1UGQB

Crystal structure of apoenzyme of co-type nitrile hydratase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Nitrile Hydratase alpha subunit
total genus 65
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugqB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugqB02
2D0QB 1QP3A 2CZ0B 4Y28E 2CZ6B 2DD4B 2ZPFB 2DD5B 2PUKB 2CZ1B 3QZ5B 2ZPIB 1UGQB 3LW5E 2PU9B 2ZZDA 3QZ9B 2PVGB 3HHTB 3X25B 2PUOB 3X28B 4RKUE 4OB3B 1V29B 2WSCE 2CYZB 4ZGEB 1UGPB 2ZPEB 2ZPGB 2WSFE 2QDYB 1PSFA 3A8HB 3WVDB 1QP2A 2PVOB 3QXEB 3X26B 1DJ7B 3A8GB 4KT0E 2PVDB 2DXCA 3VYHB 2O01E 4OB0B 4ZGJB 3A8MB 2DXCB 4ZGDB 2DD4A 2DPPB 3WVEB 3VYGA 1PSEA 2ZPBB 2DXBB 3QYHB 3X20B 3VYGB 4OB1B 3X24B 2CZ7B 4OB2B 3QYGB 1AHJB 1UGRB 4L6V5 1JB0E 2DXBA 5L8RE 2DD5A 1GXIE 3A8LB 2WSEE 1IREB 2ZPHB 4XK8E 2AHJB 4FM4B 2ZCFB 1UGSB 3A8OB 2ZZDB
chains in the Genus database with same CATH superfamily
1BI2A 1OZ2A 2C0IA 1E7PA 3K7AM 2DTIA 1NPRA 1QCNA 3OW2P 1CKBA 5DLQE 2FEIA 4EMHA 4BXXX 1M1KR 4M7DF 3L2WA 3FRNA 2V8KA 4BD3A 4C92C 1FINB 2EBPA 2VXEA 4F16A 1AISB 2PVGB 1NPPA 2ESWA 3M03A 5L23A 3EGXA 2EWNA 2PZ1A 5CKBA 2VGMA 3O5ZA 1JJ2A 2DETA 3C95A 1RLPC 3DJBA 2YWWA 4F7UE 1YFNA 5GMKh 1SEMA 2E1HA 2OTLQ 2C0TA 2JJ9A 1JJ2P 2OJ2A 1IB8A 2CT4A 4Z8AA 5IXBA 4OB0B 4WF2A 3GNFB 2HDAA 2EJGA 2E5KA 4GLKA 5D6XA 3LH0A 2FZGB 3TNIB 1WPYA 1SSFA 2ZPBB 1YNZA 1OPLA 2YDLA 2CS7A 2EGAA 3GP8A 4KULA 3M56A 2KGTA 2J6FA 4N4GA 5IHYA 5I21A 5ECAA 5C0MA 4M7DC 1MV0B 2RQTA 1VQOQ 1W2BA 2X4JA 4II1A 4C0FA 1NJIC 4BCFB 4IIMA 4OGEA 4JJDA 4QW2A 1WXTA 5LMKB 4QSHA 3MY1B 2ECZA 1YIJQ 2HQEA 4JRQA 1NEGA 2P4TA 4M77B 1VQPA 4XTUA 2CP3A 3TW7A 4BCGB 3SDZA 4V2SA 2KK4A 3CCMA 1GRIA 2D1XA 3QKJA 1YJNA 1T3SA 5FRNA 1ZUKA 2DXUA 5EJCA 2CZ0B 1YITQ 3IQLA 4J9GA 2M51A 5GMKi 3UA6A 1GCPA 3GTMS 1NE8A 1D0YA 3CMEQ 4AG2C 1S72T 5GANf 5DLOA 3UWNA 2KEAA 3REBB 4ME7A 3HB9A 2GFUA 2ZPFB 2DD5B 1YI2T 1FKMA 2YT6A 2X51A 1XO2A 1NJIR 3PVQA 4EORB 1E7OA 2CP6A 4C92F 1YI2Q 2RNAA 4KRDB 5CK9A 3CCEA 5FGKB 1IXDA 2DO3A 5C6SA 1HJDA 3ZL7C 1I8FA 1D09B 1NG2A 2IIMA 3OMGA 4JS4A 3OW2A 3THKA 4MIMA 1UE9A 4MFEA 1BI3A 3A8HB 2XDPA 2JM9A 4KUIA 4OR5B 1SPKA 2E3IA 2DEUA 3T9NA 3I56A 2XKOC 1H28B 4CRIA 4F7UA 2QA4Q 3QHWB 1YCSB 2E41A 2O01E 1RAEB 3BDUA 2DNUA 2RQRA 2QEXT 2JXBA 1WJRA 4M75F 1KK7A 3H0HA 4HVVA 1WHLA 4N4IA 2LDMA 2RJEA 5CIUA 1YJNQ 3J7AF 2K3BA 2KR3A 4LXCA 5I2MA 1GUXA 1AHJB 1GY3B 2K2VA 3UA7A 5GAOr 1YJWA 3CD6A 3BG3A 2P0KA 1QMZB 4O5VA 1UUEA 1G2BA 4A63B 4AT1B 1HD3A 3HZJA 3EGDA 4D6WA 2B9RA 5HBJB 3RMSA 3OB9A 1VQOA 5CAIA 2AHJB 4FM4B 2IG0A 1VQPQ 3UDCA 1BIBA 3SWNA 4M7AC 2DE0X 3GNGA 3MI9B 1C9BA 2PHGA 2I40B 1R8OB 4XTZA 4E7KA 2GQVA 4OF1A 1R77A 4RG8A 2ZGWA 2DL7A 3VKHA 1PRMC 1KQ2A 5GMKm 3HKSA 2DKGA 3PT9A 4J7IA 1TXQA 3KFVA 2LT4A 3VS4A 1YHQQ 3OYMA 4MZMA 4M77G 2LCSA 1UGQB 3LW5E 1QKWA 2J7IA 3M4GA 1M8VA 3X25B 2MI6A 1AT1B 2QQAA 1OULA 2CDTA 3X28B 2EQMA 4KH1B 2BKDN 5ACBA 1VQ8T 3TVTA 4KGXB 4CRLB 4QQ6A 4PJOD 2RM4A 1I81A 5GMKj 1Q82U 2UZEB 1RI0A 3ER0A 4IMYB 2FL7A 1G8XA 1MHNA 2RI3A 1M8MA 3I56Q 2DA9A 1GBQA 1RADB 3CCQQ 1GH6B 1WHGA 1H27B 1D1BA 4C8QG 1B34A 3RDVA 1C1AA 3CCQT 1HSQA 3EFOB 4LDXA 1NJIU 2GFAA 2DL8A 1VYVA 4BE1A 1JSTB 2CUBA 2K79A 3OYEA 1Y07A 3CCEQ 2K2MA 4JJNK 2AZVA 2DIQA 1VQLT 2KYBA 1O9KA 1N6AA 3VS1A 1ZUYA 1BYMA 3Q1JA 4EMKC 3VV0A 5HVYB 2LVMA 1UGRB 2L3SA 1FWZA 2UZLB 2EAYA 1KD1U 1BI0A 1FX7A 2VUBA 1K1ZA 3CC7Q 4C92A 2D8HA 1VUBA 2X1NB 3G33B 4M77A 3TNWB 2QXFA 1Q7YU 1BIAA 3CC7T 1WHJA 2LRQA 1IREB 2PK9B 4PJOF 4XU3A 3CCJA 4J9IA 4C92E 4CFMB 3CXCP 3QUIA 3CCRT 2WXVB 2JTFA 3AHUA 2QA4A 5M9OA 1JOWA 4GBQA 5LJ3f 3PGGA 5KCOA 2FZKB 5LJ3g 1S72Q 1WNLA 1VQ4Q 1QP3A 4F6UB 2JS2A 1H1SB 3QDRB 1H92A 2VYTA 2X9HA 2OTJT 3VS2A 2JZ2A 1VQMA 3M4YA 2ZPIB 4JRPA 3LX7A 2PU9B 3EH2A 1LVKA 4BCJB 2MOXA 2A28A 3LGLA 2NUTB 4FSSA 2DMEA 3HL8A 3L2RA 1V29B 2EKHA 1XNIA 4HL4A 2V8IA 3OBWA 4E7SA 3DDQB 3LLRA 1JBMA 5GAOl 4E7IA 1RAAB 2AK5A 3HO8A 3PE0A 2GTJA 1H641 4HNVA 3O8VA 1U1SA 3CCUT 4JZ4A 3H0FA 4X9CA 3CCSA 3C0CA 4JLIA 3MJXA 1KSWA 2HKNA 2YRVA 1TH7A 4RG2A 5HKCA 2DBMA 2DERA 2E64A 3CCVA 1RACB 4C5HA 4E7JA 5FROA 4Z89A 2RK2A 2O4XA 1YHQA 4EDUA 2DXBB 4EMGA 2DFUA 1MMNA 3M57A 2OTLT 5LJ5g 1QVFA 1OL2B 3CXCS 4BCHB 3QWXX 4M77C 1X27A 3MEWA 4M7AB 1K4US 2QDJA 1R0BG 3CPWP 1B3QA 4QKUA 4XTYA 2RMOA 3JCMX 1JXMA 4EMKA 1GUXB 4F7NB 2LTOA 5KCHA 4Q5WA 3REAB 4M78A 4YOOA 3LGFA 1SSHA 4CC3A 4PJJA 4M7AG 1RABB 2KBTA 3TREA 1K73U 2EQKA 5HBHB 1WQ7A 1RLQC 3G71Q 4PJOE 3HPWA 2OTLA 3BW1A 1UGSB 1UEBA 1D3BA 1ZLMA 3V7CA 1KQ1A 3NPFA 1OIYB 2V1RA 1GCQA 1GFDA 1E9HB 3AT1B 3SEMA 1JSUB 3CCVT 2YRCA 3CD6Q 1Y96B 1ZBJA 2CT3A 4DEYA 4E2FB 2COWA 3RIRA 3CCST 4M7DA 1VQ4T 4L59A 3L2ZA 2JN0A 4AMCA 4F7JB 3VS3A 4DOVA 3CCUA 2E10A 4M75A 1BU2A 4RCCA 1VQ8Q 1KFZA 2BUDA 2EQJA 1V1CA 2DAQA 3JCMb 2RB6A 4KRCB 3M0RA 5CKHA 1AWJA 3BHTB 1QW1A 3JCMc 2HQXA 2NUZA 2CUDA 4BY7X 4EONB 3OQ5A 4XU2A 1PWTA 1SKUB 2V1QA 4EOOB 2WPAB 4IUUA 3QYEA 4EPCA 3JAME 4JJBA 1VQ7Q 5KE3A 5GAOn 1LCKA 2OTJA 4LD9K 3S6WA 1OX9A 1UNLD 1WA7A 4OMMA 3URGA 3JCMW 3OYAA 4JLGA 2DVJA 2EYXA 4HLQA 3CBPA 1PHTA 1QLBA 2P0QA 2GBQA 2LJ0A 2XU8A 3LWHA 2F2CA 4ELLA 2QA4T 1X75C 4BCQD 4E6RA 4BDZA 1WHMA 1OOTA 4C5GA 3CCJT 1ACMB 3P8BB 4MDWA 3WXMB 2OX7A 3OYIA 1AWWA 2CCHB 3CC7A 2BZXA 3OBYA 1X69A 1KHCA 3PIPA 1H24B 1BU1A 1ZSZB 2DYIA 4KRTA 1M2VB 1WYXA 1G83A 3PMTA 4K11A 4Y91A 4C92D 2EPDA 4M77D 2C4GB 2BZ8A 1YWPA 3FLGA 4HT9A 3SFMA 1TFBA 4EOJB 4OGCA 1VQLA 1K8AU 2NWMA 3S3NA 1AZGB 4DBHA 1U3OA 3EFSA 1EFNA 3G71A 4GLMA 3A8OB 1YIJA 3I9QA 2D0QB 4B9WA 1K73R 1W98B 2KXDA 4PFOA 4RTZA 2KR6A 2R57A 1RI9A 2GCXA 4F17A 1PNJA 4EC9B 2DL5A 2X4YA 1GFCA 3CCQA 2A37A 1SF9A 4ZNXA 5CCAA 5IXFA 1M1KC 5DQWA 2O88A 2YHTA 2WFYB 3NDQA 2WEVB 3M0TA 1H1QB 3UT1A 3EFOA 1PKTA 4C0DC 1E6GA 1AD6A 2EKOA 1SRMA 4A54A 4RTYA 1OIUB 5CQYA 2JMAA 2YUOA 1Q86C 2M0YA 1VQ8A 2YLBA 4C92B 2KQWA 1KG1A 4BCNB 5AT1B 3C12A 4FU6A 1RAGB 1N27A 1UNHD 3EOCB 4IKFA 2C5VB 2PVOB 1PKDB 3H0IA 5HQ0B 3M0PA 3QPHA 2QYZA 1W2BS 5FWBA 1VQKT 2QK0A 3NHNA 5GAN5 4ROEA 4A4GA 2LT1A 5AYFA 4ZGDB 5DQVA 3VKIA 2M9UA 4F04B 3BHVB 2EYWA 2L8DA 2X4XA 2AIRB 5GAN2 4JRIA 1WXBA 2JS0A 5HY6A 1SG5A 2QAZA 5GANd 2PNIA 1JKWA 2XI9A 4IIOA 1UB4A 5IHIA 1VQ6Q 3CCLQ 3EFRA 4M7DD 4L6V5 1JB0E 1K9AA 5GMKe 1VQMQ 5IHNA 5GAN3 4JX4A 5A2QE 2ENMA 1YJWT 2RHUA 5GAMf 1G3WA 3QHRB 2KXCA 4ELYC 1D3BB 4UC4A 3QWLA 1D0XA 2HCKA 2HL5C 1N9SA 1YJ9A 1OI9B 4BCIB 5HNBB 3MHXA 3QHSA 3VUBA 2G6FX 2QEXA 3JV3A 2F2VA 4P5NA 2UZDB 3SWNB 2K3YA 1Q7YR 4M7DB 4RTUA 1RL2A 2RJDA 4F7UF 1ZBXA 2E12A 2V8JA 4JRKA 2IW6B 1LPLA 2LW4A 2QQ9A 2DRKA 1K73C 1NZ9A 3HHTB 4F6WB 4XTXA 3M0UA 5GAMh 3JB9F 4RKUE 2AKKA 5FU7C 2K57A 2MMPA 2JGZB 3SHWA 1WFWA 4OMNA 4HT8A 3OYLA 2HBPA 1C6VX 4EOMB 3MEAA 2RHYA 1VOLA 1CKAA 1N4MA 1BK2A 3X26B 3HBLA 2KE9A 5DY9A 2RF0A 4DBRA 1VQ9T 1T0HA 1NYGA 3QG1A 1YI2A 4RUGA 3OYYA 2Y90A 2LQKA 4ELZC 3L2VA 3L2UA 4YC3B 2VXFA 1S72A 2F5TX 2PQWA 2DD4A 3WVEB 1VIFA 3RNJA 2LMJA 3QYHB 2EYYA 3M0SA 1QVFS 2C6TB 3O0GD 1I1JA 2RO0A 3KUFA 4BE2A 3FJPA 1ZSZC 2D0NA 4JZ3A 1TD6A 1M27C 4KBMB 2WIPB 2DL4A 2CP0A 2CREA 2LP5A 4D8KA 1IGUA 4R0KA 1VQPT 4M7DE 4XTWA 4DEXA 1M2VA 2FPEA 