD A;  3NPF A;  2QGF B;  1KC8 R;  1SF9 A;  1FYN A;  4HT9 A;  1BU1 A;  2QDY B;  1TD6 A;  2DER A;  5GAN 7;  1D3B B;  5GAN g;  3G71 Q;  3A8O B;  3NFC A;  1Y57 A;  3I55 T;  2KRS A;  1XNI A;  1MV0 B;  2QI2 A;  4OMN A;  2GCX A;  2BKZ B;  3L2Z A;  4MDX A;  4M7D F;  4EIK A;  4J9G A;  5FWB A;  2MCN A;  4RMO A;  1K9A A;  1D1B A;  1KHC A;  2YXY A;  1TOV A;  2JNG A;  5IXB A;  1YHQ T;  2E5K A;  2CZ7 B;  4BD3 A;  1OL2 B;  2C0O A;  2YT6 A;  5GAO r;  1M1K U;  4BCP B;  1NLO C;  5CR2 A;  4JX6 A;  4M75 C;  4M7D E;  3CCR Q;  5IDP B;  1TS9 A;  2QG9 B;  3OW2 P;  1VIE A;  1H27 B;  3B57 A;  5CKB A;  1K1Z A;  1AT1 B;  2X4J A;  4JZ3 A;  2HCK A;  3TNH B;  1G83 A;  1Y96 B;  4JDS A;  4RTY A;  4EPC A;  4FIB A;  4IIO A;  5D6X A;  1VQ9 Q;  1N8R R;  1WQW A;  3OSS C;  2RD1 A;  1HXD A;  4HVV A;  4KH1 B;  4MIM A;  4F7N B;  1MMA A;  3CC7 T;  2LQW A;  1B34 A;  4AFZ C;  5GAM e;  1GY3 B;  1BI0 A;  3PNW C;  2F2X A;  2C5O B;  4BCG B;  4Z8A A;  2FL7 A;  4C92 B;  4AG2 C;  2FPD A;  1VQ8 T;  2DRM A;  2CSI A; 
#chains in the Genus database with same CATH homology
 3FEO A;  4CRI A;  4M7A E;  2PQW A;  3WXM B;  2VXE A;  1YJW A;  4JRK A;  1UGQ B;  3BG9 A;  1JJ2 S;  1AHJ B;  1XTD A;  3OB9 A;  1G3S A;  2QQS A;  4F7U E;  1OI1 A;  2ZGW A;  1BI2 A;  4M75 F;  4C0F A;  4WF2 A;  5HK0 A;  3M4G A;  1W2B A;  1YJW T;  1RI0 A;  3KUF A;  2MI6 A;  3L1A A;  1YI2 A;  3SDZ A;  3QYG B;  5FU6 C;  4PJO B;  4IUR A;  2HAX A;  3H4C A;  3CXC A;  3A5Z B;  4J6X A;  3JB9 G;  4F7U A;  4BE2 A;  3QO3 A;  2LT4 A;  3BG3 A;  2DXC B;  2WJ9 A;  2E70 A;  2EFI A;  1YI2 T;  4C0D C;  4M75 E;  3OYL A;  5HKC A;  3URG A;  2VGN A;  1IZ6 A;  3L42 A;  5LJ5 h;  1M8V A;  2GF7 A;  2Y90 A;  4AI6 A;  3CEY A;  1LJO A;  2E12 A;  2AHJ B;  2JN0 A;  2XI9 A;  4M77 D;  5GAM d;  3OW2 A;  3DL1 A;  4C92 A;  4OGE A;  5CKD A;  1ZHI A;  2E6N A;  4M75 A;  2E64 A;  3H6Z A;  3UT1 A;  1U1S A;  3J80 E;  2DD5 A;  4ELJ A;  5LJ3 d;  3PT9 A;  4EMK A;  5GAN f;  1VQK T;  3CME A;  3TW7 A;  3FB9 A;  4M78 D;  