1UGQB

Crystal structure of apoenzyme of co-type nitrile hydratase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile Hydratase alpha subunit
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 65
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugqB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugqB02
4OB1B 3QYHB 2PVDB 2CZ0B 2DXCA 4Y28E 3VYHB 1DJ7B 4ZGJB 2ZPEB 1UGPB 2DXBA 3VYGB 2O01E 3X20B 3X26B 3LW5E 2ZZDA 3A8OB 2CZ6B 2D0QB 2ZCFB 2PUKB 3QYGB 2PU9B 2ZPBB 1PSEA 4OB3B 3X28B 2WSEE 4ZGDB 2PVGB 2DD5B 3QZ9B 2PVOB 4KT0E 2CZ7B 3VYGA 3X25B 2DPPB 1IREB 2WSCE 3A8GB 4ZGEB 3HHTB 2DD4A 4OB0B 2ZPGB 2ZPHB 2WSFE 1UGRB 3WVEB 4L6V5 1V29B 1GXIE 3WVDB 4OB2B 3A8HB 1QP3A 1UGQB 3A8LB 1PSFA 1QP2A 2PUOB 2DXCB 3A8MB 1AHJB 2AHJB 2ZPFB 2QDYB 2DD5A 1JB0E 2ZPIB 3QXEB 5L8RE 2DXBB 1UGSB 4XK8E 2CZ1B 4FM4B 3X24B 2ZZDB 2CYZB 4RKUE 3QZ5B 2DD4B
chains in the Genus database with same CATH superfamily
2DVEA 2HQEA 1KSWA 5LJ5d 4BDZA 2EGEA 2EQKA 3TNWB 2K7AA 2JJ9A 4AT1B 4ELLA 4ZTFA 5KCOA 4ZGJB 2KQWA 1GUXB 1YP5A 2F5TX 2YRCA 4Y72B 3EAEA 4BI4A 5GAMj 1NLOC 1SRMA 2KDSA 3EH2A 4JJCA 3CCSA 1VQ9A 1KQSS 3H0HA 2GQVA 2FZKB 2LT4A 4BY7X 4FU6A 4J9GA 2JS0A 2DKGA 3VUZA 2L3SA 5GJVB 3WXMB 4LNPA 1QMZB 3PIOA 5KE3A 5GAOr 1KQSP 1N4MA 1QLBA 2EWNA 3M53A 1Q95G 5J26A 5HKCA 4R55A 3MY1B 1RI9A 2QQ8A 4PFPA 4F04B 4N0AA 1MUZA 5LJ3f 4LUEA 2OTJT 1ZP2A 1H92A 1TUDA 2EYZA 5LL6S 2QQSA 2RHXA 4F17A 1TFBA 4OB0B 4RUGA 1R0BG 3THKA 2FEIA 2DA9A 3P8HA 3VS6A 1PRLC 1D1CA 3VS0A 2A37A 2E5QA 3HL8A 4Z89A 1MMNA 5FU6B 4C8QB 2RI5A 4MMLA 4A4KA 2DMOA 1AT1B 1M1KU 4PJLA 3ZBDA 2KRSA 3HFNA 4OMLA 4BACA 3EFOB 1FMKA 3CCUT 1TS9A 4IUTA 4IUVA 4LN2A 2P0PA 3UA7A 1TUCA 2EBPA 1KK7A 3GOXA 3CMAT 1WXBA 3G71T 1D3UB 1AWOA 1VQ4T 2DO3A 3UF4A 2E6ZA 1VQLT 1WNLA 2YHTA 1PM3A 2YUNA 3M0QA 1U1TA 5IHYA 2W2HA 3J80E 3L2VA 2YLCA 2E65A 2QEXQ 1RL2A 2HDAA 1UB4A 3SWNB 1P5EB 2UZDB 3RKYA 4HT8A 1D3BB 2JOYA 1D09B 2QGFB 1N9SA 4AKHA 4M77C 2IW6B 1GCQC 1GFCA 1KD1U 4LDXA 2H3JA 1UNHD 5HCKA 1JRIA 1E7OA 4RCCA 4F7JB 3EG0A 2E4HA 3X20B 1SF9A 1YI2T 3RMSA 3A98A 4AFSC 4E7SA 4RMOA 4GY5A 3CCVT 1VQ6T 2I2LA 3POMA 3CD6A 2PU9B 2EQJA 1UHFA 3A5ZB 4KGXB 3SDZA 4BCQD 4JJNK 1G3NC 1OKVB 1VYUA 2F2VA 3G6EQ 5FRMA 2CUBA 3CC2Q 1VQNA 4HNUA 4R56A 4EONB 2E10A 3EOCB 1HD3A 2ZGWA 4J5YA 3X25B 4BI8B 4XU0A 4ORZA 2EGAA 4WF2A 4RODA 5CAIA 5LJ3g 2QQRA 1F1BB 3M56A 1BB9A 1YITT 3L1AA 1WI7A 3V7CA 4JJBA 1G5VA 4HVUA 2CP3A 1XO2A 3BLRB 5KYUA 1VIFA 3EGDA 4R0KA 2C5VB 1HK9A 2A0FB 4EOSB 5AT1B 2JXBA 2DIQA 2LNHB 2SRCA 5LJ3d 5CKDA 4M78F 4HNTA 2IN3A 1IGQA 2O31A 4M75D 4GLKA 4OMPA 5FU7C 2K3YA 1Q82R 2DD5A 2WIHB 2RJDA 1JB0E 3TREA 3TNHB 5CCAA 2KROA 4JLGA 4E7HA 2HNIA 3OA6A 2H3EB 1JJ2S 4Y92A 3BLQB 1H28B 2IPOB 2Y90A 4PJOA 4E7IA 4CFUD 3EJ1B 1K1ZA 2IVWA 1ZSZA 5CQYA 4ATOA 3KXTA 2DX1A 1X43A 3PVLA 2JM8A 1D1BA 2LCLA 2M9UA 4M7DC 3TSWA 1GRIA 1JJ2P 2NUPA 1BCOA 1W6XA 3LH0A 4K11A 2DXBA 1KHIA 4OGCA 1WXTA 2F69A 4EOJB 8AT1B 4NSTB 1K73R 3TN8B 4C92D 2CZ6B 2D0QB 4J6WA 1WLPB 2PUKB 2DM1A 2A36A 4PJNA 5LJ5e 3CCUA 2P0KA 5I22A 2DIGA 3GBQA 3CMAA 2RF0A 1H1QB 3M0RA 1S72T 3G71A 3EGXA 2AKKA 1ABOA 1VQ4A 1VQLA 2E41A 2CUDA 2MCNA 3CCRT 2YRVA 2RHIA 2MWOA 1QLYA 8ATCB 1WX6A 4M7AF 2YXYA 4RTYA 1JXMA 5EC7A 1ENWA 2BTTA 1VQKQ 1H3HA 3L42A 9ATCB 2ZPGB 1NJIR 1PWTA 2K3XA 3JB9F 3VS2A 3WVEB 2XG8D 1T3LA 1Q82C 1JBMA 4C8QE 3WVDB 2AKLA 4M75A 4RTTA 1GL5A 1ZHIA 2OI3A 3MP8A 3VS1A 5HK3A 3CCLT 2DAQA 3VKIA 2A08A 4KGZB 1YI2A 5DLOA 1YN8A 2DXTA 2QK0A 1C0MA 1R77A 1BIBA 1FMWA 4FYVB 4F7LB 4BI3A 2P4RA 2EGCA 2GQIA 1IHVA 2JTMA 4ELJA 3QSUA 1I1JA 2FHDA 4BBSM 5L8RE 1OPKA 2G3RA 1VQ9Q 2WMAB 3META 3FC3A 3CCSQ 2LQKA 1K73C 5IT9E 2DK3A 2DZCA 1JU5C 5BNJB 1UHCA 2LX9A 1KXUA 1NZ9A 2VUBA 1LVKA 3C4SA 3JCMW 2RMOA 4DBHA 4PJOG 2KXCA 4CXAB 3MIAB 2EQIA 3JCMX 4YC3B 4AKGA 3V7RA 3V8JA 2ED1A 3M0PA 5I5ZB 2P84A 1Z9QA 2RI2A 4O5VA 3NTKA 3JV3A 1WHLA 2VGNA 5KE2A 2YWWA 1VQOT 3EG1A 2EJ9A 1B07A 4M77A 1KQ2A 1K0SA 1YIJT 2E5KA 2DEQA 3HRUA 1QWFA 3GLXA 5GJWB 2LTOA 4FW1A 2O9SA 3KUFA 1H25B 5HBEB 4OVAA 1C9BA 5C6SA 4EC9B 4F7UE 3X28B 2I40B 2DD5B 2EFIA 3CBMA 4DEYA 4AMCA 2KT1A 1RAIB 2H8HA 4MZPA 5IXFA 2KRMA 2WSCE 2NUTA 3DDQB 3CCJT 2HAXA 4M7AG 2DVJA 4JZ4A 2MF2A 3BG3A 2V22B 4C5IA 2DFUA 4BCQB 2MWPA 2EQMA 2PJQA 4MFDA 1PKTA 3OB9A 1K9AA 3JB9G 4Q5WA 4EOPB 2PK9B 4G6LB 3JB9J 1NBEB 1VOLA 2HZYA 4X9CA 1TUGB 4DOWA 1WXUA 5IN1A 2ENMA 2L5QA 3VV0A 1HSQA 2AT1B 4BD3A 4V2SA 1UJ0A 1M2VA 1CKAA 1SSFA 1N8RR 2JZ2A 2O4XA 3CCMT 1TH7A 4RG8A 4IIOA 3M59A 3G6EA 3BDUA 4JX6A 3EGXB 5DM7R 3NFCA 4Z88A 2QDYB 3MJXA 1GBRA 2C4GB 4XK8E 4BE1A 4FYYB 4X1VA 3CCRA 5LJ3e 3BW1A 1H8KA 3PTAA 1FXXA 3CPWS 4CC4B 5IH2A 3L2QA 3CD6Q 4F7SB 2VGMA 2A3LA 1SHGA 2PVDB 4XTYA 3TW6A 2CZ0B 1M4ZA 3RKXA 1M3BA 3CQTA 4LDVA 1B3QA 2C0IA 2JW4A 1VQNQ 3AHUA 3MCAB 2W9FA 2ATCB 4UN0A 4PL6A 4M75B 3CPWP 3INZA 3R6OA 5I11A 2DETA 2RHYA 1EZZB 2D1XA 2CP0A 3EFSA 4M7DA 1SHFA 1OU9A 3CCLA 2ZCFB 1FKMA 3ZFJA 2FPEA 4LE9A 3I5SA 5HQ0B 2JN0A 2V1RA 3QUIA 2LJ1A 1RAHB 1UUEA 4PLIA 4OB3B 3EIDB 1I81A 5A0LA 1B7TA 1OX8A 4QT7A 4BB7A 3QZ9B 3OYBA 2LJ3A 3VS5A 4IIMA 3MP1A 4WCIA 1K76A 3TVTA 4QVCA 1ARKA 5KYXA 3L2RA 1VYVA 4EOMB 4PJMA 4C92B 4BCGB 1LCKA 1V1CA 4J9HA 3UWNA 2B8AA 3RDVA 2FG0A 4C8QF 1IO6A 2KE9A 1NM7A 4A53A 4WTOB 3OYFA 1HXDA 4AFZC 5GAN5 1M90R 1BI2A 4J6XA 4QVZA 4KH1B 3RERA 1X27A 1WHJA 2KI7A 2G77A 2L3RA 4OMNA 1PD0A 4Y91A 4DEXA 1QP3A 2AZSA 4M77B 1E6GA 1YBYA 3I55T 2LMJA 1NLPC 3C95A 1PC0A 5HBHB 2V8JA 3CC4T 2LC4A 1WFWA 4HLQA 5KYYB 1Y96A 2CSIA 2F5KA 1UG1A 1OL1B 3MHXA 3RMQA 4ROCA 1C1AA 4F14A 4BXXX 5IHIA 3SB2A 2ZPIB 3EG3A 3HFOA 2BZ8A 1OI1A 3M57A 1K8AC 2UZLB 4M78C 2C5OB 2LCSA 3KHIA 5LMKB 4RKUE 1T0JA 3JCMb 3O8VA 4HCCA 1WZOA 1W98B 3CXCA 3CCUQ 4PFZA 1VQKA 3CCJA 3CMAQ 2C06A 1Q82U 4BCOB 1RAFB 4IUUA 5LQFB 3MEAA 4OP0A 3G71Q 1BIAA 3VU3C 4J9FA 1PD1A 3REBB 1VQ4Q 4ZNXA 1VQLQ 1H1RB 4EDUA 2R7GA 4Z8AA 3F5XB 1SRLA 1AWJA 3M03A 3QJ6A 4JDSA 4F16A 1VQ8T 3QHRB 4J6YA 2CKKA 4A4FA 3TQ7P 4M7DG 1G83A 1M2VB 3RGFB 2WPAB 2O4XB 2BS4A 3H4CA 4D8KA 5GAN7 3CCQT 4F7UF 1D0YA 2F1LA 1RAAB 5EFQB 4HA8A 1QCFA 2DRKA 1UE9A 1K73U 2JMCA 3OYNA 2CP5A 2V26A 2W99A 4YTLA 5FU7B 3OW2S 3SD4A 1YI2Q 1AZEA 2X4YA 1GBQA 3C0CA 3VKGA 3TCJA 3CCVQ 1VUBA 3OMCA 1VQ6Q 3JB9H 5IF1B 1UGRB 2JVVA 2L3QA 2M51A 2OTLT 4QW2A 4GBQA 2LT1A 3OW2P 2M0OA 3VS4A 1G3YA 4OB2B 4M7AC 1M1GA 2NLUA 2K4YA 5GMKm 3JSCA 3I9QA 4TTHA 1OZ3A 4D6WA 1X69A 2D6FA 1TXQA 5GANe 3MEWA 2ESWA 3H6ZA 1H1PB 2DILA 1AWWA 3CC7T 1WGSA 3QBYA 1KC8C 2CCHB 3FEOA 1YITQ 3G1JA 2AHJB 1WHMA 2EJGA 4A54A 3M5AA 5HNBB 1JSUB 3SEMA 4RG2A 5CKHA 1MMGA 4X34A 2HKQB 2QA4A 2WHBB 4EMKB 2W9ZA 1M3AA 2BKDN 2C0TA 2WFYB 4NL2A 5KYXB 1I5LA 3QDRB 1O75A 2JMAA 3BHVB 2EIFA 2P4TA 4FL6A 4E2FB 3LYIA 4JRPA 1X01A 4M75E 2VVKA 1DJ7B 3HB9A 4YOZA 2EJFA 4NS5A 4CC3A 2RQUA 1X75C 1SEMA 2DL3A 5D6YA 2EYWA 3X26B 2RQRA 4XTVA 1QVFS 3ZEHA 5I2MA 1IZ6A 2KXDA 3I55A 3BG5A 3VKHA 2O2OA 1UDLA 1Y96B 2JGZB 1QVFP 3LQ5B 4PKCC 2DBKA 3FDRA 4XTZA 4FCYA 4F7UG 4LDYA 4E7ZA 4J83A 3PNWC 4PJOD 1OI9B 1BK2A 1NPRA 4EC8B 3A1PA 1F5QB 2E70A 4C92E 4ZGEB 3E2UA 4DBRA 2DD4A 3FJPA 3BG9A 2O88A 3QYEA 3V8KA 