1UGRB

Crystal structure of at109s mutant of co-type nitrile hydratase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
228
structure length
228
Chain Sequence
b'MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile Hydratase alpha subunit
molecule tags Lyase
source organism Pseudonocardia thermophila
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
total genus 65
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugrB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugrB02
2ZPGB 3VYGB 3QYGB 1AHJB 3QZ5B 2PUOB 4OB0B 1UGSB 4OB2B 2CYZB 4KT0E 3LW5E 2DXBB 4ZGDB 3A8OB 2PUKB 2PVOB 1IREB 2ZZDA 3WVEB 2ZPHB 2ZZDB 2PVGB 2ZPBB 4Y28E 4ZGJB 3A8GB 2PVDB 5L8RE 1UGQB 3VYGA 4ZGEB 2PU9B 2WSCE 2DD4A 3WVDB 3X26B 4RKUE 3HHTB 1V29B 1GXIE 1PSEA 2QDYB 2D0QB 1QP3A 1PSFA 2ZPIB 3QZ9B 2WSFE 4L6V5 2ZPEB 3A8HB 3X20B 1UGPB 2DD4B 3X28B 3QXEB 2DXCB 2WSEE 4OB3B 2DD5A 1DJ7B 2ZCFB 3A8MB 3VYHB 2ZPFB 1QP2A 3QYHB 2CZ7B 3X24B 3A8LB 2CZ1B 1JB0E 2DXBA 2O01E 1UGRB 4XK8E 2DPPB 2CZ6B 2CZ0B 4FM4B 2DXCA 4OB1B 2DD5B 2AHJB 3X25B
chains in the Genus database with same CATH superfamily
3CXCS 1VINA 2O31A 3GF5A 1TUGB 1AZGB 3RMSA 4BE1A 4BCGB 2DVJA 1UGSB 1VQ5Q 1X2QA 3E2UA 3H0IA 9ATCB 5EC7A 5HKCA 1UG1A 2LQWA 5DY9A 3M0UA 2J6FA 1HXDA 2ENMA 2CS7A 3M57A 4LNPA 1VQMT 2PVGB 2DF6A 1SRMA 4PJOC 2HQEA 1FVVB 5LL6S 2BS2A 5GAOp 2DJQA 4C8QF 4FIBA 2PU9B 3CD6Q 1TWBA 3NDQA 4F70B 4X9CA 1VQ4Q 1VQPT 4LOCA 1ZA1B 3CMAQ 1X2KA 2EQKA 4BCJB 2DMOA 4PFZA 4LDUA 2KGTA 1JRIA 1SG5A 2AZSA 2KVQG 5CAIA 2L3PA 3NPFA 3DKMA 2DERA 1FMVA 3VJPA 1SRLA 1I8FA 5AT1B 5KYWB 2E1HA 1NBEB 1FYNA 1UHCA 3PMTA 4GLKA 4BE2A 3BG5A 2QF7A 1OOTA 1TUCA 4LDXA 2LJ1A 1FMWA 1NJIR 1LCKA 3QUIA 4BI8B 3A8HB 3M58A 8AT1B 2DD4B 1X6BA 2C06A 1VQNA 3OW2A 1RLQC 3QYEA 2QTXA 1ZA2B 2LVMA 1MUZA 3BE3A 2QDLA 4BI3A 2DILA 1VYTA 2P84A 3CCJQ 4P5NA 1VIFA 4C8QD 1W70A 3NMZC 3MIAB 2HL5C 4UC4A 3G6EQ 5IXBA 1UFFA 4E6RA 