2BIV A;  3VKI A;  3ZBD A;  3VKG A;  1M9S A;  1UEB A;  3LGF A;  3MEV A;  3V8K A;  3JB9 I;  4JJN K;  1VQL T;  2YLC A;  3E19 A;  2G77 A;  5GMK i;  1NE8 A;  3JCM f;  3LH0 A;  5IT9 E;  2QF7 A;  3CME T;  1VQ4 A;  3MP6 A;  3A8G B;  3QYE A;  4MZT A;  1VQP T;  4M7A G;  4ZGE B;  5FU6 B;  2X4W A;  4BBR M;  2RHI A;  3RMS A;  4F7U G;  1G3Y A;  2HQE A;  3OQ5 A;  1M90 C;  5CKF A;  2DKG A;  2JZ2 A;  2QQA A;  4KT0 E;  1SSF A;  1U1T A;  4HNT A;  4M78 C;  2LQK A;  4C0D B;  3RUX A;  4BDY A;  1QW1 A;  1WQ7 A;  3LLR A;  3BY7 A;  5GAN 5;  4C5H A;  3P8D A;  2KK4 A;  2KVQ G;  3QDR B;  4CI0 C;  5C6S A;  1RL2 A;  2QXF A;  2JVV A;  2D9T A;  3CPF A;  2KSS A;  4MZP A;  3OMC A;  2JUF A;  1MHN A;  4LD6 A;  2MMP A;  3OBY A;  3GLX A;  3OS2 A;  3LWI A;  2RJE A;  1YJN A;  5LJ5 j;  1I5L A;  1VQ5 T;  2E5Q A;  4NL3 A;  3FRN A;  3DKM A;  3CPW A;  3OA6 A;  3E9F A;  2PVO B;  3KBG A;  2K5I A;  3MCA B;  1Q86 U;  4OB3 B;  2WSF E;  2C06 A;  3PGG A;  4JRI A;  1VQ6 T;  2LVM A;  2X4Y A;  3BG5 A;  4N0A C;  3I55 A;  5GMK h;  3G71 A;  2DD4 A;  3M4Y A;  4E7I A;  4B9W A;  2BS3 A;  3TEE A;  4ELY C;  2O01 E;  1M4Z A;  5EJC A;  1Q7Y U;  4M77 B;  3G71 T;  2JTF A;  4OB0 B;  3RMQ A;  4OVA A;  1OZ2 A;  4E7J A;  2K5F A;  4XTZ A;  3M57 A;  3JCM J;  3AHU A;  2EQJ A;  2RM4 A;  4LDW A;  4M78 B;  3TRE A;  5GAN h;  5KE3 A;  2PU9 B;  1PSE A;  4HL4 A;  4B9X A;  5A0D A;  2GQV A;  3HKS A;  5IN1 A;  1BYM A;  2HQX A;  4AKG A;  3JB9 H;  2OTJ T;  2CKK A;  4NOY A;  1KC8 C;  3HRT A;  5KH6 A;  3JCM h;  2DTI A;  3BDL A;  4N4H A;  4C5G A;  4MFE A;  1BKB A;  3PIO A;  2L89 A;  3VKH A;  3OS5 A;  3CCR A;  2GFA A;  2VUB A;  3OYY A;  3HPW A;  4M78 F;  4ME7 A;  5L8R E;  3SB2 A;  4PJO D;  1QLB A;  5GAN 4;  3HP9 A;  2Y4X A;  3HRS A;  4HA8 A;  4XTX A;  2P0Q A;  3CCR T;  3BFM A;  4KBM B;  3X25 B;  1GXI E;  2WSC E;  3PFS A;  4FM4 B;  3JCM Q;  1K73 U;  4HNV A;  4BDZ A;  1KD1 U;  2FB7 A;  4IUT A;  4N4I A;  4M78 E;  4HNU A;  3KHI A;  3CBM A;  5I2M A;  3RIR A;  3M56 A;  3L2Q A;  4AKI