5M9OA 2ZPHB 1SKUB 4MIMA 3KFVA 4XQ3A 1V29B 5LJ5h 1WIEA 2VASA 2W10A 2RQVA 2NWMA 3F70A 1Q81R 3JCMJ 5GMKi 3SFMA 2KNBB 2LNVA 2JS2A 3CCRQ 4VUBA 4ZTJA 1QP2A 2PUOB 3FLGA 1BBZA 5KH6A 3O0GD 4C5EA 3QPHA 2DZ9A 2WXVB 4QVDA 5GMKe 1RUWA 1M9SA 1VQ5T 3CCQA 2IVXA 2RH2A 3OS5A 2KR3A 1VA7A 4EORB 3JAME 1YJWT 4LOCA 3OYLA 1Q7YR 4FM4B 2LDMA 4HXJA 1PKSA 3X24B 4ANJA 2RA2A 2DMEA 2GTOA 4QQDA 1BI1A 3CCLQ 4HCKA 5LJ5j 4C0ZA 3EG9A 2EYQA 2DJQA 1EX4A 3JB9D 5IHNA 4KRTA 5GAN6 2OAWA 5D6XA 3S6WA 3G4ST 2FPFA 1VQ7T 2COYA 2HBPA 2OTLA 3G33B 3QHWB 1Z9ZA 1K9MR 4NL3A 1H3ZA 2XMFA 4FX3B 3TEEA 1Q86U 3GTMS 1FVVB 4E6RA 2M16A 4ZN3A 2OTJA 1RAEB 4CFNB 4I3ZB 3M9QA 1AOJA 3OYDA 1W1FA 2X4WA 4JS4A 2JUFA 1W2BA 3CC7A 4OR5B 2C0OA 1Q81C 1K8AU 2F2XA 4XTXA 1Y7XA 2HCKA 1XQHA 2VC8A 2M0YA 4MZTA 4XU2A 1QVGA 5ACBA 1JO8A 1OYXA 1IREB 1VQOQ 4LXCA 3PO3S 5GANf 2O9VA 3MPUB 2EKHA 2V8IA 2I0NA 2WSFE 4EOIB 1YIJQ 3QWYA 2YUPA 5GMKl 1BU1A 5HBJB 3HRSA 1Q7YC 5GAOn 1JXOA 2KGTA 2L3PA 1BYMA 1HYOA 6AT1B 4M77D 2FPDA 4PLLA 1UGQB 3A8LB 3S3NA 1I07A 4BCIB 4BCND 2K3BA 2HQHA 2I53A 5FU6C 4M7AA 4C8QC 2DTOA 3CCJQ 3UPUA 2KRNA 1WPYA 1ZLMA 4A63B 5GAMf 1AZGB 2BZXA 2HSEB 2OAUA 2DBMA 4OGEA 1YHQT 1K9MC 3I35A 1VQMT 2FL7A 2IIMA 1FWZA 4OMMA 4XU3A 3OS0A 2XD0A 2A28A 5FWCA 4LDUA 1QMCA 3KBGA 4Z6YA 1GH6B 5A0DA 1TU0B 2DD4B 1SG5A 3QYHB 1ACMB 3JCMf 1MNEA 2EQUA 3CCVA 1VQ6A 1EIFA 1PHTA 3VJPA 5J39A 4B6MA 3CCET 2CT4A 2QGGA 4BCPB 4M78G 3CCMQ 1VIEA 1NEBA 3MP6A 3PMTA 3OYHA 2EYYA 5KYWA 2YRDA 3SWNC 4RTWA 2QG9B 2COWA 2BKZB 2VB6A 3VS7A 1NEGA 4CFXB 3GNFB 2RJFA 1M1KR 5EG2A 1FMVA 4BE2A 1HJDA 3O5ZA 1KC8U 4LD9K 4DBQA 1AWXA 5LJ3h 1M5Q1 1OU8A 1NPPA 4EIKA 5ECAA 1WQWA 2CDTA 1YITA 2JNGA 3LWIA 4E7KA 3JCMQ 3HZJA 1X6OA 4BDYA 4O6JA 1VQ5A 1QW1A 1TTHB 5KYUB 5J3BA 2FZGB 3EGDB 3QWXX 4XAXB 3VYGA 1YJWA 1KQSA 4PNOA 5CVIA 4BCKB 2RM4A 4C92F 2DRMA 2RO0A 3HHTB 1GCQA 3OS1A 2PHGA 1NJIC 1T3SA 2DL4A 2M1HA 2BE7D 4J7IA 5GANg 3H9NA 5CO7A 4L6V5 1YNZA 4CRLB 4AFUC 3BDLA 3G4SA 2DL7A 4CI0C 2PQWA 1VQ7A 1G8XA 3JB9I 4OMOA 4M7DD 2KEAA 1KD1R 2PTKA 2QA4Q 3BLHB 3EHRA 5LJ3j 2CP7A 4J9EA 3LGLA 3OYEA 4PJOB 2FVUA 2RJEA 1O9KA 1ZSZB 2CGHA 2OJ2A 2KAFA 2AK5A 2F2WA 5GANd 4CC2A 4EOQB 3HO8A 3DB4A 4EPCA 1U3OA 1YWOA 5I2SA 3D7SB 2LJ0A 2NUPB 1OL2B 3BY7A 2DXBB 3PE0A 5I21A 5GAMg 3BE3A 3NPFA 4KRCB 1M1KC 1BCMA 1M3CA 2KMTA 4BCMD 1M30A 1QWEA 1H641 4A4GA 2X3XD 3I55Q 3MEUA 2BS3A 2DXCA 1LNXA 3CC4Q 3RUXA 3H8ZA 3RKWA 3M0UA 1H1SB 5GAN4 2W96A 2ZPEB 2EAYA 4EOOB 3IQLA 3OS2A 3V8LA 3JCMg 4JS5A 1S72A 3V7SA 1OV3A 4N4HA 2M02A 2QFZA 5GAMd 2O01E 1X2QA 2D9TA 3JCMV 3EGUA 2HEQA 4L5GA 2ZZDA 2ZAEA 3OBWA 4JLIA 2PK2A 1QQJA 2RK2A 3M4GA 4M7AB 5EJCA 5DQVA 3HPWA 4NC6A 1Y07A 2K2VA 4BY6C 4ELYC 2NYSA 3E1SA 2DXUA 3I56T 4AI6A 4DBFA 3JCMd 1U8RA 2X9HA 2RD1A 2C5NB 1WHGA 2MYSA 3VRYA 1YHQA 1VQMA 1MMAA 3S3OA 3ASKA 1M27C 3CBOA 3DL1A 1I4K1 1K4US 1VQ8Q 2XKOC 3U23A 4JZ3A 1N27A 2KYBA 2RNAA 2KY9A 2QDJA 2K2MA 3CCEA 5KYWB 3CCQQ 4FYWB 5GAN8 2VXEA 3TU4K 2Y4XA 2X4XA 1P92A 1H4LD 2A7YA 4XTWA 1ZUUA 4FW2A 1O9SA 1WHHA 4RTXA 3QO3A 2CREA 1N8RC 2WMBB 1YJNT 3LLRA 2P0QA 4HNVA 3RBBB 3A8MB 1IB8A 1W2BS 4YOOA 2K6DA 2ZPFB 3S3MA 2OTLQ 4C8QA 1RABB 1QVGS 1KQ1A 1UGSB 3OYJA 2BS2A 3GP8A 1AD6A 2LRQA 1PNJA 1VQOA 1MHNA 1KFZA 2RPNA 2OTJQ 3QZ5B 4JX5A 2GNCA 2VWFA 3OYKA 4OB1B 4C5HA 2CCIB 2BE9B 2Z0WA 4RTVA 4Y28E 3BHTB 1YIJA 4BCNB 2DYIA 4IKFA 3C12A 1N5ZA 1JQQA 1VQPT 2IG0A 1Q7YU 3CC7Q 2PNIA 5GANh 3E19A 4FT2A 4C5GA 3I5RA 3PT9A 2ROLA 2LVMA 2QAZA 2NUTB 3A8OB 1Y71A 2EPDA 2R57A 1JJ2A 3L2ZA 1O9KB 3SWNA 2ZPBB 3QKJA 1WA7A 3PIPA 2MMPA 2E64A 1E7PA 1IGUA 2AIRB 2J06A 2VKNA 2RHZA 1TSFA 3HKSA 3QJYA 5DLQE 3RIRA 1E6HA 3LX7A 3PVQA 1OKWB 2X51A 2DPPB 3OYAA 1YFNA 3CD6T 2HKNA 1YCSB 4CC7A 2V1QA 4P5NA 3JCMc 2C6TB 2KK4A 4MMKA 4RTUA 1X6GA 2DTHA 1A0NB 1WHKA 2XK0A 2HMAA 1M90C 2QQBA 1VINA 3CCMA 1S1NA 4BCFB 3EG2A 4KUIA 1B34A 3DKMA 3QG1A 4F7UA 4QSHA 1QCNA 4FYXB 2WJ9A 3A8HB 2SEMA 1GFDA 3FRNA 3P8DA 4PJOE 5ICPB 2KYMA 5CKBA 3HP9A 4LUDA 3DOGB 3MKDA 1D0ZA 1CSKA 1I5OB 2B86A 4II5B 1I0CA 3QYBA 1OQKA 2COZA 2XIDA 4IURA 4E47A 3I56A 2KR6A 1ZX6A 4C8QG 2CP6A 4J8OA 1D1AA 3RESA 2XDDA 4HVVA 4M7DB 1NJIU 1YJ9T 4F6UB 1VYWB 1NE8A 2XU8A 1ABQA 2PZ1A 3CMET 1FINB 2E3HA 5GMKh 3B57A 1VQ5Q 1N9RA 1ZBJA 1YJWQ 2XDPA 3GF5A 4E7JA 2FYKA 4M7AE 3DTOA 3UATA 2YUQA 4M75C 1XNIA 5FWBA 2HQXA 4II1A 4XU1A 2FRYA 2LCCA 3OYMA 4BCMB 3OYCA 1YJNA 2LW4A 1UNLD 1JKWA 2PVGB 2LX7A 3TNIB 5IHKA 3G4SQ 1VQ7Q 1WJRA 5GAMe 2DL5A 4YOSA 4OF1A 5DY9A 4AG1C 7AT1B 4EOKB 2LP5A 1WJQA 3E9FA 3VRZA 3SHWA 4M78D 2R5MA 1M8VA 2GF7A 5GMKj 4BE0A 4BUGA 1LOJA 1OZ2A 3CC4A 3JCMe 2CSQA 1UFFA 1PG5B 3MEVA 5GAN2 1MV3A 2QTXA 1VQPA 4C92C 1KG1A 1SSHA 1LJOA 2EVRA 1I8FA 2DEUA 1QCOA 1ZUKA 5L2WB 4GLMA 4PFOA 3H0FA 4C0DC 4N4IA 5FGKB 5KYNA 2QDLA 1TOVA 4OMFB 5IAYA 2MIOA 3LH5A 1R8OB 1LPLA 1GCPA 3K7AM 5C0MA 3MO8A 4AFQC 4KGVB 3H41A 1S72Q 1YWPA 3QXEB 3NMZC 3J81E 3BHUB 4M77E 2GBQA 3HSBA 2QQAA 1X6BA 2XI9A 4F70B 5AYFA 1E9HB 2L0AA 1VQ8A 5CK9A 3T9NA 1UNGD 4HL4A 2LQWA 4QKUA 2NUZA 2RJCA 2VXFA 3DDPB 3HTRA 1B34B 2J6FA 3H0IA 4F7UB 2DLPA 2E1HA 3M55A 5L23A 1AVZC 1M8MA 1OOTA 4AKIA 1YHQQ 1NYFA 2YSQA 1VQMQ 1QKWA 1UECA 4RTZA 4M7AD 3CPWA 2WEVB 1N8RU 4ROEA 3QYGB 1G3TA 2X3WD 1MMDA 3PGGA 4C0FA 4CFMB 2LZ6B 1U5SA 4M78A 1PSEA 1V76A 2WSEE 4ZGDB 3OSSC 4JRIA 5D6WA 1XJWB 3CCEQ 1RLPC 4J9BA 2E6NA 2RK1A 5FLXE 1OULA 2PVOB 4F7NB 4FIBA 2ECZA 5FW9A 1WQ7A 4OMQA 3FJ5A 4F6SB 2F2CA 4ELZC 1IXDA 1BU2A 3E9GA 1YJ9A 5FROA 1G3WA 3OYYA 1W4SA 4ESRA 2BPMB 1T0HA 1MNDA 4X9DA 3CMEA 5A0GA 2EYXA 2QEXT 1W70A 4J7FA 4PJOF 2GTJA 1G2BA 2WIPB 3PFSA 2IW9B 1UGVA 3OMGA 1URCB 4M6VA 3CXCS 2KT8A 1JEGA 2CT3A 4A4EA 1AHJB 4DOVA 2QI2A 1H24B 2K5FA 2X35A 3CEYA 4CFWB 3FB9A 3CXCP 3M0SA 4BY6B 4M7DE 5FRNA 2L8DA 4KRDB 3OBYA 4PJJA 3ZL7C 4XTUA 4KULA 1U06A 3QDFA 4JX4A 2FZCB 2CP2A 3G6ET 4L59A 3CC2T 1M90U 3VYHB 4EMKC 3DJBA 4BBRM 1NYGA 3GNGA 3NGPA 4B9XA 1XTDA 1UEBA 3G7ZA 1MGQA 2VV5A 2GFUA 3VS3A 2LQNA 2CH4W 4BCJB 2JTEA 4DA4A 2HBWA 4HCBA 2QTVA 2X1NB 1H27B 4RCBA 1ZSGA 1GY3B 4J9CA 3RR6A 2R58A 4M75F 2X4JA 4QQ6A 4FSXA 3EHQA 5A2QE 1BI3A 5CQXA 1X2KA 3OQ5A 5CKEA 3OYGA 3Q1JA 1FX7A 3L2UA 2UZBB 4J9DA 2CZ7B 2KBTA 5IDNB 4M4ZA 1AEYA 2R5AA 2QYZA 5GAOp 3QHSA 2XICA 4AG2C 3JCMP 2K9GA 2HL3A 5CEIB 5CR2A 3CPFA 4KUDK 2DE0X 1ZA1B 4BCHB 5GAN3 5IDPB 1M1FA 3I56Q 1TWBA 2DL8A 3OW2A 1XOVA 1TG0A 3EG9B 2RQWA 3QWLA 3M54A 3JRZA 4C92A 1Y0MA 2D8JA 1AD5A 2MK5A 3ER0A 3M58A 1WDXA 4FT4A 4M78B 4Z02A 1PKDB 2DYBA 3L2WA 3MI9B 1VYTA 1IRXA 4JUVA 4M77F 5IXBA 2UUEB 1SPKA 5GAOm 2CYZB 3GIBA 4JRKA 2CJMB 4E7LA 3REAB 1CKBA 4KT0E 2QGSA 4ME7A 5CYIB 2QF7A 4IMYB 2AZVA 1OGUB 1D0XA 2UZEB 3BFMA 2D0NA 4IUQA 2L89A 5KYYA 1PRMC 5KCHA 3C94A 1YJNQ 4CRIA 4HT9A 2Y4YA 1UGPB 2RN8A 3QIIA 4C0GA 3UT1A 3OY9A 1TD6A 2VYTA 1J3TA 4LDWA 5DQWA 3J7AF 3DLLA 1PCXA 3CBPA 2QEXA 3MY5B 1VQKT 2HD0A 4EOLB 4N0AC 3M0TA 4HKEA 2W0ZA 4C8QD 2ROTA 3DB3A 2JTFA 2E3IA 4PK4A 4NOYA 4F6WB 2MAMA 1VQPQ 4M75G 2RI3A 3GPLA 3URGA 1H26B 1FYNA 2QXFA 2DNUA 1QVFA 3HRTA 3EH1A 3A8GB 4FSSA 2BZYA 3LWHA 1OPLA 3LGFA 3TSZA 2ED0A 2WACA 4KH0B 1RAGB 3RNJA 2IW8B 3CC2A 3P8BB 5HY6A 2C5XB 2ABLA 1GXIE 1BI0A 