4PJOF 5GMKl 3M4GA 1UGRB 2VC8A 2CZ6B 2OJ2A 3JCMJ 1UB4A 5KYUB 3MI9B 1VOLA 4PJOB 1YWPA 2H3EB 2MWPA 4M77A 3OYNA 1G83A 4EDUA 2JTMA 2C6TB 4EOIB 1ABOA 1UGVA 2GFUA 2EYQA 1N8RC 2L3RA 2MYSA 3EG9A 3OW2S 3SB2A 3OYCA 1NYFA 2E41A 3M54A 4M7DG 2XU8A 2OTJA 4EMHA 8ATCB 4NOYA 1K73R 2VGNA 5CYIB 1GFDA 2VKNA 4BCMB 3HB9A 4NSTB 4F17A 2G9XB 1VUBA 1JBMA 4D8KA 1YCSB 3FEOA 5D7UA 2EFIA 2MIOA 4C0DC 5GAMh 4ZGEB 2WSCE 2VVKA 4F7UA 5CVIA 2EGCA 4ESRA 3JCMQ 2CUDA 4DBQA 1T0HA 2RHYA 2DVEA 3QHSA 3G71Q 2XHCA 3I56Q 3JB9F 5FU7C 1AZEA 2DRKA 1QMZB 2D0NA 1WJSA 3I56T 4NS5A 4BCIB 4RTUA 1WHGA 1W4SA 2ATCB 2FHDA 1E9HB 2EQIA 3BFMA 3LGLA 5GAOm 3NTHA 4C0FA 4M78C 2DXUA 2DL5A 1BB9A 1BI0A 4C92E 1OU8A 5LJ5j 2HBWA 2K3XA 2KT1A 1W2BA 3X24B 2QAZA 2CT4A 2C0OA 4E47A 1ZLMA 4OF1A 4DA4A 4MMLA 3B57A 3MEUA 4A4KA 4BY6C 2QXFA 4HVUA 2HNIA 3TVTA 2O88A 3RERA 4BDYA 4C92A 3FLGA 4J7IA 3SFMA 3THKA 5GANe 1R0BG 3EFOB 2DL4A 4I3ZB 1Z9QA 3QZ5B 1G3YA 5FWBA 3NTIA 1RAAB 5I11A 4J6YA 4JS4A 2QQAA 1VQ6A 2EQJA 1TUDA 1M1KR 2JNGA 3JCMc 4YOOA 2F2VA 1OGUB 5LJ3g 4IMYB 2CH4A 3LH5A 2DXTA 5LMKB 3JB9H 4LXCA 2A28A 4ROEA 2RB6A 2MK5A 2DETA 1ZUUA 2XMFA 3O0GD 1QVFP 2D9TA 2JOYA 5I2MA 2DE0X 2QASA 3MP8A 4HCCA 2M16A 3G7ZA 1WJQA 2D1XA 1NLOC 3HHTB 4PLLA 5HCKA 1K0XA 4JX6A 2RI3A 2AKKA 1M3BA 2WACA 5HY6A 4C5EA 1SPKA 2MCNA 3LWHA 2CDTA 3VUZA 2IW9B 1YNZA 2K5LA 4M7DE 5GJWB 2KDSA 4FYWB 4JJCA 3JB9G 1M90R 5L23A 3EOCB 4E7HA 3TU4K 1UGPB 1BCOA 4WCIA 1PD1A 1K4US 2K3YA 4OMQA 5CQYA 1HK9A 4JLGA 1WYXA 4CFXB 5GAN2 3MP1A 2EW3A 4NC6A 4M77C 1X43A 4PL6A 3EHRA 4JPBW 1JJ2A 2E6ZA 4KGXB 5D6XA 2JW4A 3EG0A 3META 4AG1C 1N27A 1T3LA 3O5ZA 3V8KA 2HKNA 2J6KA 3G4SA 1QCFA 3I55T 4IUTA 1SSFA 4M78A 5CR2A 1AD6A 3MY1B 5I22A 4O5VA 3C4SA 3A98A 4BCHB 3CC4A 2RNAA 5IF1B 1H24B 3CCLQ 3VYGB 3Q1JA 1PKTA 1LNXA 1NLPC 1Y71A 2NUPB 3BHUB 3TSWA 1VQNT 2RMOA 3PIPA 2X4XA 2FL7A 4JX5A 2P0KA 1WXBA 1YWOA 3MEAA 1K8AC 1N8RU 1IREB 4PFOA 3M53A 3QHWB 2AK5A 3TN8B 