1WGSA 2K5LA 2DD5A 2DM1A 3QYBA 4LDYA 1WXUA 2M0OA 3VU3C 2IN3A 4HKEA 2KI7A 2A36A 2Y4XA 2WJ9A 3S3MA 4XU1A 4KGZB 3H9NA 4YTLA 1M2OA 4NS5A 2LQNA 1U5SA 2L3QA 1Q81R 1IHWA 1ZA2B 3ULRB 1Z9ZA 2XDDA 3A5ZB 1YJWQ 3E1SA 3JCMQ 3CPWA 1MMGA 1OX8A 5GJWB 4NL2A 4FYWB 3TNHB 2HQHA 1JXOA 3JCMf 1KJWA 2CZ1B 1G3YA 3TCJA 1TG0A 4M78G 5CKEA 2HAXA 1BKBA 4MFDA 5EC7A 1WX6A 2IPOB 4II5B 2PUOB 4RCBA 2WMBB 2HKQB 1W4SA 1WDXA 1Q7YC 2XHCA 1QVGA 2Z0WA 1KQSP 4LDUA 1M1FA 4FT2A 1B34B 2BE9B 1VQ9A 2LQWA 1KHIA 2LCLA 3RBBB 1H1RB 1LNXA 2K3XA 2KVQG 1OI1A 5A0GA 4LNPA 4FSXA 1FXXA 1N9RA 4F7LB 3OS5A 1B07A 4BI8B 3VYHB 5KYWB 4PJOA 3JB9G 4LUEA 2CJMB 2BZYA 3FC3A 2C06A 4DBFA 4J9FA 3VYGA 5IF1B 4CFNB 1PSEA 2JW4A 1WQWA 1H4LD 4JX6A 1Y7XA 3G4ST 3MPUB 2JTMA 4IURA 3VKGA 2F2WA 3OY9A 2CZ7B 5EG2A 5I2SA 4M7AE 4FW2A 4MZTA 3I55A 2HEQA 2WIHB 3H41A 1K0XA 3CCRQ 4YOZA 2XK0A 1EZZB 4PJMA 1YJ9T 4F7UB 2VV5A 4DQ2A 2DRMA 4J7FA 4OMPA 1OEBA 1T3LA 4ORZA 3RR6A 2AKLA 2EGCA 1ENWA 2X35A 3JSCA 1H1PB 4XQ3A 2DLPA 4FYYB 4LDWA 4EMKB 1M30A 2F2XA 4XTVA 3JB9H 2M02A 2OTJQ 2KSSA 2RQVA 1WHHA 4Z02A 4EIKA 3PVLA 4A4FA 2X3XD 1U1TA 2F1LA 2L0AA 1J3TA 2A0FB 3EG0A 1UNGD 3BG5A 1Q81U 1ZSGA 5FU7B 2OAWA 4AKIA 2KAFA 2J6OA 4C8QD 1TU0B 4EC8B 2IW8B 3DTOA 7AT1B 3GIBA 4CXAB 2VVKA 4CFUB 3V8KA 3JCMV 4AFQC 1UDLA 5KYUB 4OB3B 1PD0A 2PK2A 2CYZB 1HK9A 2CP7A 3LQ5B 3U23A 4BE0A 4A4KA 1VQKA 1O9KB 1M9SA 4RTXA 1PSFA 1I0CA 1JU5C 2GF7A 1OV3A 1VQ9Q 2QEXQ 1MNDA 1UHCA 1GCQC 4B6MA 1VQNQ 1DJ7B 2DTHA 4M78F 6AT1B 2IVWA 2DXCA 2C5XB 1QWEA 4FYXB 1SHFA 1RAHB 3RUXA 4ROCA 3I5SA 4A4EA 2LJ1A 2K4YA 4LOCA 3ZEHA 4OVAA 3UPUA 3EG9A 2FVUA 3JCMe 3QWYA 2D8JA 4C92G 1UTIA 3QYGB 2L2PA 1M90U 1FMWA 2L5QA 2LC4A 1NBEB 2EYQA 3NMZC 5L8RE 1G3TA 2A7YA 1YIJT 1AZEA 3EHRA 5IAYA 3G71T 4ATOA 3BE3A 2YXYA 3FIFA 4M78E 4E7ZA 5GAOm 1K9MU 3EH1A 2GNCA 4HCZA 4NSTB 4J9EA 1MGQA 3OW2S 4J5YA 2D6FA 2V22B 1LOJA 1Q82C 3JCMh 1PC0A 1ZHIA 2VASA 2FO0A 3A1PA 4N0AA 1M1GA 5J26A 4LD6A 5GAN8 1URCB 4BCOB 5IHKA 2M16A 5D7UA 2R5MA 1F1BB 1FMKA 3E2UA 2COYA 3EHQA 2BS3A 4CFXB 1D1CA 1VOMA 1VQNA 2SRCA 1M3AA 4FCYA 4CFVB 2I2LA 2KT8A 2M1HA 1Y57A 3GF5A 2KRMA 4X34A 5D6WA 3BLRB 2BPMB 3MP8A 3GBQA 1K9MC 2UZBB 3INZA 3EG1A 3P8DA 2K5FA 4LN2A 2JT4A 2O4XB 4DA4A 3OYJA 3CMAA 1RAIB 2XIDA 4BCMB 4MDXA 2QG9B 2ATCB 2L3RA 5KE2A 3UATA 1H26B 1PCXA 1ARKA 2ZPGB 1SRLA 4TVRA 4IUVA 5GAN7 2RJCA 3M5AA 1W2BP 1H3ZA 1QP2A 4HNTA 3GLXA 5DM7R 1P92A 4C0GA 3A8GB 2KT1A 3RKYA 1E6HA 4EOLB 2DILA 1C0MA 1MNEA 1IGQA 4ZGJB 2EYZA 3A8MB 2R7GA 2WACA 1ZP2A 3GPLA 1VA7A 2QQRA 5D6YA 5CEIB 2QI2A 3BY7A 4C5EA 3OYFA 2J05A 3HFOA 3NTHA 5FWCA 3V7SA 1VQ4A 3VYGB 4OB1B 5CR2A 1QVPA 1H8KA 3MO8A 3CCMQ 3MIAB 2RI2A 3CMEA 4ZN3A 3V7RA 3BLQB 3HRSA 3OS1A 5LJ5d 2NYSA 2CGHA 4RMOA 5GJVB 4CC2A 1UJ0A 3CCLA 3DL1A 3DLMA 5KYNA 2AZSA 3CC4T 1GXIE 3A8LB 1ZX6A 1KIKA 1OKWB 2MAMA 5FLXE 4M75B 1S1NA 2XD0A 5GAMd 2CSQA 4N0AC 4BCMD 1I07A 5LQFB 2EVRA 1Q81C 3TU4K 3M53A 2O9VA 2PJQA 2H3EB 2E6ZA 2QQSA 4M75G 2YRDA 2DD4B 1Q82R 2KRNA 1I5LA 3DOGB 1K8AR 2EFIA 4DBQA 1U8RA 5I22A 3RGFB 2RK1A 2ZZDA 4EOPB 1YHQT 1VIEA 4RTWA 4CI0C 3CCSQ 5J39A 4Y72B 2EQUA 1FMVA 3JCMg 2K9GA 2I0NA 5IDPB 1TUGB 1ZQ1A 4PLLA 4KGVB 4J83A 1VQKQ 3F70A 3KBGA 2RN8A 4FL6A 3E9FA 2QDYB 3BLHB 4FYVB 3G6ET 4EOKB 2FYKA 1I5OB 3M59A 4Z88A 1M3CA 2HL3A 1Y96A 2BKZB 4KT0E 1X2QA 2B86A 2PVDB 3E9GA 4UN0A 1OQKA 3BFMA 1VQ6T 4BY6C 4AG1C 2DXCB 3KHIA 3EIDB 2DJZA 1WHKA 3R6OA 3EJ1B 2F69A 1M90C 2DBKA 4QQGA 1R0CB 2UUEB 1VQMT 3CC2A 1WI7A 4PKCC 3FEOA 1BI1A 1UGVA 2ROTA 2K5IA 1NLPC 4M77F 2KMGA 3B57A 2RQUA 3ZBDA 2XICA 2P4RA 1QCOA 2CSIA 1Q95G 2QDLA 4X9DA 3G4SQ 3NTKA 3HRUA 3CCJQ 2EJFA 2JTEA 2LX9A 3I35A 3OYBA 4ZTJA 4EOIB 1M3BA 5KYUA 3CPWS 1QCFA 3CCRA 3M54A 4DOWA 4Z6YA 5CQXA 2ZCFB 3POMA 3DB3A 1G5VA 5GMKl 3QO3A 3CCVQ 1MV3A 3OYHA 1YJ9Q 3PO3S 4BUGA 4IUPA 1M90R 3DLLA 1OU9A 8AT1B 1JO8A 4C8QF 5FW9A 5KYWA 1Q86R 5GANj 5FU6C 3BG9A 1YBYA 3RKWA 5GAN6 4M4ZA 3VS0A 4BCPB 2G3RA 2KYMA 3C4SA 1FYNA 4E7LA 1TWBA 3JCMd 3OS0A 2LZ6B 3QZ9B 3TQ7P 1QKXA 4C8QB 5CO7A 1VQ7A 1Y71A 1W1FA 3OYDA 2DX1A 3M58A 3M9QA 4PNOA 5LJ5e 3JB9I 3HSBA 2ED0A 2P84A 4J9DA 4M75E 4IUQA 2RHZA 2CCIB 2E70A 1IHVA 3NGPA 4ZGEB 2R58A 1KC8U 2ZPEB 3L2QA 3CCUQ 1AD5A 3MKDA 1A0NB 2RI5A 1X01A 2RD1A 5GAMe 5EFQB 2ROLA 4PJOG 4ZTFA 1YITA 4M7AD 3EGXB 1V76A 1XOVA 2MK5A 1X43A 2MCNA 4HNUA 2QQ8A 2DZ9A 2GQIA 5GAMg 2YUQA 2O9SA 3RERA 1WJSA 3CXCA 2COZA 3DKMA 1CSKA 4C8QE 2DPPB 2RJFA 2CP5A 1AEYA 4EOSB 4HVWA 1WJQA 1VYUA 3SD4A 5IH2A 2NUPB 2E6NA 2IW9B 3I5RA 2FPDA 4E47A 4KH0B 4HCKA 4BBSM 2JNGA 2W2HA 1QVGS 3PNWC 2ZAEA 4NOYA 4KUDK 5FRMA 2DXBA 5LJ5f 3CC4Q 3CBMA 1P5EB 2CH4A 3EGUA 3OYCA 1WZOA 1B7TA 1HXDA 1K0SA 1X6OA 4OMFB 3J81E 1I4K1 2HMAA 2ZPHB 2EJ9A 4LDVA 1LJOA 2LX7A 5KYYB 5GAOp 3MP1A 1JJ2S 1VQOT 4JUVA 1TS9A 2WMAB 4RTVA 2QQBA 4M78B 1EX4A 1X2KA 1NM7A 1RUWA 3CD6T 1BCOA 3R6NA 3OA6A 3QIIA 4OGRB 4FT4A 1WLPB 5CYIB 1OGUB 4BDYA 2F5KA 2HNIA 5GANg 1XJWB 2QTVA 2EQIA 3OSVA 1YITT 1Z9QA 4QVCA 1QMCA 4C0DB 4N4HA 5HBEB 3VUZA 1OPKA 1YN8A 2YLCA 2OI3A 2A08A 3KXTA 2W9FA 2LJ3A 5IN1A 4BCQB 2DJQA 5HK0A 2RPNA 1ZUUA 4MMKA 5I5ZB 2R5AA 4BB7A 1BB9A 2KY9A 1N8RR 2MIOA 3OSSC 3I56T 2H3JA 3OMCA 1O9SA 4CFUD 4WTOB 1VQ7T 3CMAQ 2W0ZA 3QXEB 4BI4A 4M7AF 2E65A 4XAXB 2W10A 5FU6B 1D3UB 4AKHA 3QJ6A 2VB6A 3RMQA 2MWOA 2E3HA 2E5QA 3EAEA 5GANe 1H3HA 2VKNA 3CCET 2XDBA 3OYKA 3H8ZA 2I53A 5GAMj 4PJOB 1N8RU 3ASKA 5HCKA 5KH6A 2HBWA 3X20B 3GOXA 4BCND 2W96A 4Y92A 1MMDA 4BCKB 1KQSA 3JB9D 2NUTA 3HRTA 3CBOA 4F6SB 4YOSA 4J9CA 4F7SB 4PJNA 2VGNA 2JUFA 1Q86U 1YJNT 4I3ZB 1SHGA 3QSUA 4PFZA 4OMQA 3CCMT 3JRZA 2KDSA 1NLOC 2DMOA 1X6BA 2DIGA 2J06A 3H4CA 3CC2Q 4AI6A 4RODA 4C5IA 1M1KU 1GBRA 3LWIA 3FJ5A 3CC2T 3VS5A 4EOQB 1K76A 4M7AA 4BY1X 4ELJA 4ESRA 5IDNB 1OU8A 4GY5A 4WCIA 3NFCA 1VQ6A 2EIFA 4MZPA 4QVDA 4Y28E 4C8QC 2FZCB 5LJ3h 4AFZC 1NEBA 4F70B 1QLYA 1UFFA 1K8AC 1XTDA 4JX5A 5LJ5h 1KXUA 2PUKB 4OMOA 4R56A 3J80E 1AOJA 9ATCB 3F5XB 1OYXA 2FRYA 1WIEA 3BDLA 2HSPA 5GAOq 1W6XA 3G6EA 4FIBA 2CP2A 3MY5B 3HFNA 1F5QB 4B9XA 3ZFJA 1QVGP 4D8DA 4R55A 3M0QA 2YUNA 1YCYA 3TEEA 1MUZA 2C0OA 2FPFA 3DDPB 3V8LA 2RA2A 3TSZA 2DTOA 2ED1A 4TTHA 4PJOC 2VC8A 4JDSA 3JCMP 1VYWB 2G77A 5LJ5j 1M5Q1 4JJCA 1TSFA 2BTTA 5KYXB 1N8RC 2AT1B 5CVIA 3OYGA 1G3SA 2MPXC 4HCBA 4J6WA 4CC4B 5L2WB 4J9HA 2Y4YA 2X4WA 2L3PA 2K6DA 1AWOA 4F7UG 3LYIA 2IVXA 1RAFB 2FRWA 2HD0A 3H6ZA 2FHDA 2P0PA 2XMFA 2O31A 3CPFA 5HK3A 2LCCA 1H25B 3DB4A 1IRXA 3S3OA 5LL6S 3EG2A 1XQHA 2MF2A 3CC4A 2DZCA 1FVVB 3CCLT 3HTRA 3QDFA 3G1JA 5CKDA 3VS6A 4L5GA 1VQLQ 2X3WD 4G6LB 2JOYA 4J9BA 3UF4A 3TW6A 1OZ3A 4M77E 3VJPA 3MCAB 3CMET 5CKFA 2RHIA 2K7AA 2W9ZA 2DF6A 4O6JA 3TN8B 1IO6A 4C0ZA 1PM3A 2BIVA 4F14A 5GANh 2BS2A 2C5NB 1JEGA 3N5BB 4M6VA 3P8HA 1VQ5T 2PMIB 4PK4A 3LH5A 2W99A 3QZ5B 1UECA 5GAN4 2QASA 2VWFA 4OP0A 3JB9J 4FX3B 4BACA 1NYFA 2ABLA 1ZSZA 3M55A 1D1AA 4PJLA 3RKXA 2A3LA 5I11A 4ANJA 2WSCE 4CFWB 5BNJB 3C94A 1UGPB 3CMAT 1EIFA 3ME9A 1JQQA 4LUDA 2L89A 2EGEA 2KMTA 2QGGA 1AWXA 2CH4W 1QWFA 2DVEA 4VUBA 3E19A 1G3NC 1N5ZA 2D9TA 1VQNT 4J6YA 1X6GA 3SB2A 4J8OA 1PD1A 3SWNC 5ICPB 2SEMA 1VYTA 5KYYA 1YWOA 1QQJA 2JMCA 3A98A 1YP5A 4BY6B 