1UGQB

Crystal structure of apoenzyme of co-type nitrile hydratase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Nitrile Hydratase alpha subunit
total genus 65
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugqB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugqB02
4KT0E 1IREB 4RKUE 2D0QB 2ZPIB 1PSEA 2DD4A 2AHJB 1UGPB 4ZGEB 2PUKB 3QXEB 3A8GB 2ZCFB 4OB0B 4XK8E 2ZPFB 3WVEB 4OB3B 1AHJB 1UGSB 3VYHB 2CZ1B 2ZZDB 4L6V5 2O01E 2WSFE 1GXIE 3QYHB 1QP2A 2PVDB 2ZPBB 2ZPGB 1UGQB 3A8MB 2DD4B 2CZ0B 3A8OB 2DXCA 2WSCE 1DJ7B 2ZPEB 3WVDB 4OB2B 4FM4B 2PU9B 3X20B 4ZGDB 2DD5A 1PSFA 2DXBB 2PUOB 2DPPB 3X25B 3A8LB 3HHTB 2ZZDA 2QDYB 5L8RE 2CYZB 2WSEE 4Y28E 2DXCB 3X24B 3QZ9B 3VYGA 3QZ5B 3X26B 2DXBA 3X28B 3QYGB 2CZ6B 4ZGJB 1JB0E 1V29B 2PVOB 1QP3A 3A8HB 2CZ7B 3VYGB 1UGRB 2PVGB 3LW5E 4OB1B 2ZPHB 2DD5B
chains in the Genus database with same CATH superfamily
4QVZA 5KH6A 4OMOA 1OQKA 4C92D 2E5KA 2MCNA 2EBPA 3EH2A 3M58A 1VUBA 2XD0A 4NL3A 3BLRB 2AHJB 1YHQA 1M8VA 1E9HB 2YHTA 2E3HA 1UE9A 2XIDA 2IW9B 3TN8B 3MEWA 2B9RA 5C6SA 1ZLMA 4O5VA 3H0FA 2R57A 2L5QA 5HY6A 1KG1A 3SDZA 1M5Q1 2KT8A 1N6AA 4L59A 1YITT 4LDVA 4M6VA 1Q82R 3QDFA 3L2QA 1LNXA 3CCLA 1T0HA 3L42A 2C4GB 1PRLC 3GNFB 3OYMA 3G4ST 2FL7A 2CDTA 2KYBA 2QG9B 2DXTA 4XU0A 1ZSZC 3P8DA 3QWXX 2KK4A 5GAMf 2YLBA 1TUGB 4XAXB 3RKYA 1AVZC 2DD4B 2E6ZA 2O31A 2O88A 2GTOA 4ROCA 2F1LA 1FX7A 4CFXB 4JRQA 2OTLA 4BY1X 2DZCA 5GAOp 3HFOA 3JB9J 1KD1C 4ELJA 1PSFA 5CK9A 1RLQC 1VQNQ 3QWYA 4PNOA 4HVVA 2CCIB 1WHJA 4PFOA 4DEXA 3L2UA 4M7DE 3OBWA 4F17A 4BY6C 2LVMA 3SWNB 2RHIA 5GAOn 1W2BS 1K9MC 3LQ5B 2DAQA 4HT9A 4E7KA 4HVUA 2HL5C 2UUEB 1KQ1A 4LUDA 1K9AA 4Q5WA 3G1JA 2K9GA 2BPMB 1G83A 2RF0A 2HCKA 1WA7A 4KH0B 3JB9G 1OU9A 1BI0A 2F2XA 2EWNA 2X35A 2KR6A 1ZA1B 1Q86U 4HCKA 5LJ5d 3INZA 2E41A 1B07A 3OMCA 3UDCA 1YJWQ 3QKJA 1D1BA 1TTHB 1VOMA 3DDPB 5KYYB 2QQBA 1RAHB 1Q82U 2RQVA 2J6OA 4PK4A 4C8QF 1H1PB 4KT0E 2ESWA 3EG0A 1K73C 2A3LA 1TFBA 2DEUA 4BCFB 1Q7YU 3NFCA 1TG0A 1UB4A 4PJOG 1RAIB 4Z88A 1WHMA 3JCMJ 1ZUKA 3NMZC 1C0MA 2BE7D 5GANg 1OZ2A 1FMKA 2RI5A 5C0MA 3BDUA 5IDNB 4CI0C 3G33B 4HT8A 3DOGB 5GAOq 4L6V5 1I5LA 1X27A 1T3LA 1HYOA 1HJDA 2RN8A 1GCQC 4EOIB 3HRUA 1VQ8A 1QVGS 1ZP2A 1GCQA 4F04B 4CFMB 2LW4A 2MOXA 3CCQA 3IQLA 4NS5A 1VQ9A 2HDAA 2ZPGB 1UGQB 1WHKA 2QYZA 2WFYB 2DMEA 2MYSA 4I3ZB 1SF9A 3E9GA 4R0KA 3BLQB 3TW7A 3CCUA 2QA4T 3E19A 4MMKA 1KC8C 1IXDA 1SPKA 1NE8A 2QDJA 2V26A 3H6ZA 4FM4B 4CC4B 3TSWA 3META 1Q86C 2WMAB 2WMBB 2KY9A 3MPUB 1OULA 3L2VA 4WF2A 2CUBA 4J6WA 4J9EA 4JX5A 4M77G 2VB6A 4BI8B 3NTKA 1HXDA 4KGXB 2DXCB 2YRCA 3LGFA 4PJMA 1SG5A 2O4XB 4M78E 4A63B 3EFSA 1PWTA 1TU0B 3RBBB 1K4US 4RTTA 3RUXA 3C12A 4RTWA 4PJOC 3CCVA 1Q86R 2CP3A 3CCVQ 2QEXA 2EQKA 1X2QA 2QEXQ 5EC7A 1YJ9A 2YUOA 4C8QB 5HCKA 1PHTA 3JB9D 5D6XA 1PC0A 4F7UF 3B57A 3CMEA 3V8KA 2M16A 3BHUB 3M57A 5J26A 4JX4A 4KRDB 2P0KA 3J80E 1O9KB 4M78D 3OS2A 3VUZA 3KBGA 2O2OA 3QPHA 3E1SA 1G3WA 1W4SA 2KI7A 3VRYA 3OYEA 5HK3A 1ZUYA 5LJ5f 2QQRA 4ZGEB 4M77A 2E70A 4DOWA 1PD0A 4LDXA 4EORB 2GCXA 2RNAA 3HFNA 1VIFA 1IRXA 2EJ9A 4PJOE 3OYLA 1AHJB 4OF1A 4Z02A 2RPNA 4CFUD 3M53A 4XTUA 2FZGB 2XKOC 4IUVA 3FIFA 4AFQC 3G71T 1H3HA 4BCJB 2L3SA 3A8MB 4AKGA 4A4HA 1B7TA 4ZNXA 3FJPA 5LJ5j 4N0AA 1ZX6A 1M2VB 4WCIA 5DQVA 3I56T 1QVGP 2WIPB 2V8IA 1VQPA 3CC2A 4M7AG 2KE9A 1AZEA 1JRIA 1D3UB 4KUDK 1WXBA 4MFEA 2WEVB 5KYYA 3X20B 1VYTA 1B3QA 2JS0A 4OGEA 5I2MA 3OW2P 5AYFA 1WNLA 1VQKA 2F2WA 4HNVA 1WDXA 2FEIA 1PRMC 2KBTA 3TEEA 1YWOA 1ARKA 4XTXA 2FZKB 2IN3A 4F70B 1MUZA 1OL2B 2C0OA 2Y4YA 3M55A 2DRKA 2JT4A 1X6BA 4BD3A 1LVKA 2VGNA 2OTJA 2PMIB 1D09B 2LCSA 2GQIA 2GFAA 2HSEB 3CXCP 3CCLQ 2X4XA 3BG5A 1H24B 1QP3A 2E6NA 4KGZB 3TCJA 1KD1R 3A8HB 3VKGA 3EHRA 2DJZA 2QQ9A 2LJ3A 3CCRA 2EAYA 1VA7A 1M3AA 5LQFB 5LJ5e 1OKWB 3EH1A 1QQJA 3QYEA 1D0ZA 1A0NB 4EONB 5KCOA 3N5BB 3AT1B 1FMVA 1K0XA 1N8RR 1C1AA 4HCZA 5D6YA 5LMKB 4OVAA 1H26B 4C92C 1VQLA 2KYMA 2PUKB 2ED0A 1WJSA 3QXEB 2YRVA 1BB9A 2CUDA 3JCMQ 4CFNB 5CKHA 2J6FA 2M51A 2DBMA 1QVFS 4BY6B 4C0DC 2X9HA 4BCNB 2MAMA 4HCBA 2OI3A 2QAZA 4FYVB 1YCSB 3FJ5A 4MIMA 2L0AA 1YJWA 2NUZA 2RJDA 4BCKB 1JJ2A 3EFRA 4JLIA 2JXBA 2NWMA 4ESRA 5GAN4 3CMEQ 3RMSA 2F69A 2EYQA 4QQDA 5LJ3g 1S1NA 3C95A 3MI9B 1GBQA 1UHFA 1QLBA 3A5ZB 2ZZDA 1G3SA 1FINB 3CCMQ 3RKXA 5HBEB 1K8AU 3X24B 4M77C 4YTLA 2DXBA 2DM1A 5GJVB 4M78B 4XTVA 2DYIA 2LDMA 1VQ8Q 1OX9A 3P8BB 3GBQA 2CP0A 2V22B 4EC9B 3CCQQ 5FU6B 1PNJA 4D8DA 4R56A 4CFWB 3C94A 1IB8A 5HBHB 2EUFA 4F7UG 2QGSA 5KYXB 3M03A 4LD6A 3OYGA 1JJ2P 3URGA 4RUGA 4JRKA 2PQWA 3S3OA 2EKHA 2YT6A 2RO0A 4Z8AA 2XDBA 1O9SA 2D0NA 2DRMA 4RKUE 2NUTA 1WXTA 2LJ1A 1VQOT 3R6NA 2XMFA 5D6WA 4X34A 3RR6A 1BU1A 4M4ZA 5KE3A 1M1KR 1M9SA 1NG2A 3NGPA 1ZA2B 1R77A 4ZTFA 2K3BA 1N8RU 1BK2A 4C8QC 2JMAA 2DIQA 2L3RA 2K79A 1E6GA 3JCMe 1I4K1 1RLPC 2AKKA 4Y92A 4LDYA 4BE1A 1NJIC 2OJ2A 5A0GA 2COZA 1RABB 2VYTA 2E4HA 2JS2A 1GY3B 2RK1A 1VQMQ 4EOJB 4OMPA 1W2BA 4KGVB 3CCSA 2B86A 4M7DA 3CCRQ 1YIJT 2CZ0B 3T9NA 5KYUA 2K2MA 2M0OA 4M7DB 4XTZA 4XU3A 4CXAB 4C8QD 4LN2A 1N8RC 1NJIR 2CH4A 1R8OB 2CP2A 3G6EA 3CCET 1QKXA 3H9NA 3ZBDA 3G6EQ 3L1AA 1CKAA 2M02A 1ABQA 3JB9I 1QVPA 3OS5A 1QLYA 3VS4A 4EMKA 5L8RE 2WPAB 1D3BA 3MEVA 2Y90A 2WSEE 3EGDA 1Q7YR 3P8HA 3JCMX 3QZ9B 1K0SA 3CC7A 3X26B 4N4GA 3GP8A 3HRSA 5HQ0B 2LQNA 1S72T 4BCMD 3OW2S 1Z9ZA 1WFWA 1WI7A 2HBPA 5CVIA 3UA7A 4E7LA 2DE0X 4QQGA 2K6DA 2MK5A 2DL5A 1D1CA 2EQMA 1SHFA 4ZN3A 1VQPQ 2P0PA 1GH6B 5IH2A 1PKTA 4M7AB 1OGUB 1X75C 2CP7A 2I40B 5ECAA 1B34B 2HBWA 4IKFA 2ROTA 4EOQB 2W2HA 4VUBA 4AKHA 2DD4A 3MP8A 4A4KA 4AG2C 4NL2A 2A28A 2RJCA 3VS6A 1UDLA 3CD6Q 3FDRA 3EGXA 1YP5A 2E3IA 1AWOA 1W2BP 3VUBA 3I9QA 1W98B 1X69A 1BI2A 2RHYA 2EQIA 1U1SA 2DMOA 2PTKA 1KQ2A 1D1AA 1OU8A 5CKEA 5GANd 1MMDA 4Z6YA 1YN8A 2JOYA 3JB9F 4C8QE 2EW3A 3CBPA 4OMLA 4MDXA 1HK9A 4HVWA 2L3QA 3JV3A 1M3BA 5LJ3f 3FEOA 4E6RA 2BZXA 1VQ5T 3VKIA 1X43A 1FYNA 5GAOl 2IVXA 4A54A 1UUEA 3CBOA 5IXBA 3M0UA 4E7JA 4GBQA 1XO2A 3SEMA 1OZ3A 3EIDB 5I5ZB 4J7IA 1OEBA 4JZ3A 5HBJB 1MGQA 1KFZA 3GOXA 2XDDA 1Y57A 1U8RA 2J7IA 4BDZA 1K9MR 4C92B 3MY5B 1R0CB 3CPWS 2A37A 2ECZA 3VS5A 2CH4W 4M77B 4XTWA 1WPYA 3OBYA 3C4SA 5A2QE 4ZTJA 2NUPB 2D8JA 1HSQA 3JCMc 3M5AA 5GAN5 5FWBA 3CC4A 1H28B 3QYBA 3CCSQ 3V7RA 5GAN7 3CCJA 2PVGB 3CCJQ 5DM7R 2X51A 2ZPHB 3I55T 1OOTA 3JCMg 2LCLA 5GAN8 3JCMW 1WYXA 4IIMA 1OPLA 2QDLA 1SRLA 3PNWC 3QUIA 4BE0A 1PKDB 2JTMA 5CEIB 5FU7B 4MZPA 4LXCA 1ZSGA 3LH0A 2X3XD 4EDUA 2VKNA 1BCMA 3CBMA 1VQ7A 3THKA 4C5EA 2DILA 3HRTA 1VQ7Q 3BLHB 1Y96B 4OGRB 1Q81U 1Y96A 1GL5A 4BACA 4Y72B 4O6JA 2M0YA 1YNZA 1HD3A 4J6YA 3CMAT 2LNHB 1AWXA 1FXXA 4X9CA 1VQ6T 4ROEA 1KK7A 2KRMA 2BZYA 3OYFA 4A53A 4HCCA 3QO3A 2HQHA 2QK0A 3VU3C 5FLXE 3DTOA 3VV0A 2WSCE 3CC2Q 4FU6A 2AT1B 2LNVA 1RACB 1NEGA 3NTHA 1YI2Q 1H1SB 2AZSA 4F7UB 2C06A 1M90C 1VQKQ 2M9UA 1YI2A 3KXTA 5GMKi 1KIKA 2PUOB 1VQ4Q 1UGVA 2COYA 2DL7A 4JJBA 1M1KC 2UZDB 3U23A 2W99A 4MFDA 2EJGA 4F7NB 3OYKA 3CD6A 2JNGA 2OTJQ 4JLGA 3OYIA 4AFSC 1JU5C 2DJQA 3OYYA 2KEAA 4OR5B 5LJ3j 1UNLD 2W9ZA 3EOCB 4EOMB 1OIUB 4FT4A 5FRNA 3UT1A 1WHHA 1VYWB 3S3NA 2PK9B 2R5AA 2C0TA 4D8KA 