3ULRB 1VQ9T 1GUXA 3CCST 1OIYB 3M4YA 2JT4A 2DTIA 1KD1C 2QASA 3TW7A 2GGRA 2MI6A 2PMIB 3EFRA 4JJDA 5LJ5f 3OYIA 1N6AA 1PSFA 2HL5C 2YLBA 4TVRA 1Q86R 1UJYA 4HVWA 1ZUYA 1Y57A 4C92G 1KIKA 4JPBW 5GAOq 3NDQA 2FRWA 2KMGA 2LQ8A 2YT6A 3ME9A 1RLQC 2KSSA 1ZBXA 4N4GA 2GFAA 4M7DF 1RACB 2CZ1B 1K8AR 4OGRB 1ZQ1A 2DF6A 4M77G 4QQGA 2RQTA 3OSVA 5HVYB 1OEBA 1JOWA 3HBLA 1RADB 4CFUB 4EMHA 2MPXC 2J05A 2FB7A 1Q81U 2RHUA 1UTIA 3N5BB 2QA4T 1G3SA 2K5IA 1RI0A 2MOXA 1EFNA 2J6KA 2EUFA 1K0XA 3VYGB 2B9RA 2DJZA 4MDWA 3UA6A 2J6OA 2YDLA 1VOMA 4EMKA 3LW5E 2K79A 2K57A 2D8HA 4MFEA 3EFOA 4LD6A 1W2BP 1QKXA 1IHWA 4CFVB 1U1SA 4ZN1A 1YJ9Q 4EMGA 4KBMB 2QQ9A 1MV0B 2XDBA 1QVGP 2HSPA 2DERA 2G9XB 2CS7A 4C0DB 1QVPA 2G6FX 4D8DA 3CMEQ 3UDCA 4A4HA 5HK0A 4DQ2A 4J9IA 5CKFA 1Q86C 1OIUB 1R0CB 4MDXA 2E12A 1OX9A 4JRQA 1D3BA 3NTHA 4BY1X 1KHCA 1WYXA 1K9MU 2RB6A 1YCYA 4HCZA 5D7UA 2FO0A 3AT1B 2EW3A 3PMIA 5GAMh 1BKBA 2KVQG 2GCXA 2BIVA 4M78E 1KJWA 5GANj 5LJ5g 2DXCB 4IUPA 1VQNT 2EKOA 2OX7A 4MZMA 5CIUA 1KC8R 2CH4A 1AISB 3NTIA 2YUOA 2J7IA 2BUDA 4PJOC 2JM9A 3NHNA 3VUBA 5GAOl 1ZSZC 3DLMA 1JSTB 1ZA2B 4UC4A 3R6NA 1M2OA 3JCMh 1C6VX 2K5LA 2XHCA 2ZZDB 1WJSA 2V8KA 2L2PA 1NG2A 3FIFA 4B9WA
chains in the Genus database with same CATH topology
2DVEA 2HQEA 3QYHB 2VGMA 2A3LA 2PVDB 5AYFA 5LJ5d 4BDZA 3JCMf 2EQUA 4XTYA 3TW6A 3CCVA 2CZ0B 1M4ZA 2EQKA 3RKXA 1EIFA 1VQ6A 5CK9A 3VJPA 5J39A 3T9NA 4HL4A 3CCET 4LDVA 4ZTFA 2RJCA 5KCOA 4M78G 4ZGJB 2KQWA 3MCAB 1VIEA 2VXFA 3AHUA 1B34B 3MP6A 3PMTA 2F5TX 4M75B 4PL6A 4F7UB 3OYHA 3SWNC 3EAEA 4BI4A 3INZA 3R6OA 2E1HA 5GAMj 2KDSA 3M55A 1VQ9A 2RHYA 3CCSA 4AKIA 1KQSS 2GQVA 4M7AD 3GNFB 3CPWA 2RJFA 3EFSA 4M7DA 2LT4A 4FU6A 1N8RU 3CCLA 2ZCFB 5EG2A 2DKGA 3VUZA 3QYGB 4BE2A 1G3TA 1FKMA 3ZFJA 3PGGA 4C0FA 1KC8U 4LD9K 2JN0A 3QUIA 5LJ3h 3WXMB 1M5Q1 3PIOA 1NPPA 5KE3A 4PLIA 1WQWA 1PSEA 4M78A 4OB3B 5GAOr 1QLBA 2JNGA 2EWNA 2WSEE 4ZGDB 3M53A 3OSSC 1I81A 4JRIA 5D6WA 5J26A 4BB7A 2QQ8A 5A0LA 4R55A 3LWIA 2E6NA 3HZJA 3QZ9B 1X6OA 2RK1A 4N0AA 4O6JA 5FLXE 1QW1A 3JCMQ 3OYBA 5LJ3f 4BDYA 1VQ5A 2PVOB 5J3BA 3VYGA 4FIBA 4XAXB 1YJWA 3MP1A 2OTJT 1KQSA 4PNOA 5CVIA 2RM4A 1WQ7A 4C92F 2RO0A 4QVCA 5LL6S 2QQSA 2RHXA 3L2RA 3HHTB 1YITA 4OB0B 4ELZC 3OS1A 4C92B 1NJIC 2M1HA 3E9GA 3UWNA 1YJ9A 2B8AA 4J7IA 5GANg 4C8QF 4A53A 5CO7A 4L6V5 3P8HA 1HXDA 5FROA 5GAN5 3OYFA 1BI2A 1G3WA 3BDLA 3OYYA 1W4SA 4J6XA 4QVZA 3G4SA 2E5QA 3HL8A 2PQWA 4CI0C 1VQ7A 3RERA 4X9DA 5FU6B 3CMEA 4C8QB 2RI5A 5A0GA 3JB9I 4MMLA 4A4KA 2QEXT 2G77A 2L3RA 4M7DD 4J7FA 4PJOF 1M1KU 4Y91A 3ZBDA 5LJ3j 1QP3A 3HFNA 3PFSA 4BACA 4M77B 3CCUT 1YBYA 3LGLA 4IUVA 4IUTA 3OYEA 3OMGA 2P0PA 3I55T 3C95A 2FVUA 2RJEA 3GOXA 3CMAT 4PJOB 4M6VA 2CGHA 2V8JA 3CXCS 3CC4T 2KAFA 2LC4A 4HLQA 3G71T 5GANd 4EPCA 3HO8A 3DB4A 1Y96A 4A4EA 1AHJB 2F5KA 4DOVA 2DO3A 1VQ4T 2E6ZA 5I2SA 1WNLA 1VQLT 2YHTA 3MHXA 3RMQA 2QI2A 3SB2A 2ZPIB 3BY7A 3HFOA 2K5FA 2X35A 3CEYA 1U1TA 2DXBB 3FB9A 1OI1A 3M57A 1K8AC 4BY6B 5I21A 5GAMg 3J80E 2YLCA 3L2VA 2L8DA 4M78C 5FRNA 4M7DE 2E65A 3OBYA 1M1KC 4XTUA 2KMTA 1RL2A 4KULA 3KHIA 4RKUE 4JX4A 3JCMb 1H641 1UB4A 3O8VA 3SWNB 4A4GA 3RKYA 3CXCA 1VQKA 4HCCA 4HT8A 1D3BB 4L59A 3G6ET 3MEUA 3CCJA 2BS3A 2JOYA 2DXCA 2C06A 3CC2T 1Q82U 1LNXA 1M90U 3VYHB 1N9SA 4IUUA 3RUXA 3H8ZA 3MEAA 4EMKC 3RKWA 4BBRM 4OP0A 5GAN4 3GNGA 4AKHA 2ZPEB 1BIAA 2EAYA 4M77C 3VU3C 4B9XA 3OS2A 1XTDA 3V8LA 3JCMg 4JS5A 1S72A 2H3JA 1KD1U 3V7SA 4LDXA 1UEBA 3G7ZA 4N4HA 1MGQA 4EDUA 2VV5A 1JRIA 2QFZA 4RCCA 5GAMd 2O01E 2GFUA 2D9TA 3X20B 3JCMV 1YI2T 4L5GA 2ZZDA 3RMSA 3QJ6A 4JDSA 4DA4A 3OBWA 4JLIA 4GY5A 4J6YA 4RMOA 3CCVT 2CKKA 2I2LA 3M4GA 2RK2A 4A4FA 4HCBA 1VQ6T 2PU9B 4M7AB 3CD6A 4M7DG 2EQJA 3A5ZB 5EJCA 4RCBA 3HPWA 3SDZA 2O4XB 4NC6A 2BS4A 3H4CA 4JJNK 2R58A 1Y07A 4M75F 5GAN7 3CCQT 2K2VA 2X4JA 4BY6C 4ELYC 4F7UF 5FRMA 4QQ6A 3E1SA 1VQNA 4FSXA 4HNUA 2DXUA 1BI3A 4R56A 5A2QE 4HA8A 4AI6A 5CQXA 3JCMd 3I56T 1U8RA 2E10A 3OQ5A 5CKEA 3OYGA 2RD1A 3Q1JA 1K73U 1FX7A 2ZGWA 3L2UA 4J5YA 2CZ7B 1YHQA 3X25B 3OYNA 1VQMA 4BI8B 3S3OA 3ASKA 4XU0A 4YTLA 3CBOA 4WF2A 5FU7B 3OW2S 3SD4A 3DL1A 5CAIA 5LJ3g 2QQRA 2R5AA 5GAOp 1I4K1 3QHSA 2X4YA 2XICA 3M56A 3JCMP 3VKGA 3TCJA 2XKOC 1VUBA 3OMCA 3JB9H 1YITT 1N27A 3L1AA 3V7CA 1UGRB 1G5VA 2JVVA 2KY9A 5CR2A 2QDJA 3CPFA 4KUDK 2OTLT 4QW2A 3CCEA 2LT1A 2M0OA 5GAN3 1G3YA 4OB2B 1M1FA 4M7AC 1M1GA 2NLUA 2K4YA 5GMKm 1VIFA 5GAN8 2VXEA 3TU4K 1HK9A 3JSCA 2Y4XA 2DIQA 2X4XA 1P92A 2A7YA 3OW2A 5LJ3d 1XOVA 4XTWA 5CKDA 1OZ3A 4D6WA 1O9SA 4M78F 4HNTA 2D6FA 3QWLA 3M54A 3JRZA 3QO3A 4C92A 5GANe 1N8RC 3MEWA 3H6ZA 1YJNT 3LLRA 2P0QA 3ER0A 3M58A 4M75D 4HNVA 4GLKA 3CC7T 4FT4A 3A8MB 1WGSA 3QBYA 4M78B 1KC8C 3FEOA 1W2BS 2AHJB 4Z02A 2EJGA 5FU7C 2K3YA 3M5AA 4A54A 3L2WA 2ZPFB 2DD5A 2RJDA 3S3MA 1JB0E 4RG2A 3TREA 5CKHA 5CCAA 4C8QA 4JUVA 4X34A 1QVGS 1KQ1A 1UGSB 4M77F 3OYJA 4JLGA 2QA4A 2BS2A 4E7HA 3GP8A 4EMKB 3GPLA 2HNIA 3OA6A 2LRQA 2BKDN 5GAOm 4NL2A 2CYZB 3GIBA 4JRKA 1VQOA 1I5LA 1MHNA 3QDRB 4E7LA 1JJ2S 3QZ5B 2Y90A 4JX5A 4KT0E 4ME7A 1O75A 3OYKA 4PJOA 4E7IA 4OB1B 2EIFA 2IVWA 4C5HA 2QF7A 2P4TA 4FL6A 5CQYA 4ATOA 1VQLA 3LYIA 3KXTA 4JRPA 3BFMA 1X01A 4Y28E 1YIJA 4IUQA 2L89A 4E7KA 4M75E 5KCHA 3C94A 4IKFA 3C12A 1VQPT 1DJ7B 4CRIA 2IG0A 3HB9A 2EJFA 2LCLA 2M9UA 4NS5A 1Q7YU 4HT9A 4M7DC 2Y4YA 5GANh 3E19A 1X75C 1UGPB 4FT2A 3QIIA 3LH0A 4C0GA 3UT1A 3OY9A 2VYTA 2DXBA 5D6YA 4LDWA 4C5GA 1KHIA 3PT9A 4OGCA 2F69A 3J7AF 2LVMA 3DLLA 3X26B 3CBPA 2QEXA 4XTVA 1QVFS 3A8OB 4C92D 1Y71A 2CZ6B 2R57A 1JJ2A 2D0QB 2HD0A 3L2ZA 4J6WA 5I2MA 1IZ6A 3ZEHA 1VQKT 2PUKB 4N0AC 5LJ5e 3SWNA 3CCUA 2ZPBB 2P0KA 3I55A 2DIGA 3QKJA 3BG5A 3CMAA 3VKHA 3PIPA 2MMPA 4HKEA 1Y96B 1S72T 2E64A 1E7PA 3G71A 4C8QD 3DB3A 2JTFA 4NOYA 2MAMA 2RHZA 1VQ4A 4PKCC 3HKSA 3FDRA 2E41A 2RI3A 3QJYA 4LDYA 4M75G 4XTZA 5DLQE 3LX7A 4J83A 3PNWC 3URGA 2QXFA 2YRVA 2RHIA 2MWOA 3CCRT 2DPPB 3OYAA 4PJOD 1QVFA 3HRTA 1NPRA 3CD6T 4M7AF 3A8GB 2E70A 4C92E 4ZGEB 3LWHA 4P5NA 2DD4A 3JCMc 3FJPA 3BG9A 2KK4A 4MMKA 3QYEA 3L42A 3V8KA 5M9OA 2ZPGB 2ZPHB 2DTHA 3LGFA 2XK0A 4MIMA 2K3XA 2WACA 3JB9F 4XQ3A 3WVEB 3CC2A 2XG8D 3P8BB 1Q82C 1V29B 5HY6A 1JBMA 5LJ5h 2QQBA 1M90C 3CCMA 1GXIE 4C8QE 3WVDB 1BI0A 1VQ9T 4KUIA 1B34A 3CCST 4M75A 3DKMA 3F70A 1ZHIA 3QG1A 3M4YA 4F7UA 4QSHA 3JCMJ 3MP8A 5GMKi 2DTIA 5HK3A 1KD1C 2WJ9A 3A8HB 3TW7A 2LNVA 2MI6A 3SFMA 3EFRA 3FRNA 5LJ5f 3P8DA 3OYIA 4VUBA 4F7UG 5CKBA 3CCLT 1N6AA 4ZTJA 1PSFA 1QP2A 2DAQA 2PUOB 3HP9A 3VKIA 2YLBA 5DLOA 2DXTA 1YI2A 3FLGA 4TVRA 1BIBA 5KH6A 4C5EA 4BI3A 3QPHA 2DZ9A 4C92G 4QVDA 5GMKe 5GAOq 3RIRA 2KMGA 2LQ8A 3ME9A 3QYBA 2XIDA 1M9SA 1VQ8T 1VQ5T 3CCQA 2JTMA 2RH2A 4ELJA 4IURA 3OS5A 4E47A 3QSUA 2FHDA 2KSSA 1ZBXA 4N4GA 4BBSM 3JAME 4LOCA 5L8RE 3I56A 2GFAA 1YJWT 2G3RA 2KR6A 3OYLA 4M7DF 3META 3FC3A 4C8QG 2CZ1B 4FM4B 2LQKA 2LDMA 5IT9E 2DK3A 2DZCA 4J8OA 1K73C 2LX9A 3X24B 3RESA 2XDDA 2RA2A 1NZ9A 2VUBA 4M7DB 4QQDA 1ZQ1A 1NJIU 1BI1A 3C4SA 4M77G 4QQGA 5LJ5j 3JCMW 4C0ZA 3OSVA 1YJ9T 4PJOG 2EYQA 3HBLA 1NE8A 1VQ8A 3JCMX 3JB9D 4AKGA 2XU8A 4EMHA 5GAN6 3S6WA 5D6XA 3V7RA 2FB7A 3V8JA 3G4ST 1Q81U 1VQ7T 2RHUA 3CMET 3N5BB 2QA4T 2HBPA 