3L42A 1BCMA 1M4ZA 4HVUA 4M78D 4M78C 3X24B 1AVZC 1TOVA 2DL3A 1T0JA 2OAUA 3FDRA 2EW3A 1ZA1B 2RQWA 4M75C 2DEQA 2C5OB 4PFPA 1JRIA 3OYNA 2FG0A 4FW1A 3VRYA 3TSWA 2XG8D 2DXTA 3L1AA 4OMLA 4M7DG 1OL1B 2WSEE 4XK8E 4JS5A 2WHBB 3CEYA 1HYOA 2QTXA 3VRZA 2QGSA 1KD1R 2MYSA 5A0DA 2KNBB 3JCMJ 3MEUA 3V8JA 3EG3A 1K9MR 2J6KA 4AFUC 5LJ3d 2ZZDB 4M75D 4X1VA 2LNVA 3PIOA 2CZ6B 1IZ6A 4QVZA 3PMIA 4HA8A 2G9XB 3G7ZA 2V26A 2YSQA 1U06A 3EGDB 2BS4A 4J6XA 3RESA 4BBRM 5LJ3j 4PLIA 3EG9B 4MMLA 3G6EQ 2QF7A 4A53A 1TUDA 1VQ5Q 2QFZA 4HXJA 1BBZA 4LE9A 3MEVA 3META 1VINA 2PTKA 3D7SB 2RHXA 1OKVB 2LNHB 1KD1C 3OS2A 2WSFE 1TTHB 4C8QA 3WVDB 3QBYA 2O2OA 2QGFB 4JPBW 2EUFA 4HCCA 4ZN1A 1D0ZA 3FB9A 2GGRA 2JVVA 1UHFA 4AFSC 4E7HA 4XU0A 5A0LA 2NLUA 2DK3A 1W70A 2B8AA 3QJYA 2CKKA 1O75A 2RH2A 2KRSA 5KYXA 4NC6A 1KQSS 2DYBA 1ABQA 3PTAA 2MWPA 1KC8R 3NTIA 3CQTA 3BHUB 3HP9A 3MP6A 2YUPA 4QQDA 2HZYA 4OB2B 2H8HA 1VQ5A 1ABOA 1UJYA 2HSEB 1MMAA 2KROA 2GTOA 1PKSA 4CC7A 3PFSA 4PL6A 2FB7A 4AKGA 2NUPA 4A4HA 1UG1A 1PG5B 3VS7A 8ATCB 5LJ3e 3I55T 5J3BA 4BI3A 4IUTA 2E4HA 5IT9E 2BE7D 1QVFP 2LQ8A 1TUCA 3I55Q 4NL3A 4RTTA 1GL5A 1PRLC 2JM8A 4QT7A 1KC8C 1Y0MA 3G4SA
chains in the Genus database with same CATH topology
1BI2A 1KQ1A 4Z02A 1OZ2A 1GXIE 3CD6T 4A4FA 1E7PA 2DTIA 3OA6A 1NPRA 3QIIA 3CCVT 1U1TA 5DLQE 4EMHA 4FT4A 1Y96B 4M7DF 3L2WA 3FRNA 3BG5A 2V8KA 4BD3A 1Q81U 4C92C 4BDYA 2F5KA 2HNIA 5FU7B 5GANg 3RIRA 3CCST 3OSVA 2VXEA 4M7DA 1VQ4T 4L59A 1YITT 4AKIA 3L2ZA 4QVCA 2JN0A 2KAFA 2PVGB 1NPPA 4C8QD 4DOVA 3CCUA 2E10A 4M75A 4C0DB 4N4HA 4RCCA 3VUZA 2BUDA 2YLCA 3GIBA 2EQJA 2DAQA 3V8KA 2EWNA 3JCMb 3KXTA 2RB6A 3JCMV 5CKHA 4OB3B 5IN1A 5HK0A 5CKBA 2VGMA 2CYZB 1JJ2A 1HK9A 4MMKA 2R5AA 4BB7A 4BE0A 4A4KA 2KY9A 1VQKA 3OSSC 1M9SA 3I56T 1QW1A 2H3JA 3OMCA 3JCMc 1O9SA 1PSFA 2HQXA 2GF7A 3C95A 1VQ7T 3OQ5A 4XU2A 3QXEB 4BI4A 4M7AF 2E65A 4F7UE 4IUUA 3QYEA 4EPCA 5GMKh 4XAXB 3JAME 1DJ7B 2DTHA 5FU6B 4M78F 5KE3A 2E1HA 4AKHA 5GAOn 3QJ6A 2OTJA 2IVWA 3RMQA 2DXCA 2MWOA 3S6WA 2E5QA 4LD9K 3EAEA 3URGA 4OB0B 4WF2A 3GNFB 3JCMW 3OYAA 5GANe 3CCET 2EJGA 2XDBA 4GLKA 3OYKA 5D6XA 4JLGA 3LH0A 3H8ZA 4HLQA 3CBPA 3RUXA 1WPYA 5GAMj 4PJOB 1SSFA 1QLBA 2P0QA 3ASKA 2ZPBB 4A4EA 2K4YA 1N8RU 5KH6A 2XU8A 3LWHA 4LOCA 3X20B 3GOXA 3ZEHA 4OVAA 3UPUA 2FVUA 3JCMe 2QA4T 1X75C 2CS7A 4C92G 4BDZA 1KQSA 3JB9D 3GP8A 4KULA 3QYGB 3M56A 1M90U 4C5GA 3CCJT 3HRTA 2L5QA 3CBOA 3P8BB 4MDWA 4N4GA 3WXMB 3OYIA 5I21A 2LC4A 5C0MA 2EYQA 3CC7A 4M7DC 3OBYA 1W2BA 5L8RE 1G3TA 1KHCA 2VGNA 2JUFA 2X4JA 4II1A 4C0FA 2A7YA 3PIPA 1YIJT 1Q86U 1NJIC 4OGEA 5IAYA 4QW2A 3G71T 1YJNT 4ATOA 3QSUA 3PMTA 4QSHA 4Y91A 4C92D 3CCMT 3JRZA 2KDSA 3FIFA 4M78E 2HQEA 4M77D 4JRQA 4M77B 2DIGA 2P4TA 5GAOm 4XTUA 1VQPA 1K9MU 3H4CA 4HCZA 3FLGA 4HT9A 3SFMA 4AI6A 1MGQA 3OW2S 3TW7A 4J5YA 2D6FA 1LOJA 4OGCA 3SDZA 1VQLA 4C5IA 3G4SA 1Q82C 1M1KU 1K8AU 4V2SA 3LWIA 2KK4A 3CCMA 3S3NA 3CC2T 3JCMh 3EFSA 1ZHIA 3QKJA 3G71A 1YJNA 5FRNA 4M7AA 2DXUA 1YIJA 3A8OB 4N0AA 5EJCA 2D0QB 4ELJA 4B9WA 1M1GA 5J26A 2CZ0B 4LD6A 5GAN8 2M16A 2KR6A 2R57A 4GY5A 2R5MA 5GMKi 3NFCA 1NE8A 2GCXA 1S72T 1VQ6A 2X4YA 2EIFA 2BS3A 4MZPA 4QVDA 4Y28E 3UWNA 4C8QC 5DLOA 5GANf 3CCQA 4ME7A 1VQNA 3HB9A 2GFUA 5LJ3h 5CCAA 2ZPFB 2DD5B 1YI2T 1FKMA 4JX5A 1XTDA 5LJ5h 2PUKB 3J80E 4R56A 1K8AC 1M1KC 2YHTA 2I2LA 2M1HA 1OYXA 3UT1A 3GF5A 4X34A 5D6WA 4C0DC 4C92F 3BDLA 5GAOq 3MP8A 1K9MC 3G6EA 4FIBA 3INZA 3P8DA 2K5FA 2EKOA 5CK9A 3HFNA 3CCEA 2O4XB 4B9XA 2DO3A 3ZFJA 4A54A 5C6SA 4DA4A 3OYJA 3CMAA 4R55A 5CQYA 1YCYA 1I8FA 2XIDA 2QQBA 3TEEA 1Q86C 4MDXA 3OMGA 1VQ8A 2L3RA 2YLBA 5KE2A 4JS4A 3OW2A 4C92B 2KQWA 3V8LA 1KG1A 2ZPGB 4MIMA 2RA2A 4IUVA 4TVRA 4MFEA 5GAN7 1BI3A 3A8HB 2RJCA 1N27A 2XDPA 3C12A 3M5AA 2DTOA 4FU6A 4IKFA 4KUIA 1H3ZA 1QP2A 4HNTA 3GLXA 4PJOC 2PVOB 2VC8A 3T9NA 5DM7R 4JDSA 3JCMP 3QPHA 3I56A 1P92A 4C0GA 3A8GB 2XKOC 2G77A 5LJ5j 4CRIA 1M5Q1 1W2BS 1VQKT 5GAN5 3RKYA 4F7UA 2E41A 1N8RC 4A4GA 2O01E 5CVIA 3OYGA 2LT1A 4ZGJB 1G3SA 3A8MB 2WACA 3BDUA 5AYFA 3GPLA 4ZGDB 2QQRA 5D6YA 4HCBA 4J6WA 2QEXT 1WJRA 3VKIA 4M75F 2QI2A 2M9UA 3BY7A 4C5EA 2Y4YA 2X4WA 3OYFA 3HFOA 3NTHA 2L8DA 3V7SA 4F7UG 3LYIA 2X4XA 1VQ4A 5GAN2 4N4IA 2LDMA 3VYGB 2RJEA 4JRIA 5HY6A 2HD0A 4OB1B 5CIUA 5CR2A 1QVPA 5GANd 3H6ZA 2FHDA 2P0PA 3J7AF 2XI9A 3MO8A 1UB4A 2RI2A 3CPFA 4ZN3A 5I2MA 3V7RA 5HK3A 3CMEA 2LCCA 3HRSA 3DB4A 1AHJB 2K2VA 3EFRA 3S3OA 5GAOr 5LL6S 4M7DD 4L6V5 1XQHA 2MF2A 3OS1A 5LJ5d 1JB0E 1YJWA 3BG3A 2DZCA 2P0KA 3CC4A 3CD6A 2CGHA 4RMOA 3CCLT 4O5VA 5GMKe 5CKDA 5GAN3 4JX4A 3CCLA 4L5GA 3DL1A 3HZJA 3DLMA 2JOYA 4D6WA 5A2QE 3CC4T 1YJWT 3A8LB 3RMSA 3OB9A 1VQOA 3TW6A 1OZ3A 4M77E 5CAIA 4JRPA 2MAMA 2RHUA 5FLXE 5GAMf 2AHJB 4FM4B 1G3WA 2IG0A 4M75B 3VJPA 2XD0A 3UDCA 5GAMd 3MCAB 4N0AC 3CMET 5CKFA 1BIBA 3SWNA 4M7AC 4ELYC 1D3BB 4UC4A 1Q81C 3QWLA 2RHIA 3GNGA 4O6JA 4C0ZA 1N9SA 3TU4K 1R8OB 3M53A 4XTZA 4E7KA 2GQVA 4OF1A 1YJ9A 3MHXA 3QHSA 2BIVA 4RG8A 2ZGWA 5GANh 3VKHA 2BS2A 3VUBA 3N5BB 2QEXA 1KQ2A 4M6VA 3P8HA 3HKSA 2DKGA 5GMKm 3PT9A 1VQ5T 2E6ZA 4P5NA 4J7IA 3SWNB 2QQSA 4M75G 2K3YA 2DD4B 1I5LA 4M7DB 1RL2A 2LT4A 2RJDA 4F7UF 3OYMA 1ZBXA 2E12A 2V8JA 4JRKA 4M77G 4MZMA 3QZ5B 5GAN4 2EFIA 1UGQB 3LW5E 1U8RA 2QQ9A 2RK1A 2ZZDA 1K73C 1YHQT 1NZ9A 1VIEA 3HHTB 3M4GA 4OP0A 3JB9J 4XTXA 1M8VA 3X25B 4CI0C 2MI6A 5J39A 5GAMh 2QQAA 4BACA 2EQUA 3JB9F 3X28B 2EQMA 3M55A 3JCMg 4RKUE 3RKXA 5FU7C 2A3LA 2K57A 2BKDN 2MMPA 1ZQ1A 1VQ8T 2WSCE 4PLLA 4J83A 4HT8A 3OYLA 4QQ6A 2HBPA 3F70A 4PJOD 3KBGA 3C94A 1UGPB 2RM4A 4FL6A 1I81A 3CMAT 1EIFA 3ME9A 3MEAA 2L89A 2QDYB 2KMTA 2RHYA 3E9FA 3ER0A 1RI0A 5GMKj 3G6ET 1Q82U 2FL7A 2FYKA 1MHNA 2DVEA 3X26B 2RI3A 3M59A 3E19A 4VUBA 3HBLA 5DY9A 1Y96A 1VQ9T 4KT0E 2PVDB 3QG1A 1YI2A 3E9GA 3OYYA 2Y90A 4C8QG 2LQKA 4ELZC 1B34A 2D9TA 3L2VA 3L2UA 3BFMA 4J6YA 3SB2A 3CCQT 4J8OA 2VXFA 1VQNT 4LDXA 1S72A 1NJIU 4BY6C 1VQ6T 2F5TX 2GFAA 2PQWA 2DXCB 3SWNC 2DD4A 4BE1A 3KHIA 3WVEB 1VIFA 2DJZA 3OYEA 3R6OA 2F69A 1Y07A 1M90C 4BY6B 4JJNK 3L42A 3QYHB 1M4ZA 4QQGA 1QVFS 4M78D 3CC2A 1VQMT 4M78C 3X24B 4PKCC 2RO0A 3KUFA 3FEOA 4BE2A 1BI1A 2DIQA 2K5IA 1VQLT 4M77F 1N6AA 3FJPA 2KMGA 2OAUA 3FDRA 4KBMB 4M75C 1BYMA 3Q1JA 2DEQA 2XICA 3VV0A 3ZBDA 4EMKC 2LVMA 1UGRB 1VQPT 4M7DE 1FWZA 2EAYA 1JRIA 4XTWA 1KD1U 1WGSA 2K5LA 1BI0A 1FX7A 4X9DA 2VUBA 3OYNA 3NTKA 3HRUA 4C92A 1VUBA 2EJFA 2DD5A 2XG8D 4M77A 2QXFA 1Q7YU 2DXTA 3L1AA 2LX9A 3OYBA 4M7DG 1BIAA 4ZTJA 3QYBA 4LDYA 2M0OA 3VU3C 3CC7T 2WSEE 2LRQA 1IREB 3CPWS 3CCRA 3M54A 4PJOF 4DOWA 4XK8E 4Z6YA 4XU3A 4HKEA 5CQXA 3CCJA 4JS5A 4C92E 2ZCFB 2Y4XA 2WJ9A 3CEYA 3DB3A 1G5VA 2QTXA 5GMKl 3QO3A 3S3MA 3QUIA 3CCRT 4XU1A 5A0DA 2JTFA 4YTLA 3OYHA 3AHUA 2QA4A 3JCMJ 4NS5A 5M9OA 3MEUA 5LJ3f 3PGGA 3V8JA 4BUGA 4IUPA 2XDDA 5LJ3d 5KCOA 5LJ3g 2ZZDB 3DLLA 3A5ZB 1WNLA 4M75D 4C8QF 1QP3A 3E1SA 3JCMQ 3CPWA 2LNVA 3QDRB 2VYTA 3PIOA 5GANj 5FU6C 3BG9A 1YBYA 3RKWA 2CZ6B 5GAN6 1IZ6A 4QVZA 4NL2A 2G3RA 2OTJT 3C4SA 3JCMf 3PMIA 4HA8A 4E7LA 2CZ1B 2JZ2A 1G3YA 3G7ZA 3JCMd 1VQMA 3M4YA 2ZPIB 3TCJA 3LX7A 2BS4A 2PU9B 4J6XA 4M78G 3RESA 4BBRM 5CKEA 5LJ3j 3OS0A 2HAXA 3QZ9B 4PLIA 1BKBA 