A;  2VGM A;  2ZZD A;  5HK3 A;  3HZJ A;  3MP1 A;  4HCC A;  3DB3 A;  4PJO C;  2RI2 A;  3QZ5 B;  2V8J A;  4C8Q D;  1KQ2 A;  1VIF A;  4XU3 A;  1ZQ1 A;  3QKJ A;  3LX7 A;  1VQ9 T;  3VYG A;  1WJS A;  4FSX A;  4AKH A;  4M78 A;  3JCM c;  1I8F A;  5GAN j;  1VQ8 A;  2XDP A;  3OBW A;  3EFR A;  2FYK A;  4J7F A;  3VYH B;  2E41 A;  2D0Q B;  4OF1 A;  3N5B B;  3DLL A;  3ZEH A;  2BS2 A;  5A0G A;  5GAN 2;  1FKM A;  1Q82 U;  4IKF A;  2QA4 A;  4OGC A;  4NC6 A;  1Y7X A;  2PUO B;  2BS4 A;  4IUV A;  4C8Q C;  4D6W A;  3CCE A;  2DEQ A;  4O5V A;  2KMG A;  4N4G A;  1NJI U;  2H3J A;  4QVD A;  2M9U A;  5GAM g;  1K9M C;  1I4K 1;  3WVD B;  5GAN 6;  4PKC C;  4XTY A;  3SFM A;  4N0A A;  2EAY A;  4M7D G;  3CCE T;  4C92 F;  1UGS B;  2EWN A;  5LJ3 g;  2QFZ A;  1BIA A;  3P8B B;  1WPY A;  3A8H B;  3F70 A;  3ME9 A;  3LW5 E;  1Y96 A;  2DXT A;  3L2R A;  2G3R A;  2O4X A;  2X4X A;  3QG1 A;  4KUL A;  5GAM h;  5D6W A;  2Y4Y A;  4LDX A;  1KHI A;  3QJY A;  1QVP A;  4KUI A;  4E47 A;  2EQK A;  3WVE B;  2F69 A;  4J8O A;  3BW1 A;  3NTK A;  5LL6 S;  4C92 E;  1LOJ A;  5LJ5 e;  2LQ8 A;  3CCJ A;  2D6F A;  3CMA T;  2KMT A;  2JOY A;  3OYC A;  4HCZ A;  3OYJ A;  3GIB A;  5DLO A;  2RK2 A;  4PJO F;  4MML A;  1QVG S;  4JLI A;  3CCJ T;  1VQM A;  5DY9 A;  2EIF A;  1IRE B;  4C8Q B;  3KXT A;  2CYZ B;  1VQL A;  2YRV A;  4DQ2 A;  3GNG A;  4A4G A;  2KY9 A;  3CCU A;  2DTO A;  5GAO n;  2ZPE B;  4FL6 A;  4BI4 A;  1VQM T;  4PL6 A;  4BE0 A;  2CS7 A;  1WJR A;  1VQP A;  1QP3 A;  3FLG A;  3GF5 A;  2B8A A;  3VUZ A;  4PJO E;  2DJZ A;  3LGL A;  3CCU T;  2R5M A;  3QJ6 A;  2L8D A;  2YLB A;  4C8Q F;  5C0M A;  4M77 C;  4E7H A;  1W2B S;  1N9S A;  5CIU A;  1Q81 C;  4XAX B;  2LCL A;  1QVF S;  2K3X A;  2DAQ A;  1BI1 A;  2XK0 A;  5GAN 8;  3HO8 A;  4MFD A;  3CXC S;  4QQ6 A;  1NPP A;  2HNI A;  3E9G A;  3JRZ A;  5CCA A;  4PJO A;  5GMK l;  1G3W A;  3QYH B;  1W4S A;  4R55 A;  1KG1 A;  3M55 A;  1O9S A;  2RHZ A;  3X20 B;  5GAN 3;  3SD4 A;  2VYT A;  2E10 A;  3JB9 D;  2LT1 A;  3G6E