5IAYA 1RI9A 3SD4A 1VQMA 2GTJA 4JPBW 4IURA 2DKGA 1TUDA 4CFVB 1T0JA 1LPLA 3PGGA 3JRZA 2X4YA 2WXVB 2W96A 3CPFA 1YJNT 3M4GA 1NYGA 3LW5E 2VGMA 1Q7YC 1YITQ 1W70A 2HL3A 1YITA 2JMCA 2L3PA 3SB2A 1Y71A 3EJ1B 5GMKj 2K5FA 3HL8A 1KHIA 3ASKA 4CC3A 1PCXA 1VQLQ 1NLPC 4II5B 3MP1A 3HSBA 3J7AF 3EG3A 2CKKA 4L5GA 3QJYA 2CT4A 2WJ9A 2AZVA 3OSSC 4A4EA 2RK2A 5IHIA 4LE9A 3VYHB 1AOJA 1Y07A 2ATCB 2CZ1B 1RADB 3LWHA 2OTLT 2ZZDB 4KRCB 2O01E 2YDLA 2WSFE 1BIBA 2CREA 1VQNT 4PJOB 3BW1A 3GF5A 4C0GA 3L2ZA 3CPWP 4FYWB 3L2WA 4UN0A 5DQWA 2R7GA 1AD5A 1VINA 1MMNA 2I0NA 3M56A 1UTIA 3TU4K 1BYMA 1AEYA 4TTHA 2G6FX 4M7DD 1WLPB 3TNHB 3POMA 1AD6A 2F2CA 3HHTB 4HKEA 1KC8U 1MMGA 1RAGB 2H3EB 4EOOB 4JRPA 3CCMA 3REAB 4F6WB 4KH1B 1SKUB 2NYSA 3QJ6A 3CQTA 1TXQA 2DTIA 4J9HA 1GRIA 1JXOA 2QQAA 1SRMA 3QZ5B 2RHZA 3VYGA 2MWOA 2DEQA 1V29B 1NEBA 2V8KA 2CJMB 4AT1B 3LGLA 2J06A 4RCCA 1TS9A 1TH7A 4DBHA 2CSIA 3QDRB 2F5TX 4CRIA 3HB9A 1URCB 5IT9E 1YBYA 1RI0A 3JCMf 2EGAA 2MWPA 3WXMB 1KC8R 5CR2A 3UATA 1Q95G 2PK2A 1AISB 3MHXA 4P5NA 3DDQB 2FHDA 4F6UB 2FPEA 2RA2A 1GCPA 1XTDA 3PIOA 3PO3S 4E7ZA 2FRWA 1VQ9T 2MI6A 4R55A 1OI1A 1KHCA 2KXCA 4BI3A 1WQWA 4KUIA 2D1XA 2KMTA 3PVQA 3CCUT 2W0ZA 2ZGWA 2QA4A 1W1FA 3CEYA 2VASA 1K1ZA 2RJFA 2CP5A 5GAMg 3J81E 3PVLA 2J05A 1C6VX 2PZ1A 1WHLA 1QP2A 1UECA 4RTZA 2HAXA 4PFPA 2EYYA 4II1A 4MZTA 4GLMA 2P84A 3G7ZA 1RAEB 1I0CA 2DTOA 2JTFA 5AT1B 4IMYB 2EYZA 1I07A 4Y91A 2GQVA 5KE2A 4FX3B 1ZSZA 2LC4A 1UJ0A 2O9SA 2O9VA 1QCNA 1JSTB 4HLQA 3EG2A 1M1GA 2Z0WA 2HKNA 1KSWA 2AKLA 2YXYA 4FIBA 1G3YA 5CAIA 3CCVT 3QHRB 5I2SA 2QEXT 4F6SB 1H1QB 1QCOA 4CC2A 4X9DA 2C5NB 1H92A 5DY9A 2OAUA 1YJ9T 4Y28E 2K7AA 3RKWA 3CC7Q 3OYAA 4OGCA 5LL6S 2QF7A 2LQ8A 4C92F 1I5OB 2RQRA 3CMET 1JB0E 2EYXA 5BNJB 4DBRA 4PJLA 1UNGD 4C5IA 4DOVA 1EX4A 3QHSA 1X01A 4JZ4A 1JXMA 4RG2A 1SSFA 2E64A 3JCMd 3ME9A 1GUXB 4QVDA 4PJOA 2K5LA 1I1JA 4M78A 2JUFA 1OV3A 1JJ2S 5CCAA 3QHWB 5KYWB 2F5KA 3ZEHA 4HNTA 2X4JA 2KRSA 1ABOA 3AHUA 2CT3A 3C0CA 2X4WA 4LOCA 1VQ4A 2PHGA 2GNCA 2D8HA 2QQSA 1TOVA 2XICA 1E7PA 2VWFA 3VRZA 3L2RA 3FC3A 3OW2A 3DJBA 4ELLA 3G71A 4BCHB 4BCPB 1UGPB 3JSCA 4EMKC 3OYJA 1P92A 3HO8A 4EOKB 1YWPA 2QFZA 1F1BB 2K57A 2QXFA 2LMJA 2YUNA 4XK8E 2YUPA 1VIEA 3BG3A 4JUVA 3I56Q 5LJ3h 2WHBB 1LJOA 1U1TA 2W9FA 3GNGA 3VS2A 2ABLA 2DL8A 1JSUB 4EMKB 3JCMV 1WGSA 2LT1A 1BBZA 3PMTA 4YC3B 2IW8B 3EGDB 1RAFB 1YHQT 3M0RA 1QKWA 1UHCA 4XQ3A 5IF1B 1IHVA 3MP6A 1Y7XA 4AFZC 3PT9A 4F7UE 5GANj 5GAOr 1LOJA 2L2PA 4QT7A 4PJNA 2FG0A 3KHIA 2VXFA 2EVRA 3CPWA 3CCLT 3OYCA 1M1FA 4ZGDB 5IN1A 1CKBA 3G4SA 5CIUA 5CKBA 2DPPB 5GAMj 2VV5A 1Y0MA 2BTTA 2I53A 4BUGA 4JJNK 2LZ6B 4C8QA 4J9GA 3TNWB 2K4YA 1TWBA 4F7SB 1X6GA 3OSVA 3CCRT 3V7CA 2NLUA 2A7YA 1OI9B 1JBMA 2XDPA 5FW9A 4F14A 1I8FA 4C0ZA 3CXCA 2COWA 2KMGA 3TREA 4M77D 4EIKA 3EAEA 2GGRA 2QGFB 5LJ3e 2W10A 4ZN1A 1BKBA 4B6MA 4C5GA 1MMAA 5CKDA 3GTMS 4F16A 3CC4Q 4M75G 3MO8A 1K76A 4DQ2A 2PJQA 2RHUA 5GANe 5CQXA 1H25B 1N5ZA 1WJRA 4IIOA 5M9OA 1X6OA 2DYBA 2JM9A 1M1KU 2DF6A 3EHQA 3BHVB 4J5YA 1ZSZB 2DX1A 5LJ3d 4BCQD 2ZPIB 2DERA 2WACA 2DZ9A 4LUEA 2LX9A 2XI9A 2RMOA 3R6OA 4IUTA 3VS7A 1UJYA 3D7SB 2RHXA 5FU6C 1B34A 2ZCFB 3JCMP 1YJWT 4X1VA 4IUUA 5LJ5g 2DA9A 2E65A 1UG1A 2CGHA 3LH5A 4JJCA 4N4IA 1JQQA 2A08A 1PD1A 4MDWA 4F7JB 2WIHB 3QYHB 1OYXA 2PVDB 4KBMB 5I11A 3OA6A 4JS4A 2KAFA 5FWCA 3QBYA 5I22A 3BFMA 4J9FA 4ELZC 3OYNA 2L89A 2VVKA 2KR3A 5IHNA 1K8AR 3MIAB 3M9QA 4K11A 4KULA 5CO7A 4B9XA 3PFSA 1H3ZA 6AT1B 5KYWA 1JO8A 4GY5A 1VQ8T 5CKFA 4HNUA 2X3WD 3CCQT 2ENMA 4OMNA 5GJWB 1U5SA 4M7AD 2UZLB 4PL6A 1D0XA 5J39A 4C92G 1WIEA 2CZ6B 2FZCB 4ZGJB 2XK0A 2QA4Q 2YUQA 4M78F 2F2VA 3GPLA 2FPDA 5GMKm 4PJOF 3VKHA 3GIBA 1FKMA 3BG9A 2DTHA 2R58A 1U3OA 3PMIA 1M4ZA 4M75D 4M75C 1VQOA 3LWIA 3KUFA 1D3BB 4E7HA 4PKCC 1AT1B 4M75A 4AFUC 2DL3A 1M8MA 4BB7A 1NPPA 1K73R 1UGRB 5DLOA 2RJEA 1EIFA 1W6XA 2BKDN 3HKSA 1QMZB 2DD5B 2E10A 4J8OA 3OYBA 1Q81R 5IDPB 4J7FA 4NSTB 1M2OA 2K3YA 4LDUA 3G4SQ 1NBEB 4JJDA 2FRYA 2MMPA 4C92E 4N4HA 2C5VB 2QGGA 1NM7A 4BXXX 1KJWA 5HK0A 8ATCB 4RODA 4RTUA 4XU2A 2YRDA 4PLLA 3CCST 5KCHA 1XOVA 2OAWA 3BE3A 4J6XA 1J3TA 2FYKA 4JX6A 1Z9QA 1UGSB 3I55Q 3NHNA 5EG2A 4NOYA 4PJOD 3EGXB 3FB9A 2DXUA 3G6ET 3FLGA 2JTEA 1QWFA 3BDLA 5CQYA 1NZ9A 1U06A 4OMQA 4B9WA 4ORZA 2JZ2A 4FL6A 5D7UA 2ZAEA 2X1NB 2DXCA 2KQWA 2RH2A 3TQ7P 1WZOA 8AT1B 3O0GD 3SWNA 4ELYC 7AT1B 2MIOA 2KGTA 1VQ6Q 3X25B 1QCFA 4BY7X 4M7AE 5L23A 5EJCA 2CS7A 4A4GA 2QDYB 3QIIA 4G6LB 2VXEA 1JOWA 1KQSA 4BCND 3K7AM 4F7UA 3I56A 2XU8A 3UF4A 3CC2T 1VQPT 2M1HA 2A36A 1CSKA 2GBQA 4AMCA 3JCMb 1IHWA 2KDSA 2PVOB 5IHYA 1VQKT 3F5XB 2LCCA 4JDSA 1FWZA 3QG1A 1UFFA 5GAMd 2IIMA 2UZEB 2GF7A 3H0HA 1H4LD 2HD0A 3OY9A 2CZ7B 2DVJA 4JS5A 2JM8A 2KXDA 5I21A 1RAAB 3TSZA 3LLRA 1E6HA 3A98A 1ZUUA 2OTJT 2G9XB 3S3MA 2C0IA 2P4RA 4FSSA 3OYDA 2VC8A 2P0QA 2NUPA 3V8LA 1V76A 2D0QB 5GAOm 1OL1B 1PSEA 1RUWA 4AG1C 2R5MA 1SHGA 3EG9A 2YSQA 4BBRM 2HZYA 3I5SA 4D6WA 3MY1B 1MV0B 1C9BA 3VS0A 3UWNA 4OB0B 2SRCA 1UEBA 2DNUA 1IGQA 3H41A 4C0DB 1XQHA 4QW2A 2ZPFB 3WVEB 2MPXC 3M0PA 1VQ5A 2FVUA 2DLPA 1N27A 1KXUA 4BCQB 3Q1JA 1Q81C 2GFUA 1GXIE 4DEYA 2IW6B 1VQLT 1T3SA 1OPKA 5GMKl 1K73U 3OB9A 4HL4A 2UZBB 4KRTA 1DJ7B 2RQUA 5GAMe 2OX7A 2ZPEB 5IHKA 2QTXA 3HTRA 3E2UA 3MKDA 3WVDB 2G3RA 4FW1A 1LCKA 4QQ6A 5IXFA 2OTLQ 1PG5B 2DD5A 1IO6A 5LJ5h 3TNIB 5DLQE 1NJIU 2E5QA 1YFNA 4EMHA 2JN0A 1QMCA 2CYZB 2D9TA 4M7AA 1GBRA 4M78G 4BCGB 2C5XB 3CCJT 1G8XA 3UA6A 5EFQB 4YOOA 1ZBXA 3I55A 1VYVA 4FYYB 3FRNA 1N4MA 3H0IA 3KFVA 1OKVB 1WJQA 4A4FA 3OS0A 2E12A 1ZHIA 4RTVA 1QVFP 5HKCA 1MHNA 1TSFA 2G77A 2BZ8A 1VQ7T 1QW1A 1MV3A 3S6WA 4OB1B 1PM3A 3SFMA 1K9MU 4LNPA 1WQ7A 5GAN2 2AIRB 1QVGA 4C0FA 4F7LB 1IREB 3ULRB 3CMAQ 3RERA 4LD9K 1H8KA 2FO0A 2O4XA 5FROA 3CMAA 2JGZB 2BUDA 3ZFJA 3G71Q 4M77F 1R0BG 2KNBB 3OS1A 1GFDA 1G3TA 1WXUA 2KSSA 4IUPA 4EOSB 4M75E 3MEUA 1BI3A 2SEMA 4N0AC 5GMKh 2QASA 2V1QA 2XHCA 3RDVA 1F5QB 2CSQA 5FRMA 1M2VA 3SWNC 3DL1A 5ACBA 1ENWA 1M27C 2EGCA 1VQOQ 4MZMA 4CFUB 4M75F 1O9KA 1SSHA 4RTXA 1VQ9Q 3MJXA 3LYIA 1ACMB 4DBFA 9ATCB 2FPFA 2E1HA 3O5ZA 1EFNA 3A8OB 1BCOA 4FT2A 3DKMA 3MCAB 1FVVB 3TW6A 4TVRA 1G3NC 2LQKA 3CCUQ 4QSHA 4BCIB 4PJJA 1MNEA 5J3BA 4C8QG 1OIYB 5GAN6 3M0TA 2DXBB 3RGFB 5GMKe 2JVVA 4RTYA 1KQSP 5HNBB 4XTYA 2EGEA 4Z89A 3MEAA 3V7SA 2EYWA 1VQMT 2RB6A 1YIJA 5A0DA 3UPUA 3PIPA 1YIJQ 1FMWA 1YJNQ 3REBB 1YJNA 3ZL7C 4ME7A 3CCEA 4OMMA 5KYXA 1NLOC 4V2SA 3RIRA 3ER0A 4EOPB 3NDQA 4EC8B 2Y4XA 3VS1A 4ATOA 4FCYA 2IVWA 1MNDA 2J6KA 3BHTB 2EKOA 4DA4A 2RM4A 3H4CA 1YJ9Q 2BS3A 4YOZA 2LT4A 3NPFA 4BE2A 1M90U 4LDWA 3VYGB 1TD6A 3CC7T 1YCYA 4M7AF 3QWLA 3PTAA 3M54A 1AWWA 1NYFA 4BCMB 1JEGA 1S72A 1BU2A 4E2FB 1S72Q 4BDYA 1XJWB 1GUXA 2ED1A 1M90R 3OMGA 4M7AC 3DLLA 4BBSM 2DFUA 4EPCA 4RG8A 4UC4A 1VQNA 1N9SA 4RMOA 3QSUA 3M0QA 4E7IA 3RNJA 2D6FA 4FW2A 1AZGB 3I35A 4E47A 4IUQA 5KYUB 2LTOA 2JJ9A 3F70A 2C5OB 4GLKA 4J9CA 1UNHD 2VUBA 5GAMh 4M7DC 2FB7A 1SEMA 1IGUA 2ZPBB 2IG0A 5L2WB 3DB4A 3CCMT 1KD1U 4FYXB 5FU7C 3V8JA 3A1PA 2V8JA 5GAN3 5KYNA 1VOLA 2A0FB 3NTIA 4HA8A 2RI2A 1N9RA 2EQJA 1NPRA 4HXJA 3VS3A 1V1CA 4OB2B 2PU9B 2RI3A 3DB3A 4M75B 3E9FA 