4C8QB 4MMLA 4MFDA 5CO7A 1VQ7A 2QF7A 1Y71A 2PUOB 4RCBA 4A53A 3OYDA 3LGLA 3M58A 2QFZA 3M9QA 4PNOA 1W4SA 5LJ5e 3JB9I 3HSBA 1Q7YC 2XHCA 3MEVA 3HL8A 4M75E 1QVGA 3META 3L2RA 1V29B 4IUQA 1XNIA 4HL4A 2E70A 2RHZA 2V8IA 4LDUA 3OBWA 1M1FA 2RHXA 4ZGEB 2R58A 3LLRA 4FT2A 1KC8U 1JBMA 1B34B 5GAOl 1KD1C 4E7IA 2ZPEB 3OS2A 3L2QA 1VQ9A 2WSFE 3HO8A 4C8QA 3WVDB 3QBYA 1H641 1KHIA 2RI5A 1X01A 4HCCA 2RD1A 4HNVA 5GAMe 2LCLA 4ZN1A 3O8VA 1U1SA 4PJOG 1LNXA 3FB9A 2K3XA 4X9CA 2KVQG 3CCUT 2JVVA 4ZTFA 1OI1A 5A0GA 1YITA 1XOVA 4M7AD 4E7HA 4XU0A 5A0LA 2NLUA 3CCSA 2DK3A 4HNUA 2QQ8A 2DZ9A 1FXXA 1N9RA 4FSXA 4JLIA 2YRVA 1TH7A 3OS5A 4RG2A 5HKCA 2B8AA 4BI8B 5GAMg 3VYHB 3QJYA 3RERA 2CKKA 1O75A 1WJSA 2E64A 2RH2A 3CXCA 3CCVA 3JB9G 3DKMA 4C8QE 4PJOA 4C5HA 4E7JA 3FC3A 4NC6A 2C06A 1KQSS 2DPPB 3VYGA 5FROA 3PTAA 1PSEA 2MWPA 1WQWA 2RJFA 3NTIA 2RK2A 2O4XA 1YHQA 4JX6A 1Y7XA 2DXBB 4EDUA 4EMGA 3G4ST 3HP9A 1WJQA 3M57A 2OTLT 5LJ5g 3SD4A 1QVFA 2JTMA 3CXCS 4IURA 3VKGA 3MP6A 2E6NA 4M77C 4M7AB 3MEWA 2CZ7B 4QQDA 5EG2A 2QDJA 3OY9A 4E47A 5I2SA 4M7AE 4OB2B 4BBSM 2JNGA 1VQ5A 4MZTA 3I55A 4XTYA 1QVGS 3PNWC 3JCMX 4EMKA 4NOYA 4KUDK 5FRMA 2DXBA 5LJ5f 2XK0A 3PFSA 4PL6A 3CBMA 2LTOA 5KCHA 2FB7A 3OYCA 4AKGA 1YJ9T 4A4HA 4F7UB 2VV5A 1HXDA 4Q5WA 4M78A 4DQ2A 1X6OA 4J7FA 4OMFB 3LGFA 3J81E 1I4K1 2ZPHB 2EJ9A 4LDVA 4M7AG 5LJ3e 2X35A 1LJOA 3JSCA 3I55T 5J3BA 3TREA 4XQ3A 4BI3A 4IUTA 1K73U 5IT9E 2EQKA 3MP1A 5GAOp 4LDWA 4EMKB 2LQ8A 1VQOT 1JJ2S 1WQ7A 4JUVA 4XTVA 3JB9H 4NL3A 4PJOE 3HPWA 2KSSA 2OTLA 3BW1A 1UGSB 1KC8C 1UEBA 1D3BA 4M78B 3V7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0Q B;  1QP3 A;  2CZ0 B;  4Y28 E;  2CZ6 B;  2DD4 B;  2ZPF B;  2DD5 B;  2PUK B;  2CZ1 B;  3QZ5 B;  2ZPI B;  1UGQ B;  3LW5 E;  2PU9 B;  2ZZD A;  3QZ9 B;  2PVG B;  3HHT B;  3X25 B;  2PUO B;  3X28 B;  4RKU E;  4OB3 B;  1V29 B;  2WSC E;  2CYZ B;  4ZGE B;  1UGP B;  2ZPE B;  2ZPG B;  2WSF E;  2QDY B;  1PSF A;  3A8H B;  3WVD B;  1QP2 A;  2PVO B;  3QXE B;  3X26 B;  1DJ7 B;  3A8G B;  4KT0 E;  2PVD B;  2DXC A;  3VYH B;  2O01 E;  4OB0 B;  4ZGJ B;  3A8M B;  2DXC B;  4ZGD B;  2DD4 A;  2DPP B;  3WVE B;  3VYG A;  1PSE A;  2ZPB B;  2DXB B;  3QYH B;  3X20 B;  3VYG B;  4OB1 B;  3X24 B;  2CZ7 B;  4OB2 B;  3QYG B;  1AHJ B;  1UGR B;  4L6V 5;  1JB0 E;  2DXB A;  5L8R E;  2DD5 A;  1GXI E;  3A8L B;  2WSE E;  1IRE B;  2ZPH B;  4XK8 E;  2AHJ B;  4FM4 B;  2ZCF B;  1UGS B;  3A8O B;  2ZZD B; 
#chains in the Genus database with same CATH topology
 1BI2 A;  1OZ2 A;  2C0I A;  1E7P A;  3K7A M;  2DTI A;  1NPR A;  1QCN A;  3OW2 P;  1CKB A;  5DLQ E;  2FEI A;  4EMH A;  4BXX X;  1M1K R;  4M7D F;  3L2W A;  3FRN A;  2V8K A;  4BD3 A;  4C92 C;  1FIN B;  2EBP A;  2VXE A;  4F16 A;  1AIS B;  2PVG B;  1NPP A;  2ESW A;  3M03 A;  5L23 A;  3EGX A;  2EWN A;  2PZ1 A;  5CKB A;  2VGM A;  3O5Z A;  1JJ2 A;  2DET A;  3C95 A;  1RLP C;  3DJB A;  2YWW A;  4F7U E;  1YFN A;  5GMK h;  1SEM A;  2E1H A;  2OTL Q;  2C0T A;  2JJ9 A;  1JJ2 P;  2OJ2 A;  1IB8 A;  2CT4 A;  4Z8A A;  5IXB A;  4OB0 B;  4WF2 A;  3GNF B;  2HDA A;  2EJG A;  2E5K A;  4GLK A;  5D6X A;  3LH0 A;  2FZG B;  3TNI B;  1WPY A;  1SSF A;  2ZPB B;  1YNZ A;  1OPL A;  2YDL A;  2CS7 A;  2EGA A;  3GP8 A;  4KUL A;  3M56 A;  2KGT A;  2J6F A;  4N4G A;  5IHY A;  5I21 A;  5ECA A;  5C0M A;  4M7D C;  1MV0 B;  2RQT A;  1VQO Q;  1W2B A;  2X4J A;  4II1 A;  4C0F A;  1NJI C;  4BCF B;  4IIM A;  4OGE A;  4JJD A;  4QW2 A;  1WXT A;  5LMK B;  4QSH A;  3MY1 B;  2ECZ A;  1YIJ Q;  2HQE A;  4JRQ A;  1NEG A;  2P4T A;  4M77 B;  1VQP A;  4XTU A;  2CP3 A;  3TW7 A;  4BCG B;  3SDZ A;  4V2S A;  2KK4 A;  3CCM A;  1GRI A;  2D1X A;  3QKJ A;  1YJN A;  1T3S A;  5FRN A;  1ZUK A;  2DXU A;  5EJC A;  2CZ0 B;  1YIT Q;  3IQL A;  4J9G A;  2M51 A;  5GMK i;  3UA6 A;  1GCP A;  3GTM S;  1NE8 A;  1D0Y A;  3CME Q;  4AG2 C;  1S72 T;  5GAN f;  5DLO A;  3UWN A;  2KEA A;  3REB B;  4ME7 A;  3HB9 A;  2GFU A;  2ZPF B;  2DD5 B;  1YI2 T;  1FKM A;  2YT6 A;  2X51 A;  1XO2 A;  1NJI R;  3PVQ A;  4EOR B;  1E7O A;  2CP6 A;  4C92 F;  1YI2 Q;  2RNA A;  4KRD B;  5CK9 A;  3CCE A;  5FGK B;  1IXD A;  2DO3 A;  5C6S A;  1HJD A;  3ZL7 C;  1I8F A;  1D09 B;  1NG2 A;  2IIM A;  3OMG A;  4JS4 A;  3OW2 A;  3THK A;  4MIM A;  1UE9 A;  4MFE A;  1BI3 A;  3A8H B;  2XDP A;  2JM9 A;  4KUI A;  4OR5 B;  1SPK A;  2E3I A;  2DEU A;  3T9N A;  3I56 A;  2XKO C;  1H28 B;  4CRI A;  4F7U A;  2QA4 Q;  3QHW B;  1YCS B;  2E41 A;  2O01 E;  1RAE B;  3BDU A;  2DNU A;  2RQR A;  2QEX T;  2JXB A;  1WJR A;  4M75 F;  1KK7 A;  3H0H A;  4HVV A;  1WHL A;  4N4I A;  2LDM A;  2RJE A;  5CIU A;  1YJN Q;  3J7A F;  2K3B A;  2KR3 A;  4LXC A;  5I2M A;  1GUX A;  1AHJ B;  1GY3 B;  2K2V A;  3UA7 A;  5GAO r;  1YJW A;  3CD6 A;  3BG3 A;  2P0K A;  1QMZ B;  4O5V A;  1UUE A;  1G2B A;  4A63 B;  4AT1 B;  1HD3 A;  3HZJ A;  3EGD A;  4D6W A;  2B9R A;  5HBJ B;  3RMS A;  3OB9 A;  1VQO A;  5CAI A;  2AHJ B;  4FM4 B;  2IG0 A;  1VQP Q;  3UDC A;  1BIB A;  3SWN A;  4M7A C;  2DE0 X;  3GNG A;  3MI9 B;  1C9B A;  2PHG A;  2I40 B;  1R8O B;  4XTZ A;  4E7K A;  2GQV A;  4OF1 A;  1R77 A;  4RG8 A;  2ZGW A;  2DL7 A;  3VKH A;  1PRM C;  1KQ2 A;  5GMK m;  3HKS A;  2DKG A;  3PT9 A;  4J7I A;  1TXQ A;  3KFV A;  2LT4 A;  3VS4 A;  1YHQ Q;  3OYM A;  4MZM A;  4M77 G;  2LCS A;  1UGQ B;  3LW5 E;  1QKW A;  2J7I A;  3M4G A;  1M8V A;  3X25 B;  2MI6 A;  1AT1 B;  2QQA A;  1OUL A;  2CDT A;  3X28 B;  2EQM A;  4KH1 B;  2BKD N;  5ACB A;  1VQ8 T;  3TVT A;  4KGX B;  4CRL B;  4QQ6 A;  4PJO D;  2RM4 A;  1I81 A;  5GMK j;  1Q82 U;  2UZE B;  1RI0 A;  3ER0 A;  4IMY B;  2FL7 A;  1G8X A;  1MHN A;  2RI3 A;  1M8M A;  3I56 Q;  2DA9 A;  1GBQ A;  1RAD B;  3CCQ Q;  1GH6 B;  1WHG A;  1H27 B;  1D1B A;  4C8Q G;  1B34 A;  3RDV A;  1C1A A;  3CCQ T;  1HSQ A;  3EFO B;  4LDX A;  1NJI U;  2GFA A;  2DL8 A;  1VYV A;  4BE1 A;  1JST B;  2CUB A;  2K79 A;  3OYE A;  1Y07 A;  3CCE Q;  2K2M A;  4JJN K;  2AZV A;  2DIQ A;  1VQL T;  2KYB A;  1O9K A;  1N6A A;  3VS1 A;  1ZUY A;  1BYM A;  3Q1J A;  4EMK C;  3VV0 A;  5HVY B;  2LVM A;  1UGR B;  2L3S A;  1FWZ A;  2UZL B;  2EAY A;  1KD1 U;  1BI0 A;  1FX7 A;  2VUB A;  1K1Z A;  3CC7 Q;  4C92 A;  2D8H A;  1VUB A;  2X1N B;  3G33 B;  4M77 A;  3TNW B;  2QXF A;  1Q7Y U;  1BIA A;  3CC7 T;  1WHJ A;  2LRQ A;  1IRE B;  2PK9 B;  4PJO F;  4XU3 A;  3CCJ A;  4J9I A;  4C92 E;  4CFM B;  3CXC P;  3QUI A;  3CCR T;  2WXV B;  2JTF A;  3AHU A;  2QA4 A;  5M9O A;  1JOW A;  4GBQ A;  5LJ3 f;  3PGG A;  5KCO A;  2FZK B;  5LJ3 g;  1S72 Q;  1WNL A;  1VQ4 Q;  1QP3 A;  4F6U B;  2JS2 A;  1H1S B;  3QDR B;  1H92 A;  2VYT A;  2X9H A;  2OTJ T;  3VS2 A;  2JZ2 A;  1VQM A;  3M4Y A;  2ZPI B;  4JRP A;  3LX7 A;  2PU9 B;  3EH2 A;  1LVK A;  4BCJ B;  2MOX A;  2A28 A;  3LGL A;  2NUT B;  4FSS A;  2DME A;  3HL8 A;  3L2R A;  1V29 B;  2EKH A;  1XNI A;  4HL4 A;  2V8I A;  3OBW A;  4E7S A;  3DDQ B;  3LLR A;  1JBM A;  5GAO l;  4E7I A;  1RAA B;  2AK5 A;  3HO8 A;  3PE0 A;  2GTJ A;  1H64 1;  4HNV A;  3O8V A;  1U1S A;  3CCU T;  4JZ4 