T;  1NPR A;  2DXC A;  5CVI A;  4JRQ A;  1VQ5 A;  4C8Q E;  2DXU A;  3GNF B;  3OYK A;  4Y28 E;  4QVZ A;  3GOX A;  2RHU A;  5LJ5 d;  1VQ6 A;  1H3Z A;  3J81 E;  3OW2 S;  4C92 G;  1DJ7 B;  4J6Y A;  4M75 G;  3QXE B;  3SWN C;  3V7S A;  1YCY A;  3V7R A;  5D6Y A;  5FU7 C;  4FT2 A;  4ZTJ A;  2DXB B;  1YIJ T;  2QQR A;  2EQU A;  4C8Q A;  3GPL A;  1UGP B;  1G3T A;  2QQB A;  3ASK A;  3OYB A;  3RKW A;  2EKO A;  4ELZ C;  3OYE A;  3JCM b;  3MHX A;  2KQW A;  1JB0 E;  1ZBX A;  5A2Q E;  3INZ A;  2K57 A;  2LNV A;  2RHY A;  4EMH A;  3OYG A;  2RI5 A;  3ZFJ A;  3CCS T;  1YJ9 T;  4ATO A;  1M90 U;  2XD0 A;  3RKY A;  1LNX A;  5GAN e;  2EJ9 A;  3OS1 A;  2VC8 A;  4PNO A;  2OTJ A;  3QII A;  4ZTF A;  3PIP A;  4M7A D;  2ZPH B;  4A4F A;  2R58 A;  2DIQ A;  4QQD A;  1FWZ A;  2K5L A;  4C5I A;  3JCM e;  3CCV T;  2DVE A;  3S6W A;  4Y91 A;  1M1K C;  2QQ8 A;  4M77 F;  5DM7 R;  4X9D A;  4X9C A;  1Y07 A;  1KQS A;  3MO8 A;  5CO7 A;  3A8M B;  4V2S A;  1VQ7 A;  3I56 T;  2QA4 T;  3X28 B;  1OZ3 A;  3QUI A;  3O8V A;  1QP2 A;  2PUK B;  2CZ1 B;  4J5Y A;  4NS5 A;  3SWN B;  2XG8 D;  5GAM f;  5FU7 B;  2DK3 A;  2DZC A;  5M9O A;  3G4S T;  1K8A C;  3FJP A;  4DOW A;  1VQ7 T;  4M7A C;  4M77 E;  3HRU A;  1YIT T;  1X6O A;  2DXB A;  5LJ3 f;  4J6W A;  3CC2 T;  2XDB A;  2RK1 A;  3HFN A;  1B34 B;  2MAM A;  2LRQ A;  3H8Z A;  5GMK j;  2OTL T;  3FC3 A;  3BDU A;  3CBO A;  4L59 A;  3PMT A;  5EG2 A;  3VV0 A;  1S72 T;  4XTW A;  2RI3 A;  1VQ9 A;  1M5Q 1;  5IAY A;  4M77 A;  1WJQ A;  3ER0 A;  2QEX A;  2FHD A;  3MEW A;  5GAO q;  1FXX A;  4L5G A;  4LDU A;  4MMK A;  1I81 A;  2V8K A;  4UC4 A;  1KC8 U;  2QEX T;  2ZPB B;  3JSC A;  3OYM A;  2A7Y A;  4XU1 A;  4C0Z A;  3CCL A;  4II1 A;  1XQH A;  4XTU A;  3DLM A;  2EYQ A;  3M53 A;  4BAC A;  3VUB A;  1JJ2 A;  1HK9 A;  2K2V A;  4C0G A;  2VV5 A;  4ZGJ B;  3CCL T;  3OYN A;  2EQM A;  4XQ3 A;  1H64 1;  2RJD A;  4OMF B;  4RCB A;  2F5T X;  1MGQ A;  2LC4 A;  4IUP A;  4M7A B;  1VQN T;  3SWN A;  3CMA A;  3C12 A;  3DB4 A;  3P8H