2RI2A 1G3SA 3NTKA 4O5VA 2K5IA 1RI0A 2VGNA 5KE2A 5GMKh 2OTLA 1N9RA 4NL3A 3VYGB 1H3ZA 1VQOT 3TEEA 2DJZA 4MDWA 2XDPA 3GF5A 4EMKA 4E7JA 1Q86U 3LW5E 2EJ9A 2FYKA 4M7AE 2K57A 2M16A 4ZN3A 2OTJA 4MFEA 4LD6A 4M77A 4M75C 1KQ2A 1XNIA 2HQXA 4II1A 4XU1A 1YIJT 2DEQA 2LCCA 3M9QA 5HKCA 3OYDA 3HRUA 1U1SA 3GLXA 4ZN1A 3OYMA 3OYCA 4EMGA 2LTOA 2QQ9A 4KBMB 3KUFA 2X4WA 2XDBA 4JS4A 2JUFA 4OVAA 1YJNA 5C6SA 1W2BA 4F7UE 3X28B 3CC7A 2CS7A 2PVGB 2EFIA 2DD5B 4C0DB 1QVPA 3CBMA 1Q81C 1K8AU 4XTXA 1WJRA 1Y7XA 4MZPA 5GAMe 1XQHA 2VC8A 4MZTA 3UDCA 4XU2A 1QVGA 4OF1A 4A4HA 5HK0A 5DY9A 1OYXA 1IREB 4DQ2A 2WSCE 1WJQA 3E9FA 5CKFA 1Q86C 5GANf 4MDXA 3CCJT 2HAXA 4M78D 2E12A 4JRQA 4M7AG 2V8IA 2R5MA 1M8VA 1D3BA 2GF7A 2WSFE 5GMKj 4BE0A 3NTHA 4BUGA 1LOJA 2MF2A 1OZ2A 3BG3A 3CC4A 1KHCA 3L2QA 5GMKl 4C5IA 3JCMe 2MWPA 3HRSA 2EQMA 3MEVA 4MFDA 2RB6A 5GAN2 1K9MU 3OB9A 2QTXA 1VQPA 1YCYA 1Q7YC 3JB9G 4Q5WA 3JB9J 4C92C 4HCZA 5GAOn 1KG1A 1BYMA 4M77D 4X9CA 1LJOA 4DOWA 1I8FA 3PMIA 4PLLA 5IN1A 1UGQB 5A0DA 3A8LB 2L5QA 3VV0A 3S3NA 5GAMh 4BD3A 4V2SA 1BKBA 4C0DC 2KVQG 4N4IA 2GCXA 5FU6C 4M7AA 4C8QC 2BIVA 2DTOA 4M78E 1SSFA 4OMFB 5GANj 5LJ5g 2DXCB 5IAYA 2JZ2A 2O4XA 2EKOA 1TH7A 4IUPA 1R8OB 4MZMA 4RG8A 3CCMT 3UPUA 1VQNT 3M59A 1WPYA 3G6EA 3BDUA 4JX6A 5CIUA 5C0MA 5GAMf 3MO8A 3NTIA 5DM7R 3NFCA 2BUDA 4PJOC 3VUBA 2QDYB 2OAUA 4PJOE 4OGEA 5GAOl 1YHQT 1K9MC 3DLMA 3QXEB 1VQMT 2FL7A 3J81E 4UC4A 4XK8E 4BE1A 1FWZA 4XU3A 3JCMh 3OS0A 4M77E 3CCRA 2XD0A 2K5LA 2XHCA 5LJ3e 3BW1A 3HSBA 2ZZDB 1WJSA 2QQAA 2V8KA 1FXXA 4LDUA 3PTAA 3CPWS 3KBGA 4Z6YA 2XI9A 3FIFA 2DD4B 4B9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OB1 B;  3QYH B;  2PVD B;  2CZ0 B;  2DXC A;  4Y28 E;  3VYH B;  1DJ7 B;  4ZGJ B;  2ZPE B;  1UGP B;  2DXB A;  3VYG B;  2O01 E;  3X20 B;  3X26 B;  3LW5 E;  2ZZD A;  3A8O B;  2CZ6 B;  2D0Q B;  2ZCF B;  2PUK B;  3QYG B;  2PU9 B;  2ZPB B;  1PSE A;  4OB3 B;  3X28 B;  2WSE E;  4ZGD B;  2PVG B;  2DD5 B;  3QZ9 B;  2PVO B;  4KT0 E;  2CZ7 B;  3VYG A;  3X25 B;  2DPP B;  1IRE B;  2WSC E;  3A8G B;  4ZGE B;  3HHT B;  2DD4 A;  4OB0 B;  2ZPG B;  2ZPH B;  2WSF E;  1UGR B;  3WVE B;  4L6V 5;  1V29 B;  1GXI E;  3WVD B;  4OB2 B;  3A8H B;  1QP3 A;  1UGQ B;  3A8L B;  1PSF A;  1QP2 A;  2PUO B;  2DXC B;  3A8M B;  1AHJ B;  2AHJ B;  2ZPF B;  2QDY B;  2DD5 A;  1JB0 E;  2ZPI B;  3QXE B;  5L8R E;  2DXB B;  1UGS B;  4XK8 E;  2CZ1 B;  4FM4 B;  3X24 B;  2ZZD B;  2CYZ B;  4RKU E;  3QZ5 B;  2DD4 B; 
#chains in the Genus database with same CATH topology
 2DVE A;  2HQE A;  1KSW A;  5LJ5 d;  4BDZ A;  2EGE A;  2EQK A;  3TNW B;  2K7A A;  2JJ9 A;  4AT1 B;  4ELL A;  4ZTF A;  5KCO A;  4ZGJ B;  2KQW A;  1GUX B;  1YP5 A;  2F5T X;  2YRC A;  4Y72 B;  3EAE A;  4BI4 A;  5GAM j;  1NLO C;  1SRM A;  2KDS A;  3EH2 A;  4JJC A;  3CCS A;  1VQ9 A;  1KQS S;  3H0H A;  2GQV A;  2FZK B;  2LT4 A;  4BY7 X;  4FU6 A;  4J9G A;  2JS0 A;  2DKG A;  3VUZ A;  2L3S A;  5GJV B;  3WXM B;  4LNP A;  1QMZ B;  3PIO A;  5KE3 A;  5GAO r;  1KQS P;  1N4M A;  1QLB A;  2EWN A;  3M53 A;  1Q95 G;  5J26 A;  5HKC A;  4R55 A;  3MY1 B;  1RI9 A;  2QQ8 A;  4PFP A;  4F04 B;  4N0A A;  1MUZ A;  5LJ3 f;  4LUE A;  2OTJ T;  1ZP2 A;  1H92 A;  1TUD A;  2EYZ A;  5LL6 S;  2QQS A;  2RHX A;  4F17 A;  1TFB A;  4OB0 B;  4RUG A;  1R0B G;  3THK A;  2FEI A;  2DA9 A;  3P8H A;  3VS6 A;  1PRL C;  1D1C A;  3VS0 A;  2A37 A;  2E5Q A;  3HL8 A;  4Z89 A;  1MMN A;  5FU6 B;  4C8Q B;  2RI5 A;  4MML A;  4A4K A;  2DMO A;  1AT1 B;  1M1K U;  4PJL A;  3ZBD A;  2KRS A;  3HFN A;  4OML A;  4BAC A;  3EFO B;  1FMK A;  3CCU T;  1TS9 A;  4IUT A;  4IUV A;  4LN2 A;  2P0P A;  3UA7 A;  1TUC A;  2EBP A;  1KK7 A;  3GOX A;  3CMA T;  1WXB A;  3G71 T;  1D3U B;  1AWO A;  1VQ4 T;  2DO3 A;  3UF4 A;  2E6Z A;  1VQL T;  1WNL A;  2YHT A;  1PM3 A;  2YUN A;  3M0Q A;  1U1T A;  5IHY A;  2W2H A;  3J80 E;  3L2V A;  2YLC A;  2E65 A;  2QEX Q;  1RL2 A;  2HDA A;  1UB4 A;  3SWN B;  1P5E B;  2UZD B;  3RKY A;  4HT8 A;  1D3B B;  2JOY A;  1D09 B;  2QGF B;  1N9S A;  4AKH A;  4M77 C;  2IW6 B;  1GCQ C;  1GFC A;  1KD1 U;  4LDX A;  2H3J A;  1UNH D;  5HCK A;  1JRI A;  1E7O A;  4RCC A;  4F7J B;  3EG0 A;  2E4H A;  3X20 B;  1SF9 A;  1YI2 T;  3RMS A;  3A98 A;  4AFS C;  4E7S A;  4RMO A;  4GY5 A;  3CCV T;  1VQ6 T;  2I2L A;  3POM A;  3CD6 A;  2PU9 B;  2EQJ A;  1UHF A;  3A5Z B;  4KGX B;  3SDZ A;  4BCQ D;  4JJN K;  1G3N C;  1OKV B;  1VYU A;  2F2V A;  3G6E Q;  5FRM A;  2CUB A;  3CC2 Q;  1VQN A;  4HNU A;  4R56 A;  4EON B;  2E10 A;  3EOC B;  1HD3 A;  2ZGW A;  4J5Y A;  3X25 B;  4BI8 B;  4XU0 A;  4ORZ A;  2EGA A;  4WF2 A;  4ROD A;  5CAI A;  5LJ3 g;  2QQR A;  1F1B B;  3M56 A;  1BB9 A;  1YIT T;  3L1A A;  1WI7 A;  3V7C A;  4JJB A;  1G5V A;  4HVU A;  2CP3 A;  1XO2 A;  3BLR B;  5KYU A;  1VIF A;  3EGD A;  4R0K A;  2C5V B;  1HK9 A;  2A0F B;  4EOS B;  5AT1 B;  2JXB A;  2DIQ A;  2LNH B;  2SRC A;  5LJ3 d;  5CKD A;  4M78 F;  4HNT A;  2IN3 A;  1IGQ A;  2O31 A;  4M75 D;  4GLK A;  4OMP A;  5FU7 C;  2K3Y A;  1Q82 R;  2DD5 A;  2WIH B;  2RJD A;  1JB0 E;  3TRE A;  3TNH B;  5CCA A;  2KRO A;  4JLG A;  4E7H A;  2HNI A;  3OA6 A;  2H3E B;  1JJ2 S;  4Y92 A;  3BLQ B;  1H28 B;  2IPO B;  2Y90 A;  4PJO A;  4E7I A;  4CFU D;  3EJ1 B;  1K1Z A;  2IVW A;  1ZSZ A;  5CQY A;  4ATO A;  3KXT A;  2DX1 A;  1X43 A;  3PVL A;  2JM8 A;  1D1B A;  2LCL A;  2M9U A;  4M7D C;  3TSW A;  1GRI A;  1JJ2 P;  2NUP A;  1BCO A;  1W6X A;  3LH0 A;  4K11 A;  2DXB A;  1KHI A;  4OGC A;  1WXT A;  2F69 A;  4EOJ B;  8AT1 B;  4NST B;  1K73 R;  3TN8 B;  4C92 D;  2CZ6 B;  2D0Q B;  4J6W A;  1WLP B;  2PUK B;  2DM1 A;  2A36 A;  4PJN A;  5LJ5 e;  3CCU A;  2P0K A;  5I22 A;  2DIG A;  3GBQ A;  3CMA A;  2RF0 A;  1H1Q B;  3M0R A;  1S72 T;  3G71 A;  3EGX A;  2AKK A;  1ABO A;  1VQ4 A;  1VQL A;  2E41 A;  2CUD A;  2MCN A;  3CCR T;  2YRV A;  2RHI A;  2MWO A;  1QLY A;  8ATC B;  1WX6 A;  4M7A F;  2YXY A;  4RTY A;  1JXM A;  5EC7 A;  1ENW A;  2BTT A;  1VQK Q;  1H3H A;  3L42 A;  9ATC B;  2ZPG B;  1NJI R;  1PWT A;  2K3X A;  3JB9 F;  3VS2 A;  3WVE B;  2XG8 D;  1T3L A;  1Q82 C;  1JBM A;  4C8Q E;  3WVD B;  2AKL A;  4M75 A;  4RTT A;  1GL5 A;  1ZHI A;  2OI3 A;  3MP8 A;  3VS1 A;  5HK3 A;  3CCL T;  2DAQ A;  3VKI A;  2A08 A;  4KGZ B;  1YI2 A;  5DLO A;  1YN8 A;  2DXT A;  2QK0 A;  1C0M A;  1R77 A;  1BIB A;  1FMW A;  4FYV B;  4F7L B;  4BI3 A;  2P4R A;  2EGC A;  2GQI A;  1IHV A;  2JTM A;  4ELJ A;  3QSU A;  1I1J A;  2FHD A;  4BBS M;  5L8R E;  1OPK A;  2G3R A;  1VQ9 Q;  2WMA B;  3MET A;  3FC3 A;  3CCS Q;  2LQK A;  1K73 C;  5IT9 E;  2DK3 A;  2DZC A;  1JU5 C;  5BNJ B;  1UHC A;  2LX9 A;  1KXU A;  1NZ9 A;  2VUB A;  1LVK A;  3C4S A;  3JCM W;  2RMO A;  4DBH A;  4PJO G;  2KXC A;  4CXA B;  3MIA B;  2EQI A;  3JCM X;  4YC3 B;  4AKG A;  3V7R A;  3V8J A;  2ED1 A;  3M0P A;  5I5Z B;  2P84 A;  1Z9Q A;  2RI2 A;  4O5V A;  3NTK A;  3JV3 A;  1WHL A;  2VGN A;  5KE2 A;  2YWW A;  1VQO T;  3EG1 A;  2EJ9 A;  1B07 A;  4M77 A;  1KQ2 A;  1K0S A;  1YIJ T;  2E5K A;  2DEQ A;  3HRU A;  1QWF A;  3GLX