A;  3H0F A;  4X9C A;  3CCS A;  3C0C A;  4JLI A;  3MJX A;  1KSW A;  2HKN A;  2YRV A;  1TH7 A;  4RG2 A;  5HKC A;  2DBM A;  2DER A;  2E64 A;  3CCV A;  1RAC B;  4C5H A;  4E7J A;  5FRO A;  4Z89 A;  2RK2 A;  2O4X A;  1YHQ A;  4EDU A;  2DXB B;  4EMG A;  2DFU A;  1MMN A;  3M57 A;  2OTL T;  5LJ5 g;  1QVF A;  1OL2 B;  3CXC S;  4BCH B;  3QWX X;  4M77 C;  1X27 A;  3MEW A;  4M7A B;  1K4U S;  2QDJ A;  1R0B G;  3CPW P;  1B3Q A;  4QKU A;  4XTY A;  2RMO A;  3JCM X;  1JXM A;  4EMK A;  1GUX B;  4F7N B;  2LTO A;  5KCH A;  4Q5W A;  3REA B;  4M78 A;  4YOO A;  3LGF A;  1SSH A;  4CC3 A;  4PJJ A;  4M7A G;  1RAB B;  2KBT A;  3TRE A;  1K73 U;  2EQK A;  5HBH B;  1WQ7 A;  1RLQ C;  3G71 Q;  4PJO E;  3HPW A;  2OTL A;  3BW1 A;  1UGS B;  1UEB A;  1D3B A;  1ZLM A;  3V7C A;  1KQ1 A;  3NPF A;  1OIY B;  2V1R A;  1GCQ A;  1GFD A;  1E9H B;  3AT1 B;  3SEM A;  1JSU B;  3CCV T;  2YRC A;  3CD6 Q;  1Y96 B;  1ZBJ A;  2CT3 A;  4DEY A;  4E2F B;  2COW A;  3RIR A;  3CCS T;  4M7D A;  1VQ4 T;  4L59 A;  3L2Z A;  2JN0 A;  4AMC A;  4F7J B;  3VS3 A;  4DOV A;  3CCU A;  2E10 A;  4M75 A;  1BU2 A;  4RCC A;  1VQ8 Q;  1KFZ A;  2BUD A;  2EQJ A;  1V1C A;  2DAQ A;  3JCM b;  2RB6 A;  4KRC B;  3M0R A;  5CKH A;  1AWJ A;  3BHT B;  1QW1 A;  3JCM c;  2HQX A;  2NUZ A;  2CUD A;  4BY7 X;  4EON B;  3OQ5 A;  4XU2 A;  1PWT A;  1SKU B;  2V1Q A;  4EOO B;  2WPA B;  4IUU A;  3QYE A;  4EPC A;  3JAM E;  4JJB A;  1VQ7 Q;  5KE3 A;  5GAO n;  1LCK A;  2OTJ A;  4LD9 K;  3S6W A;  1OX9 A;  1UNL D;  1WA7 A;  4OMM A;  3URG A;  3JCM W;  3OYA A;  4JLG A;  2DVJ A;  2EYX A;  4HLQ A;  3CBP A;  1PHT A;  1QLB A;  2P0Q A;  2GBQ A;  2LJ0 A;  2XU8 A;  3LWH A;  2F2C A;  4ELL A;  2QA4 T;  1X75 C;  4BCQ D;  4E6R A;  4BDZ A;  1WHM A;  1OOT A;  4C5G A;  3CCJ T;  1ACM B;  3P8B B;  4MDW A;  3WXM B;  2OX7 A;  3OYI A;  1AWW A;  2CCH B;  3CC7 A;  2BZX A;  3OBY A;  1X69 A;  1KHC A;  3PIP A;  1H24 B;  1BU1 A;  1ZSZ B;  2DYI A;  4KRT A;  1M2V B;  1WYX A;  1G83 A;  3PMT A;  4K11 A;  4Y91 A;  4C92 D;  2EPD A;  4M77 D;  2C4G B;  2BZ8 A;  1YWP A;  3FLG A;  4HT9 A;  3SFM A;  1TFB A;  4EOJ B;  4OGC A;  1VQL A;  1K8A U;  2NWM A;  3S3N A;  1AZG B;  4DBH A;  1U3O A;  3EFS A;  1EFN A;  3G71 A;  4GLM A;  3A8O B;  1YIJ A;  3I9Q A;  2D0Q B;  4B9W A;  1K73 R;  1W98 B;  2KXD A;  4PFO A;  4RTZ A;  2KR6 A;  2R57 A;  1RI9 A;  2GCX A;  4F17 A;  1PNJ A;  4EC9 B;  2DL5 A;  2X4Y A;  1GFC A;  3CCQ A;  2A37 A;  1SF9 A;  4ZNX A;  5CCA A;  5IXF A;  1M1K C;  5DQW A;  2O88 A;  2YHT A;  2WFY B;  3NDQ A;  2WEV B;  3M0T A;  1H1Q B;  3UT1 A;  3EFO A;  1PKT A;  4C0D C;  1E6G A;  1AD6 A;  2EKO A;  1SRM A;  4A54 A;  4RTY A;  1OIU B;  5CQY A;  2JMA A;  2YUO A;  1Q86 C;  2M0Y A;  1VQ8 A;  2YLB A;  4C92 B;  2KQW A;  1KG1 A;  4BCN B;  5AT1 B;  3C12 A;  4FU6 A;  1RAG B;  1N27 A;  1UNH D;  3EOC B;  4IKF A;  2C5V B;  2PVO B;  1PKD B;  3H0I A;  5HQ0 B;  3M0P A;  3QPH A;  2QYZ A;  1W2B S;  5FWB A;  1VQK T;  2QK0 A;  3NHN A;  5GAN 5;  4ROE A;  4A4G A;  2LT1 A;  5AYF A;  4ZGD B;  5DQV A;  3VKI A;  2M9U A;  4F04 B;  3BHV B;  2EYW A;  2L8D A;  2X4X A;  2AIR B;  5GAN 2;  4JRI A;  1WXB A;  2JS0 A;  5HY6 A;  1SG5 A;  2QAZ A;  5GAN d;  2PNI A;  1JKW A;  2XI9 A;  4IIO A;  1UB4 A;  5IHI A;  1VQ6 Q;  3CCL Q;  3EFR A;  4M7D D;  4L6V 5;  1JB0 E;  1K9A A;  5GMK e;  1VQM Q;  5IHN A;  5GAN 3;  4JX4 A;  5A2Q E;  2ENM A;  1YJW T;  2RHU A;  5GAM f;  1G3W A;  3QHR B;  2KXC A;  4ELY C;  1D3B B;  4UC4 A;  3QWL A;  1D0X A;  2HCK A;  2HL5 C;  1N9S A;  1YJ9 A;  1OI9 B;  4BCI B;  5HNB B;  3MHX A;  3QHS A;  3VUB A;  2G6F X;  2QEX A;  3JV3 A;  2F2V A;  4P5N A;  2UZD B;  3SWN B;  2K3Y A;  1Q7Y R;  4M7D B;  4RTU A;  1RL2 A;  2RJD A;  4F7U F;  1ZBX A;  2E12 A;  2V8J A;  4JRK A;  2IW6 B;  1LPL A;  2LW4 A;  2QQ9 A;  2DRK A;  1K73 C;  1NZ9 A;  3HHT B;  4F6W B;  4XTX A;  3M0U A;  5GAM h;  3JB9 F;  4RKU E;  2AKK A;  5FU7 C;  2K57 A;  2MMP A;  2JGZ B;  3SHW A;  1WFW A;  4OMN A;  4HT8 A;  3OYL A;  2HBP A;  1C6V X;  4EOM B;  3MEA A;  2RHY A;  1VOL A;  1CKA A;  1N4M A;  1BK2 A;  3X26 B;  3HBL A;  2KE9 A;  5DY9 A;  2RF0 A;  4DBR A;  1VQ9 T;  1T0H A;  1NYG A;  3QG1 A;  1YI2 A;  4RUG A;  3OYY A;  2Y90 A;  2LQK A;  4ELZ C;  3L2V A;  3L2U A;  4YC3 B;  2VXF A;  1S72 A;  2F5T X;  2PQW A;  2DD4 A;  3WVE B;  1VIF A;  3RNJ A;  2LMJ A;  3QYH B;  2EYY A;  3M0S A;  1QVF S;  2C6T B;  3O0G D;  1I1J A;  2RO0 A;  3KUF A;  4BE2 A;  3FJP A;  1ZSZ C;  2D0N A;  4JZ3 A;  1TD6 A;  1M27 C;  4KBM B;  2WIP B;  2DL4 A;  2CP0 A;  2CRE A;  2LP5 A;  4D8K A;  1IGU A;  4R0K A;  1VQP T;  4M7D E;  4XTW A;  4DEX A;  1M2V A;  2FPE A;  1WGS A;  2K5L A;  2DD5 A;  2DM1 A;  3QYB A;  4LDY A;  1WXU A;  2M0O A;  3VU3 C;  2IN3 A;  4HKE A;  2KI7 A;  2A36 A;  2Y4X A;  2WJ9 A;  3S3M A;  4XU1 A;  4KGZ B;  3H9N A;  4YTL A;  1M2O A;  4NS5 A;  2LQN A;  1U5S A;  2L3Q A;  1Q81 R;  1IHW A;  1ZA2 B;  3ULR B;  1Z9Z A;  2XDD A;  3A5Z B;  1YJW Q;  3E1S A;  3JCM Q;  3CPW A;  1MMG A;  1OX8 A;  5GJW B;  4NL2 A;  4FYW B;  3TNH B;  2HQH A;  1JXO A;  3JCM f;  1KJW A;  2CZ1 B;  1G3Y A;  3TCJ A;  1TG0 A;  4M78 G;  5CKE A;  2HAX A;  1BKB A;  4MFD A;  5EC7 A;  1WX6 A;  2IPO B;  4II5 B;  2PUO B;  4RCB A;  2WMB B;  2HKQ B;  1W4S A;  1WDX A;  1Q7Y C;  2XHC A;  1QVG A;  2Z0W A;  1KQS P;  4LDU A;  1M1F A;  4FT2 A;  1B34 B;  2BE9 B;  1VQ9 A;  2LQW A;  1KHI A;  2LCL A;  3RBB B;  1H1R B;  1LNX A;  2K3X A;  2KVQ G;  1OI1 A;  5A0G A;  4LNP A;  4FSX A;  1FXX A;  1N9R A;  4F7L B;  3OS5 A;  1B07 A;  4BI8 B;  3VYH B;  5KYW B;  4PJO A;  3JB9 G;  4LUE A;  2CJM B;  2BZY A;  3FC3 A;  2C06 A;  4DBF A;  4J9F A;  3VYG A;  5IF1 B;  4CFN B;  1PSE A;  2JW4 A;  1WQW A;  1H4L D;  4JX6 A;  1Y7X A;  3G4S T;  3MPU B;  2JTM A;  4IUR A;  3VKG A;  2F2W A;  3OY9 A;  2CZ7 B;  5EG2 A;  5I2S A;  4M7A E;  4FW2 A;  4MZT A;  3I55 A;  2HEQ A;  2WIH B;  3H41 A;  1K0X A;  3CCR Q;  4YOZ A;  2XK0 A;  1EZZ B;  4PJM A;  1YJ9 T;  4F7U B;  2VV5 A;  4DQ2 A;  2DRM A;  4J7F A;  4OMP A;  1OEB A;  1T3L A;  4ORZ A;  3RR6 A;  2AKL A;  2EGC A;  1ENW A;  2X35 A;  3JSC A;  1H1P B;  4XQ3 A;  2DLP A;  4FYY B;  4LDW A;  4EMK B;  1M30 A;  2F2X A;  4XTV A;  3JB9 H;  2M02 A;  2OTJ Q;  2KSS A;  2RQV A;  1WHH A;  4Z02 A;  4EIK A;  3PVL A;  4A4F A;  2X3X D;  1U1T A;  2F1L A;  2L0A A;  1J3T A;  2A0F B;  3EG0 A;  1UNG D;  3BG5 A;  1Q81 U;  1ZSG A;  5FU7 B;  2OAW A;  4AKI A;  2KAF A;  2J6O A;  4C8Q D;  1TU0 B;  4EC8 B;  2IW8 B;  3DTO A;  7AT1 B;  3GIB A;  4CXA B;  2VVK A;  4CFU B;  3V8K A;  3JCM V;  4AFQ C;  1UDL A;  5KYU B;  4OB3 B;  1PD0 A;  2PK2 A;  2CYZ B;  1HK9 A;  2CP7 A;  3LQ5 B;  3U23 A;  4BE0 A;  4A4K A;  1VQK A;  1O9K B;  1M9S A;  4RTX A;  1PSF A;  1I0C A;  1JU5 C;  2GF7 A;  1OV3 A;  1VQ9 Q;  2QEX Q;  1MND A;  1UHC A;  1GCQ C;  4B6M A;  1VQN Q;  1DJ7 B;  2DTH A;  4M78 F;  6AT1 B;  2IVW A;  2DXC A;  2C5X B;  1QWE A;  4FYX B;  1SHF A;  1RAH B;  3RUX A;  4ROC A;  3I5S A;  4A4E A;  2LJ1 A;  2K4Y A;  4LOC A;  3ZEH A;  4OVA