1YHQQ 1WX6A 2BS2A 2HNIA 4CRLB 2XG8D 2LX7A 2H3JA 2EIFA 5A0LA 4M78C 3DLMA 3HPWA 1BI1A 3H8ZA 4AKIA 1QWEA 2B8AA 2HEQA 1VQ5Q 2BIVA 2YLCA 4QKUA 1H1RB 2AK5A 3JCMh 2QI2A 4E7SA 2H8HA 2BKZB 1M3CA 4M7DF 2BS4A 2EPDA 2V1RA 4M77E 2BE9B 1GFCA 2C6TB 3JB9H 5ICPB 2HMAA 2CCHB 1BIAA 1VYUA 1AWJA 1E7OA 1M30A 1QVFA 4M7DG 1ZQ1A 2K2VA 2QQ8A 1ZBJA 2LRQA 4XU1A 2PNIA 4MMLA 1EZZB 3O8VA 2HSPA 4RCBA 3OYHA 1H641 3HBLA 1Q82C 2HQXA 2DO3A 3SHWA 1O75A 2KT1A 3CC4T 2ROLA 4EOLB 2IPOB 2I2LA 2KVQG 3A8GB 4QVCA 2MF2A 3EGUA 2RQTA 2K3XA 4PLIA 4OB3B 2K5IA 2LQWA 2DBKA 3VJPA 4J9DA 4NC6A 4WTOB 3CXCS 3CCEQ 1RL2A 5GANf 3HZJA 2LJ0A 1G5VA 4ANJA 4CC7A 1X2KA 4J9IA 4OP0A 1I81A 1P5EB 3JAME 1K8AC 2NUTB 2KRNA 1D0YA 5GANh 2RD1A 3OQ5A 3PE0A 2YWWA 3M59A 2L8DA 1WHGA 3I5RA 2JW4A 3BY7A 3RMQA 4C92A 2DVEA 2EJFA 4PFZA 1VQ6A 3EFOB 3A8LB 1XNIA 2CP6A 4J83A 3EFOA 2EQUA 3HP9A 2RQWA 2EFIA 4FSXA 4YOSA 2HQEA 3GLXA 1H27B 3LX7A 3X28B 3QYGB 4JRIA 2HKQB 3M0SA 4C5HA 5CYIB 4BCOB 3EG9B 1YI2T 2DIGA 4OMFB 2KROA 2QTVA 2DL4A 1VQ4T 1TUCA 4J9BA 2P4TA 3EG1A 4BI4A 3TVTA 1JKWA 3CD6T 5FGKB 2DK3A 2DETA 2LP5A 1OX8A 3M4YA 4EMGA 5HVYB 4DBQA 1KQSS 1IZ6A 1PKSA 1G2BA 4AI6A 3RESA
chains in the Genus database with same CATH topology
4QVZA 5KH6A 2RO0A 4C92D 2XDBA 1O9SA 2FHDA 4RKUE 3V8LA 3M58A 2D0QB 1VUBA 2XD0A 5GAOm 4NL3A 1PSEA 1VQOT 2AHJB 2R5MA 2RA2A 1YHQA 5D6WA 1XTDA 2YHTA 4X34A 5KE3A 3PIOA 1M8VA 2XIDA 4BBRM 1M9SA 3MEWA 5C6SA 1VQ9T 4D6WA 2MI6A 4O5VA 4R55A 4ZTFA 1OI1A 1KHCA 2R57A 4BI3A 2L5QA 4OB0B 3UWNA 1UEBA 5HY6A 1KG1A 1WQWA 3SDZA 4C0DB 1N8RU 1M5Q1 1XQHA 2L3RA 2DIQA 4KUIA 4QW2A 4C8QC 2ZPFB 3WVEB 2KMTA 1N6AA 4L59A 3CCUT 4LDVA 4M6VA 1YITT 2ZGWA 3L2QA 2QA4A 1VQ5A 2FVUA 1LNXA 3CEYA 3JCMe 3CCLA 5GAMg 1I4K1 2RJFA 3J81E 1N27A 3L42A 3GNFB 3OYMA 4LDYA 4BE1A 3G4ST 2FL7A 1NJIC 3Q1JA 1Q81C 2GFUA 1GXIE 5A0GA 4XU0A 2DXTA 1VQLT 1QP2A 2VYTA 3P8DA 2HAXA 4II1A 2RK1A 4MZTA 2KK4A 5GAMf 2YLBA 3G7ZA 1W2BA 3CCSA 4M7DA 4XAXB 3RKYA 5GMKl 2DTOA 2JTFA 3OB9A 1YIJT 2CZ0B 2DD4B 2E6ZA 3T9NA 2M0OA 4HL4A 4M7DB 4Y91A 2GQVA 1DJ7B 4XTZA 5GAMe 1FX7A 5KE2A 4XU3A 2ZPEB 2LC4A 2QTXA 4QQ6A 4C8QD 4JRQA 3WVDB 2G3RA 1N8RC 2OTLA 2DZCA 5GAOp 3HFOA 3JB9J 1KD1C 1R8OB 3G6EA 2DD5A 4ELJA 4HLQA 3CCET 1PSFA 3ZBDA 5CK9A 1M1GA 3L1AA 5LJ5h 3JB9I 3CCVT 4FIBA 1G3YA 5CAIA 4PNOA 5DLQE 5I2SA 1QVPA 3OS5A 2QEXT 3L2UA 4M7DE 3OBWA 2E5QA 4EMKA 4EMHA 4X9DA 3FC3A 2JN0A 1NJIU 5L8RE 2CYZB 5DY9A 2OAUA 1D3BA 2D9TA 3MEVA 1YJ9T 2Y90A 2WSEE 4Y28E 3RKWA 4BY6C 2LVMA 3P8HA 3SWNB 2RHIA 3JCMX 5GAOn 4OGCA 3OYAA 3QZ9B 5LL6S 1W2BS 1K9MC 2QF7A 3X26B 2DAQA 2LQ8A 4M78G 4N4GA 3GP8A 3CC7A 3CCJT 4C92F 3HRSA 4E7KA 4HT9A 3CMET 1JB0E 1ZBXA 1S72T 3I55A 1KQ1A 4C5IA 4DOVA 3QHSA 1X01A 3OW2S 3FRNA 4Q5WA 1M90C 2HBPA 5CVIA 1WJQA 1SSFA 2E64A 4RG2A 3ME9A 4A4FA 3JCMd 3OS0A 2E12A 4QVDA 4PJOA 1ZHIA 3JB9G 2K5LA 4E7LA 5HKCA 4QQGA 4M78A 4M7DG 1BI0A 1MHNA 2EWNA 2JUFA 2X35A 2G77A 2KR6A 1Q86U 1VQ7T 5LJ5d 2EQMA 1QW1A 3INZA 2E41A 3OMCA 2P0PA 3UDCA 4ZN3A 3QKJA 3S6WA 5CCAA 1JJ2S 4M7AB 4OB1B 3SFMA 2F5KA 1K9MU 3ZEHA 4HNTA 1X75C 1WQ7A 2QQBA 2X4JA 5GAN2 1Q82U 3AHUA 4C8QF 1B34B 4KT0E 1QVGA 4C0FA 4IKFA 1K73C 1IREB 2A3LA 2X4WA 4LOCA 1VQ4A 4LD9K 3RERA 2O4XA 5FROA 3CMAA 2QQSA 4VUBA 2XICA 1E7PA 2BUDA 3ZFJA 3L2RA 4AKHA 2DD4A 3MP8A 4A4KA 3NFCA 3OW2A 1Q7YU 1UB4A 4M77F 4NL2A 2RJCA 4PJOG 3G71A 1UGPB 3JSCA 4EMKC 3OS1A 1P92A 3FDRA 3OYJA 3HO8A 1G3TA 2KSSA 4IUPA 4M75E 3JCMJ 2QXFA 2QFZA 2K57A 3MEUA 1BI3A 5GANg 4XK8E 1OZ2A 4JUVA 1VIEA 3BG3A 2RI5A 4N0AC 5LJ3h 5C0MA 5GMKh 3BDUA 1LJOA 3VUBA 4CI0C 4HT8A 5GAOq 1U1TA 2XHCA 3GNGA 4EMKB 4L6V5 1I5LA 5FRMA 1BI2A 2RHYA 1U1SA 3JCMV 1WGSA 2LT1A 3PMTA 1KQ2A 3HRUA 1VQ8A 3SWNC 4M7AA 1QVGS 3DL1A 1YHQT 5CKEA 4MZMA 4XQ3A 5GANd 3CCQA 4M75F 4Z6YA 4NS5A 1VQ9A 3MP6A 2ZPGB 1Y7XA 1UGQB 2JOYA 3LYIA 3PT9A 4F7UE 5GANj 5GAOr 1LOJA 3JB9F 4C8QE 2E1HA 3CBPA 3A8OB 4FT2A 4MDXA 3KHIA 3DKMA 3E9GA 1HK9A 3TW7A 3MCAB 3CCUA 3TW6A 4TVRA 5LJ3f 1K73U 2LQKA 2VXFA 3FEOA 3CPWA 4QSHA 2QA4T 3E19A 4MMKA 3VKIA 1KC8C 1VQ5T 3CCLT 5GAOl 1NE8A 3OYCA 2QDJA 1M1FA 4FM4B 3H6ZA 4A54A 4ZGDB 3CBOA 3META 5IN1A 5J3BA 4C8QG 1Q86C 3G4SA 4E7JA 5GAN6 2DXBB 5CKBA 5CIUA 2DPPB 5GMKe 2KY9A 2JVVA 5GAMj 2VV5A 3L2VA 4WF2A 1OZ3A 4XTYA 4BUGA 4JJNK 3MEAA 4J6WA 4J7IA 3V7SA 4C8QA 4JX5A 1VQMT 2RB6A 4M77G 4BI8B 3NTKA 2K4YA 1MGQA 1YIJA 3GOXA 1HXDA 5A0DA 2XDDA 2DXCB 3OSVA 3PIPA 3V7CA 3CCRT 3UPUA 2NLUA 2A7YA 3LGFA 2O4XB 1U8RA 1JBMA 2XDPA 4M78E 4BDZA 3EFSA 1YJNA 3RUXA 3C12A 4C92B 1I8FA 4ME7A 4C0ZA 3CXCA 3CCEA 4PJOC 3CPWS 4V2SA 3RIRA 3CCVA 2KMGA 3TREA 3ER0A 4M77B 4M77D 4XTWA 3EAEA 1WPYA 2QEXA 2EQKA 2Y4XA 3OBYA 3C4SA 5LJ3e 4ZN1A 5A2QE 4ZTJA 1BKBA 4ATOA 4C5GA 2IVWA 5CKDA 1YJ9A 2EKOA 4DA4A 2RM4A 4M75G 3H4CA 3MO8A 3JCMc 2BS3A 3M5AA 2LT4A 4C8QB 4DQ2A 5GAN5 3CC4A 4BE2A 5GANe 2RHUA 1M90U 4LDWA 3QYBA 3VYGB 5CQXA 3JB9D 1YCYA 5D6XA 3V7RA 3CC7T 5GAN7 3CCJA 4M7AF 1WJRA 3QWLA 2PVGB 4F7UF 3CMEA 3V8KA 5M9OA 3M54A 2M16A 5DM7R 3PTAA 1X6OA 3M57A 2ZPHB 5J26A 3I55T 1S72A 3JCMg 1M1KU 4JX4A 2LCLA 4J5YA 5GAN8 2P0KA 4BDYA 3J80E 3JCMW 4M78D 3OS2A 5LJ3d 3OMGA 4M7AC 3VUZA 3DLLA 4BBSM 3KBGA 3PNWC 3QUIA 4BE0A 2ZPIB 2JTMA 4EPCA 3QPHA 4RG8A 4UC4A 2WACA 1VQNA 3E1SA 2DZ9A 1G3WA 1W4SA 1N9SA 4MZPA 5FU7B 2LX9A 5HK3A 3OYEA 2XI9A 5LJ5f 2QQRA 3LH0A 4RMOA 4EDUA 4ZGEB 3R6OA 3QSUA 4M77A 2E70A 3CBMA 4IUTA 4DOWA 1VQ7A 2RHXA 4C5EA 5FU6C 4E7IA 4LDXA 2GCXA 1B34A 2ZCFB 3HRTA 3JCMP 3HFNA 1VIFA 1Y96B 2D6FA 1YJWT 2EJ9A 4IUUA 4E47A 4PJOE 4IUQA 5LJ5g 2LTOA 3OYLA 1Q81U 1Y96A 1AHJB 2E65A 4OF1A 3F70A 4BACA 4O6JA 4Z02A 4J6YA 3M53A 4XTUA 2CGHA 3CMAT 2XKOC 1FXXA 4GLKA 4IUVA 4N4IA 4X9CA 2VUBA 1VQ6T 3FIFA 5GAMh 4MDWA 4M7DC 2FB7A 3G71T 3QYHB 2PVDB 1OYXA 2ZPBB 4A53A 3OYFA 4KBMB 3OA6A 4JS4A 2KAFA 2IG0A 3QO3A 4HCCA 3QBYA 3BFMA 3DB4A 4ELZC 3CCMT 1KD1U 5FU7C 3A8MB 2L89A 3V8JA 4AKGA 2V8JA 3VU3C 4A4HA 5FLXE 5GAN3 5LJ5j 3VV0A 3FJPA 4N0AA 2WSCE 3NTIA 4HA8A 4FU6A 3M9QA 4KULA 3I56T 2RI2A 1N9RA 2V8IA 1VQPA 2LNVA 5CO7A 2EQJA 4B9XA 3CC2A 4M7AG 1NPRA 1JRIA 3PFSA 4KUDK 3NTHA 1H3ZA 4MFEA 4OB2B 2PU9B 4F7UB 2C06A 3X20B 2RI3A 3DB3A 2M9UA 4GY5A 4OGEA 5I2MA 1YI2A 3KXTA 4M75B 1VQ8T 5GMKi 5AYFA 1WNLA 1VQKA 5CKFA 2PUOB 4HNUA 4HNVA 3E9FA 3CCQT 2BS2A 2HNIA 3TEEA 4XTXA 2XG8D 1M1KC 2H3JA 4MFDA 2EJGA 3OYKA 3CD6A 2EIFA 5A0LA 2Y4YA 3M55A 4M78C 2JNGA 3DLMA 4M7AD 3HPWA 1BI1A 4JLGA 4PL6A 4BD3A 3OYIA 2VGNA 5J39A 4C92G 3H8ZA 3OYYA 4AKIA 2OTJA 2CZ6B 2XK0A 4ZGJB 2B8AA 5LJ3j 2BIVA 2YLCA 2GFAA 4M78F 3GPLA 2X4XA 5GMKm 3BG5A 4PJOF 3VKHA 1QP3A 3GIBA 4FT4A 5FRNA 3JCMh 2QI2A 3UT1A 2E6NA 1FKMA 3BG9A 3S3NA 2DTHA 3TCJA 2R58A 2R5AA 3PMIA 4M7DF 3A8HB 1M4ZA 3VKGA 2BS4A 4M75D 3SD4A 4M75C 5IAYA 3OYNA 1VQOA 3LWIA 1VQMA 2DJZA 3KUFA 1D3BB 4IURA 2DKGA 4M77E 4PKCC 2QQ9A 4M75A 4E7HA 3CCRA 3JB9H 4BB7A 2EAYA 1NPPA 3PGGA 1UGRB 3JRZA 2X4YA 3CPFA 1BIAA 5DLOA 2RJEA 5LJ5e 1EIFA 1YJNT 3M4GA 3LW5E 2VGMA 2BKDN 3QYEA 1Q7YC 3HKSA 1QVFA 2E10A 2DD5B 4J8OA 2K2VA 1ZQ1A 2QQ8A 3OYBA 4XU1A 2LRQA 1YITA 4MMLA 4J7FA 3O8VA 3SB2A 5KCOA 1Y71A 5GMKj 3N5BB 2K3YA 2K5FA 4LDUA 4RCBA 3OYHA 3HL8A 1H641 1KHIA 3ASKA 