A;  5GJW B;  2LTO A;  4FW1 A;  2O9S A;  3KUF A;  1H25 B;  5HBE B;  4OVA A;  1C9B A;  5C6S A;  4EC9 B;  4F7U E;  3X28 B;  2I40 B;  2DD5 B;  2EFI A;  3CBM A;  4DEY A;  4AMC A;  2KT1 A;  1RAI B;  2H8H A;  4MZP A;  5IXF A;  2KRM A;  2WSC E;  2NUT A;  3DDQ B;  3CCJ T;  2HAX A;  4M7A G;  2DVJ A;  4JZ4 A;  2MF2 A;  3BG3 A;  2V22 B;  4C5I A;  2DFU A;  4BCQ B;  2MWP A;  2EQM A;  2PJQ A;  4MFD A;  1PKT A;  3OB9 A;  1K9A A;  3JB9 G;  4Q5W A;  4EOP B;  2PK9 B;  4G6L B;  3JB9 J;  1NBE B;  1VOL A;  2HZY A;  4X9C A;  1TUG B;  4DOW A;  1WXU A;  5IN1 A;  2ENM A;  2L5Q A;  3VV0 A;  1HSQ A;  2AT1 B;  4BD3 A;  4V2S A;  1UJ0 A;  1M2V A;  1CKA A;  1SSF A;  1N8R R;  2JZ2 A;  2O4X A;  3CCM T;  1TH7 A;  4RG8 A;  4IIO A;  3M59 A;  3G6E A;  3BDU A;  4JX6 A;  3EGX B;  5DM7 R;  3NFC A;  4Z88 A;  2QDY B;  3MJX A;  1GBR A;  2C4G B;  4XK8 E;  4BE1 A;  4FYY B;  4X1V A;  3CCR A;  5LJ3 e;  3BW1 A;  1H8K A;  3PTA A;  1FXX A;  3CPW S;  4CC4 B;  5IH2 A;  3L2Q A;  3CD6 Q;  4F7S B;  2VGM A;  2A3L A;  1SHG A;  2PVD B;  4XTY A;  3TW6 A;  2CZ0 B;  1M4Z A;  3RKX A;  1M3B A;  3CQT A;  4LDV A;  1B3Q A;  2C0I A;  2JW4 A;  1VQN Q;  3AHU A;  3MCA B;  2W9F A;  2ATC B;  4UN0 A;  4PL6 A;  4M75 B;  3CPW P;  3INZ A;  3R6O A;  5I11 A;  2DET A;  2RHY A;  1EZZ B;  2D1X A;  2CP0 A;  3EFS A;  4M7D A;  1SHF A;  1OU9 A;  3CCL A;  2ZCF B;  1FKM A;  3ZFJ A;  2FPE A;  4LE9 A;  3I5S A;  5HQ0 B;  2JN0 A;  2V1R A;  3QUI A;  2LJ1 A;  1RAH B;  1UUE A;  4PLI A;  4OB3 B;  3EID B;  1I81 A;  5A0L A;  1B7T A;  1OX8 A;  4QT7 A;  4BB7 A;  3QZ9 B;  3OYB A;  2LJ3 A;  3VS5 A;  4IIM A;  3MP1 A;  4WCI A;  1K76 A;  3TVT A;  4QVC A;  1ARK A;  5KYX A;  3L2R A;  1VYV A;  4EOM B;  4PJM A;  4C92 B;  4BCG B;  1LCK A;  1V1C A;  4J9H A;  3UWN A;  2B8A A;  3RDV A;  2FG0 A;  4C8Q F;  1IO6 A;  2KE9 A;  1NM7 A;  4A53 A;  4WTO B;  3OYF A;  1HXD A;  4AFZ C;  5GAN 5;  1M90 R;  1BI2 A;  4J6X A;  4QVZ A;  4KH1 B;  3RER A;  1X27 A;  1WHJ A;  2KI7 A;  2G77 A;  2L3R A;  4OMN A;  1PD0 A;  4Y91 A;  4DEX A;  1QP3 A;  2AZS A;  4M77 B;  1E6G A;  1YBY A;  3I55 T;  2LMJ A;  1NLP C;  3C95 A;  1PC0 A;  5HBH B;  2V8J A;  3CC4 T;  2LC4 A;  1WFW A;  4HLQ A;  5KYY B;  1Y96 A;  2CSI A;  2F5K A;  1UG1 A;  1OL1 B;  3MHX A;  3RMQ A;  4ROC A;  1C1A A;  4F14 A;  4BXX X;  5IHI A;  3SB2 A;  2ZPI B;  3EG3 A;  3HFO A;  2BZ8 A;  1OI1 A;  3M57 A;  1K8A C;  2UZL B;  4M78 C;  2C5O B;  2LCS A;  3KHI A;  5LMK B;  4RKU E;  1T0J A;  3JCM b;  3O8V A;  4HCC A;  1WZO A;  1W98 B;  3CXC A;  3CCU Q;  4PFZ A;  1VQK A;  3CCJ A;  3CMA Q;  2C06 A;  1Q82 U;  4BCO B;  1RAF B;  4IUU A;  5LQF B;  3MEA A;  4OP0 A;  3G71 Q;  1BIA A;  3VU3 C;  4J9F A;  1PD1 A;  3REB B;  1VQ4 Q;  4ZNX A;  1VQL Q;  1H1R B;  4EDU A;  2R7G A;  4Z8A A;  3F5X B;  1SRL A;  1AWJ A;  3M03 A;  3QJ6 A;  4JDS A;  4F16 A;  1VQ8 T;  3QHR B;  4J6Y A;  2CKK A;  4A4F A;  3TQ7 P;  4M7D G;  1G83 A;  1M2V B;  3RGF B;  2WPA B;  2O4X B;  2BS4 A;  3H4C A;  4D8K A;  5GAN 7;  3CCQ T;  4F7U F;  1D0Y A;  2F1L A;  1RAA B;  5EFQ B;  4HA8 A;  1QCF A;  2DRK A;  1UE9 A;  1K73 U;  2JMC A;  3OYN A;  2CP5 A;  2V26 A;  2W99 A;  4YTL A;  5FU7 B;  3OW2 S;  3SD4 A;  1YI2 Q;  1AZE A;  2X4Y A;  1GBQ A;  3C0C A;  3VKG A;  3TCJ A;  3CCV Q;  1VUB A;  3OMC A;  1VQ6 Q;  3JB9 H;  5IF1 B;  1UGR B;  2JVV A;  2L3Q A;  2M51 A;  2OTL T;  4QW2 A;  4GBQ A;  2LT1 A;  3OW2 P;  2M0O A;  3VS4 A;  1G3Y A;  4OB2 B;  4M7A C;  1M1G A;  2NLU A;  2K4Y A;  5GMK m;  3JSC A;  3I9Q A;  4TTH A;  1OZ3 A;  4D6W A;  1X69 A;  2D6F A;  1TXQ A;  5GAN e;  3MEW A;  2ESW A;  3H6Z A;  1H1P B;  2DIL A;  1AWW A;  3CC7 T;  1WGS A;  3QBY A;  1KC8 C;  2CCH B;  3FEO A;  1YIT Q;  3G1J A;  2AHJ B;  1WHM A;  2EJG A;  4A54 A;  3M5A A;  5HNB B;  1JSU B;  3SEM A;  4RG2 A;  5CKH A;  1MMG A;  4X34 A;  2HKQ B;  2QA4 A;  2WHB B;  4EMK B;  2W9Z A;  1M3A A;  2BKD N;  2C0T A;  2WFY B;  4NL2 A;  5KYX B;  1I5L A;  3QDR B;  1O75 A;  2JMA A;  3BHV B;  2EIF A;  2P4T A;  4FL6 A;  4E2F B;  3LYI A;  4JRP A;  1X01 A;  4M75 E;  2VVK A;  1DJ7 B;  3HB9 A;  4YOZ A;  2EJF A;  4NS5 A;  4CC3 A;  2RQU A;  1X75 C;  1SEM A;  2DL3 A;  5D6Y A;  2EYW A;  3X26 B;  2RQR A;  4XTV A;  1QVF S;  3ZEH A;  5I2M A;  1IZ6 A;  2KXD A;  3I55 A;  3BG5 A;  3VKH A;  2O2O A;  1UDL A;  1Y96 B;  2JGZ B;  1QVF P;  3LQ5 B;  4PKC C;  2DBK A;  3FDR A;  4XTZ A;  4FCY A;  4F7U G;  4LDY A;  4E7Z A;  4J83 A;  3PNW C;  4PJO D;  1OI9 B;  1BK2 A;  1NPR A;  4EC8 B;  3A1P A;  1F5Q B;  2E70 A;  4C92 E;  4ZGE B;  3E2U A;  4DBR A;  2DD4 A;  3FJP A;  3BG9 A;  2O88 A;  3QYE A;  3V8K A;  5M9O A;  2ZPH B;  1SKU B;  4MIM A;  3KFV A;  4XQ3 A;  1V29 B;  5LJ5 h;  1WIE A;  2VAS A;  2W10 A;  2RQV A;  2NWM A;  3F70 A;  1Q81 R;  3JCM J;  5GMK i;  3SFM A;  2KNB B;  2LNV A;  2JS2 A;  3CCR Q;  4VUB A;  4ZTJ A;  1QP2 A;  2PUO B;  3FLG A;  1BBZ A;  5KH6 A;  3O0G D;  4C5E A;  3QPH A;  2DZ9 A;  2WXV B;  4QVD A;  5GMK e;  1RUW A;  1M9S A;  1VQ5 T;  3CCQ A;  2IVX A;  2RH2 A;  3OS5 A;  2KR3 A;  1VA7 A;  4EOR B;  3JAM E;  1YJW T;  4LOC A;  3OYL A;  1Q7Y R;  4FM4 B;  2LDM A;  4HXJ A;  1PKS A;  3X24 B;  4ANJ A;  2RA2 A;  2DME A;  2GTO A;  4QQD A;  1BI1 A;  3CCL Q;  4HCK A;  5LJ5 j;  4C0Z A;  3EG9 A;  2EYQ A;  2DJQ A;  1EX4 A;  3JB9 D;  5IHN A;  4KRT A;  5GAN 6;  2OAW A;  5D6X A;  3S6W A;  3G4S T;  2FPF A;  1VQ7 T;  2COY A;  2HBP A;  2OTL A;  3G33 B;  3QHW B;  1Z9Z A;  1K9M R;  4NL3 A;  1H3Z A;  2XMF A;  4FX3 B;  3TEE A;  1Q86 U;  3GTM S;  1FVV B;  4E6R A;  2M16 A;  4ZN3 A;  2OTJ A;  1RAE B;  4CFN B;  4I3Z B;  3M9Q A;  1AOJ A;  3OYD A;  1W1F A;  2X4W A;  4JS4 A;  2JUF A;  1W2B A;  3CC7 A;  4OR5 B;  2C0O A;  1Q81 C;  1K8A U;  2F2X A;  4XTX A;  1Y7X A;  2HCK A;  1XQH A;  2VC8 A;  2M0Y A;  4MZT A;  4XU2 A;  1QVG A;  5ACB A;  1JO8 A;  1OYX A;  1IRE B;  1VQO Q;  4LXC A;  3PO3 S;  5GAN f;  2O9V A;  3MPU B;  2EKH A;  2V8I A;  2I0N A;  2WSF E;  4EOI B;  1YIJ Q;  3QWY A;  2YUP A;  5GMK l;  1BU1 A;  5HBJ B;  3HRS A;  1Q7Y C;  5GAO n;  1JXO A;  2KGT A;  2L3P A;  1BYM A;  1HYO A;  6AT1 B;  4M77 D;  2FPD A;  4PLL A;  1UGQ B;  3A8L B;  3S3N A;  1I07 A;  4BCI B;  4BCN D;  2K3B A;  2HQH A;  2I53 A;  5FU6 C;  4M7A A;  4C8Q C;  2DTO A;  3CCJ Q;  3UPU A;  2KRN A;  1WPY A;  1ZLM A;  4A63 B;  5GAM f;  1AZG B;  2BZX A;  2HSE B;  2OAU A;  2DBM A;  4OGE A;  1YHQ T;  1K9M C;  3I35 A;  1VQM T;  2FL7 A;  2IIM A;  1FWZ A;  4OMM A;  4XU3 A;  3OS0 A;  2XD0 A;  2A28 A;  5FWC A;  4LDU A;  1QMC A;  3KBG A;  4Z6Y A;  1GH6 B;  5A0D A;  1TU0 B;  2DD4 B;  1SG5 A;  3QYH B;  1ACM B;  3JCM f;  1MNE A;  2EQU A;  3CCV A;  1VQ6 A;  1EIF A;  1PHT A;  3VJP A;  5J39 A;  4B6M A;  3CCE T;  2CT4 A;  2QGG A;  4BCP B;  4M78 G;  3CCM Q;  1VIE A;  1NEB A;  3MP6 A;  3PMT A;  3OYH A;  2EYY A;  5KYW A;  2YRD A;  3SWN C;  4RTW A;  2QG9 B;  2COW A;  2BKZ B;  2VB6 A;  3VS7 A;  1NEG A;  4CFX B;  3GNF B;  2RJF A;  1M1K R;  5EG2 A;  1FMV A;  4BE2 A;  1HJD A;  3O5Z A;  1KC8 U;  4LD9 K;  4DBQ A;  1AWX A;  