3IQLA 3JAME 5IN1A 1RADB 2CREA 1WA7A 2YLCA 1M90C 3QWLA 3CCST 1M90U 4EOSB 2Y4YA 3M55A 4E7KA 3CEYA 1JSTB 3CCUT 2L89A 1XQHA 2WHBB 4AKHA 2R57A 1YCYA 4ME7A 3ZBDA 1VQMQ 1SF9A 2FRWA 3JCMP 2L8DA 4OP0A 2XDDA 1ZUYA 2RQRA 1RAFB 1OI1A 4J9BA 4J9HA 3OYLA 1MHNA 1WJRA 2K57A 2KMGA 3QDFA 3VS5A 5IDNB 1GXIE 1VQPQ 3DJBA 4QQ6A 2X3XD 4HL4A 4CFUD 1K73C 1QWFA 2F5KA 1NJIU 2EKHA 2I0NA 2KRNA 3HRTA 2GBQA 4OMMA 2C4GB 4PJMA 3P8BB 3X28B 3PT9A 2KQWA 2WSEE 2BE7D 4BCQD 4JRPA 4LN2A 2VWFA 1Z9ZA 1ACMB 4M77B 2R5AA 3KXTA 4C92G 2HDAA 2DO3A 2EUFA 2LMJA 4FW2A 2K6DA 3I35A 3ZFJA 4TTHA 3G4ST 2BUDA 2J6OA 2WIHB 4DOWA 3PFSA 1YJ9Q 1G3SA 2RJEA 1OI9B 1OQKA 3QWXX 2O01E 5HNBB 2MAMA 1N4MA 2IG0A 1VQ8T 1GH6B 2XDPA 3PNWC 1UEBA 1VQ8A 2DD5B 5LQFB 4FL6A 2AHJB 4KUDK 2DTIA 3UA7A 5AYFA 2CSQA 1ARKA 4NL3A 1VQ7A 2KR3A 3DTOA 3PTAA 1VQ8Q 5I5ZB 2PUOB 1S72A 3L1AA 1VYVA 2RQTA 4HKEA 3AT1B 5GAN6 1NZ9A 3GPLA 2RPNA 2FEIA 4ZGDB 4BI4A 2BKZB 3A8OB 4UN0A 4O6JA 2JS0A 1AEYA 1K73U 3PIOA 3E9FA 3CCUA 2H3JA 3M0PA 4IUUA 1YP5A 2ZPBB 1LPLA 3SDZA 2EGAA 4ATOA 4FT4A 3TW6A 2CCIB 3E1SA 3OYIA 4M7DA 4OVAA 2DIQA 1CKAA 1VQOQ 4BCOB 2YHTA 1K0SA 1GL5A 2V1QA 4Q5WA 1UJYA 5GAMg 4M7AE 1P5EB 3M0TA 1ENWA 1N9RA 4HNVA 3LLRA 2IVXA 1JXOA 2FZKB 2RJDA 5EJCA 1VQ4T 2KRSA 3FDRA 3CCVA 5A0GA 3LYIA 1KSWA 2M0OA 1VQ4A 1PRLC 3G71T 3V8JA 5ECAA 2PZ1A 2F69A 1M3AA 5C6SA 3MPUB 5FU7B 2D8JA 1H4LD 4XTXA 1M4ZA 2EIFA 1UTIA 2YSQA 4HT9A 2K4YA 3C95A 3VRYA 3TNWB 3BLHB 1C0MA 2DFUA 1Y57A 2EYYA 4CFWB 5HK3A 3JCMb 1GCQA 4OMNA 2CZ7B 2OTLA 2D6FA 4PLIA 1EFNA 2BZXA 1VQ5A 1Y0MA 4PJOD 2OTJQ 2CJMB 1QCNA 4JRQA 3AHUA 1M2OA 5KYYB 1AOJA 1I5LA 5GAOq 2L0AA 1RABB 2QGSA 2JM9A 1TH7A 2PMIB 1B34B 4Z8AA 1LOJA 3X25B 3CCEA 4FSSA 4X34A 1CKBA 1AHJB 4M7DF 1N6AA 2EJ9A 3V7CA 3CQTA 4RTWA 2IW6B 2QEXT 4MDWA 3JV3A 1VYUA 4BCPB 2FZCB 3ASKA 4BCQB 3EG9B 1WI7A 1YI2A 2ZGWA 1M2VA 3LX7A 4YOZA 3HFOA 4ZTFA 4K11A 1MNEA 2Z0WA 1QKXA 3PGGA 3EFSA 4HVWA 5J26A 1VQ6Q 4OGCA 2MMPA 