3HBLA 4C92E 2MMPA 4HCZA 4N4HA 5D6YA 1Q82C 2HQXA 2DO3A 4OVAA 3MP1A 1O75A 4C92C 1VQLA 3HSBA 3J7AF 2PUKB 2CKKA 5HK0A 3CC4T 1WJSA 4L5GA 4XU2A 3QXEB 4PLLA 2I2LA 2YRVA 2KVQG 3A8GB 1XOVA 2MF2A 4QVCA 5KCHA 3CCST 3QJYA 4J6XA 3JCMQ 2WJ9A 3OSSC 2FYKA 2K3XA 4A4EA 4JX6A 4PLIA 4OB3B 2K5IA 5CKHA 1UGSB 3VJPA 2RK2A 4NC6A 3VYHB 1Y07A 3LWHA 2CZ1B 2OTLT 5EG2A 2ZZDB 4NOYA 1QVFS 3CXCS 4PJOD 1RL2A 2O01E 3FB9A 2DXUA 3HZJA 5GANf 3FLGA 3G6ET 1G5VA 4BY6B 2WSFE 4C0DC 1BIBA 1VQNT 2MAMA 3BDLA 4HCBA 3BW1A 4PJOB 3GF5A 5CQYA 4OP0A 4C0GA 1NZ9A 1I81A 3L2ZA 3JAME 4B9WA 1K8AC 2JZ2A 4FL6A 5GANh 3L2WA 2RD1A 3OQ5A 4MIMA 3M59A 2RJDA 1YJWA 1JJ2A 3EFRA 2L8DA 2DXCA 4JLIA 2KQWA 2RH2A 5GAN4 3RMSA 3M56A 3BY7A 3RMQA 3SWNA 4C92A 4ELYC 2DVEA 3TU4K 1BYMA 2EJFA 2F69A 1VQ6A 4M7DD 2EYQA 4QQDA 3X25B 5LJ3g 3A8LB 1XNIA 4M7AE 3C95A 3HHTB 4J83A 1QLBA 4HKEA 5EJCA 2CS7A 1KC8U 3A5ZB 2ZZDA 4A4GA 2EQUA 2QDYB 1G3SA 3HP9A 2EFIA 4JRPA 3QIIA 4FSXA 3CCMA 2VXEA 3QJ6A 3RKXA 1KQSA 2HQEA 2DTIA 1K8AU 3GLXA 3X24B 4M77C 4F7UA 2XU8A 3I56A 3CC2T 2QQAA 1VQPT 2M1HA 3QZ5B 2RHZA 3LX7A 4YTLA 2DXBA 2MWOA 3VYGA 3X28B 3QYGB 3JCMb 4JRIA 4C5HA 2DEQA 4M78B 1V29B 2V8KA 4XTVA 2KDSA 2PVOB 2LDMA 3LGLA 1YI2T 4RCCA 2DIGA 4OMFB 2LCCA 4JDSA 1VQKT 1FWZA 1TH7A 3QG1A 3P8BB 5GAMd 1VQ4T 2P4TA 3QDRB 2F5TX 5FU6B 4BI4A 2GF7A 4CRIA 2HD0A 3OY9A 3CD6T 4R56A 2CZ7B 4JS5A 3HB9A 2DK3A 3C94A 5I21A 5IT9E 1YBYA 1RI0A 3LLRA 3JCMf 3M4YA 2MWPA 4F7UG 4EMGA 2OTJT 3WXMB 4LD6A 3S3MA 3OYGA 1KQSS 5CR2A 1IZ6A 3URGA 4AI6A 4JRKA 2PQWA 3MHXA 3OYDA 4P5NA 3S3OA 2VC8A 2P0QA 3RESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KT0 E;  1IRE B;  4RKU E;  2D0Q B;  2ZPI B;  1PSE A;  2DD4 A;  2AHJ B;  1UGP B;  4ZGE B;  2PUK B;  3QXE B;  3A8G B;  2ZCF B;  4OB0 B;  4XK8 E;  2ZPF B;  3WVE B;  4OB3 B;  1AHJ B;  1UGS B;  3VYH B;  2CZ1 B;  2ZZD B;  4L6V 5;  2O01 E;  2WSF E;  1GXI E;  3QYH B;  1QP2 A;  2PVD B;  2ZPB B;  2ZPG B;  1UGQ B;  3A8M B;  2DD4 B;  2CZ0 B;  3A8O B;  2DXC A;  2WSC E;  1DJ7 B;  2ZPE B;  3WVD B;  4OB2 B;  4FM4 B;  2PU9 B;  3X20 B;  4ZGD B;  2DD5 A;  1PSF A;  2DXB B;  2PUO B;  2DPP B;  3X25 B;  3A8L B;  3HHT B;  2ZZD A;  2QDY B;  5L8R E;  2CYZ B;  2WSE E;  4Y28 E;  2DXC B;  3X24 B;  3QZ9 B;  3VYG A;  3QZ5 B;  3X26 B;  2DXB A;  3X28 B;  3QYG B;  2CZ6 B;  4ZGJ B;  1JB0 E;  1V29 B;  2PVO B;  1QP3 A;  3A8H B;  2CZ7 B;  3VYG B;  1UGR B;  2PVG B;  3LW5 E;  4OB1 B;  2ZPH B;  2DD5 B; 
#chains in the Genus database with same CATH topology
 4QVZ A;  5KH6 A;  4OMO A;  1OQK A;  4C92 D;  2E5K A;  2MCN A;  2EBP A;  3EH2 A;  3M58 A;  1VUB A;  2XD0 A;  4NL3 A;  3BLR B;  2AHJ B;  1YHQ A;  1M8V A;  1E9H B;  2YHT A;  2E3H A;  1UE9 A;  2XID A;  2IW9 B;  3TN8 B;  3MEW A;  2B9R A;  5C6S A;  1ZLM A;  4O5V A;  3H0F A;  2R57 A;  2L5Q A;  5HY6 A;  1KG1 A;  3SDZ A;  1M5Q 1;  2KT8 A;  1N6A A;  4L59 A;  1YIT T;  4LDV A;  4M6V A;  1Q82 R;  3QDF A;  3L2Q A;  1LNX A;  3CCL A;  1T0H A;  3L42 A;  2C4G B;  1PRL C;  3GNF B;  3OYM A;  3G4S T;  2FL7 A;  2CDT A;  2KYB A;  2QG9 B;  2DXT A;  4XU0 A;  1ZSZ C;  3P8D A;  3QWX X;  2KK4 A;  5GAM f;  2YLB A;  1TUG B;  4XAX B;  3RKY A;  1AVZ C;  2DD4 B;  2E6Z A;  2O31 A;  2O88 A;  2GTO A;  4ROC A;  2F1L A;  1FX7 A;  4CFX B;  4JRQ A;  2OTL A;  4BY1 X;  2DZC A;  5GAO p;  3HFO A;  3JB9 J;  1KD1 C;  4ELJ A;  1PSF A;  5CK9 A;  1RLQ C;  1VQN Q;  3QWY A;  4PNO A;  4HVV A;  2CCI B;  1WHJ A;  4PFO A;  4DEX A;  3L2U A;  4M7D E;  3OBW A;  4F17 A;  4BY6 C;  2LVM A;  3SWN B;  2RHI A;  5GAO n;  1W2B S;  1K9M C;  3LQ5 B;  2DAQ A;  4HT9 A;  4E7K A;  4HVU A;  2HL5 C;  2UUE B;  1KQ1 A;  4LUD A;  1K9A A;  4Q5W A;  3G1J A;  2K9G A;  2BPM B;  1G83 A;  2RF0 A;  2HCK A;  1WA7 A;  4KH0 B;  3JB9 G;  1OU9 A;  1BI0 A;  2F2X A;  2EWN A;  2X35 A;  2KR6 A;  1ZA1 B;  1Q86 U;  4HCK A;  5LJ5 d;  3INZ A;  2E41 A;  1B07 A;  3OMC A;  3UDC A;  1YJW Q;  3QKJ A;  1D1B A;  1TTH B;  1VOM A;  3DDP B;  5KYY B;  2QQB A;  1RAH B;  1Q82 U;  2RQV A;  2J6O A;  4PK4 A;  4C8Q F;  1H1P B;  4KT0 E;  2ESW A;  3EG0 A;  1K73 C;  2A3L A;  1TFB A;  2DEU A;  4BCF B;  1Q7Y U;  3NFC A;  1TG0 A;  1UB4 A;  4PJO G;  1RAI B;  4Z88 A;  1WHM A;  3JCM J;  1ZUK A;  3NMZ C;  1C0M A;  2BE7 D;  5GAN g;  1OZ2 A;  1FMK A;  2RI5 A;  5C0M A;  3BDU A;  5IDN B;  4CI0 C;  3G33 B;  4HT8 A;  3DOG B;  5GAO q;  4L6V 5;  1I5L A;  1X27 A;  1T3L A;  1HYO A;  1HJD A;  2RN8 A;  1GCQ C;  4EOI B;  3HRU A;  1VQ8 A;  1QVG S;  1ZP2 A;  1GCQ A;  4F04 B;  4CFM B;  2LW4 A;  2MOX A;  3CCQ A;  3IQL A;  4NS5 A;  1VQ9 A;  2HDA A;  2ZPG B;  1UGQ B;  1WHK A;  2QYZ A;  2WFY B;  2DME A;  2MYS A;  4I3Z B;  1SF9 A;  3E9G A;  4R0K A;  3BLQ B;  3TW7 A;  3CCU A;  2QA4 T;  3E19 A;  4MMK A;  1KC8 C;  1IXD A;  1SPK A;  1NE8 A;  2QDJ A;  2V26 A;  3H6Z A;  4FM4 B;  4CC4 B;  3TSW A;  3MET A;  1Q86 C;  2WMA B;  2WMB B;  2KY9 A;  3MPU B;  1OUL A;  3L2V A;  4WF2 A;  2CUB A;  4J6W A;  4J9E A;  4JX5 A;  4M77 G;  2VB6 A;  4BI8 B;  3NTK A;  1HXD A;  4KGX B;  2DXC B;  2YRC A;  3LGF A;  4PJM A;  1SG5 A;  2O4X B;  4M78 E;  4A63 B;  3EFS A;  1PWT A;  1TU0 B;  3RBB B;  1K4U S;  4RTT A;  3RUX A;  3C12 A;  4RTW A;  4PJO C;  3CCV A;  1Q86 R;  2CP3 A;  3CCV Q;  2QEX A;  2EQK A;  1X2Q A;  2QEX Q;  5EC7 A;  1YJ9 A;  2YUO A;  4C8Q B;  5HCK A;  1PHT A;  3JB9 D;  5D6X A;  1PC0 A;  4F7U F;  3B57 A;  3CME A;  3V8K A;  2M16 A;  3BHU B;  3M57 A;  5J26 A;  4JX4 A;  4KRD B;  2P0K A;  3J80 E;  1O9K B;  4M78 D;  3OS2 A;  3VUZ A;  3KBG A;  2O2O A;  3QPH A;  3E1S A;  1G3W A;  1W4S A;  2KI7 A;  3VRY A;  3OYE A;  5HK3 A;  1ZUY A;  5LJ5 f;  2QQR A;  4ZGE B;  4M77 A;  2E70 A;  4DOW A;  1PD0 A;  4LDX A;  4EOR B;  2GCX A;  2RNA A;  3HFN A;  1VIF A;  1IRX A;  2EJ9 A;  4PJO E;  3OYL A;  1AHJ B;  4OF1 A;  4Z02 A;  2RPN A;  4CFU D;  3M53 A;  4XTU A;  2FZG B;  2XKO C;  4IUV A;  3FIF A;  4AFQ C;  3G71 T;  1H3H A;  4BCJ B;  2L3S A;  3A8M B;  4AKG A;  4A4H A;  1B7T A;  4ZNX A;  3FJP A;  5LJ5 j;  4N0A A;  1ZX6 A;  1M2V B;  4WCI A;  5DQV A;  3I56 T;  1QVG P;  2WIP B;  2V8I A;  1VQP A;  3CC2 A;  4M7A G;  2KE9 A;  1AZE A;  1JRI A;  1D3U B;  4KUD K;  1WXB A;  4MFE A;  2WEV B;  5KYY A;  3X20 B;  1VYT A;  1B3Q A;  2JS0 A;  4OGE A;  5I2M A;  3OW2 P;  5AYF A;  1WNL A;  1VQK A;  2F2W A;  4HNV A;  1WDX A;  2FEI A;  1PRM C;  2KBT A;  3TEE A;  1YWO A;  1ARK A;  4XTX A;  2FZK B;  2IN3 A;  4F70 B;  1MUZ A;  1OL2 B;  2C0O A;  2Y4Y A;  3M55 A;  2DRK A;  2JT4 A;  1X6B A;  4BD3 A;  1LVK A;  2VGN A;  2OTJ A;  2PMI B;  1D09 B;  2LCS A;  2GQI A;  2GFA A;  2HSE B;  3CXC P;  3CCL Q;  2X4X A;  3BG5 A;  1H24 B;  1QP3 A;  2E6N A;  4KGZ B;  3TCJ A;  1KD1 R;  3A8H B;  3VKG A;  3EHR A;  2DJZ A;  2QQ9 A;  2LJ3 A;  3CCR A;  2EAY A;  1VA7 A;  1M3A A;  5LQF B;  5LJ5 e;  1OKW B;  3EH1 A;  1QQJ A;  3QYE A;  1D0Z A;  1A0N B;  4EON B;  5KCO A;  3N5B B;  3AT1 B;  1FMV A;  1K0X A;  1N8R R;  1C1A A;  4HCZ A;  5D6Y A;  5LMK B;  4OVA A;  1H26 B;  4C92 C;  1VQL A;  2KYM A;  2PUK B;  2ED0 A;  1WJS A;  3QXE B;  2YRV