A;  3UPU A;  3EG9 A;  2FVU A;  3JCM e;  3QWY A;  2D8J A;  4C92 G;  1UTI A;  3QYG B;  2L2P A;  1M90 U;  1FMW A;  2L5Q A;  2LC4 A;  1NBE B;  2EYQ A;  3NMZ C;  5L8R E;  1G3T A;  2A7Y A;  1YIJ T;  1AZE A;  3EHR A;  5IAY A;  3G71 T;  4ATO A;  3BE3 A;  2YXY A;  3FIF A;  4M78 E;  4E7Z A;  5GAO m;  1K9M U;  3EH1 A;  2GNC A;  4HCZ A;  4NST B;  4J9E A;  1MGQ A;  3OW2 S;  4J5Y A;  2D6F A;  2V22 B;  1LOJ A;  1Q82 C;  3JCM h;  1PC0 A;  1ZHI A;  2VAS A;  2FO0 A;  3A1P A;  4N0A A;  1M1G A;  5J26 A;  4LD6 A;  5GAN 8;  1URC B;  4BCO B;  5IHK A;  2M16 A;  5D7U A;  2R5M A;  1F1B B;  1FMK A;  3E2U A;  2COY A;  3EHQ A;  2BS3 A;  4CFX B;  1D1C A;  1VOM A;  1VQN A;  2SRC A;  1M3A A;  4FCY A;  4CFV B;  2I2L A;  2KT8 A;  2M1H A;  1Y57 A;  3GF5 A;  2KRM A;  4X34 A;  5D6W A;  3BLR B;  2BPM B;  3MP8 A;  3GBQ A;  1K9M C;  2UZB B;  3INZ A;  3EG1 A;  3P8D A;  2K5F A;  4LN2 A;  2JT4 A;  2O4X B;  4DA4 A;  3OYJ A;  3CMA A;  1RAI B;  2XID A;  4BCM B;  4MDX A;  2QG9 B;  2ATC B;  2L3R A;  5KE2 A;  3UAT A;  1H26 B;  1PCX A;  1ARK A;  2ZPG B;  1SRL A;  4TVR A;  4IUV A;  5GAN 7;  2RJC A;  3M5A A;  1W2B P;  1H3Z A;  1QP2 A;  4HNT A;  3GLX A;  5DM7 R;  1P92 A;  4C0G A;  3A8G B;  2KT1 A;  3RKY A;  1E6H A;  4EOL B;  2DIL A;  1C0M A;  1MNE A;  1IGQ A;  4ZGJ B;  2EYZ A;  3A8M B;  2R7G A;  2WAC A;  1ZP2 A;  3GPL A;  1VA7 A;  2QQR A;  5D6Y A;  5CEI B;  2QI2 A;  3BY7 A;  4C5E A;  3OYF A;  2J05 A;  3HFO A;  3NTH A;  5FWC A;  3V7S A;  1VQ4 A;  3VYG B;  4OB1 B;  5CR2 A;  1QVP A;  1H8K A;  3MO8 A;  3CCM Q;  3MIA B;  2RI2 A;  3CME A;  4ZN3 A;  3V7R A;  3BLQ B;  3HRS A;  3OS1 A;  5LJ5 d;  2NYS A;  2CGH A;  4RMO A;  5GJV B;  4CC2 A;  1UJ0 A;  3CCL A;  3DL1 A;  3DLM A;  5KYN A;  2AZS A;  3CC4 T;  1GXI E;  3A8L B;  1ZX6 A;  1KIK A;  1OKW B;  2MAM A;  5FLX E;  4M75 B;  1S1N A;  2XD0 A;  5GAM d;  2CSQ A;  4N0A C;  4BCM D;  1I07 A;  5LQF B;  2EVR A;  1Q81 C;  3TU4 K;  3M53 A;  2O9V A;  2PJQ A;  2H3E B;  2E6Z A;  2QQS A;  4M75 G;  2YRD A;  2DD4 B;  1Q82 R;  2KRN A;  1I5L A;  3DOG B;  1K8A R;  2EFI A;  4DBQ A;  1U8R A;  5I22 A;  3RGF B;  2RK1 A;  2ZZD A;  4EOP B;  1YHQ T;  1VIE A;  4RTW A;  4CI0 C;  3CCS Q;  5J39 A;  4Y72 B;  2EQU A;  1FMV A;  3JCM g;  2K9G A;  2I0N A;  5IDP B;  1TUG B;  1ZQ1 A;  4PLL A;  4KGV B;  4J83 A;  1VQK Q;  3F70 A;  3KBG A;  2RN8 A;  4FL6 A;  3E9F A;  2QDY B;  3BLH B;  4FYV B;  3G6E T;  4EOK B;  2FYK A;  1I5O B;  3M59 A;  4Z88 A;  1M3C A;  2HL3 A;  1Y96 A;  2BKZ B;  4KT0 E;  1X2Q A;  2B86 A;  2PVD B;  3E9G A;  4UN0 A;  1OQK A;  3BFM A;  1VQ6 T;  4BY6 C;  4AG1 C;  2DXC B;  3KHI A;  3EID B;  2DJZ A;  1WHK A;  3R6O A;  3EJ1 B;  2F69 A;  1M90 C;  2DBK A;  4QQG A;  1R0C B;  2UUE B;  1VQM T;  3CC2 A;  1WI7 A;  4PKC C;  3FEO A;  1BI1 A;  1UGV A;  2ROT A;  2K5I A;  1NLP C;  4M77 F;  2KMG A;  3B57 A;  2RQU A;  3ZBD A;  2XIC A;  2P4R A;  1QCO A;  2CSI A;  1Q95 G;  2QDL A;  4X9D A;  3G4S Q;  3NTK A;  3HRU A;  3CCJ Q;  2EJF A;  2JTE A;  2LX9 A;  3I35 A;  3OYB A;  4ZTJ A;  4EOI B;  1M3B A;  5KYU A;  3CPW S;  1QCF A;  3CCR A;  3M54 A;  4DOW A;  4Z6Y A;  5CQX A;  2ZCF B;  3POM A;  3DB3 A;  1G5V A;  5GMK l;  3QO3 A;  3CCV Q;  1MV3 A;  3OYH A;  1YJ9 Q;  3PO3 S;  4BUG A;  4IUP A;  1M90 R;  3DLL A;  1OU9 A;  8AT1 B;  1JO8 A;  4C8Q F;  5FW9 A;  5KYW A;  1Q86 R;  5GAN j;  5FU6 C;  3BG9 A;  1YBY A;  3RKW A;  5GAN 6;  4M4Z A;  3VS0 A;  4BCP B;  2G3R A;  2KYM A;  3C4S A;  1FYN A;  4E7L A;  1TWB A;  3JCM d;  3OS0 A;  2LZ6 B;  3QZ9 B;  3TQ7 P;  1QKX A;  4C8Q B;  5CO7 A;  1VQ7 A;  1Y71 A;  1W1F A;  3OYD A;  2DX1 A;  3M58 A;  3M9Q A;  4PNO A;  5LJ5 e;  3JB9 I;  3HSB A;  2ED0 A;  2P84 A;  4J9D A;  4M75 E;  4IUQ A;  2RHZ A;  2CCI B;  2E70 A;  1IHV A;  3NGP A;  4ZGE B;  2R58 A;  1KC8 U;  2ZPE B;  3L2Q A;  3CCU Q;  1AD5 A;  3MKD A;  1A0N B;  2RI5 A;  1X01 A;  2RD1 A;  5GAM e;  5EFQ B;  2ROL A;  4PJO G;  4ZTF A;  1YIT A;  4M7A D;  3EGX B;  1V76 A;  1XOV A;  2MK5 A;  1X43 A;  2MCN A;  4HNU A;  2QQ8 A;  2DZ9 A;  2GQI A;  5GAM g;  2YUQ A;  2O9S A;  3RER A;  1WJS A;  3CXC A;  2COZ A;  3DKM A;  1CSK A;  4C8Q E;  2DPP B;  2RJF A;  2CP5 A;  1AEY A;  4EOS B;  4HVW A;  1WJQ A;  1VYU A;  3SD4 A;  5IH2 A;  2NUP B;  2E6N A;  2IW9 B;  3I5R A;  2FPD A;  4E47 A;  4KH0 B;  4HCK A;  4BBS M;  2JNG A;  2W2H A;  1QVG S;  3PNW C;  2ZAE A;  4NOY A;  4KUD K;  5FRM A;  2DXB A;  5LJ5 f;  3CC4 Q;  3CBM A;  1P5E B;  2CH4 A;  3EGU A;  3OYC A;  1WZO A;  1B7T A;  1HXD A;  1K0S A;  1X6O A;  4OMF B;  3J81 E;  1I4K 1;  2HMA A;  2ZPH B;  2EJ9 A;  4LDV A;  1LJO A;  2LX7 A;  5KYY B;  5GAO p;  3MP1 A;  1JJ2 S;  1VQO T;  4JUV A;  1TS9 A;  2WMA B;  4RTV A;  2QQB A;  4M78 B;  1EX4 A;  1X2K A;  1NM7 A;  1RUW A;  3CD6 T;  1BCO A;  3R6N A;  3OA6 A;  3QII A;  4OGR B;  4FT4 A;  1WLP B;  5CYI B;  1OGU B;  4BDY A;  2F5K A;  2HNI A;  5GAN g;  1XJW B;  2QTV A;  2EQI A;  3OSV A;  1YIT T;  1Z9Q A;  4QVC A;  1QMC A;  4C0D B;  4N4H A;  5HBE B;  3VUZ A;  1OPK A;  1YN8 A;  2YLC A;  2OI3 A;  2A08 A;  3KXT A;  2W9F A;  2LJ3 A;  5IN1 A;  4BCQ B;  2DJQ A;  5HK0 A;  2RPN A;  1ZUU A;  4MMK A;  5I5Z B;  2R5A A;  4BB7 A;  1BB9 A;  2KY9 A;  1N8R R;  2MIO A;  3OSS C;  3I56 T;  2H3J A;  3OMC A;  1O9S A;  4CFU D;  4WTO B;  1VQ7 T;  3CMA Q;  2W0Z A;  3QXE B;  4BI4 A;  4M7A F;  2E65 A;  4XAX B;  2W10 A;  5FU6 B;  1D3U B;  4AKH A;  3QJ6 A;  2VB6 A;  3RMQ A;  2MWO A;  2E3H A;  2E5Q A;  3EAE A;  5GAN e;  1H3H A;  2VKN A;  3CCE T;  2XDB A;  3OYK A;  3H8Z A;  2I53 A;  5GAM j;  4PJO B;  1N8R U;  3ASK A;  5HCK A;  5KH6 A;  2HBW A;  3X20 B;  3GOX A;  4BCN D;  2W96 A;  4Y92 A;  1MMD A;  4BCK B;  1KQS A;  3JB9 D;  2NUT A;  3HRT A;  3CBO A;  4F6S B;  4YOS A;  4J9C A;  4F7S B;  4PJN A;  2VGN A;  2JUF A;  1Q86 U;  1YJN T;  4I3Z B;  1SHG A;  3QSU A;  4PFZ A;  4OMQ A;  3CCM T;  3JRZ A;  2KDS A;  1NLO C;  2DMO A;  1X6B A;  2DIG A;  2J06 A;  3H4C A;  3CC2 Q;  4AI6 A;  4ROD A;  4C5I A;  1M1K U;  1GBR A;  3LWI A;  3FJ5 A;  3CC2 T;  3VS5 A;  4EOQ B;  1K76 A;  4M7A A;  4BY1 X;  4ELJ A;  4ESR A;  5IDN B;  1OU8 A;  4GY5 A;  4WCI A;  3NFC A;  1VQ6 A;  2EIF A;  4MZP A;  4QVD A;  4Y28 E;  4C8Q C;  2FZC B;  5LJ3 h;  4AFZ C;  1NEB A;  4F70 B;  1QLY A;  1UFF A;  1K8A C;  1XTD A;  4JX5 A;  5LJ5 h;  1KXU A;  2PUK B;  4OMO A;  4R56 A;  3J80 E;  1AOJ A;  9ATC B;  3F5X B;  1OYX A;  2FRY A;  1WIE A;  3BDL A;  2HSP A;  5GAO q;  1W6X A;  3G6E A;  4FIB A;  2CP2 A;  3MY5 B;  3HFN A;  1F5Q B;  4B9X A;  3ZFJ A;  1QVG P;  4D8D A;  4R55 A;  3M0Q A;  2YUN A;  1YCY A;  3TEE A;  1MUZ A;  2C0O A;  2FPF A;  3DDP B;  3V8L A;  2RA2 A;  3TSZ A;  2DTO A;  2ED1 A;  4TTH A;  4PJO C;  2VC8 A;  4JDS A;  3JCM P;  1VYW B;  2G77 A;  5LJ5 j;  1M5Q 1;  4JJC A;  1TSF A;  2BTT A;  5KYX B;  1N8R C;  2AT1 B;  5CVI A;  3OYG A;  1G3S A;  2MPX C;  4HCB A;  4J6W A;  4CC4 B;  5L2W B;  4J9H A;  2Y4Y A;  2X4W A;  2L3P A;  2K6D A;  1AWO A;  4F7U G;  3LYI A;  2IVX A;  1RAF B;  2FRW A;  2HD0 A;  3H6Z A;  2FHD