3RKXA 3SWNB 4JZ3A 4KBMB 5GAN4 4KRDB 4QT7A 2LNVA 4BUGA 1ZQ1A 3CXCP 2LRQA 3ZL7C 3CC7Q 1TS9A 3WVDB 3VS6A 1KJWA 3OYGA 1XOVA 4ZTJA 2KXCA 3CCQA 2JS2A 1YJNQ 2L3SA 1M1GA 4PJNA 1I5OB 2QQSA 4DQ2A 2JM8A 5HQ0B 3EJ1B 5GANd 3V8LA 1TSFA 2O2OA 3GTMS 3M0RA 4M7DB 1UDLA 3CCRT 2WSFE 3QYBA 4ELLA 2DRMA 2BIVA 4GLMA 2K7AA 4C0GA 2XIDA 2DXCB 1X6OA 2J7IA 1WNLA 5LJ5f 5A2QE 4AT1B 3JCMV 5CK9A 1ZBJA 1DJ7B 3M4YA 2WEVB 3E9GA 2PHGA 4G6LB 2DL7A 5LJ5d 2ZPFB 1QP2A 1M8VA 3CPFA 2XI9A 1D0YA 3QKJA 3DB4A 4QW2A 4F7UE 2C0IA 3P8HA 3CCJA 3OYMA 5GAOl 4R56A 2KMTA 2RA2A 5A0DA 4R0KA 2IW8B 2NWMA 3CCET 1K9MU 4MZPA 2UZEB 2HQHA 3CCVQ 2E6NA 5LJ3f 2KEAA 2HD0A 1H1PB 1KIKA 2BTTA 1FX7A 1V76A 3VS2A 2OTLT 4CFVB 2P0QA 3EGDB 3I55Q 3CCVT 2KR6A 4B9WA 4FYXB 1ZP2A 2BS4A 4EONB 3CCLT 2A36A 4RCCA 2LDMA 2PUKB 1K8AU 1NEBA 3GOXA 2CP0A 2F2WA 4N4HA 3L2RA 1JU5C 1C6VX 3K7AM 3S6WA 3H4CA 4F7JB 2E12A 2YUNA 1F5QB 2X9HA 1MMGA 3BHVB 1PD0A 4KGVB 1VQ9Q 3A8GB 2L2PA 3OYJA 4FSXA 1I07A 1BI3A 4NL2A 2CSIA 2CP6A 1QVFS 3OS1A 2OAWA 2KT8A 1VQ9A 5D6YA 2BKDN 4BCND 1IGQA 2EWNA 1VOMA 4FYYB 4J9IA 1VQOA 1JQQA 1YITA 1GFCA 4E7ZA 2CP3A 3DOGB 4BDZA 1JOWA 4C8QG 1H25B 3T9NA 1BU1A 1PSEA 4RTZA 1QVFA 1ZBXA 3BW1A 5IHYA 1RACB 2J06A 4J9EA 1K9MR 2M9UA 1GCQC 2X35A 2V8JA 4PNOA 4BD3A 4C5GA 4L6V5 3I55A 4D8DA 1N5ZA 1I1JA 1VQ7Q 4QVZA 3X20B 2LNHB 1S72Q 2HL3A 2EVRA 5GJVB 1XNIA 1KHIA 2PK2A 3M03A 2WMAB 1E7OA 3TW7A 1YIJQ 3UPUA 4F04B 2MI6A 4JDSA 3CC2A 2WFYB 2RN8A 4XTWA 3EGXA 4MDXA 1S72T 1WHMA 1GUXB 1YIJA 3LQ5B 4BXXX 1NG2A 1J3TA 2M51A 2FPEA 3POMA 1YFNA 1YIJT 1JXMA 1RI9A 3JCMf 5EFQB 5LJ5g 5GAN5 4M7DD 4GBQA 4PKCC 1OKWB 2R5MA 4FM4B 2AT1B 3R6OA 3VRZA 3JCMd 3G4SQ 5ACBA 1UE9A 1H3ZA 1OU9A 1RAGB 1NJIC 4XU1A 3RGFB 4M75B 3P8DA 1TG0A 1NM7A 3QYGB 3CC4Q 1M2VB 2E5QA 1AWOA 3OBYA 3M0QA 2QQRA 2QG9B 4BY7X 3QG1A 3OS5A 4HXJA 1MV3A 3JB9I 4FYVB 1ABQA 4YOSA 7AT1B 2O9VA 3DLLA 1YJNA 1YBYA 4Y72B 3QWYA 1I0CA 1ZSZC 1G3NC 3OMCA 4RG2A 1VQ5T 