A;  1BB9 A;  2CUD A;  3JCM Q;  4CFN B;  5CKH A;  2J6F A;  2M51 A;  2DBM A;  1QVF S;  4BY6 B;  4C0D C;  2X9H A;  4BCN B;  2MAM A;  4HCB A;  2OI3 A;  2QAZ A;  4FYV B;  1YCS B;  3FJ5 A;  4MIM A;  2L0A A;  1YJW A;  2NUZ A;  2RJD A;  4BCK B;  1JJ2 A;  3EFR A;  4JLI A;  2JXB A;  2NWM A;  4ESR A;  5GAN 4;  3CME Q;  3RMS A;  2F69 A;  2EYQ A;  4QQD A;  5LJ3 g;  1S1N A;  3C95 A;  3MI9 B;  1GBQ A;  1UHF A;  1QLB A;  3A5Z B;  2ZZD A;  1G3S A;  1FIN B;  3CCM Q;  3RKX A;  5HBE B;  1K8A U;  3X24 B;  4M77 C;  4YTL A;  2DXB A;  2DM1 A;  5GJV B;  4M78 B;  4XTV A;  2DYI A;  2LDM A;  1VQ8 Q;  1OX9 A;  3P8B B;  3GBQ A;  2CP0 A;  2V22 B;  4EC9 B;  3CCQ Q;  5FU6 B;  1PNJ A;  4D8D A;  4R56 A;  4CFW B;  3C94 A;  1IB8 A;  5HBH B;  2EUF A;  4F7U G;  2QGS A;  5KYX B;  3M03 A;  4LD6 A;  3OYG A;  1JJ2 P;  3URG A;  4RUG A;  4JRK A;  2PQW A;  3S3O A;  2EKH A;  2YT6 A;  2RO0 A;  4Z8A A;  2XDB A;  1O9S A;  2D0N A;  2DRM A;  4RKU E;  2NUT A;  1WXT A;  2LJ1 A;  1VQO T;  3R6N A;  2XMF A;  5D6W A;  4X34 A;  3RR6 A;  1BU1 A;  4M4Z A;  5KE3 A;  1M1K R;  1M9S A;  1NG2 A;  3NGP A;  1ZA2 B;  1R77 A;  4ZTF A;  2K3B A;  1N8R U;  1BK2 A;  4C8Q C;  2JMA A;  2DIQ A;  2L3R A;  2K79 A;  1E6G A;  3JCM e;  1I4K 1;  1RLP C;  2AKK A;  4Y92 A;  4LDY A;  4BE1 A;  1NJI C;  2OJ2 A;  5A0G A;  2COZ A;  1RAB B;  2VYT A;  2E4H A;  2JS2 A;  1GY3 B;  2RK1 A;  1VQM Q;  4EOJ B;  4OMP A;  1W2B A;  4KGV B;  3CCS A;  2B86 A;  4M7D A;  3CCR Q;  1YIJ T;  2CZ0 B;  3T9N A;  5KYU A;  2K2M A;  2M0O A;  4M7D B;  4XTZ A;  4XU3 A;  4CXA B;  4C8Q D;  4LN2 A;  1N8R C;  1NJI R;  2CH4 A;  1R8O B;  2CP2 A;  3G6E A;  3CCE T;  1QKX A;  3H9N A;  3ZBD A;  3G6E Q;  3L1A A;  1CKA A;  2M02 A;  1ABQ A;  3JB9 I;  1QVP A;  3OS5 A;  1QLY A;  3VS4 A;  4EMK A;  5L8R E;  2WPA B;  1D3B A;  3MEV A;  2Y90 A;  2WSE E;  3EGD A;  1Q7Y R;  3P8H A;  3JCM X;  3QZ9 B;  1K0S A;  3CC7 A;  3X26 B;  4N4G A;  3GP8 A;  3HRS A;  5HQ0 B;  2LQN A;  1S72 T;  4BCM D;  3OW2 S;  1Z9Z A;  1WFW A;  1WI7 A;  2HBP A;  5CVI A;  3UA7 A;  4E7L A;  2DE0 X;  4QQG A;  2K6D A;  2MK5 A;  2DL5 A;  1D1C A;  2EQM A;  1SHF A;  4ZN3 A;  1VQP Q;  2P0P A;  1GH6 B;  5IH2 A;  1PKT A;  4M7A B;  1OGU B;  1X75 C;  2CP7 A;  2I40 B;  5ECA A;  1B34 B;  2HBW A;  4IKF A;  2ROT A;  4EOQ B;  2W2H A;  4VUB A;  4AKH A;  2DD4 A;  3MP8 A;  4A4K A;  4AG2 C;  4NL2 A;  2A28 A;  2RJC A;  3VS6 A;  1UDL A;  3CD6 Q;  3FDR A;  3EGX A;  1YP5 A;  2E3I A;  1AWO A;  1W2B P;  3VUB A;  3I9Q A;  1W98 B;  1X69 A;  1BI2 A;  2RHY A;  2EQI A;  1U1S A;  2DMO A;  2PTK A;  1KQ2 A;  1D1A A;  1OU8 A;  5CKE A;  5GAN d;  1MMD A;  4Z6Y A;  1YN8 A;  2JOY A;  3JB9 F;  4C8Q E;  2EW3 A;  3CBP A;  4OML A;  4MDX A;  1HK9 A;  4HVW A;  2L3Q A;  3JV3 A;  1M3B A;  5LJ3 f;  3FEO A;  4E6R A;  2BZX A;  1VQ5 T;  3VKI A;  1X43 A;  1FYN A;  5GAO l;  2IVX A;  4A54 A;  1UUE A;  3CBO A;  5IXB A;  3M0U A;  4E7J A;  4GBQ A;  1XO2 A;  3SEM A;  1OZ3 A;  3EID B;  5I5Z B;  4J7I A;  1OEB A;  4JZ3 A;  5HBJ B;  1MGQ A;  1KFZ A;  3GOX A;  2XDD A;  1Y57 A;  1U8R A;  2J7I A;  4BDZ A;  1K9M R;  4C92 B;  3MY5 B;  1R0C B;  3CPW S;  2A37 A;  2ECZ A;  3VS5 A;  2CH4 W;  4M77 B;  4XTW A;  1WPY A;  3OBY A;  3C4S A;  5A2Q E;  4ZTJ A;  2NUP B;  2D8J A;  1HSQ A;  3JCM c;  3M5A A;  5GAN 5;  5FWB A;  3CC4 A;  1H28 B;  3QYB A;  3CCS Q;  3V7R A;  5GAN 7;  3CCJ A;  2PVG B;  3CCJ Q;  5DM7 R;  2X51 A;  2ZPH B;  3I55 T;  1OOT A;  3JCM g;  2LCL A;  5GAN 8;  3JCM W;  1WYX A;  4IIM A;  1OPL A;  2QDL A;  1SRL A;  3PNW C;  3QUI A;  4BE0 A;  1PKD B;  2JTM A;  5CEI B;  5FU7 B;  4MZP A;  4LXC A;  1ZSG A;  3LH0 A;  2X3X D;  4EDU A;  2VKN A;  1BCM A;  3CBM A;  1VQ7 A;  3THK A;  4C5E A;  2DIL A;  3HRT A;  1VQ7 Q;  3BLH B;  1Y96 B;  4OGR B;  1Q81 U;  1Y96 A;  1GL5 A;  4BAC A;  4Y72 B;  4O6J A;  2M0Y A;  1YNZ A;  1HD3 A;  4J6Y A;  3CMA T;  2LNH B;  1AWX A;  1FXX A;  4X9C A;  1VQ6 T;  4ROE A;  1KK7 A;  2KRM A;  2BZY A;  3OYF A;  4A53 A;  4HCC A;  3QO3 A;  2HQH A;  2QK0 A;  3VU3 C;  5FLX E;  3DTO A;  3VV0 A;  2WSC E;  3CC2 Q;  4FU6 A;  2AT1 B;  2LNV A;  1RAC B;  1NEG A;  3NTH A;  1YI2 Q;  1H1S B;  2AZS A;  4F7U B;  2C06 A;  1M90 C;  1VQK Q;  2M9U A;  1YI2 A;  3KXT A;  5GMK i;  1KIK A;  2PUO B;  1VQ4 Q;  1UGV A;  2COY A;  2DL7 A;  4JJB A;  1M1K C;  2UZD B;  3U23 A;  2W99 A;  4MFD A;  2EJG A;  4F7N B;  3OYK A;  3CD6 A;  2JNG A;  2OTJ Q;  4JLG A;  3OYI A;  4AFS C;  1JU5 C;  2DJQ A;  3OYY A;  2KEA A;  4OR5 B;  5LJ3 j;  1UNL D;  2W9Z A;  3EOC B;  4EOM B;  1OIU B;  4FT4 A;  5FRN A;  3UT1 A;  1WHH A;  1VYW B;  3S3N A;  2PK9 B;  2R5A A;  2C0T A;  4D8K A;  5IAY A;  1RI9 A;  3SD4 A;  1VQM A;  2GTJ A;  4JPB W;  4IUR A;  2DKG A;  1TUD A;  4CFV B;  1T0J A;  1LPL A;  3PGG A;  3JRZ A;  2X4Y A;  2WXV B;  2W96 A;  3CPF A;  1YJN T;  3M4G A;  1NYG A;  3LW5 E;  2VGM A;  1Q7Y C;  1YIT Q;  1W70 A;  2HL3 A;  1YIT A;  2JMC A;  2L3P A;  3SB2 A;  1Y71 A;  3EJ1 B;  5GMK j;  2K5F A;  3HL8 A;  1KHI A;  3ASK A;  4CC3 A;  1PCX A;  1VQL Q;  1NLP C;  4II5 B;  3MP1 A;  3HSB A;  3J7A F;  3EG3 A;  2CKK A;  4L5G A;  3QJY A;  2CT4 A;  2WJ9 A;  2AZV A;  3OSS C;  4A4E A;  2RK2 A;  5IHI A;  4LE9 A;  3VYH B;  1AOJ A;  1Y07 A;  2ATC B;  2CZ1 B;  1RAD B;  3LWH A;  2OTL T;  2ZZD B;  4KRC B;  2O01 E;  2YDL A;  2WSF E;  1BIB A;  2CRE A;  1VQN T;  4PJO B;  3BW1 A;  3GF5 A;  4C0G A;  3L2Z A;  3CPW P;  4FYW B;  3L2W A;  4UN0 A;  5DQW A;  2R7G A;  1AD5 A;  1VIN A;  1MMN A;  2I0N A;  3M56 A;  1UTI A;  3TU4 K;  1BYM A;  1AEY A;  4TTH A;  2G6F X;  4M7D D;  1WLP B;  3TNH B;  3POM A;  1AD6 A;  2F2C A;  3HHT B;  4HKE A;  1KC8 U;  1MMG A;  1RAG B;  2H3E B;  4EOO B;  4JRP A;  3CCM A;  3REA B;  4F6W B;  4KH1 B;  1SKU B;  2NYS A;  3QJ6 A;  3CQT A;  1TXQ A;  2DTI A;  4J9H A;  1GRI A;  1JXO A;  2QQA A;  1SRM A;  3QZ5 B;  2RHZ A;  3VYG A;  2MWO A;  2DEQ A;  1V29 B;  1NEB A;  2V8K A;  2CJM B;  4AT1 B;  3LGL A;  2J06 A;  4RCC A;  1TS9 A;  1TH7 A;  4DBH A;  2CSI A;  3QDR B;  2F5T X;  4CRI A;  3HB9 A;  1URC B;  5IT9 E;  1YBY A;  1RI0 A;  3JCM f;  2EGA A;  2MWP A;  3WXM B;  1KC8 R;  5CR2 A;  3UAT A;  1Q95 G;  2PK2 A;  1AIS B;  3MHX A;  4P5N A;  3DDQ B;  2FHD A;  4F6U B;  2FPE A;  2RA2 A;  1GCP A;  1XTD A;  3PIO A;  3PO3 S;  4E7Z A;  2FRW A;  1VQ9 T;  2MI6 A;  4R55 A;  1OI1 A;  1KHC A;  2KXC A;  4BI3 A;  1WQW A;  4KUI A;  2D1X A;  2KMT A;  3PVQ A;  3CCU T;  2W0Z A;  2ZGW A;  2QA4 A;  1W1F A;  3CEY A;  2VAS A;  1K1Z A;  2RJF A;  2CP5 A;  5GAM g;  3J81 E;  3PVL A;  2J05 A;  1C6V X;  2PZ1 A;  1WHL A;  1QP2 A;  1UEC A;  4RTZ A;  2HAX A;  4PFP A;  2EYY A;  4II1 A;  4MZT A;  4GLM A;  2P84 A;  3G7Z A;  1RAE B;  1I0C A;  2DTO A;  2JTF A;  5AT1 B;  4IMY B;  2EYZ A;  1I07 A;  4Y91 A;  2GQV A;  5KE2 A;  4FX3 B;  1ZSZ A;  2LC4 A;  1UJ0 A;  2O9S A;  2O9V A;  1QCN A;  1JST B;  4HLQ A;  3EG2 A;  1M1G A;  2Z0W A;  2HKN A;  1KSW A;  2AKL A;  2YXY A;  4FIB A;  1G3Y A;  5CAI A;  3CCV T;  3QHR B;  5I2S A;  2QEX T;  4F6S B;  1H1Q