5LJ3 h;  1M5Q 1;  1OU8 A;  1NPP A;  4EIK A;  5ECA A;  1WQW A;  2CDT A;  1YIT A;  2JNG A;  3LWI A;  4E7K A;  3JCM Q;  3HZJ A;  1X6O A;  4BDY A;  4O6J A;  1VQ5 A;  1QW1 A;  1TTH B;  5KYU B;  5J3B A;  2FZG B;  3EGD B;  3QWX X;  4XAX B;  3VYG A;  1YJW A;  1KQS A;  4PNO A;  5CVI A;  4BCK B;  2RM4 A;  4C92 F;  2DRM A;  2RO0 A;  3HHT B;  1GCQ A;  3OS1 A;  2PHG A;  1NJI C;  1T3S A;  2DL4 A;  2M1H A;  2BE7 D;  4J7I A;  5GAN g;  3H9N A;  5CO7 A;  4L6V 5;  1YNZ A;  4CRL B;  4AFU C;  3BDL A;  3G4S A;  2DL7 A;  4CI0 C;  2PQW A;  1VQ7 A;  1G8X A;  3JB9 I;  4OMO A;  4M7D D;  2KEA A;  1KD1 R;  2PTK A;  2QA4 Q;  3BLH B;  3EHR A;  5LJ3 j;  2CP7 A;  4J9E A;  3LGL A;  3OYE A;  4PJO B;  2FVU A;  2RJE A;  1O9K A;  1ZSZ B;  2CGH A;  2OJ2 A;  2KAF A;  2AK5 A;  2F2W A;  5GAN d;  4CC2 A;  4EOQ B;  3HO8 A;  3DB4 A;  4EPC A;  1U3O A;  1YWO A;  5I2S A;  3D7S B;  2LJ0 A;  2NUP B;  1OL2 B;  3BY7 A;  2DXB B;  3PE0 A;  5I21 A;  5GAM g;  3BE3 A;  3NPF A;  4KRC B;  1M1K C;  1BCM A;  1M3C A;  2KMT A;  4BCM D;  1M30 A;  1QWE A;  1H64 1;  4A4G A;  2X3X D;  3I55 Q;  3MEU A;  2BS3 A;  2DXC A;  1LNX A;  3CC4 Q;  3RUX A;  3H8Z A;  3RKW A;  3M0U A;  1H1S B;  5GAN 4;  2W96 A;  2ZPE B;  2EAY A;  4EOO B;  3IQL A;  3OS2 A;  3V8L A;  3JCM g;  4JS5 A;  1S72 A;  3V7S A;  1OV3 A;  4N4H A;  2M02 A;  2QFZ A;  5GAM d;  2O01 E;  1X2Q A;  2D9T A;  3JCM V;  3EGU A;  2HEQ A;  4L5G A;  2ZZD A;  2ZAE A;  3OBW A;  4JLI A;  2PK2 A;  1QQJ A;  2RK2 A;  3M4G A;  4M7A B;  5EJC A;  5DQV A;  3HPW A;  4NC6 A;  1Y07 A;  2K2V A;  4BY6 C;  4ELY C;  2NYS A;  3E1S A;  2DXU A;  3I56 T;  4AI6 A;  4DBF A;  3JCM d;  1U8R A;  2X9H A;  2RD1 A;  2C5N B;  1WHG A;  2MYS A;  3VRY A;  1YHQ A;  1VQM A;  1MMA A;  3S3O A;  3ASK A;  1M27 C;  3CBO A;  3DL1 A;  1I4K 1;  1K4U S;  1VQ8 Q;  2XKO C;  3U23 A;  4JZ3 A;  1N27 A;  2KYB A;  2RNA A;  2KY9 A;  2QDJ A;  2K2M A;  3CCE A;  5KYW B;  3CCQ Q;  4FYW B;  5GAN 8;  2VXE A;  3TU4 K;  2Y4X A;  2X4X A;  1P92 A;  1H4L D;  2A7Y A;  4XTW A;  1ZUU A;  4FW2 A;  1O9S A;  1WHH A;  4RTX A;  3QO3 A;  2CRE A;  1N8R C;  2WMB B;  1YJN T;  3LLR A;  2P0Q A;  4HNV A;  3RBB B;  3A8M B;  1IB8 A;  1W2B S;  4YOO A;  2K6D A;  2ZPF B;  3S3M A;  2OTL Q;  4C8Q A;  1RAB B;  1QVG S;  1KQ1 A;  1UGS B;  3OYJ A;  2BS2 A;  3GP8 A;  1AD6 A;  2LRQ A;  1PNJ A;  1VQO A;  1MHN A;  1KFZ A;  2RPN A;  2OTJ Q;  3QZ5 B;  4JX5 A;  2GNC A;  2VWF A;  3OYK A;  4OB1 B;  4C5H A;  2CCI B;  2BE9 B;  2Z0W A;  4RTV A;  4Y28 E;  3BHT B;  1YIJ A;  4BCN B;  2DYI A;  4IKF A;  3C12 A;  1N5Z A;  1JQQ A;  1VQP T;  2IG0 A;  1Q7Y U;  3CC7 Q;  2PNI A;  5GAN h;  3E19 A;  4FT2 A;  4C5G A;  3I5R A;  3PT9 A;  2ROL A;  2LVM A;  2QAZ A;  2NUT B;  3A8O B;  1Y71 A;  2EPD A;  2R57 A;  1JJ2 A;  3L2Z A;  1O9K B;  3SWN A;  2ZPB B;  3QKJ A;  1WA7 A;  3PIP A;  2MMP A;  2E64 A;  1E7P A;  1IGU A;  2AIR B;  2J06 A;  2VKN A;  2RHZ A;  1TSF A;  3HKS A;  3QJY A;  5DLQ E;  3RIR A;  1E6H A;  3LX7 A;  3PVQ A;  1OKW B;  2X51 A;  2DPP B;  3OYA A;  1YFN A;  3CD6 T;  2HKN A;  1YCS B;  4CC7 A;  2V1Q A;  4P5N A;  3JCM c;  2C6T B;  2KK4 A;  4MMK A;  4RTU A;  1X6G A;  2DTH A;  1A0N B;  1WHK A;  2XK0 A;  2HMA A;  1M90 C;  2QQB A;  1VIN A;  3CCM A;  1S1N A;  4BCF B;  3EG2 A;  4KUI A;  1B34 A;  3DKM A;  3QG1 A;  4F7U A;  4QSH A;  1QCN A;  4FYX B;  2WJ9 A;  3A8H B;  2SEM A;  1GFD A;  3FRN A;  3P8D A;  4PJO E;  5ICP B;  2KYM A;  5CKB A;  3HP9 A;  4LUD A;  3DOG B;  3MKD A;  1D0Z A;  1CSK A;  1I5O B;  2B86 A;  4II5 B;  1I0C A;  3QYB A;  1OQK A;  2COZ A;  2XID A;  4IUR A;  4E47 A;  3I56 A;  2KR6 A;  1ZX6 A;  4C8Q G;  2CP6 A;  4J8O A;  1D1A A;  3RES A;  2XDD A;  4HVV A;  4M7D B;  1NJI U;  1YJ9 T;  4F6U B;  1VYW B;  1NE8 A;  2XU8 A;  1ABQ A;  2PZ1 A;  3CME T;  1FIN B;  2E3H A;  5GMK h;  3B57 A;  1VQ5 Q;  1N9R A;  1ZBJ A;  1YJW Q;  2XDP A;  3GF5 A;  4E7J A;  2FYK A;  4M7A E;  3DTO A;  3UAT A;  2YUQ A;  4M75 C;  1XNI A;  5FWB A;  2HQX A;  4II1 A;  4XU1 A;  2FRY A;  2LCC A;  3OYM A;  4BCM B;  3OYC A;  1YJN A;  2LW4 A;  1UNL D;  1JKW A;  2PVG B;  2LX7 A;  3TNI B;  5IHK A;  3G4S Q;  1VQ7 Q;  1WJR A;  5GAM e;  2DL5 A;  4YOS A;  4OF1 A;  5DY9 A;  4AG1 C;  7AT1 B;  4EOK B;  2LP5 A;  1WJQ A;  3E9F A;  3VRZ A;  3SHW A;  4M78 D;  2R5M A;  1M8V A;  2GF7 A;  5GMK j;  4BE0 A;  4BUG A;  1LOJ A;  1OZ2 A;  3CC4 A;  3JCM e;  2CSQ A;  1UFF A;  1PG5 B;  3MEV A;  5GAN 2;  1MV3 A;  2QTX A;  1VQP A;  4C92 C;  1KG1 A;  1SSH A;  1LJO A;  2EVR A;  1I8F A;  2DEU A;  1QCO A;  1ZUK A;  5L2W B;  4GLM A;  4PFO A;  3H0F A;  4C0D C;  4N4I A;  5FGK B;  5KYN A;  2QDL A;  1TOV A;  4OMF B;  5IAY A;  2MIO A;  3LH5 A;  1R8O B;  1LPL A;  1GCP A;  3K7A M;  5C0M A;  3MO8 A;  4AFQ C;  4KGV B;  3H41 A;  1S72 Q;  1YWP A;  3QXE B;  3NMZ C;  3J81 E;  3BHU B;  4M77 E;  2GBQ A;  3HSB A;  2QQA A;  1X6B A;  2XI9 A;  4F70 B;  5AYF A;  1E9H B;  2L0A A;  1VQ8 A;  5CK9 A;  3T9N A;  1UNG D;  4HL4 A;  2LQW A;  4QKU A;  2NUZ A;  2RJC A;  2VXF A;  3DDP B;  3HTR A;  1B34 B;  2J6F A;  3H0I A;  4F7U B;  2DLP A;  2E1H A;  3M55 A;  5L23 A;  1AVZ C;  1M8M A;  1OOT A;  4AKI A;  1YHQ Q;  1NYF A;  2YSQ A;  1VQM Q;  1QKW A;  1UEC A;  4RTZ A;  4M7A D;  3CPW A;  2WEV B;  1N8R U;  4ROE A;  3QYG B;  1G3T A;  2X3W D;  1MMD A;  3PGG A;  4C0F A;  4CFM B;  2LZ6 B;  1U5S A;  4M78 A;  1PSE A;  1V76 A;  2WSE E;  4ZGD B;  3OSS C;  4JRI A;  5D6W A;  1XJW B;  3CCE Q;  1RLP C;  4J9B A;  2E6N A;  2RK1 A;  5FLX E;  1OUL A;  2PVO B;  4F7N B;  4FIB A;  2ECZ A;  5FW9 A;  1WQ7 A;  4OMQ A;  3FJ5 A;  4F6S B;  2F2C A;  4ELZ C;  1IXD A;  1BU2 A;  3E9G A;  1YJ9 A;  5FRO A;  1G3W A;  3OYY A;  1W4S A;  4ESR A;  2BPM B;  1T0H A;  1MND A;  4X9D A;  3CME A;  5A0G A;  2EYX A;  2QEX T;  1W70 A;  4J7F A;  4PJO F;  2GTJ A;  1G2B A;  2WIP B;  3PFS A;  2IW9 B;  1UGV A;  3OMG A;  1URC B;  4M6V A;  3CXC S;  2KT8 A;  1JEG A;  2CT3 A;  4A4E A;  1AHJ B;  4DOV A;  2QI2 A;  1H24 B;  2K5F A;  2X35 A;  3CEY A;  4CFW B;  3FB9 A;  3CXC P;  3M0S A;  4BY6 B;  4M7D E;  5FRN A;  2L8D A;  4KRD B;  3OBY A;  4PJJ A;  3ZL7 C;  4XTU A;  4KUL A;  1U06 A;  3QDF A;  4JX4 A;  2FZC B;  2CP2 A;  3G6E T;  4L59 A;  3CC2 T;  1M90 U;  3VYH B;  4EMK C;  3DJB A;  4BBR M;  1NYG A;  3GNG A;  3NGP A;  4B9X A;  1XTD A;  1UEB A;  3G7Z A;  1MGQ A;  2VV5 A;  2GFU A;  3VS3 A;  2LQN A;  2CH4 W;  4BCJ B;  2JTE A;  4DA4 A;  2HBW A;  4HCB A;  2QTV A;  2X1N B;  1H27 B;  4RCB A;  1ZSG A;  1GY3 B;  4J9C A;  3RR6 A;  2R58 A;  4M75 F;  2X4J A;  4QQ6 A;  4FSX A;  3EHQ A;  5A2Q E;  1BI3 A;  5CQX A;  1X2K A;  3OQ5 A;  5CKE A;  3OYG A;  3Q1J A;  1FX7 A;  3L2U A;  2UZB B;  4J9D A;  2CZ7 B;  2KBT A;  5IDN B;  4M4Z A;  1AEY A;  2R5A A;  2QYZ A;  5GAO p;  3QHS A;  2XIC A;  4AG2 C;  3JCM P;  2K9G A;  2HL3 A;  5CEI B;  5CR2 A;  3CPF A;  4KUD K;  2DE0 X;  1ZA1 B;  4BCH B;  5GAN 3;  5IDP B;  1M1F A;  3I56 Q;  1TWB A;  2DL8 A;  3OW2 A;  1XOV A;  1TG0 A;  3EG9 B;  2RQW A;  3QWL A;  3M54 A;  3JRZ A;  4C92 A;  1Y0M