1GBRA 4MZTA 4ELYC 4EOKB 1OV3A 4QSHA 3CPWS 3EFRA 3J80E 1QKWA 2WJ9A 4KULA 1OZ2A 3OYAA 2M02A 4M7AG 2V8KA 5DQVA 2KBTA 3L2ZA 5J39A 4XTZA 3SWNA 1OIYB 1VQKA 4E7IA 2CP7A 1G5VA 4ORZA 2FO0A 1JO8A 5KYUA 1N8RR 4AFSC 3QO3A 2QEXA 2NUTA 1GBQA 5KE3A 3GNGA 2C5OB 4JZ4A 3HL8A 1E6HA 1IO6A 1QLYA 4AI6A 3CMAT 1IGUA 2IIMA 3VKGA 2YRCA 1K1ZA 1OKVB 3QZ9B 1G8XA 2QK0A 2YUQA 3CMEQ 4JRKA 3I5SA 3UATA 3M0SA 3J81E 3LGFA 3OY9A 2JTEA 3RUXA 3H8ZA 2F1LA 4Y92A 3CD6A 1OL2B 2M0YA 5IHIA 4KUIA 2V22B 3CMET 2DAQA 3A8MB 1WPYA 5DLOA 1WHJA 3REAB 3OYFA 2QTVA 2PTKA 4FT2A 1O9KB 4HNUA 1AT1B 2RHUA 3FC3A 3KUFA 5KYWA 1I81A 1RAHB 3HPWA 2RH2A 4IIOA 2LCSA 2X1NB 1AWJA 4C8QE 2Y90A 3OQ5A 4XK8E 2EKOA 1X01A 2DPPB 2CZ0B 2HCKA 4KRCB 2CCHB 1FINB 1H1QB 5ICPB 1H641 1ZSGA 2UZLB 2FRYA 4RG8A 1KD1R 1G3WA 3INZA 1YJ9T 1KXUA 2HKQB 2CP2A 4F6WB 2XICA 1D3BA 2G3RA 3DDPB 4PFPA 3RBBB 3TCJA 1HSQA 1IB8A 3JCMX 2GGRA 1MGQA 1Q81U 2E3IA 1K9AA 3LWIA 1WIEA 2C0TA 3S3MA 2W9FA 2QQ8A 4MIMA 4M77D 4JJBA 4J83A 3QJYA 2A7YA 1SHFA 2BZ8A 2KI7A 5FRNA 1X75C 3OA6A 4EOPB 3MP6A 4VUBA 1RL2A 3CCRA 2EQUA 1B34A 4Z88A 3HZJA 1BK2A 2FB7A 3JB9D 1LVKA 2HAXA 3HTRA 4IURA 5EG2A 1B3QA 4M4ZA 3OYBA 5GAOr 2KYMA 3GLXA 2DEUA 1H3HA 5D6WA 2WMBB 4OGEA 3OBWA 2A0FB 1U5SA 2VXFA 1ZSZB 3BG3A 2L5QA 3CCLA 1M9SA 5FRMA 1UNLD 1YHQA 3TQ7P 4C0DB 4MMKA 4A4HA 1SEMA 4JS5A 1H1SB 1KC8R 2FVUA 4N0AC 1BI2A 2EPDA 5LJ5h 2AZVA 1NEGA 1UNGD 4DBFA 5GAN7 2JXBA 2DTHA 1EIFA 3OYDA 1Q7YC 2JMCA 5CEIB 1KK7A 4M7AB 2OI3A 1JB0E 5L2WB 2DXBA 1VIEA 2SEMA 2WPAB 1NPRA 3C94A 4CC4B 5FU6C 3L42A 3EH2A 5CIUA 4EOOB 2NUTB 1BU2A 1D3UB 4JJDA 2K5FA 3CCEQ 3M59A 1GRIA 1UJ0A 4A4GA 1FXXA 1SHGA 1UUEA 2EJGA 2LCCA 2YRVA 1M27C 4Z6YA 1W2BP 4M78F 2ABLA 2IN3A 5FW9A 2EYWA 3M5AA 2R7GA 2QEXQ 2EQMA 2GTJA 2QGGA 2F2XA 4C92D 4E7LA 3PMIA 2ZPHB 2ZZDB 2KRMA 5M9OA 3EGUA 3H0HA 3OYEA 2PVDB 2BZYA 4F7UG 2RHXA 2DZ9A 3QDRB 4M7DC 3CMEA 2MPXC 2NYSA 1IRXA 3QHRB 5FGKB 3OYKA 4XQ3A 1KQSA 1AWXA 