B;  1QCO A;  4CC2 A;  4X9D A;  2C5N B;  1H92 A;  5DY9 A;  2OAU A;  1YJ9 T;  4Y28 E;  2K7A A;  3RKW A;  3CC7 Q;  3OYA A;  4OGC A;  5LL6 S;  2QF7 A;  2LQ8 A;  4C92 F;  1I5O B;  2RQR A;  3CME T;  1JB0 E;  2EYX A;  5BNJ B;  4DBR A;  4PJL A;  1UNG D;  4C5I A;  4DOV A;  1EX4 A;  3QHS A;  1X01 A;  4JZ4 A;  1JXM A;  4RG2 A;  1SSF A;  2E64 A;  3JCM d;  3ME9 A;  1GUX B;  4QVD A;  4PJO A;  2K5L A;  1I1J A;  4M78 A;  2JUF A;  1OV3 A;  1JJ2 S;  5CCA A;  3QHW B;  5KYW B;  2F5K A;  3ZEH A;  4HNT A;  2X4J A;  2KRS A;  1ABO A;  3AHU A;  2CT3 A;  3C0C A;  2X4W A;  4LOC A;  1VQ4 A;  2PHG A;  2GNC A;  2D8H A;  2QQS A;  1TOV A;  2XIC A;  1E7P A;  2VWF A;  3VRZ A;  3L2R A;  3FC3 A;  3OW2 A;  3DJB A;  4ELL A;  3G71 A;  4BCH B;  4BCP B;  1UGP B;  3JSC A;  4EMK C;  3OYJ A;  1P92 A;  3HO8 A;  4EOK B;  1YWP A;  2QFZ A;  1F1B B;  2K57 A;  2QXF A;  2LMJ A;  2YUN A;  4XK8 E;  2YUP A;  1VIE A;  3BG3 A;  4JUV A;  3I56 Q;  5LJ3 h;  2WHB B;  1LJO A;  1U1T A;  2W9F A;  3GNG A;  3VS2 A;  2ABL A;  2DL8 A;  1JSU B;  4EMK B;  3JCM V;  1WGS A;  2LT1 A;  1BBZ A;  3PMT A;  4YC3 B;  2IW8 B;  3EGD B;  1RAF B;  1YHQ T;  3M0R A;  1QKW A;  1UHC A;  4XQ3 A;  5IF1 B;  1IHV A;  3MP6 A;  1Y7X A;  4AFZ C;  3PT9 A;  4F7U E;  5GAN j;  5GAO r;  1LOJ A;  2L2P A;  4QT7 A;  4PJN A;  2FG0 A;  3KHI A;  2VXF A;  2EVR A;  3CPW A;  3CCL T;  3OYC A;  1M1F A;  4ZGD B;  5IN1 A;  1CKB A;  3G4S A;  5CIU A;  5CKB A;  2DPP B;  5GAM j;  2VV5 A;  1Y0M A;  2BTT A;  2I53 A;  4BUG A;  4JJN K;  2LZ6 B;  4C8Q A;  4J9G A;  3TNW B;  2K4Y A;  1TWB A;  4F7S B;  1X6G A;  3OSV A;  3CCR T;  3V7C A;  2NLU A;  2A7Y A;  1OI9 B;  1JBM A;  2XDP A;  5FW9 A;  4F14 A;  1I8F A;  4C0Z A;  3CXC A;  2COW A;  2KMG A;  3TRE A;  4M77 D;  4EIK A;  3EAE A;  2GGR A;  2QGF B;  5LJ3 e;  2W10 A;  4ZN1 A;  1BKB A;  4B6M A;  4C5G A;  1MMA A;  5CKD A;  3GTM S;  4F16 A;  3CC4 Q;  4M75 G;  3MO8 A;  1K76 A;  4DQ2 A;  2PJQ A;  2RHU A;  5GAN e;  5CQX A;  1H25 B;  1N5Z A;  1WJR A;  4IIO A;  5M9O A;  1X6O A;  2DYB A;  2JM9 A;  1M1K U;  2DF6 A;  3EHQ A;  3BHV B;  4J5Y A;  1ZSZ B;  2DX1 A;  5LJ3 d;  4BCQ D;  2ZPI B;  2DER A;  2WAC A;  2DZ9 A;  4LUE A;  2LX9 A;  2XI9 A;  2RMO A;  3R6O A;  4IUT A;  3VS7 A;  1UJY A;  3D7S B;  2RHX A;  5FU6 C;  1B34 A;  2ZCF B;  3JCM P;  1YJW T;  4X1V A;  4IUU A;  5LJ5 g;  2DA9 A;  2E65 A;  1UG1 A;  2CGH A;  3LH5 A;  4JJC A;  4N4I A;  1JQQ A;  2A08 A;  1PD1 A;  4MDW A;  4F7J B;  2WIH B;  3QYH B;  1OYX A;  2PVD B;  4KBM B;  5I11 A;  3OA6 A;  4JS4 A;  2KAF A;  5FWC A;  3QBY A;  5I22 A;  3BFM A;  4J9F A;  4ELZ C;  3OYN A;  2L89 A;  2VVK A;  2KR3 A;  5IHN A;  1K8A R;  3MIA B;  3M9Q A;  4K11 A;  4KUL A;  5CO7 A;  4B9X A;  3PFS A;  1H3Z A;  6AT1 B;  5KYW A;  1JO8 A;  4GY5 A;  1VQ8 T;  5CKF A;  4HNU A;  2X3W D;  3CCQ T;  2ENM A;  4OMN A;  5GJW B;  1U5S A;  4M7A D;  2UZL B;  4PL6 A;  1D0X A;  5J39 A;  4C92 G;  1WIE A;  2CZ6 B;  2FZC B;  4ZGJ B;  2XK0 A;  2QA4 Q;  2YUQ A;  4M78 F;  2F2V A;  3GPL A;  2FPD A;  5GMK m;  4PJO F;  3VKH A;  3GIB A;  1FKM A;  3BG9 A;  2DTH A;  2R58 A;  1U3O A;  3PMI A;  1M4Z A;  4M75 D;  4M75 C;  1VQO A;  3LWI A;  3KUF A;  1D3B B;  4E7H A;  4PKC C;  1AT1 B;  4M75 A;  4AFU C;  2DL3 A;  1M8M A;  4BB7 A;  1NPP A;  1K73 R;  1UGR B;  5DLO A;  2RJE A;  1EIF A;  1W6X A;  2BKD N;  3HKS A;  1QMZ B;  2DD5 B;  2E10 A;  4J8O A;  3OYB A;  1Q81 R;  5IDP B;  4J7F A;  4NST B;  1M2O A;  2K3Y A;  4LDU A;  3G4S Q;  1NBE B;  4JJD A;  2FRY A;  2MMP A;  4C92 E;  4N4H A;  2C5V B;  2QGG A;  1NM7 A;  4BXX X;  1KJW A;  5HK0 A;  8ATC B;  4ROD A;  4RTU A;  4XU2 A;  2YRD A;  4PLL A;  3CCS T;  5KCH A;  1XOV A;  2OAW A;  3BE3 A;  4J6X A;  1J3T A;  2FYK A;  4JX6 A;  1Z9Q A;  1UGS B;  3I55 Q;  3NHN A;  5EG2 A;  4NOY A;  4PJO D;  3EGX B;  3FB9 A;  2DXU A;  3G6E T;  3FLG A;  2JTE A;  1QWF A;  3BDL A;  5CQY A;  1NZ9 A;  1U06 A;  4OMQ A;  4B9W A;  4ORZ A;  2JZ2 A;  4FL6 A;  5D7U A;  2ZAE A;  2X1N B;  2DXC A;  2KQW A;  2RH2 A;  3TQ7 P;  1WZO A;  8AT1 B;  3O0G D;  3SWN A;  4ELY C;  7AT1 B;  2MIO A;  2KGT A;  1VQ6 Q;  3X25 B;  1QCF A;  4BY7 X;  4M7A E;  5L23 A;  5EJC A;  2CS7 A;  4A4G A;  2QDY B;  3QII A;  4G6L B;  2VXE A;  1JOW A;  1KQS A;  4BCN D;  3K7A M;  4F7U A;  3I56 A;  2XU8 A;  3UF4 A;  3CC2 T;  1VQP T;  2M1H A;  2A36 A;  1CSK A;  2GBQ A;  4AMC A;  3JCM b;  1IHW A;  2KDS A;  2PVO B;  5IHY A;  1VQK T;  3F5X B;  2LCC A;  4JDS A;  1FWZ A;  3QG1 A;  1UFF A;  5GAM d;  2IIM A;  2UZE B;  2GF7 A;  3H0H A;  1H4L D;  2HD0 A;  3OY9 A;  2CZ7 B;  2DVJ A;  4JS5 A;  2JM8 A;  2KXD A;  5I21 A;  1RAA B;  3TSZ A;  3LLR A;  1E6H A;  3A98 A;  1ZUU A;  2OTJ T;  2G9X B;  3S3M A;  2C0I A;  2P4R A;  4FSS A;  3OYD A;  2VC8 A;  2P0Q A;  2NUP A;  3V8L A;  1V76 A;  2D0Q B;  5GAO m;  1OL1 B;  1PSE A;  1RUW A;  4AG1 C;  2R5M A;  1SHG A;  3EG9 A;  2YSQ A;  4BBR M;  2HZY A;  3I5S A;  4D6W A;  3MY1 B;  1MV0 B;  1C9B A;  3VS0 A;  3UWN A;  4OB0 B;  2SRC A;  1UEB A;  2DNU A;  1IGQ A;  3H41 A;  4C0D B;  1XQH A;  4QW2 A;  2ZPF B;  3WVE B;  2MPX C;  3M0P A;  1VQ5 A;  2FVU A;  2DLP A;  1N27 A;  1KXU A;  4BCQ B;  3Q1J A;  1Q81 C;  2GFU A;  1GXI E;  4DEY A;  2IW6 B;  1VQL T;  1T3S A;  1OPK A;  5GMK l;  1K73 U;  3OB9 A;  4HL4 A;  2UZB B;  4KRT A;  1DJ7 B;  2RQU A;  5GAM e;  2OX7 A;  2ZPE B;  5IHK A;  2QTX A;  3HTR A;  3E2U A;  3MKD A;  3WVD B;  2G3R A;  4FW1 A;  1LCK A;  4QQ6 A;  5IXF A;  2OTL Q;  1PG5 B;  2DD5 A;  1IO6 A;  5LJ5 h;  3TNI B;  5DLQ E;  1NJI U;  2E5Q A;  1YFN A;  4EMH A;  2JN0 A;  1QMC A;  2CYZ B;  2D9T A;  4M7A A;  1GBR A;  4M78 G;  4BCG B;  2C5X B;  3CCJ T;  1G8X A;  3UA6 A;  5EFQ B;  4YOO A;  1ZBX A;  3I55 A;  1VYV A;  4FYY B;  3FRN A;  1N4M A;  3H0I A;  3KFV A;  1OKV B;  1WJQ A;  4A4F A;  3OS0 A;  2E12 A;  1ZHI A;  4RTV A;  1QVF P;  5HKC A;  1MHN A;  1TSF A;  2G77 A;  2BZ8 A;  1VQ7 T;  1QW1 A;  1MV3 A;  3S6W A;  4OB1 B;  1PM3 A;  3SFM A;  1K9M U;  4LNP A;  1WQ7 A;  5GAN 2;  2AIR B;  1QVG A;  4C0F A;  4F7L B;  1IRE B;  3ULR B;  3CMA Q;  3RER A;  4LD9 K;  1H8K A;  2FO0 A;  2O4X A;  5FRO A;  3CMA A;  2JGZ B;  2BUD A;  3ZFJ A;  3G71 Q;  4M77 F;  1R0B G;  2KNB B;  3OS1 A;  1GFD A;  1G3T A;  1WXU A;  2KSS A;  4IUP A;  4EOS B;  4M75 E;  3MEU A;  1BI3 A;  2SEM A;  4N0A C;  5GMK h;  2QAS A;  2V1Q A;  2XHC A;  3RDV A;  1F5Q B;  2CSQ A;  5FRM A;  1M2V A;  3SWN C;  3DL1 A;  5ACB A;  1ENW A;  1M27 C;  2EGC A;  1VQO Q;  4MZM A;  4CFU B;  4M75 F;  1O9K A;  1SSH A;  4RTX A;  1VQ9 Q;  3MJX A;  3LYI A;  1ACM B;  4DBF A;  9ATC B;  2FPF A;  2E1H A;  3O5Z A;  1EFN A;  3A8O B;  1BCO A;  4FT2 A;  3DKM A;  3MCA B;  1FVV B;  3TW6 A;  4TVR A;  1G3N C;  2LQK A;  3CCU Q;  4QSH A;  4BCI B;  4PJJ A;  1MNE A;  5J3B A;  4C8Q G;  1OIY B;  5GAN 6;  3M0T A;  2DXB B;  3RGF B;  5GMK e;  2JVV A;  4RTY A;  1KQS P;  5HNB B;  4XTY A;  2EGE A;  4Z89 A;  3MEA A;  3V7S A;  2EYW A;  1VQM T;  2RB6 A;  1YIJ A;  5A0D A;  3UPU A;  3PIP A;  1YIJ Q;  1FMW A;  1YJN Q;  3REB