A;  2D8J A;  1AD5 A;  2MK5 A;  3ER0 A;  3M58 A;  1WDX A;  4FT4 A;  4M78 B;  4Z02 A;  1PKD B;  2DYB A;  3L2W A;  3MI9 B;  1VYT A;  1IRX A;  4JUV A;  4M77 F;  5IXB A;  2UUE B;  1SPK A;  5GAO m;  2CYZ B;  3GIB A;  4JRK A;  2CJM B;  4E7L A;  3REA B;  1CKB A;  4KT0 E;  2QGS A;  4ME7 A;  5CYI B;  2QF7 A;  4IMY B;  2AZV A;  1OGU B;  1D0X A;  2UZE B;  3BFM A;  2D0N A;  4IUQ A;  2L89 A;  5KYY A;  1PRM C;  5KCH A;  3C94 A;  1YJN Q;  4CRI A;  4HT9 A;  2Y4Y A;  1UGP B;  2RN8 A;  3QII A;  4C0G A;  3UT1 A;  3OY9 A;  1TD6 A;  2VYT A;  1J3T A;  4LDW A;  5DQW A;  3J7A F;  3DLL A;  1PCX A;  3CBP A;  2QEX A;  3MY5 B;  1VQK T;  2HD0 A;  4EOL B;  4N0A C;  3M0T A;  4HKE A;  2W0Z A;  4C8Q D;  2ROT A;  3DB3 A;  2JTF A;  2E3I A;  4PK4 A;  4NOY A;  4F6W B;  2MAM A;  1VQP Q;  4M75 G;  2RI3 A;  3GPL A;  3URG A;  1H26 B;  1FYN A;  2QXF A;  2DNU A;  1QVF A;  3HRT A;  3EH1 A;  3A8G B;  4FSS A;  2BZY A;  3LWH A;  1OPL A;  3LGF A;  3TSZ A;  2ED0 A;  2WAC A;  4KH0 B;  1RAG B;  3RNJ A;  2IW8 B;  3CC2 A;  3P8B B;  5HY6 A;  2C5X B;  2ABL A;  1GXI E;  1BI0 A;  3ULR B;  1VQ9 T;  1GUX A;  3CCS T;  1OIY B;  3M4Y A;  2JT4 A;  2DTI A;  1KD1 C;  2QAS A;  3TW7 A;  2GGR A;  2MI6 A;  2PMI B;  3EFR A;  4JJD A;  5LJ5 f;  3OYI A;  1N6A A;  1PSF A;  2HL5 C;  2YLB A;  4TVR A;  1Q86 R;  1UJY A;  4HVW A;  1ZUY A;  1Y57 A;  4C92 G;  1KIK A;  4JPB W;  5GAO q;  3NDQ A;  2FRW A;  2KMG A;  2LQ8 A;  2YT6 A;  3ME9 A;  1RLQ C;  2KSS A;  1ZBX A;  4N4G A;  2GFA A;  4M7D F;  1RAC B;  2CZ1 B;  1K8A R;  4OGR B;  1ZQ1 A;  2DF6 A;  4M77 G;  4QQG A;  2RQT A;  3OSV A;  5HVY B;  1OEB A;  1JOW A;  3HBL A;  1RAD B;  4CFU B;  4EMH A;  2MPX C;  2J05 A;  2FB7 A;  1Q81 U;  2RHU A;  1UTI A;  3N5B B;  2QA4 T;  1G3S A;  2K5I A;  1RI0 A;  2MOX A;  1EFN A;  2J6K A;  2EUF A;  1K0X A;  3VYG B;  2B9R A;  2DJZ A;  4MDW A;  3UA6 A;  2J6O A;  2YDL A;  1VOM A;  4EMK A;  3LW5 E;  2K79 A;  2K57 A;  2D8H A;  4MFE A;  3EFO A;  4LD6 A;  1W2B P;  1QKX A;  1IHW A;  4CFV B;  1U1S A;  4ZN1 A;  1YJ9 Q;  4EMG A;  4KBM B;  2QQ9 A;  1MV0 B;  2XDB A;  1QVG P;  2HSP A;  2DER A;  2G9X B;  2CS7 A;  4C0D B;  1QVP A;  2G6F X;  4D8D A;  3CME Q;  3UDC A;  4A4H A;  5HK0 A;  4DQ2 A;  4J9I A;  5CKF A;  1Q86 C;  1OIU B;  1R0C B;  4MDX A;  2E12 A;  1OX9 A;  4JRQ A;  1D3B A;  3NTH A;  4BY1 X;  1KHC A;  1WYX A;  1K9M U;  2RB6 A;  1YCY A;  4HCZ A;  5D7U A;  2FO0 A;  3AT1 B;  2EW3 A;  3PMI A;  5GAM h;  1BKB A;  2KVQ G;  2GCX A;  2BIV A;  4M78 E;  1KJW A;  5GAN j;  5LJ5 g;  2DXC B;  4IUP A;  1VQN T;  2EKO A;  2OX7 A;  4MZM A;  5CIU A;  1KC8 R;  2CH4 A;  1AIS B;  3NTI A;  2YUO A;  2J7I A;  2BUD A;  4PJO C;  2JM9 A;  3NHN A;  3VUB A;  5GAO l;  1ZSZ C;  3DLM A;  1JST B;  1ZA2 B;  4UC4 A;  3R6N A;  1M2O A;  3JCM h;  1C6V X;  2K5L A;  2XHC A;  2ZZD B;  1WJS A;  2V8K A;  2L2P A;  1NG2 A;  3FIF A;  4B9W A; 
#chains in the Genus database with same CATH homology
 2DVE A;  2HQE A;  3QYH B;  2VGM A;  2A3L A;  2PVD B;  5AYF A;  5LJ5 d;  4BDZ A;  3JCM f;  2EQU A;  4XTY A;  3TW6 A;  3CCV A;  2CZ0 B;  1M4Z A;  2EQK A;  3RKX A;  1EIF A;  1VQ6 A;  5CK9 A;  3VJP A;  5J39 A;  3T9N A;  4HL4 A;  3CCE T;  4LDV A;  4ZTF A;  2RJC A;  5KCO A;  4M78 G;  4ZGJ B;  2KQW A;  3MCA B;  1VIE A;  2VXF A;  3AHU A;  1B34 B;  3MP6 A;  3PMT A;  2F5T X;  4M75 B;  4PL6 A;  4F7U B;  3OYH A;  3SWN C;  3EAE A;  4BI4 A;  3INZ A;  3R6O A;  2E1H A;  5GAM j;  2KDS A;  3M55 A;  1VQ9 A;  2RHY A;  3CCS A;  4AKI A;  1KQS S;  2GQV A;  4M7A D;  3GNF B;  3CPW A;  2RJF A;  3EFS A;  4M7D A;  2LT4 A;  4FU6 A;  1N8R U;  3CCL A;  2ZCF B;  5EG2 A;  2DKG A;  3VUZ A;  3QYG B;  4BE2 A;  1G3T A;  1FKM A;  3ZFJ A;  3PGG A;  4C0F A;  1KC8 U;  4LD9 K;  2JN0 A;  3QUI A;  5LJ3 h;  3WXM B;  1M5Q 1;  3PIO A;  1NPP A;  5KE3 A;  4PLI A;  1WQW A;  1PSE A;  4M78 A;  4OB3 B;  5GAO r;  1QLB A;  2JNG A;  2EWN A;  2WSE E;  4ZGD B;  3M53 A;  3OSS C;  1I81 A;  4JRI A;  5D6W A;  5J26 A;  4BB7 A;  2QQ8 A;  5A0L A;  4R55 A;  3LWI A;  2E6N A;  3HZJ A;  3QZ9 B;  1X6O A;  2RK1 A;  4N0A A;  4O6J A;  5FLX E;  1QW1 A;  3JCM Q;  3OYB A;  5LJ3 f;  4BDY A;  1VQ5 A;  2PVO B;  5J3B A;  3VYG A;  4FIB A;  4XAX B;  1YJW A;  3MP1 A;  2OTJ T;  1KQS A;  4PNO A;  5CVI A;  2RM4 A;  1WQ7 A;  4C92 F;  2RO0 A;  4QVC A;  5LL6 S;  2QQS A;  2RHX A;  3L2R A;  3HHT B;  1YIT A;  4OB0 B;  4ELZ C;  3OS1 A;  4C92 B;  1NJI C;  2M1H A;  3E9G A;  3UWN A;  1YJ9 A;  2B8A A;  4J7I A;  5GAN g;  4C8Q F;  4A53 A;  5CO7 A;  4L6V 5;  3P8H A;  1HXD A;  5FRO A;  5GAN 5;  3OYF A;  1BI2 A;  1G3W A;  3BDL A;  3OYY A;  1W4S A;  4J6X A;  4QVZ A;  3G4S A;  2E5Q A;  3HL8 A;  2PQW A;  4CI0 C;  1VQ7 A;  3RER A;  4X9D A;  5FU6 B;  3CME A;  4C8Q B;  2RI5 A;  5A0G A;  3JB9 I;  4MML A;  4A4K A;  2QEX T;  2G77 A;  2L3R A;  4M7D D;  4J7F A;  4PJO F;  1M1K U;  4Y91 A;  3ZBD A;  5LJ3 j;  1QP3 A;  3HFN A;  3PFS A;  4BAC A;  4M77 B;  3CCU T;  1YBY A;  3LGL A;  4IUV A;  4IUT A;  3OYE A;  3OMG A;  2P0P A;  3I55 T;  3C95 A;  2FVU A;  2RJE A;  3GOX A;  3CMA T;  4PJO B;  4M6V A;  2CGH A;  2V8J A;  3CXC S;  3CC4 T;  2KAF A;  2LC4 A;  4HLQ A;  3G71 T;  5GAN d;  4EPC A;  3HO8 A;  3DB4 A;  1Y96 A;  4A4E A;  1AHJ B;  2F5K A;  4DOV A;  2DO3 A;  1VQ4 T;  2E6Z A;  5I2S A;  1WNL A;  1VQL T;  2YHT A;  3MHX A;  3RMQ A;  2QI2 A;  3SB2 A;  2ZPI B;  3BY7 A;  3HFO A;  2K5F A;  2X35 A;  3CEY A;  1U1T A;  2DXB B;  3FB9 A;  1OI1 A;  3M57 A;  1K8A C;  4BY6 B;  5I21 A;  5GAM g;  3J80 E;  2YLC A;  3L2V A;  2L8D A;  4M78 C;  5FRN A;  4M7D E;  2E65 A;  3OBY A;  1M1K C;  4XTU A;  2KMT A;  1RL2 A;  4KUL A;  3KHI A;  4RKU E;  4JX4 A;  3JCM b;  1H64 1;  1UB4 A;  3O8V A;  3SWN B;  4A4G A;  3RKY A;  3CXC A;  1VQK A;  4HCC A;  4HT8 A;  1D3B B;  4L59 A;  3G6E T;  3MEU A;  3CCJ A;  2BS3 A;  2JOY A;  2DXC A;  2C06 A;  3CC2 T;  1Q82 U;  1LNX A;  1M90 U;  3VYH B;  1N9S A;  4IUU A;  3RUX A;  3H8Z A;  3MEA A;  4EMK C;  3RKW A;  4BBR M;  4OP0 A;  5GAN 4;  3GNG A;  4AKH A;  2ZPE B;  1BIA A;  2EAY A;  4M77 C;  3VU3 C;  4B9X A;  3OS2 A;  1XTD A;  3V8L A;  3JCM g;  4JS5 A;  1S72 A;  2H3J A;  1KD1 U;  3V7S A;  4LDX A;  1UEB A;  3G7Z A;  4N4H A;  1MGQ A;  4EDU A;  2VV5 A;  1JRI A;  2QFZ A;  4RCC A;  5GAM d;  2O01 E;  2GFU A;  2D9T A;  3X20 B;  3JCM V;  1YI2 T;  4L5G A;  2ZZD A;  3RMS A;  3QJ6 A;  4JDS A;  4DA4 A;  3OBW A;  4JLI A;  4GY5 A;  4J6Y A;  4RMO A;  3CCV T;  2CKK A;  2I2L A;  3M4G A;  2RK2 A;  4A4F A;  4HCB A;  1VQ6 T;  2PU9 B;  4M7A B;  3CD6 A;  4M7D G;  2EQJ A;  3A5Z B;  5EJC A;  4RCB A;  3HPW A;  3SDZ A;  2O4X B;  4NC6 A;  2BS4 A;  3H4C A;  4JJN K;  2R58 A;  1Y07 A;  4M75 F;  5GAN 7;  3CCQ T;  2K2V A;  2X4J A;  4BY6 C;  4ELY C;  4F7U F;  5FRM A;  4QQ6 A;  3E1S A;  1VQN A;  4FSX A;  4HNU A;  2DXU A;  1BI3 A;  4R56 A;  5A2Q E;  4HA8 A;  4AI6 A;  5CQX A;  3JCM d;  3I56 T;  1U8R A;  2E10 A;  3OQ5 A;  5CKE A;  3OYG A;  2RD1 A;  3Q1J A;  1K73 U;  1FX7 A;  2ZGW A;  3L2U A;  4J5Y A;  2CZ7 B;  1YHQ A;  3X25 B;  