1T0JA 2RJFA 2VV5A 2NLUA 2VGMA 3RNJA 1Q7YU 1M5Q1 3MY5B 2LQKA 2VASA 4KGZB 1TOVA 4ANJA 4ZN1A 2YDLA 3CC7T 1Q95G 3FRNA 4J9CA 1YITT 1VQLQ 3VV0A 4KH0B 4M77E 3EIDB 1UECA 5GAMe 3HP9A 3H6ZA 1YJNT 1ZHIA 5GAMf 5KYXA 4JX4A 4C8QA 3H41A 4CC7A 1YITQ 1VQLT 5LJ3d 2H8HA 4YC3B 4B6MA 4QVCA 2BE9B 4M78B 2KY9A 1Q86C 2M1HA 3UT1A 2DBMA 3UWNA 3G6ET 2VB6A 3BG9A 1X69A 1Y07A 1Q82R 1K76A 2E5KA 3CBPA 4ELZC 1FWZA 2LJ3A 4CFUB 5GMKj 2GF7A 3L2QA 3VKIA 2CT3A 3TREA 2LT1A 2DXCA 3RR6A 3UF4A 4EMGA 2YWWA 3BY7A 1TU0B 2DK3A 2YUPA 4ZNXA 2ECZA 3WXMB 2I40B 1U1TA 2E70A 4CFNB 1QVGS 4HCZA 2DEQA 4JLIA 3G71A 4KT0E 4GY5A 3MO8A 2OTLQ 3HRUA 4M78D 5CKFA 2RK1A 1HJDA 2MF2A 4TVRA 4RTXA 5HK0A 4HCBA 3KFVA 5FROA 3CMAA 1MNDA 2ED1A 2KNBB 4C8QB 1AISB 1M1KU 4ZGJB 2K79A 4B9XA 5KYNA 3S3OA 5LJ3e 4BCFB 1UGQB 4X1VA 2WXVB 3NGPA 2W0ZA 1KD1C 2LP5A 4M7AA 3ZEHA 3MJXA 4RUGA 1D1CA 4RKUE 1VQ9T 1PWTA 3CCUQ 1WXUA 2PQWA 3PE0A 3CC2T 3S3NA 5CKDA 2P0PA 1VQLA 4MFEA 1TFBA 2HBPA 3BHTB 3GBQA 1O9KA 1C9BA 5LJ5e 2QDYB 4D6WA 2RI5A 5IHNA 2I2LA 2QA4A 2CGHA 2E64A 2DA9A 3R6NA 3O8VA 3CCMQ 1B07A 1Q82C 4QVDA 2KAFA 1TTHB 1D1AA 5HBJB 2X4WA 1YI2T 3CC7A 2O4XB 2DLPA 4CRIA 3VYHB 1VQ7T 4KH1B 4OMPA 1R77A 3QYHB 5GANj 4R55A 2PK9B 1OL1B 2DIGA 4CC2A 2NUZA 3A8LB 4DBRA 1N9SA 3QJ6A 3EH1A 2W96A 4HT8A 4II1A 2LT4A 1QWEA 1H1RB 4JJNK 3CBOA 1QW1A 4E7SA 2HZYA 2Y4XA 1KD1U 1SSHA 2YT6A 1NE8A 4M78G 3VU3C 3RKYA 1YHQT 3OW2P 2JT4A 3GP8A 1BI1A 2D8HA 1PHTA 2E3HA 2V1RA 2LX9A 2NUPA 1VQKQ 1M3CA 2O9SA 4MFDA 2K2VA 2RM4A 2JZ2A 4RCBA 2HQXA 5KYXB 2CYZB 1VYWB 2LQNA 5IXFA 4II5B 3CXCA 3E19A 4EOJB 4M75E 4FX3B 2SRCA 3CPWP 1HD3A 2L3QA 5GAN8 3HKSA 2RQVA 2X4YA 3MEWA 5GMKi 3PO3S 2QYZA 2EGEA 1CSKA 4Y28E 1T3SA 2I53A 1W1FA 2F5TX 4RODA 3VUBA 1X6GA 1Y96A 4LUEA 2VYTA 4C8QC 1K9MC 2FG0A 2C5XB 4M7AF 4BY6B 2FPFA 1RLPC 2CH4W 2RO0A 2W9ZA 3RMQA 3RIRA 3VS3A 2K5IA 1F1BB 4C92B 1A0NB 4EC8B 1RAIB 4OMOA 5DLQE 3TSZA 1QP3A 3C12A 2GQIA 4EMKA 2YLBA 4F6UB 