B;  1YJN A;  3ZL7 C;  4ME7 A;  3CCE A;  4OMM A;  5KYX A;  1NLO C;  4V2S A;  3RIR A;  3ER0 A;  4EOP B;  3NDQ A;  4EC8 B;  2Y4X A;  3VS1 A;  4ATO A;  4FCY A;  2IVW A;  1MND A;  2J6K A;  3BHT B;  2EKO A;  4DA4 A;  2RM4 A;  3H4C A;  1YJ9 Q;  2BS3 A;  4YOZ A;  2LT4 A;  3NPF A;  4BE2 A;  1M90 U;  4LDW A;  3VYG B;  1TD6 A;  3CC7 T;  1YCY A;  4M7A F;  3QWL A;  3PTA A;  3M54 A;  1AWW A;  1NYF A;  4BCM B;  1JEG A;  1S72 A;  1BU2 A;  4E2F B;  1S72 Q;  4BDY A;  1XJW B;  1GUX A;  2ED1 A;  1M90 R;  3OMG A;  4M7A C;  3DLL A;  4BBS M;  2DFU A;  4EPC A;  4RG8 A;  4UC4 A;  1VQN A;  1N9S A;  4RMO A;  3QSU A;  3M0Q A;  4E7I A;  3RNJ A;  2D6F A;  4FW2 A;  1AZG B;  3I35 A;  4E47 A;  4IUQ A;  5KYU B;  2LTO A;  2JJ9 A;  3F70 A;  2C5O B;  4GLK A;  4J9C A;  1UNH D;  2VUB A;  5GAM h;  4M7D C;  2FB7 A;  1SEM A;  1IGU A;  2ZPB B;  2IG0 A;  5L2W B;  3DB4 A;  3CCM T;  1KD1 U;  4FYX B;  5FU7 C;  3V8J A;  3A1P A;  2V8J A;  5GAN 3;  5KYN A;  1VOL A;  2A0F B;  3NTI A;  4HA8 A;  2RI2 A;  1N9R A;  2EQJ A;  1NPR A;  4HXJ A;  3VS3 A;  1V1C A;  4OB2 B;  2PU9 B;  2RI3 A;  3DB3 A;  4M75 B;  3E9F A;  1YHQ Q;  1WX6 A;  2BS2 A;  2HNI A;  4CRL B;  2XG8 D;  2LX7 A;  2H3J A;  2EIF A;  5A0L A;  4M78 C;  3DLM A;  3HPW A;  1BI1 A;  3H8Z A;  4AKI A;  1QWE A;  2B8A A;  2HEQ A;  1VQ5 Q;  2BIV A;  2YLC A;  4QKU A;  1H1R B;  2AK5 A;  3JCM h;  2QI2 A;  4E7S A;  2H8H A;  2BKZ B;  1M3C A;  4M7D F;  2BS4 A;  2EPD A;  2V1R A;  4M77 E;  2BE9 B;  1GFC A;  2C6T B;  3JB9 H;  5ICP B;  2HMA A;  2CCH B;  1BIA A;  1VYU A;  1AWJ A;  1E7O A;  1M30 A;  1QVF A;  4M7D G;  1ZQ1 A;  2K2V A;  2QQ8 A;  1ZBJ A;  2LRQ A;  4XU1 A;  2PNI A;  4MML A;  1EZZ B;  3O8V A;  2HSP A;  4RCB A;  3OYH A;  1H64 1;  3HBL A;  1Q82 C;  2HQX A;  2DO3 A;  3SHW A;  1O75 A;  2KT1 A;  3CC4 T;  2ROL A;  4EOL B;  2IPO B;  2I2L A;  2KVQ G;  3A8G B;  4QVC A;  2MF2 A;  3EGU A;  2RQT A;  2K3X A;  4PLI A;  4OB3 B;  2K5I A;  2LQW A;  2DBK A;  3VJP A;  4J9D A;  4NC6 A;  4WTO B;  3CXC S;  3CCE Q;  1RL2 A;  5GAN f;  3HZJ A;  2LJ0 A;  1G5V A;  4ANJ A;  4CC7 A;  1X2K A;  4J9I A;  4OP0 A;  1I81 A;  1P5E B;  3JAM E;  1K8A C;  2NUT B;  2KRN A;  1D0Y A;  5GAN h;  2RD1 A;  3OQ5 A;  3PE0 A;  2YWW A;  3M59 A;  2L8D A;  1WHG A;  3I5R A;  2JW4 A;  3BY7 A;  3RMQ A;  4C92 A;  2DVE A;  2EJF A;  4PFZ A;  1VQ6 A;  3EFO B;  3A8L B;  1XNI A;  2CP6 A;  4J83 A;  3EFO A;  2EQU A;  3HP9 A;  2RQW A;  2EFI A;  4FSX A;  4YOS A;  2HQE A;  3GLX A;  1H27 B;  3LX7 A;  3X28 B;  3QYG B;  4JRI A;  2HKQ B;  3M0S A;  4C5H A;  5CYI B;  4BCO B;  3EG9 B;  1YI2 T;  2DIG A;  4OMF B;  2KRO A;  2QTV A;  2DL4 A;  1VQ4 T;  1TUC A;  4J9B A;  2P4T A;  3EG1 A;  4BI4 A;  3TVT A;  1JKW A;  3CD6 T;  5FGK B;  2DK3 A;  2DET A;  2LP5 A;  1OX8 A;  3M4Y A;  4EMG A;  5HVY B;  4DBQ A;  1KQS S;  1IZ6 A;  1PKS A;  1G2B A;  4AI6 A;  3RES A; 
#chains in the Genus database with same CATH homology
 4QVZ A;  5KH6 A;  2RO0 A;  4C92 D;  2XDB A;  1O9S A;  2FHD A;  4RKU E;  3V8L A;  3M58 A;  2D0Q B;  1VUB A;  2XD0 A;  5GAO m;  4NL3 A;  1PSE A;  1VQO T;  2AHJ B;  2R5M A;  2RA2 A;  1YHQ A;  5D6W A;  1XTD A;  2YHT A;  4X34 A;  5KE3 A;  3PIO A;  1M8V A;  2XID A;  4BBR M;  1M9S A;  3MEW A;  5C6S A;  1VQ9 T;  4D6W A;  2MI6 A;  4O5V A;  4R55 A;  4ZTF A;  1OI1 A;  1KHC A;  2R57 A;  4BI3 A;  2L5Q A;  4OB0 B;  3UWN A;  1UEB A;  5HY6 A;  1KG1 A;  1WQW A;  3SDZ A;  4C0D B;  1N8R U;  1M5Q 1;  1XQH A;  2L3R A;  2DIQ A;  4KUI A;  4QW2 A;  4C8Q C;  2ZPF B;  3WVE B;  2KMT A;  1N6A A;  4L59 A;  3CCU T;  4LDV A;  4M6V A;  1YIT T;  2ZGW A;  3L2Q A;  2QA4 A;  1VQ5 A;  2FVU A;  1LNX A;  3CEY A;  3JCM e;  3CCL A;  5GAM g;  1I4K 1;  2RJF A;  3J81 E;  1N27 A;  3L42 A;  3GNF B;  3OYM A;  4LDY A;  4BE1 A;  3G4S T;  2FL7 A;  1NJI C;  3Q1J A;  1Q81 C;  2GFU A;  1GXI E;  5A0G A;  4XU0 A;  2DXT A;  1VQL T;  1QP2 A;  2VYT A;  3P8D A;  2HAX A;  4II1 A;  2RK1 A;  4MZT A;  2KK4 A;  5GAM f;  2YLB A;  3G7Z A;  1W2B A;  3CCS A;  4M7D A;  4XAX B;  3RKY A;  5GMK l;  2DTO A;  2JTF A;  3OB9 A;  1YIJ T;  2CZ0 B;  2DD4 B;  2E6Z A;  3T9N A;  2M0O A;  4HL4 A;  4M7D B;  4Y91 A;  2GQV A;  1DJ7 B;  4XTZ A;  5GAM e;  1FX7 A;  5KE2 A;  4XU3 A;  2ZPE B;  2LC4 A;  2QTX A;  4QQ6 A;  4C8Q D;  4JRQ A;  3WVD B;  2G3R A;  1N8R C;  2OTL A;  2DZC A;  5GAO p;  3HFO A;  3JB9 J;  1KD1 C;  1R8O B;  3G6E A;  2DD5 A;  4ELJ A;  4HLQ A;  3CCE T;  1PSF A;  3ZBD A;  5CK9 A;  1M1G A;  3L1A A;  5LJ5 h;  3JB9 I;  3CCV T;  4FIB A;  1G3Y A;  5CAI A;  4PNO A;  5DLQ E;  5I2S A;  1QVP A;  3OS5 A;  2QEX T;  3L2U A;  4M7D E;  3OBW A;  2E5Q A;  4EMK A;  4EMH A;  4X9D A;  3FC3 A;  2JN0 A;  1NJI U;  5L8R E;  2CYZ B;  5DY9 A;  2OAU A;  1D3B A;  2D9T A;  3MEV A;  1YJ9 T;  2Y90 A;  2WSE E;  4Y28 E;  3RKW A;  4BY6 C;  2LVM A;  3P8H A;  3SWN B;  2RHI A;  3JCM X;  5GAO n;  4OGC A;  3OYA A;  3QZ9 B;  5LL6 S;  1W2B S;  1K9M C;  2QF7 A;  3X26 B;  2DAQ A;  2LQ8 A;  4M78 G;  4N4G A;  3GP8 A;  3CC7 A;  3CCJ T;  4C92 F;  3HRS A;  4E7K A;  4HT9 A;  3CME T;  1JB0 E;  1ZBX A;  1S72 T;  3I55 A;  1KQ1 A;  4C5I A;  4DOV A;  3QHS A;  1X01 A;  3OW2 S;  3FRN A;  4Q5W A;  1M90 C;  2HBP A;  5CVI A;  1WJQ A;  1SSF A;  2E64 A;  4RG2 A;  3ME9 A;  4A4F A;  3JCM d;  3OS0 A;  2E12 A;  4QVD A;  4PJO A;  1ZHI A;  3JB9 G;  2K5L A;  4E7L A;  5HKC A;  4QQG A;  4M78 A;  4M7D G;  1BI0 A;  1MHN A;  2EWN A;  2JUF A;  2X35 A;  2G77 A;  2KR6 A;  1Q86 U;  1VQ7 T;  5LJ5 d;  2EQM A;  1QW1 A;  3INZ A;  2E41 A;  3OMC A;  2P0P A;  3UDC A;  4ZN3 A;  3QKJ A;  3S6W A;  5CCA A;  1JJ2 S;  4M7A B;  4OB1 B;  3SFM A;  2F5K A;  1K9M U;  3ZEH A;  4HNT A;  1X75 C;  1WQ7 A;  2QQB A;  2X4J A;  5GAN 2;  1Q82 U;  3AHU A;  4C8Q F;  1B34 B;  4KT0 E;  1QVG A;  4C0F A;  4IKF A;  1K73 C;  1IRE B;  2A3L A;  2X4W A;  4LOC A;  1VQ4 A;  4LD9 K;  3RER A;  2O4X A;  5FRO A;  3CMA A;  2QQS A;  4VUB A;  2XIC A;  1E7P A;  2BUD A;  3ZFJ A;  3L2R A;  4AKH A;  2DD4 A;  3MP8 A;  4A4K A;  3NFC A;  3OW2 A;  1Q7Y U;  1UB4 A;  4M77 F;  4NL2 A;  2RJC A;  4PJO G;  3G71 A;  1UGP B;  3JSC A;  4EMK C;  3OS1 A;  1P92 A;  3FDR A;  3OYJ A;  3HO8 A;  1G3T A;  2KSS A;  4IUP A;  4M75 E;  3JCM J;  2QXF A;  2QFZ A;  2K57 A;  3MEU A;  1BI3 A;  5GAN g;  4XK8 E;  1OZ2 A;  4JUV A;  1VIE A;  3BG3 A;  2RI5 A;  4N0A C;  5LJ3 h;  5C0M A;  5GMK h;  3BDU A;  1LJO A;  3VUB A;  4CI0 C;  4HT8 A;  5GAO q;  1U1T A;  2XHC A;  3GNG A;  4EMK B;  4L6V 5;  1I5L A;  5FRM A;  1BI2 A;  2RHY A;  1U1S A;  3JCM V;  1WGS A;  2LT1 A;  3PMT A;  1KQ2 A;  3HRU A;  1VQ8 A;  3SWN C;  4M7A A;  1QVG S;  3DL1 A;  1YHQ T;  5CKE A;  4MZM A;  4XQ3 A;  5GAN d;  3CCQ A;  4M75 F;  4Z6Y A;  4NS5 A;  1VQ9 A;  3MP6 A;  2ZPG B;  1Y7X A;  1UGQ B;  2JOY A;  3LYI A;  3PT9 A;  4F7U E;  5GAN j;  5GAO r;  1LOJ A;  3JB9 F;  4C8Q E;  2E1H A;  3CBP A;  3A8O B;  4FT2 A;  4MDX A;  3KHI A;  3DKM A;  3E9G A;  1HK9 A;  3TW7 A;  3MCA B;  3CCU A;  3TW6 A;  4TVR A;  5LJ3 f;  1K73 U;  2LQK A;  2VXF A;  3FEO A;  3CPW