A;  2P0P A;  2XMF A;  2O31 A;  3CPF A;  5HK3 A;  2LCC A;  1H25 B;  3DB4 A;  1IRX A;  3S3O A;  5LL6 S;  3EG2 A;  1XQH A;  2MF2 A;  3CC4 A;  2DZC A;  1FVV B;  3CCL T;  3HTR A;  3QDF A;  3G1J A;  5CKD A;  3VS6 A;  4L5G A;  1VQL Q;  2X3W D;  4G6L B;  2JOY A;  4J9B A;  3UF4 A;  3TW6 A;  1OZ3 A;  4M77 E;  3VJP A;  3MCA B;  3CME T;  5CKF A;  2RHI A;  2K7A A;  2W9Z A;  2DF6 A;  4O6J A;  3TN8 B;  1IO6 A;  4C0Z A;  1PM3 A;  2BIV A;  4F14 A;  5GAN h;  2BS2 A;  2C5N B;  1JEG A;  3N5B B;  4M6V A;  3P8H A;  1VQ5 T;  2PMI B;  4PK4 A;  3LH5 A;  2W99 A;  3QZ5 B;  1UEC A;  5GAN 4;  2QAS A;  2VWF A;  4OP0 A;  3JB9 J;  4FX3 B;  4BAC A;  1NYF A;  2ABL A;  1ZSZ A;  3M55 A;  1D1A A;  4PJL A;  3RKX A;  2A3L A;  5I11 A;  4ANJ A;  2WSC E;  4CFW B;  5BNJ B;  3C94 A;  1UGP B;  3CMA T;  1EIF A;  3ME9 A;  1JQQ A;  4LUD A;  2L89 A;  2EGE A;  2KMT A;  2QGG A;  1AWX A;  2CH4 W;  1QWF A;  2DVE A;  4VUB A;  3E19 A;  1G3N C;  1N5Z A;  2D9T A;  1VQN T;  4J6Y A;  1X6G A;  3SB2 A;  4J8O A;  1PD1 A;  3SWN C;  5ICP B;  2SEM A;  1VYT A;  5KYY A;  1YWO A;  1QQJ A;  2JMC A;  3A98 A;  1YP5 A;  4BY6 B;  3L42 A;  1BCM A;  1M4Z A;  4HVU A;  4M78 D;  4M78 C;  3X24 B;  1AVZ C;  1TOV A;  2DL3 A;  1T0J A;  2OAU A;  3FDR A;  2EW3 A;  1ZA1 B;  2RQW A;  4M75 C;  2DEQ A;  2C5O B;  4PFP A;  1JRI A;  3OYN A;  2FG0 A;  4FW1 A;  3VRY A;  3TSW A;  2XG8 D;  2DXT A;  3L1A A;  4OML A;  4M7D G;  1OL1 B;  2WSE E;  4XK8 E;  4JS5 A;  2WHB B;  3CEY A;  1HYO A;  2QTX A;  3VRZ A;  2QGS A;  1KD1 R;  2MYS A;  5A0D A;  2KNB B;  3JCM J;  3MEU A;  3V8J A;  3EG3 A;  1K9M R;  2J6K A;  4AFU C;  5LJ3 d;  2ZZD B;  4M75 D;  4X1V A;  2LNV A;  3PIO A;  2CZ6 B;  1IZ6 A;  4QVZ A;  3PMI A;  4HA8 A;  2G9X B;  3G7Z A;  2V26 A;  2YSQ A;  1U06 A;  3EGD B;  2BS4 A;  4J6X A;  3RES A;  4BBR M;  5LJ3 j;  4PLI A;  3EG9 B;  4MML A;  3G6E Q;  2QF7 A;  4A53 A;  1TUD A;  1VQ5 Q;  2QFZ A;  4HXJ A;  1BBZ A;  4LE9 A;  3MEV A;  3MET A;  1VIN A;  2PTK A;  3D7S B;  2RHX A;  1OKV B;  2LNH B;  1KD1 C;  3OS2 A;  2WSF E;  1TTH B;  4C8Q A;  3WVD B;  3QBY A;  2O2O A;  2QGF B;  4JPB W;  2EUF A;  4HCC A;  4ZN1 A;  1D0Z A;  3FB9 A;  2GGR A;  2JVV A;  1UHF A;  4AFS C;  4E7H A;  4XU0 A;  5A0L A;  2NLU A;  2DK3 A;  1W70 A;  2B8A A;  3QJY A;  2CKK A;  1O75 A;  2RH2 A;  2KRS A;  5KYX A;  4NC6 A;  1KQS S;  2DYB A;  1ABQ A;  3PTA A;  2MWP A;  1KC8 R;  3NTI A;  3CQT A;  3BHU B;  3HP9 A;  3MP6 A;  2YUP A;  4QQD A;  2HZY A;  4OB2 B;  2H8H A;  1VQ5 A;  1ABO A;  1UJY A;  2HSE B;  1MMA A;  2KRO A;  2GTO A;  1PKS A;  4CC7 A;  3PFS A;  4PL6 A;  2FB7 A;  4AKG A;  2NUP A;  4A4H A;  1UG1 A;  1PG5 B;  3VS7 A;  8ATC B;  5LJ3 e;  3I55 T;  5J3B A;  4BI3 A;  4IUT A;  2E4H A;  5IT9 E;  2BE7 D;  1QVF P;  2LQ8 A;  1TUC A;  3I55 Q;  4NL3 A;  4RTT A;  1GL5 A;  1PRL C;  2JM8 A;  4QT7 A;  1KC8 C;  1Y0M A;  3G4S A; 
#chains in the Genus database with same CATH homology
 1BI2 A;  1KQ1 A;  4Z02 A;  1OZ2 A;  1GXI E;  3CD6 T;  4A4F A;  1E7P A;  2DTI A;  3OA6 A;  1NPR A;  3QII A;  3CCV T;  1U1T A;  5DLQ E;  4EMH A;  4FT4 A;  1Y96 B;  4M7D F;  3L2W A;  3FRN A;  3BG5 A;  2V8K A;  4BD3 A;  1Q81 U;  4C92 C;  4BDY A;  2F5K A;  2HNI A;  5FU7 B;  5GAN g;  3RIR A;  3CCS T;  3OSV A;  2VXE A;  4M7D A;  1VQ4 T;  4L59 A;  1YIT T;  4AKI A;  3L2Z A;  4QVC A;  2JN0 A;  2KAF A;  2PVG B;  1NPP A;  4C8Q D;  4DOV A;  3CCU A;  2E10 A;  4M75 A;  4C0D B;  4N4H A;  4RCC A;  3VUZ A;  2BUD A;  2YLC A;  3GIB A;  2EQJ A;  2DAQ A;  3V8K A;  2EWN A;  3JCM b;  3KXT A;  2RB6 A;  3JCM V;  5CKH A;  4OB3 B;  5IN1 A;  5HK0 A;  5CKB A;  2VGM A;  2CYZ B;  1JJ2 A;  1HK9 A;  4MMK A;  2R5A A;  4BB7 A;  4BE0 A;  4A4K A;  2KY9 A;  1VQK A;  3OSS C;  1M9S A;  3I56 T;  1QW1 A;  2H3J A;  3OMC A;  3JCM c;  1O9S A;  1PSF A;  2HQX A;  2GF7 A;  3C95 A;  1VQ7 T;  3OQ5 A;  4XU2 A;  3QXE B;  4BI4 A;  4M7A F;  2E65 A;  4F7U E;  4IUU A;  3QYE A;  4EPC A;  5GMK h;  4XAX B;  3JAM E;  1DJ7 B;  2DTH A;  5FU6 B;  4M78 F;  5KE3 A;  2E1H A;  4AKH A;  5GAO n;  3QJ6 A;  2OTJ A;  2IVW A;  3RMQ A;  2DXC A;  2MWO A;  3S6W A;  2E5Q A;  4LD9 K;  3EAE A;  3URG A;  4OB0 B;  4WF2 A;  3GNF B;  3JCM W;  3OYA A;  5GAN e;  3CCE T;  2EJG A;  2XDB A;  4GLK A;  3OYK A;  5D6X A;  4JLG A;  3LH0 A;  3H8Z A;  4HLQ A;  3CBP A;  3RUX A;  1WPY A;  5GAM j;  4PJO B;  1SSF A;  1QLB A;  2P0Q A;  3ASK A;  2ZPB B;  4A4E A;  2K4Y A;  1N8R U;  5KH6 A;  2XU8 A;  3LWH A;  4LOC A;  3X20 B;  3GOX A;  3ZEH A;  4OVA A;  3UPU A;  2FVU A;  3JCM e;  2QA4 T;  1X75 C;  2CS7 A;  4C92 G;  4BDZ A;  1KQS A;  3JB9 D;  3GP8 A;  4KUL A;  3QYG B;  3M56 A;  1M90 U;  4C5G A;  3CCJ T;  3HRT A;  2L5Q A;  3CBO A;  3P8B B;  4MDW A;  4N4G A;  3WXM B;  3OYI A;  5I21 A;  2LC4 A;  5C0M A;  2EYQ A;  3CC7 A;  4M7D C;  3OBY A;  1W2B A;  5L8R E;  1G3T A;  1KHC A;  2VGN A;  2JUF A;  2X4J A;  4II1 A;  4C0F A;  2A7Y A;  3PIP A;  1YIJ T;  1Q86 U;  1NJI C;  4OGE A;  5IAY A;  4QW2 A;  3G71 T;  1YJN T;  4ATO A;  3QSU A;  3PMT A;  4QSH A;  4Y91 A;  4C92 D;  3CCM T;  3JRZ A;  2KDS A;  3FIF A;  4M78 E;  2HQE A;  4M77 D;  4JRQ A;  4M77 B;  2DIG A;  2P4T A;  5GAO m;  4XTU A;  1VQP A;  1K9M U;  3H4C A;  4HCZ A;  3FLG A;  4HT9 A;  3SFM A;  4AI6 A;  1MGQ A;  3OW2 S;  3TW7 A;  4J5Y A;  2D6F A;  1LOJ A;  4OGC A;  3SDZ A;  1VQL A;  4C5I A;  3G4S A;  1Q82 C;  1M1K U;  1K8A U;  4V2S A;  3LWI A;  2KK4 A;  3CCM A;  3S3N A;  3CC2 T;  3JCM h;  3EFS A;  1ZHI A;  3QKJ A;  3G71 A;  1YJN A;  5FRN A;  4M7A A;  2DXU A;  1YIJ A;  3A8O B;  4N0A A;  5EJC A;  2D0Q B;  4ELJ A;  4B9W A;  1M1G A;  5J26 A;  2CZ0 B;  4LD6 A;  5GAN 8;  2M16 A;  2KR6 A;  2R57 A;  4GY5 A;  2R5M A;  5GMK i;  3NFC A;  1NE8 A;  2GCX A;  1S72 T;  1VQ6 A;  2X4Y A;  2EIF A;  2BS3 A;  4MZP A;  4QVD A;  4Y28 E;  3UWN A;  4C8Q C;  5DLO A;  5GAN f;  3CCQ A;  4ME7 A;  1VQN A;  3HB9 A;  2GFU A;  5LJ3 h;  5CCA A;  2ZPF B;  2DD5 B;  1YI2 T;  1FKM A;  4JX5 A;  1XTD A;  5LJ5 h;  2PUK B;  3J80 E;  4R56 A;  1K8A C;  1M1K C;  2YHT A;  2I2L A;  2M1H A;  1OYX A;  3UT1 A;  3GF5 A;  4X34 A;  5D6W A;  4C0D C;  4C92 F;  3BDL A;  5GAO q;  3MP8 A;  1K9M C;  3G6E A;  4FIB A;  3INZ A;  3P8D A;  2K5F A;  2EKO A;  5CK9 A;  3HFN A;  3CCE A;  2O4X B;  4B9X A;  2DO3 A;  3ZFJ A;  4A54 A;  5C6S A;  4DA4 A;  3OYJ A;  3CMA A;  4R55 A;  5CQY A;  1YCY A;  1I8F A;  2XID A;  2QQB A;  3TEE A;  1Q86 C;  4MDX A;  3OMG A;  1VQ8 A;  2L3R A;  2YLB A;  5KE2 A;  4JS4 A;  3OW2 A;  4C92 B;  2KQW A;  3V8L A;  1KG1 A;  2ZPG B;  4MIM A;  2RA2 A;  4IUV A;  4TVR A;  4MFE A;  5GAN 7;  1BI3 A;  3A8H B;  2RJC A;  1N27 A;  2XDP A;  3C12 A;  3M5A A;  2DTO A;  4FU6 A;  4IKF A;  4KUI A;  1H3Z A;  1QP2 A;  4HNT A;  3GLX A;  4PJO C;  2PVO B;  2VC8 A;  3T9N A;  5DM7 R;  4JDS A;  3JCM P;  3QPH A;  3I56 A;  1P92 A;  4C0G A;  3A8G B;  2XKO C;  2G77 A;  5LJ5 j;  4CRI A;  1M5Q 1;  1W2B S;  1VQK T;  5GAN 5;  3RKY A;  4F7U A;  2E41 A;  1N8R C;  4A4G A;  2O01 E;  5CVI A;  3OYG A;  2LT1 A;  4ZGJ B;  1G3S