2LX7A 4XU3A 4LE9A 2OAUA 1U8RA 3KHIA 5GMKh 3QXEB 3EG2A 1YJ9A 2FPDA 4EPCA 2QQBA 1AD5A 3KBGA 4J5YA 3QIIA 1E7PA 2JTFA 2KE9A 1M1KC 5KCOA 3I9QA 1NPPA 1M8MA 5IAYA 2UZBB 4J7FA 4IIMA 4F14A 5IDPB 2K9GA 3PVQA 1PNJA 2YRDA 2UUEB 4J6XA 2ED0A 4XU0A 3RKWA 3RESA 1EZZB 5I21A 4OB1B 5GANg 1VQNQ 5IT9E 1WQWA 5CKBA 5KYYA 2OTJT 2RD1A 3DDQB 3N5BB 1OPKA 2QA4Q 5IH2A 1RI0A 3MEVA 4PJOA 4HNTA 3JCMg 1JSUB 3U23A 2DM1A 1JJ2P 1BIBA 1X27A 1W98B 2RJCA 3CCSQ 2QA4T 1MMDA 1G3TA 1H27B 3LH0A 4BCMD 4M75G 1VQMA 1ZSZA 3VS0A 1O9SA 1XO2A 1V1CA 4LD6A 4CI0C 4BB7A 4XTUA 4PJOE 2COZA 2KYBA 4AG2C 1M1FA 4ELJA 1OULA 4J6WA 4BCKB 1VQPA 2MWOA 1M30A 3DLMA 2DD4A 4EC9B 1R8OB 1H92A 2IVWA 1Q81R 1PG5B 5KH6A 2A3LA 1I4K1 1EX4A 5GMKm 2X4JA 3G1JA 2DL3A 4JUVA 4RTTA 3REBB 2XD0A 2EYZA 3SEMA 1PKSA 3BDLA 5GANh 2HSEB 2D0QB 1PSFA 1NYGA 4L5GA 4HLQA 4J8OA 2ZPEB 3L2WA 3OSVA 4F6SB 2LZ6B 2JMAA 5I2SA 5LJ3h 1BCMA 1WLPB 5HBHB 1VA7A 1BBZA 5KE2A 1YJWQ 2W10A 1BKBA 3EGXB 3CCJT 4BCNB 4OB3B 2HMAA 2XDBA 2MOXA 4XTYA 2EAYA 2JJ9A 3ME9A 4PJJA 2DKGA 3HRSA 4X9DA 4PJOG 5CCAA 3G33B 2DL8A 1YJWT 3VS1A 1JJ2S 2V26A 4IUQA 2LTOA 3TNHB 4BY1X 3VKHA 2RF0A 2DZCA 2DYIA 2CZ1B 2XK0A 4M75A 3EHQA 5HBEB 3MKDA 1KG1A 4CFMB 1PRMC 4A53A 4RTVA 1QCOA 1UNHD 3OYHA 2GTOA 4N0AA 4M7AD 1G2BA 2V8IA 3JCMe 1KC8U 4C92C 2EYXA 1Q81C 1KFZA 2JGZB 2CUBA 5KCHA 3C0CA 4IKFA 1QVGA 4JRIA 2QGFB 1Q86R 4A63B 3HSBA 5IHKA 2DX1A 2A08A 2DXBB 2G6FX 2RK2A 5GANf 4FW1A 2XG8D 4F7UF 5FU6B 2ZZDA 4F7LB 4E2FB 3WVEB 2OX7A 1VQOT 3CD6T 2EJFA 2HEQA 1P92A 1S1NA 1WHHA 2AKLA 3CPWA 3BLRB 4EOMB 2LCLA 1OPLA 4L59A 4V2SA 2KSSA 3V7SA 2CKKA 2E10A 4PJLA 2ESWA 1TD6A 4IUVA 1OYXA 4XAXB 5HVYB 2DYBA 4F7UB 1W6XA 3V7RA 3FJ5A 4PK4A 1H28B 4CC3A 3HFNA 1IZ6A 1UHFA 3QPHA 3ER0A 2LW4A 1KQSP 1D0XA 3GNFB 1XJWB 3OMGA 2P4RA 1PC0A 3JCMW 4YTLA 2KXDA 2RHIA 4QQDA 4C92F 2DNUA 4F7NB 1SKUB 2DTOA 2J05A 1AVZC 1MV0B 1WZOA 1Q7YR 2C5NB 1ZUKA 3CCSA 2RI2A 4Z02A 2PJQA 1Q86U 1H8KA 3RDVA 2ROTA 