3OYN A;  1VQM A;  4BI8 B;  3S3O A;  3ASK A;  4XU0 A;  4YTL A;  3CBO A;  4WF2 A;  5FU7 B;  3OW2 S;  3SD4 A;  3DL1 A;  5CAI A;  5LJ3 g;  2QQR A;  2R5A A;  5GAO p;  1I4K 1;  3QHS A;  2X4Y A;  2XIC A;  3M56 A;  3JCM P;  3VKG A;  3TCJ A;  2XKO C;  1VUB A;  3OMC A;  3JB9 H;  1YIT T;  1N27 A;  3L1A A;  3V7C A;  1UGR B;  1G5V A;  2JVV A;  2KY9 A;  5CR2 A;  2QDJ A;  3CPF A;  4KUD K;  2OTL T;  4QW2 A;  3CCE A;  2LT1 A;  2M0O A;  5GAN 3;  1G3Y A;  4OB2 B;  1M1F A;  4M7A C;  1M1G A;  2NLU A;  2K4Y A;  5GMK m;  1VIF A;  5GAN 8;  2VXE A;  3TU4 K;  1HK9 A;  3JSC A;  2Y4X A;  2DIQ A;  2X4X A;  1P92 A;  2A7Y A;  3OW2 A;  5LJ3 d;  1XOV A;  4XTW A;  5CKD A;  1OZ3 A;  4D6W A;  1O9S A;  4M78 F;  4HNT A;  2D6F A;  3QWL A;  3M54 A;  3JRZ A;  3QO3 A;  4C92 A;  5GAN e;  1N8R C;  3MEW A;  3H6Z A;  1YJN T;  3LLR A;  2P0Q A;  3ER0 A;  3M58 A;  4M75 D;  4HNV A;  4GLK A;  3CC7 T;  4FT4 A;  3A8M B;  1WGS A;  3QBY A;  4M78 B;  1KC8 C;  3FEO A;  1W2B S;  2AHJ B;  4Z02 A;  2EJG A;  5FU7 C;  2K3Y A;  3M5A A;  4A54 A;  3L2W A;  2ZPF B;  2DD5 A;  2RJD A;  3S3M A;  1JB0 E;  4RG2 A;  3TRE A;  5CKH A;  5CCA A;  4C8Q A;  4JUV A;  4X34 A;  1QVG S;  1KQ1 A;  1UGS B;  4M77 F;  3OYJ A;  4JLG A;  2QA4 A;  2BS2 A;  4E7H A;  3GP8 A;  4EMK B;  3GPL A;  2HNI A;  3OA6 A;  2LRQ A;  2BKD N;  5GAO m;  4NL2 A;  2CYZ B;  3GIB A;  4JRK A;  1VQO A;  1I5L A;  1MHN A;  3QDR B;  4E7L A;  1JJ2 S;  3QZ5 B;  2Y90 A;  4JX5 A;  4KT0 E;  4ME7 A;  1O75 A;  3OYK A;  4PJO A;  4E7I A;  4OB1 B;  2EIF A;  2IVW A;  4C5H A;  2QF7 A;  2P4T A;  4FL6 A;  5CQY A;  4ATO A;  1VQL A;  3LYI A;  3KXT A;  4JRP A;  3BFM A;  1X01 A;  4Y28 E;  1YIJ A;  4IUQ A;  2L89 A;  4E7K A;  4M75 E;  5KCH A;  3C94 A;  4IKF A;  3C12 A;  1VQP T;  1DJ7 B;  4CRI A;  2IG0 A;  3HB9 A;  2EJF A;  2LCL A;  2M9U A;  4NS5 A;  1Q7Y U;  4HT9 A;  4M7D C;  2Y4Y A;  5GAN h;  3E19 A;  1X75 C;  1UGP B;  4FT2 A;  3QII A;  3LH0 A;  4C0G A;  3UT1 A;  3OY9 A;  2VYT A;  2DXB A;  5D6Y A;  4LDW A;  4C5G A;  1KHI A;  3PT9 A;  4OGC A;  2F69 A;  3J7A F;  2LVM A;  3DLL A;  3X26 B;  3CBP A;  2QEX A;  4XTV A;  1QVF S;  3A8O B;  4C92 D;  1Y71 A;  2CZ6 B;  2R57 A;  1JJ2 A;  2D0Q B;  2HD0 A;  3L2Z A;  4J6W A;  5I2M A;  1IZ6 A;  3ZEH A;  1VQK T;  2PUK B;  4N0A C;  5LJ5 e;  3SWN A;  3CCU A;  2ZPB B;  2P0K A;  3I55 A;  2DIG A;  3QKJ A;  3BG5 A;  3CMA A;  3VKH A;  3PIP A;  2MMP A;  4HKE A;  1Y96 B;  1S72 T;  2E64 A;  1E7P A;  3G71 A;  4C8Q D;  3DB3 A;  2JTF A;  4NOY A;  2MAM A;  2RHZ A;  1VQ4 A;  4PKC C;  3HKS A;  3FDR A;  2E41 A;  2RI3 A;  3QJY A;  4LDY A;  4M75 G;  4XTZ A;  5DLQ E;  3LX7 A;  4J83 A;  3PNW C;  3URG A;  2QXF A;  2YRV A;  2RHI A;  2MWO A;  3CCR T;  2DPP B;  3OYA A;  4PJO D;  1QVF A;  3HRT A;  1NPR A;  3CD6 T;  4M7A F;  3A8G B;  2E70 A;  4C92 E;  4ZGE B;  3LWH A;  4P5N A;  2DD4 A;  3JCM c;  3FJP A;  3BG9 A;  2KK4 A;  4MMK A;  3QYE A;  3L42 A;  3V8K A;  5M9O A;  2ZPG B;  2ZPH B;  2DTH A;  3LGF A;  2XK0 A;  4MIM A;  2K3X A;  2WAC A;  3JB9 F;  4XQ3 A;  3WVE B;  3CC2 A;  2XG8 D;  3P8B B;  1Q82 C;  1V29 B;  5HY6 A;  1JBM A;  5LJ5 h;  2QQB A;  1M90 C;  3CCM A;  1GXI E;  4C8Q E;  3WVD B;  1BI0 A;  1VQ9 T;  4KUI A;  1B34 A;  3CCS T;  4M75 A;  3DKM A;  3F70 A;  1ZHI A;  3QG1 A;  3M4Y A;  4F7U A;  4QSH A;  3JCM J;  3MP8 A;  5GMK i;  2DTI A;  5HK3 A;  1KD1 C;  2WJ9 A;  3A8H B;  3TW7 A;  2LNV A;  2MI6 A;  3SFM A;  3EFR A;  3FRN A;  5LJ5 f;  3P8D A;  3OYI A;  4VUB A;  4F7U G;  5CKB A;  3CCL T;  1N6A A;  4ZTJ A;  1PSF A;  1QP2 A;  2DAQ A;  2PUO B;  3HP9 A;  3VKI A;  2YLB A;  5DLO A;  2DXT A;  1YI2 A;  3FLG A;  4TVR A;  1BIB A;  5KH6 A;  4C5E A;  4BI3 A;  3QPH A;  2DZ9 A;  4C92 G;  4QVD A;  5GMK e;  5GAO q;  3RIR A;  2KMG A;  2LQ8 A;  3ME9 A;  3QYB A;  2XID A;  1M9S A;  1VQ8 T;  1VQ5 T;  3CCQ A;  2JTM A;  2RH2 A;  4ELJ A;  4IUR A;  3OS5 A;  4E47 A;  3QSU A;  2FHD A;  2KSS A;  1ZBX A;  4N4G A;  4BBS M;  3JAM E;  4LOC A;  5L8R E;  3I56 A;  2GFA A;  1YJW T;  2G3R A;  2KR6 A;  3OYL A;  4M7D F;  3MET A;  3FC3 A;  4C8Q G;  2CZ1 B;  4FM4 B;  2LQK A;  2LDM A;  5IT9 E;  2DK3 A;  2DZC A;  4J8O A;  1K73 C;  2LX9 A;  3X24 B;  3RES A;  2XDD A;  2RA2 A;  1NZ9 A;  2VUB A;  4M7D B;  4QQD A;  1ZQ1 A;  1NJI U;  1BI1 A;  3C4S A;  4M77 G;  4QQG A;  5LJ5 j;  3JCM W;  4C0Z A;  3OSV A;  1YJ9 T;  4PJO G;  2EYQ A;  3HBL A;  1NE8 A;  1VQ8 A;  3JCM X;  3JB9 D;  4AKG A;  2XU8 A;  4EMH A;  5GAN 6;  3S6W A;  5D6X A;  3V7R A;  2FB7 A;  3V8J A;  3G4S T;  1Q81 U;  1VQ7 T;  2RHU A;  3CME T;  3N5B B;  2QA4 T;  2HBP A;  2RI2 A;  1G3S A;  3NTK A;  4O5V A;  2K5I A;  1RI0 A;  2VGN A;  5KE2 A;  5GMK h;  2OTL A;  1N9R A;  4NL3 A;  3VYG B;  1H3Z A;  1VQO T;  3TEE A;  2DJZ A;  4MDW A;  2XDP A;  3GF5 A;  4EMK A;  4E7J A;  1Q86 U;  3LW5 E;  2EJ9 A;  2FYK A;  4M7A E;  2K57 A;  2M16 A;  4ZN3 A;  2OTJ A;  4MFE A;  4LD6 A;  4M77 A;  4M75 C;  1KQ2 A;  1XNI A;  2HQX A;  4II1 A;  4XU1 A;  1YIJ T;  2DEQ A;  2LCC A;  3M9Q A;  5HKC A;  3OYD A;  3HRU A;  1U1S A;  3GLX A;  4ZN1 A;  3OYM A;  3OYC A;  4EMG A;  2LTO A;  2QQ9 A;  4KBM B;  3KUF A;  2X4W A;  2XDB A;  4JS4 A;  2JUF A;  4OVA A;  1YJN A;  5C6S A;  1W2B A;  4F7U E;  3X28 B;  3CC7 A;  2CS7 A;  2PVG B;  2EFI A;  2DD5 B;  4C0D B;  1QVP A;  3CBM A;  1Q81 C;  1K8A U;  4XTX A;  1WJR A;  1Y7X A;  4MZP A;  5GAM e;  1XQH A;  2VC8 A;  4MZT A;  3UDC A;  4XU2 A;  1QVG A;  4OF1 A;  4A4H A;  5HK0 A;  5DY9 A;  1OYX A;  1IRE B;  4DQ2 A;  2WSC E;  1WJQ A;  3E9F A;  5CKF A;  1Q86 C;  5GAN f;  4MDX A;  3CCJ T;  2HAX A;  4M78 D;  2E12 A;  4JRQ A;  4M7A G;  2V8I A;  2R5M A;  1M8V A;  1D3B A;  2GF7 A;  2WSF E;  5GMK j;  4BE0 A;  3NTH A;  4BUG A;  1LOJ A;  2MF2 A;  1OZ2 A;  3BG3 A;  3CC4 A;  1KHC A;  3L2Q A;  5GMK l;  4C5I A;  3JCM e;  2MWP A;  3HRS A;  2EQM A;  3MEV A;  4MFD A;  2RB6 A;  5GAN 2;  1K9M U;  3OB9 A;  2QTX A;  1VQP A;  1YCY A;  1Q7Y C;  3JB9 G;  4Q5W A;  3JB9 J;  4C92 C;  4HCZ A;  5GAO n;  1KG1 A;  1BYM A;  4M77 D;  4X9C A;  1LJO A;  4DOW A;  1I8F A;  3PMI A;  4PLL A;  5IN1 A;  1UGQ B;  5A0D A;  3A8L B;  2L5Q A;  3VV0 A;  3S3N A;  5GAM h;  4BD3 A;  4V2S A;  1BKB A;  4C0D C;  2KVQ G;  4N4I A;  2GCX A;  5FU6 C;  4M7A A;  4C8Q C;  2BIV A;  2DTO A;  4M78 E;  1SSF A;  4OMF B;  5GAN j;  5LJ5 g;  2DXC B;  5IAY A;  2JZ2 A;  2O4X A;  2EKO A;  1TH7 A;  4IUP A;  1R8O B;  4MZM A;  4RG8 A;  3CCM T;  3UPU A;  1VQN T;  3M59 A;  1WPY A;  3G6E A;  3BDU A;  4JX6 A;  5CIU A;  5C0M A;  5GAM f;  3MO8 A;  3NTI A;  5DM7 R;  3NFC A;  2BUD A;  4PJO C;  3VUB A;  2QDY B;  2OAU A;  4PJO E;  4OGE A;  5GAO l;  1YHQ T;  1K9M C;  3DLM A;  3QXE B;  1VQM T;  2FL7 A;  3J81 E;  4UC4 A;  4XK8 E;  4BE1 A;  1FWZ A;  4XU3 A;  3JCM h;  3OS0 A;  4M77 E;  3CCR A;  2XD0 A;  2K5L A;  2XHC A;  5LJ3 e;  3BW1 A;  3HSB A;  2ZZD B;  1WJS A;  2QQA A;  2V8K A;  1FXX A;  4LDU A;  3PTA A;  3CPW S;  3KBG A;  4Z6Y A;  2XI9 A;  3FIF A;  2DD4 B;  4B9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...