A;  4QSH A;  2QA4 T;  3E19 A;  4MMK A;  3VKI A;  1KC8 C;  1VQ5 T;  3CCL T;  5GAO l;  1NE8 A;  3OYC A;  2QDJ A;  1M1F A;  4FM4 B;  3H6Z A;  4A54 A;  4ZGD B;  3CBO A;  3MET A;  5IN1 A;  5J3B A;  4C8Q G;  1Q86 C;  3G4S A;  4E7J A;  5GAN 6;  2DXB B;  5CKB A;  5CIU A;  2DPP B;  5GMK e;  2KY9 A;  2JVV A;  5GAM j;  2VV5 A;  3L2V A;  4WF2 A;  1OZ3 A;  4XTY A;  4BUG A;  4JJN K;  3MEA A;  4J6W A;  4J7I A;  3V7S A;  4C8Q A;  4JX5 A;  1VQM T;  2RB6 A;  4M77 G;  4BI8 B;  3NTK A;  2K4Y A;  1MGQ A;  1YIJ A;  3GOX A;  1HXD A;  5A0D A;  2XDD A;  2DXC B;  3OSV A;  3PIP A;  3V7C A;  3CCR T;  3UPU A;  2NLU A;  2A7Y A;  3LGF A;  2O4X B;  1U8R A;  1JBM A;  2XDP A;  4M78 E;  4BDZ A;  3EFS A;  1YJN A;  3RUX A;  3C12 A;  4C92 B;  1I8F A;  4ME7 A;  4C0Z A;  3CXC A;  3CCE A;  4PJO C;  3CPW S;  4V2S A;  3RIR A;  3CCV A;  2KMG A;  3TRE A;  3ER0 A;  4M77 B;  4M77 D;  4XTW A;  3EAE A;  1WPY A;  2QEX A;  2EQK A;  2Y4X A;  3OBY A;  3C4S A;  5LJ3 e;  4ZN1 A;  5A2Q E;  4ZTJ A;  1BKB A;  4ATO A;  4C5G A;  2IVW A;  5CKD A;  1YJ9 A;  2EKO A;  4DA4 A;  2RM4 A;  4M75 G;  3H4C A;  3MO8 A;  3JCM c;  2BS3 A;  3M5A A;  2LT4 A;  4C8Q B;  4DQ2 A;  5GAN 5;  3CC4 A;  4BE2 A;  5GAN e;  2RHU A;  1M90 U;  4LDW A;  3QYB A;  3VYG B;  5CQX A;  3JB9 D;  1YCY A;  5D6X A;  3V7R A;  3CC7 T;  5GAN 7;  3CCJ A;  4M7A F;  1WJR A;  3QWL A;  2PVG B;  4F7U F;  3CME A;  3V8K A;  5M9O A;  3M54 A;  2M16 A;  5DM7 R;  3PTA A;  1X6O A;  3M57 A;  2ZPH B;  5J26 A;  3I55 T;  1S72 A;  3JCM g;  1M1K U;  4JX4 A;  2LCL A;  4J5Y A;  5GAN 8;  2P0K A;  4BDY A;  3J80 E;  3JCM W;  4M78 D;  3OS2 A;  5LJ3 d;  3OMG A;  4M7A C;  3VUZ A;  3DLL A;  4BBS M;  3KBG A;  3PNW C;  3QUI A;  4BE0 A;  2ZPI B;  2JTM A;  4EPC A;  3QPH A;  4RG8 A;  4UC4 A;  2WAC A;  1VQN A;  3E1S A;  2DZ9 A;  1G3W A;  1W4S A;  1N9S A;  4MZP A;  5FU7 B;  2LX9 A;  5HK3 A;  3OYE A;  2XI9 A;  5LJ5 f;  2QQR A;  3LH0 A;  4RMO A;  4EDU A;  4ZGE B;  3R6O A;  3QSU A;  4M77 A;  2E70 A;  3CBM A;  4IUT A;  4DOW A;  1VQ7 A;  2RHX A;  4C5E A;  5FU6 C;  4E7I A;  4LDX A;  2GCX A;  1B34 A;  2ZCF B;  3HRT A;  3JCM P;  3HFN A;  1VIF A;  1Y96 B;  2D6F A;  1YJW T;  2EJ9 A;  4IUU A;  4E47 A;  4PJO E;  4IUQ A;  5LJ5 g;  2LTO A;  3OYL A;  1Q81 U;  1Y96 A;  1AHJ B;  2E65 A;  4OF1 A;  3F70 A;  4BAC A;  4O6J A;  4Z02 A;  4J6Y A;  3M53 A;  4XTU A;  2CGH A;  3CMA T;  2XKO C;  1FXX A;  4GLK A;  4IUV A;  4N4I A;  4X9C A;  2VUB A;  1VQ6 T;  3FIF A;  5GAM h;  4MDW A;  4M7D C;  2FB7 A;  3G71 T;  3QYH B;  2PVD B;  1OYX A;  2ZPB B;  4A53 A;  3OYF A;  4KBM B;  3OA6 A;  4JS4 A;  2KAF A;  2IG0 A;  3QO3 A;  4HCC A;  3QBY A;  3BFM A;  3DB4 A;  4ELZ C;  3CCM T;  1KD1 U;  5FU7 C;  3A8M B;  2L89 A;  3V8J A;  4AKG A;  2V8J A;  3VU3 C;  4A4H A;  5FLX E;  5GAN 3;  5LJ5 j;  3VV0 A;  3FJP A;  4N0A A;  2WSC E;  3NTI A;  4HA8 A;  4FU6 A;  3M9Q A;  4KUL A;  3I56 T;  2RI2 A;  1N9R A;  2V8I A;  1VQP A;  2LNV A;  5CO7 A;  2EQJ A;  4B9X A;  3CC2 A;  4M7A G;  1NPR A;  1JRI A;  3PFS A;  4KUD K;  3NTH A;  1H3Z A;  4MFE A;  4OB2 B;  2PU9 B;  4F7U B;  2C06 A;  3X20 B;  2RI3 A;  3DB3 A;  2M9U A;  4GY5 A;  4OGE A;  5I2M A;  1YI2 A;  3KXT A;  4M75 B;  1VQ8 T;  5GMK i;  5AYF A;  1WNL A;  1VQK A;  5CKF A;  2PUO B;  4HNU A;  4HNV A;  3E9F A;  3CCQ T;  2BS2 A;  2HNI A;  3TEE A;  4XTX A;  2XG8 D;  1M1K C;  2H3J A;  4MFD A;  2EJG A;  3OYK A;  3CD6 A;  2EIF A;  5A0L A;  2Y4Y A;  3M55 A;  4M78 C;  2JNG A;  3DLM A;  4M7A D;  3HPW A;  1BI1 A;  4JLG A;  4PL6 A;  4BD3 A;  3OYI A;  2VGN A;  5J39 A;  4C92 G;  3H8Z A;  3OYY A;  4AKI A;  2OTJ A;  2CZ6 B;  2XK0 A;  4ZGJ B;  2B8A A;  5LJ3 j;  2BIV A;  2YLC A;  2GFA A;  4M78 F;  3GPL A;  2X4X A;  5GMK m;  3BG5 A;  4PJO F;  3VKH A;  1QP3 A;  3GIB A;  4FT4 A;  5FRN A;  3JCM h;  2QI2 A;  3UT1 A;  2E6N A;  1FKM A;  3BG9 A;  3S3N A;  2DTH A;  3TCJ A;  2R58 A;  2R5A A;  3PMI A;  4M7D F;  3A8H B;  1M4Z A;  3VKG A;  2BS4 A;  4M75 D;  3SD4 A;  4M75 C;  5IAY A;  3OYN A;  1VQO A;  3LWI A;  1VQM A;  2DJZ A;  3KUF A;  1D3B B;  4IUR A;  2DKG A;  4M77 E;  4PKC C;  2QQ9 A;  4M75 A;  4E7H A;  3CCR A;  3JB9 H;  4BB7 A;  2EAY A;  1NPP A;  3PGG A;  1UGR B;  3JRZ A;  2X4Y A;  3CPF A;  1BIA A;  5DLO A;  2RJE A;  5LJ5 e;  1EIF A;  1YJN T;  3M4G A;  3LW5 E;  2VGM A;  2BKD N;  3QYE A;  1Q7Y C;  3HKS A;  1QVF A;  2E10 A;  2DD5 B;  4J8O A;  2K2V A;  1ZQ1 A;  2QQ8 A;  3OYB A;  4XU1 A;  2LRQ A;  1YIT A;  4MML A;  4J7F A;  3O8V A;  3SB2 A;  5KCO A;  1Y71 A;  5GMK j;  3N5B B;  2K3Y A;  2K5F A;  4LDU A;  4RCB A;  3OYH A;  3HL8 A;  1H64 1;  1KHI A;  3ASK A;  3HBL A;  4C92 E;  2MMP A;  4HCZ A;  4N4H A;  5D6Y A;  1Q82 C;  2HQX A;  2DO3 A;  4OVA A;  3MP1 A;  1O75 A;  4C92 C;  1VQL A;  3HSB A;  3J7A F;  2PUK B;  2CKK A;  5HK0 A;  3CC4 T;  1WJS A;  4L5G A;  4XU2 A;  3QXE B;  4PLL A;  2I2L A;  2YRV A;  2KVQ G;  3A8G B;  1XOV A;  2MF2 A;  4QVC A;  5KCH A;  3CCS T;  3QJY A;  4J6X A;  3JCM Q;  2WJ9 A;  3OSS C;  2FYK A;  2K3X A;  4A4E A;  4JX6 A;  4PLI A;  4OB3 B;  2K5I A;  5CKH A;  1UGS B;  3VJP A;  2RK2 A;  4NC6 A;  3VYH B;  1Y07 A;  3LWH A;  2CZ1 B;  2OTL T;  5EG2 A;  2ZZD B;  4NOY A;  1QVF S;  3CXC S;  4PJO D;  1RL2 A;  2O01 E;  3FB9 A;  2DXU A;  3HZJ A;  5GAN f;  3FLG A;  3G6E T;  1G5V A;  4BY6 B;  2WSF E;  4C0D C;  1BIB A;  1VQN T;  2MAM A;  3BDL A;  4HCB A;  3BW1 A;  4PJO B;  3GF5 A;  5CQY A;  4OP0 A;  4C0G A;  1NZ9 A;  1I81 A;  3L2Z A;  3JAM E;  4B9W A;  1K8A C;  2JZ2 A;  4FL6 A;  5GAN h;  3L2W A;  2RD1 A;  3OQ5 A;  4MIM A;  3M59 A;  2RJD A;  1YJW A;  1JJ2 A;  3EFR A;  2L8D A;  2DXC A;  4JLI A;  2KQW A;  2RH2 A;  5GAN 4;  3RMS A;  3M56 A;  3BY7 A;  3RMQ A;  3SWN A;  4C92 A;  4ELY C;  2DVE A;  3TU4 K;  1BYM A;  2EJF A;  2F69 A;  1VQ6 A;  4M7D D;  2EYQ A;  4QQD A;  3X25 B;  5LJ3 g;  3A8L B;  1XNI A;  4M7A E;  3C95 A;  3HHT B;  4J83 A;  1QLB A;  4HKE A;  5EJC A;  2CS7 A;  1KC8 U;  3A5Z B;  2ZZD A;  4A4G A;  2EQU A;  2QDY B;  1G3S A;  3HP9 A;  2EFI A;  4JRP A;  3QII A;  4FSX A;  3CCM A;  2VXE A;  3QJ6 A;  3RKX A;  1KQS A;  2HQE A;  2DTI A;  1K8A U;  3GLX A;  3X24 B;  4M77 C;  4F7U A;  2XU8 A;  3I56 A;  3CC2 T;  2QQA A;  1VQP T;  2M1H A;  3QZ5 B;  2RHZ A;  3LX7 A;  4YTL A;  2DXB A;  2MWO A;  3VYG A;  3X28 B;  3QYG B;  3JCM b;  4JRI A;  4C5H A;  2DEQ A;  4M78 B;  1V29 B;  2V8K A;  4XTV A;  2KDS A;  2PVO B;  2LDM A;  3LGL A;  1YI2 T;  4RCC A;  2DIG A;  4OMF B;  2LCC A;  4JDS A;  1VQK T;  1FWZ A;  1TH7 A;  3QG1 A;  3P8B B;  5GAM d;  1VQ4 T;  2P4T A;  3QDR B;  2F5T X;  5FU6 B;  4BI4 A;  2GF7 A;  4CRI A;  2HD0 A;  3OY9 A;  3CD6 T;  4R56 A;  2CZ7 B;  4JS5 A;  3HB9 A;  2DK3 A;  3C94 A;  5I21 A;  5IT9 E;  1YBY A;  1RI0 A;  3LLR A;  3JCM f;  3M4Y A;  2MWP A;  4F7U G;  4EMG A;  2OTJ T;  3WXM B;  4LD6 A;  3S3M A;  3OYG A;  1KQS S;  5CR2 A;  1IZ6 A;  3URG A;  4AI6 A;  4JRK A;  2PQW A;  3MHX A;  3OYD A;  4P5N A;  3S3O A;  2VC8 A;  2P0Q A;  3RES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...