A;  4PLI A;  3QHS A;  4F7U B;  4RCC A;  2NLU A;  3QBY A;  5FRM A;  2RJC A;  4QQG A;  3M54 A;  1Y71 A;  3EFS A;  5FLX E;  1V29 B;  3M9Q A;  2K4Y A;  4IUU A;  2LCC A;  2RHX A;  1N8R C;  2M1H A;  2P0K A;  4X34 A;  4M77 G;  4M7A F;  4QSH A;  4R56 A;  4DA4 A;  1QVG A;  3PTA A;  1G5V A;  1BIB A;  3VJP A;  4C5E A;  4OB1 B;  4A54 A;  1M1F A;  2I2L A;  5J26 A;  2X35 A;  5CK9 A;  4M78 G;  4EMK B;  2DO3 A;  3JCM X;  1N27 A;  1XOV A;  5LJ3 h;  3CD6 T;  4Z6Y A;  5I21 A;  4TVR A;  3L2W A;  4A4K A;  2E65 A;  1O75 A;  4BBS M;  1OYX A;  2BKD N;  3X24 B;  4LDV A;  1K9M U;  1VQK A;  3RKX A;  4A4E A;  5KCH A;  5LJ5 g;  5I2S A;  4M7A A;  4XU0 A;  1NZ9 A;  4BE1 A;  3QYB A;  2A3L A;  2DZ9 A;  2HD0 A;  2ZCF B;  4L6V 5;  4MDW A;  4BI8 B;  5GAO l;  2P0P A;  1N8R U;  3QSU A;  4OB2 B;  4J7I A;  2LTO A;  4Z02 A;  1FX7 A;  1R8O B;  2E6Z A;  3JCM P;  5KCO A;  4M7D D;  3M59 A;  4VUB A;  5GAO p;  3OMG A;  4NL2 A;  3G6E A;  3CC4 A;  2VXF A;  2L3R A;  3CCM A;  4LDY A;  3TU4 K;  2XKO C;  4BY6 C;  4EDU A;  5GAM j;  3OYA A;  3JAM E;  4JUV A;  5CAI A;  1VQO A;  3CC4 T;  3HL8 A;  4J83 A;  2DD4 B;  5KE2 A;  1VUB A;  2ZPI B;  4A53 A;  3CCM T;  4JS4 A;  2R57 A;  4ZGD B;  2RO0 A;  4JX4 A;  4QVC A;  1YBY A;  3RES A;  5LJ3 j;  1Q86 C;  1YIJ A;  4M7D C;  2ZPF B;  1X01 A;  1VQO T;  4P5N A;  3LYI A;  3OS0 A;  4PLL A;  4A4H A;  1JBM A;  2XID A;  2EJG A;  2XU8 A;  4Q5W A;  2KAF A;  5AYF A;  5GMK e;  4JRP A;  1Q7Y C;  2E1H A;  3QWL A;  1YJ9 A;  3NTI A;  4GY5 A;  3CCS A;  4JLG A;  2FVU A;  1VQ4 T;  3OSV A;  3HFO A;  3JCM W;  1KQ1 A;  2XDD A;  2QQ9 A;  1N9R A;  1Q81 U;  3QZ9 B;  4XK8 E;  3HHT B;  2K3Y A;  3E1S A;  3A8L B;  2L5Q A;  3M58 A;  4OP0 A;  4XTV A;  1U8R A;  4BI3 A;  1BI3 A;  4KUD K;  3CCV A;  4EMG A;  4E7L A;  4MZM A;  2RH2 A;  4HLQ A;  2CGH A;  2MWO A;  4DOV A;  2M0O A;  4PJO G;  4ZN3 A;  3OYD A;  4LD9 K;  4BY6 B;  2R5A A;  2PVD B;  4RG2 A;  2BUD A;  3UWN A;  3OYF A;  3X26 B;  3RER A;  3C4S A;  1JRI A;  3I56 A;  2KR6 A;  3EAE