A;  3A8M B;  2WAC A;  3BDU A;  5AYF A;  3GPL A;  4ZGD B;  2QQR A;  5D6Y A;  4HCB A;  4J6W A;  2QEX T;  1WJR A;  3VKI A;  4M75 F;  2QI2 A;  2M9U A;  3BY7 A;  4C5E A;  2Y4Y A;  2X4W A;  3OYF A;  3HFO A;  3NTH A;  2L8D A;  3V7S A;  4F7U G;  3LYI A;  2X4X A;  1VQ4 A;  5GAN 2;  4N4I A;  2LDM A;  3VYG B;  2RJE A;  4JRI A;  5HY6 A;  2HD0 A;  4OB1 B;  5CIU A;  5CR2 A;  1QVP A;  5GAN d;  3H6Z A;  2FHD A;  2P0P A;  3J7A F;  2XI9 A;  3MO8 A;  1UB4 A;  2RI2 A;  3CPF A;  4ZN3 A;  5I2M A;  3V7R A;  5HK3 A;  3CME A;  2LCC A;  3HRS A;  3DB4 A;  1AHJ B;  2K2V A;  3EFR A;  3S3O A;  5GAO r;  5LL6 S;  4M7D D;  4L6V 5;  1XQH A;  2MF2 A;  3OS1 A;  5LJ5 d;  1JB0 E;  1YJW A;  3BG3 A;  2DZC A;  2P0K A;  3CC4 A;  3CD6 A;  2CGH A;  4RMO A;  3CCL T;  4O5V A;  5GMK e;  5CKD A;  5GAN 3;  4JX4 A;  3CCL A;  4L5G A;  3DL1 A;  3HZJ A;  3DLM A;  2JOY A;  4D6W A;  5A2Q E;  3CC4 T;  1YJW T;  3A8L B;  3RMS A;  3OB9 A;  1VQO A;  3TW6 A;  1OZ3 A;  4M77 E;  5CAI A;  4JRP A;  2MAM A;  2RHU A;  5FLX E;  5GAM f;  2AHJ B;  4FM4 B;  1G3W A;  2IG0 A;  4M75 B;  3VJP A;  2XD0 A;  3UDC A;  5GAM d;  3MCA B;  4N0A C;  3CME T;  5CKF A;  1BIB A;  3SWN A;  4M7A C;  4ELY C;  1D3B B;  4UC4 A;  1Q81 C;  3QWL A;  2RHI A;  3GNG A;  4O6J A;  4C0Z A;  1N9S A;  3TU4 K;  1R8O B;  3M53 A;  4XTZ A;  4E7K A;  2GQV A;  4OF1 A;  1YJ9 A;  3MHX A;  3QHS A;  2BIV A;  4RG8 A;  2ZGW A;  5GAN h;  3VKH A;  2BS2 A;  3VUB A;  3N5B B;  2QEX A;  1KQ2 A;  4M6V A;  3P8H A;  3HKS A;  2DKG A;  5GMK m;  3PT9 A;  1VQ5 T;  2E6Z A;  4P5N A;  4J7I A;  3SWN B;  2QQS A;  4M75 G;  2K3Y A;  2DD4 B;  1I5L A;  4M7D B;  1RL2 A;  2LT4 A;  2RJD A;  4F7U F;  3OYM A;  1ZBX A;  2E12 A;  2V8J A;  4JRK A;  4M77 G;  4MZM A;  3QZ5 B;  5GAN 4;  2EFI A;  1UGQ B;  3LW5 E;  1U8R A;  2QQ9 A;  2RK1 A;  2ZZD A;  1K73 C;  1YHQ T;  1NZ9 A;  1VIE A;  3HHT B;  3M4G A;  4OP0 A;  3JB9 J;  4XTX A;  1M8V A;  3X25 B;  4CI0 C;  2MI6 A;  5J39 A;  5GAM h;  2QQA A;  4BAC A;  2EQU A;  3JB9 F;  3X28 B;  2EQM A;  3M55 A;  3JCM g;  4RKU E;  3RKX A;  5FU7 C;  2A3L A;  2K57 A;  2BKD N;  2MMP A;  1ZQ1 A;  1VQ8 T;  2WSC E;  4PLL A;  4J83 A;  4HT8 A;  3OYL A;  4QQ6 A;  2HBP A;  3F70 A;  4PJO D;  3KBG A;  3C94 A;  1UGP B;  2RM4 A;  4FL6 A;  1I81 A;  3CMA T;  1EIF A;  3ME9 A;  3MEA A;  2L89 A;  2QDY B;  2KMT A;  2RHY A;  3E9F A;  3ER0 A;  1RI0 A;  5GMK j;  3G6E T;  1Q82 U;  2FL7 A;  2FYK A;  1MHN A;  2DVE A;  3X26 B;  2RI3 A;  3M59 A;  3E19 A;  4VUB A;  3HBL A;  5DY9 A;  1Y96 A;  1VQ9 T;  4KT0 E;  2PVD B;  3QG1 A;  1YI2 A;  3E9G A;  3OYY A;  2Y90 A;  4C8Q G;  2LQK A;  4ELZ C;  1B34 A;  2D9T A;  3L2V A;  3L2U A;  3BFM A;  4J6Y A;  3SB2 A;  3CCQ T;  4J8O A;  2VXF A;  1VQN T;  4LDX A;  1S72 A;  1NJI U;  4BY6 C;  1VQ6 T;  2F5T X;  2GFA A;  2PQW A;  2DXC B;  3SWN C;  2DD4 A;  4BE1 A;  3KHI A;  3WVE B;  1VIF A;  2DJZ A;  3OYE A;  3R6O A;  2F69 A;  1Y07 A;  1M90 C;  4BY6 B;  4JJN K;  3L42 A;  3QYH B;  1M4Z A;  4QQG A;  1QVF S;  4M78 D;  3CC2 A;  1VQM T;  4M78 C;  3X24 B;  4PKC C;  2RO0 A;  3KUF A;  3FEO A;  4BE2 A;  1BI1 A;  2DIQ A;  2K5I A;  1VQL T;  4M77 F;  1N6A A;  3FJP A;  2KMG A;  2OAU A;  3FDR A;  4KBM B;  4M75 C;  1BYM A;  3Q1J A;  2DEQ A;  2XIC A;  3VV0 A;  3ZBD A;  4EMK C;  2LVM A;  1UGR B;  1VQP T;  4M7D E;  1FWZ A;  2EAY A;  1JRI A;  4XTW A;  1KD1 U;  1WGS A;  2K5L A;  1BI0 A;  1FX7 A;  4X9D A;  2VUB A;  3OYN A;  3NTK A;  3HRU A;  4C92 A;  1VUB A;  2EJF A;  2DD5 A;  2XG8 D;  4M77 A;  2QXF A;  1Q7Y U;  2DXT A;  3L1A A;  2LX9 A;  3OYB A;  4M7D G;  1BIA A;  4ZTJ A;  3QYB A;  4LDY A;  2M0O A;  3VU3 C;  3CC7 T;  2WSE E;  2LRQ A;  1IRE B;  3CPW S;  3CCR A;  3M54 A;  4PJO F;  4DOW A;  4XK8 E;  4Z6Y A;  4XU3 A;  4HKE A;  5CQX A;  3CCJ A;  4JS5 A;  4C92 E;  2ZCF B;  2Y4X A;  2WJ9 A;  3CEY A;  3DB3 A;  1G5V A;  2QTX A;  5GMK l;  3QO3 A;  3S3M A;  3QUI A;  3CCR T;  4XU1 A;  5A0D A;  2JTF A;  4YTL A;  3OYH A;  3AHU A;  2QA4 A;  3JCM J;  4NS5 A;  5M9O A;  3MEU A;  5LJ3 f;  3PGG A;  3V8J A;  4BUG A;  4IUP A;  2XDD A;  5LJ3 d;  5KCO A;  5LJ3 g;  2ZZD B;  3DLL A;  3A5Z B;  1WNL A;  4M75 D;  4C8Q F;  1QP3 A;  3E1S A;  3JCM Q;  3CPW A;  2LNV A;  3QDR B;  2VYT A;  3PIO A;  5GAN j;  5FU6 C;  3BG9 A;  1YBY A;  3RKW A;  2CZ6 B;  5GAN 6;  1IZ6 A;  4QVZ A;  4NL2 A;  2G3R A;  2OTJ T;  3C4S A;  3JCM f;  3PMI A;  4HA8 A;  4E7L A;  2CZ1 B;  2JZ2 A;  1G3Y A;  3G7Z A;  3JCM d;  1VQM A;  3M4Y A;  2ZPI B;  3TCJ A;  3LX7 A;  2BS4 A;  2PU9 B;  4J6X A;  4M78 G;  3RES A;  4BBR M;  5CKE A;  5LJ3 j;  3OS0 A;  2HAX A;  3QZ9 B;  4PLI A;  1BKB A;  4C8Q B;  4MML A;  4MFD A;  5CO7 A;  1VQ7 A;  2QF7 A;  1Y71 A;  2PUO B;  4RCB A;  4A53 A;  3OYD A;  3LGL A;  3M58 A;  2QFZ A;  3M9Q A;  4PNO A;  1W4S A;  5LJ5 e;  3JB9 I;  3HSB A;  1Q7Y C;  2XHC A;  3MEV A;  3HL8 A;  4M75 E;  1QVG A;  3MET A;  3L2R A;  1V29 B;  4IUQ A;  1XNI A;  4HL4 A;  2E70 A;  2RHZ A;  2V8I A;  4LDU A;  3OBW A;  1M1F A;  2RHX A;  4ZGE B;  2R58 A;  3LLR A;  4FT2 A;  1KC8 U;  1JBM A;  1B34 B;  5GAO l;  1KD1 C;  4E7I A;  2ZPE B;  3OS2 A;  3L2Q A;  1VQ9 A;  2WSF E;  3HO8 A;  4C8Q A;  3WVD B;  3QBY A;  1H64 1;  1KHI A;  2RI5 A;  1X01 A;  4HCC A;  2RD1 A;  4HNV A;  5GAM e;  2LCL A;  4ZN1 A;  3O8V A;  1U1S A;  4PJO G;  1LNX A;  3FB9 A;  2K3X A;  4X9C A;  2KVQ G;  3CCU T;  2JVV A;  4ZTF A;  1OI1 A;  5A0G A;  1YIT A;  1XOV A;  4M7A D;  4E7H A;  4XU0 A;  5A0L A;  2NLU A;  3CCS A;  2DK3 A;  4HNU A;  2QQ8 A;  2DZ9 A;  1FXX A;  1N9R A;  4FSX A;  4JLI A;  2YRV A;  1TH7 A;  3OS5 A;  4RG2 A;  5HKC A;  2B8A A;  4BI8 B;  5GAM g;  3VYH B;  3QJY A;  3RER A;  2CKK A;  1O75 A;  1WJS A;  2E64 A;  2RH2 A;  3CXC A;  3CCV A;  3JB9 G;  3DKM A;  4C8Q E;  4PJO A;  4C5H A;  4E7J A;  3FC3 A;  4NC6 A;  2C06 A;  1KQS S;  2DPP B;  3VYG A;  5FRO A;  3PTA A;  1PSE A;  2MWP A;  1WQW A;  2RJF A;  3NTI A;  2RK2 A;  2O4X A;  1YHQ A;  4JX6 A;  1Y7X A;  2DXB B;  4EDU A;  4EMG A;  3G4S T;  3HP9 A;  1WJQ A;  3M57 A;  2OTL T;  5LJ5 g;  3SD4 A;  1QVF A;  2JTM A;  3CXC S;  4IUR A;  3VKG A;  3MP6 A;  2E6N A;  4M77 C;  4M7A B;  3MEW A;  2CZ7 B;  4QQD A;  5EG2 A;  2QDJ A;  3OY9 A;  4E47 A;  5I2S A;  4M7A E;  4OB2 B;  4BBS M;  2JNG A;  1VQ5 A;  4MZT A;  3I55 A;  4XTY A;  1QVG S;  3PNW C;  3JCM X;  4EMK A;  4NOY A;  4KUD K;  5FRM A;  2DXB A;  5LJ5 f;  2XK0 A;  3PFS A;  4PL6 A;  3CBM A;  2LTO A;  5KCH A;  2FB7 A;  3OYC A;  4AKG A;  1YJ9 T;  4A4H A;  4F7U B;  2VV5 A;  1HXD A;  4Q5W A;  4M78 A;  4DQ2 A;  1X6O A;  4J7F A;  4OMF B;  3LGF A;  3J81 E;  1I4K 1;  2ZPH B;  2EJ9 A;  4LDV A;  4M7A G;  5LJ3 e;  2X35 A;  1LJO A;  3JSC A;  3I55 T;  5J3B A;  3TRE A;  4XQ3 A;  4BI3 A;  4IUT A;  1K73 U;  5IT9 E;  2EQK A;  3MP1 A;  5GAO p;  4LDW A;  4EMK B;  2LQ8 A;  1VQO T;  1JJ2 S;  1WQ7 A;  4JUV A;  4XTV A;  3JB9 H;  4NL3 A;  4PJO E;  3HPW A;  2KSS A;  2OTL A;  3BW1 A;  1UGS B;  1KC8 C;  1UEB A;  1D3B A;  4M78 B;  3V7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...