A;  4IUQ A;  4HT9 A;  2QDY B;  3Q1J A;  2RA2 A;  5GAN 7;  4E7K A;  1N6A A;  1X75 C;  2QTX A;  1YJN T;  2LX9 A;  2IVW A;  4HT8 A;  2XHC A;  1D3B B;  3LWH A;  3G4S A;  4M7D B;  5GAN g;  3FIF A;  3A8O B;  2PVG B;  3GP8 A;  1YIT A;  3J7A F;  3HB9 A;  3NFC A;  3CPW S;  4FU6 A;  3CC2 A;  3I55 T;  2ZZD B;  1WGS A;  3S3M A;  5CQX A;  4C8Q G;  1K73 C;  5FRO A;  2WAC A;  2OTL A;  1XNI A;  2QI2 A;  3JCM g;  2V8I A;  4C92 D;  1KD1 C;  4LOC A;  4M75 D;  3TCJ A;  2GCX A;  3L2Z A;  1S72 A;  2DIG A;  4HCB A;  4MDX A;  4M7D F;  1YHQ A;  1UGR B;  3VYG B;  3MP8 A;  3PMI A;  4FT4 A;  4RMO A;  3S3N A;  3L2V A;  1PSF A;  2MWP A;  3HBL A;  4QW2 A;  3T9N A;  1M1G A;  1KHC A;  5GAO m;  2JNG A;  2WSE E;  1E7P A;  1YHQ T;  2F5K A;  2HBP A;  2CZ7 B;  4BD3 A;  1UB4 A;  3JB9 F;  3OY9 A;  5GAO r;  3CCQ A;  4C92 C;  1M1K U;  3G7Z A;  5CR2 A;  3L2U A;  4JX6 A;  4M75 C;  4M7D E;  2QDJ A;  2EJF A;  3S3O A;  2IG0 A;  1EIF A;  4RKU E;  5GAN d;  4EMK C;  2XIC A;  3UDC A;  1Q82 C;  2JTM A;  5CKE A;  3CCQ T;  2DPP B;  1KQS S;  1NJI C;  3VU3 C;  2P4T A;  1VIE A;  5GMK m;  4JX5 A;  1VQN A;  2LDM A;  3FDR A;  5HY6 A;  4ZN1 A;  5FRN A;  3JCM d;  4XU2 A;  5CKB A;  3OYH A;  1K8A U;  2MF2 A;  3HSB A;  4M7D A;  1D3B A;  5LJ5 f;  2X4J A;  3NTH A;  3V8J A;  2ZPG B;  1WNL A;  1Y96 B;  2DTH A;  4JDS A;  3V8L A;  2O4X B;  4EPC A;  4FIB A;  3JCM V;  3CC7 A;  3CBP A;  5D6X A;  2RJF A;  3MET A;  3R6O A;  3C94 A;  1TH7 A;  2CZ6 B;  1WQW A;  3MEU A;  3OSS C;  2RD1 A;  4GLK A;  1HXD A;  5J3B A;  4BUG A;  1QVF A;  4M6V A;  4MIM A;  4HKE A;  4BB7 A;  3JB9 J;  3CC7 T;  5DLQ E;  1B34 A;  1P92 A;  5GAM e;  3M5A A;  5CKH A;  5J39 A;  1BI0 A;  3PNW C;  4YTL A;  3V7C A;  2M16 A;  2GFU A;  4RG8 A;  2KDS A;  2YHT A;  4O6J A;  3CD6 A;  2FL7 A;  5CQY A;  4F7U F;  4C92 B;  4JS5 A;  5LJ3 e;  2CZ0 B;  2OAU A;  2RB6 A;  4M75 B;  3TW6 A;  3C95 A;  3MEA A;  3QPH A;  1VQ8 T;  2DD5 B;  5A0L A;  3OYI A;  3UPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...