1C1AA 3FIFA 2IPOB 1BIAA 1OX9A 3G6EA 2XKOC 2WIPB 1YI2Q 2AIRB 4OGRB 2ZAEA 1WHLA 3M56A 3NHNA 4DEXA 2PNIA 3H9NA 4HA8A 4AKIA 3OS2A 3QSUA 1JEGA 4F7SB 3I56A 3TNIB 4EOLB 3JCMh 2JVVA 1IHVA 4M77G 4BE0A 4AFQC 3J7AF 1IHWA 2CP5A 3NFCA 2K3BA 4C5IA 2JN0A 4N4GA 4ROCA 4C0ZA 1Q82U 2VXEA 4M75F 3UDCA 1VQ6T 4EOQB 4OB2B 1Y7XA 1D09B 1YHQQ 3HBLA 3GIBA 1GUXA 4WF2A 2PVOB 4J9FA 4AFUC 3VS7A 3JRZA 6AT1B 4A54A 1VQKT 2GCXA 5CKEA 2B9RA 1KQSS 1QVPA 2FYKA 1U3OA 1WFWA 2COWA 1K8AR 3MHXA 3UA6A 2DMEA 2P4TA 3JB9J 5GAMd 4RMOA 4FU6A 3OSSC 4A4FA 3X26B 2GQVA 1GCPA 3CBMA 1WXTA 3H0FA 5LJ3j 4OMFB 3ULRB 3BLQB 1WDXA 3CCRQ 5A0LA 2X3WD 4M78E 4KRTA 3FB9A 1PM3A 3OB9A 4XTVA 4QQGA 5J3BA 4ZN3A 5GAN3 3DB3A 3CC2Q 1D0ZA 3CCQQ 1YN8A 1XTDA 3URGA 1QMCA 4MZMA 5FWCA 4N4IA 4Z89A 4M75C 3FJPA 1QQJA 1D1BA 2RQUA 1KQ2A 3CCQT 2F2CA 3BDUA 4BBSM 4QKUA 4DEYA 4HVVA 3OS0A 3CCMT 2VUBA 5DM7R 1D3BB 1U06A 4LDVA 2LC4A 2DBKA 2RQWA 2QDJA 2W2HA 3DL1A 2YXYA 3F70A 2DJZA 1GY3B 5CQXA 2W99A 4AFZC 1PCXA 2A37A 3EGDA 3SD4A 1FMKA 4EORB 4OR5B 2RHZA 1R0CB 2C5VB 1OEBA 2BS3A 2KROA 1OX8A 2QFZA 2ZPGB 4C5HA 2COYA 4M77F 3MCAB 4OB0B 1KC8C 2LJ0A 3A1PA 2HSPA 3L2VA 2G77A 1WX6A 3LW5E 2QQ9A 4LDYA 4M7AC 2UZDB 1RAEB 1YJWA 5DQWA 1KQ1A 1W2BS 3I5RA 3M9QA 1MMAA 1U1SA 4LDWA 2R58A 5L8RE 3VS4A 1LJOA 5FLXE 2B86A 3OYYA 3A5ZB 4IUPA 2JUFA 2B8AA 3VYGA 2K2MA 4HCKA 2BPMB 4XU2A 2GNCA 5CKHA 4Y91A 1Y96B 1QVGP 1H26B 3SWNC 1HYOA 1KHCA 1OZ3A 4CRLB 1TXQA 3EG1A 2ROLA 1B7TA 1FKMA 4M75D 5GAOn 3L2UA 1QLBA 1WGSA 1V29B 4LUDA 1PKDB 3D7SB 2FZGB 3EG3A 1ZX6A 4LD9K 4RTYA 2KK4A 3QBYA 2ZPIB 5GAMj 1O75A 1OIUB 3PVLA 3EAEA 3JSCA 4A4EA 2QI2A 4DBHA 1WQ7A 2DD5A 4J9DA 2ZCFB 1E6GA 4OMLA 4CXAB 1WHKA 4M6VA 3NTKA 4WTOB 2LQ8A 4FCYA 4J9GA 4AMCA 4EMKC 1JKWA 2EBPA 4EIKA 5C0MA 4DOVA 3F5XB 1BYMA 2X51A 3HO8A 5GMKe 5CO7A 1AWWA 4E7JA 4AKGA 3CC4T 2E4HA 5BNJB 2E65A 3EFOA 4BBRM 1RUWA 3TEEA 4EMKB 4F16A 4BACA 1URCB 2YUOA 2O4XA 1IXDA 2GFAA 3SHWA 3CCMA 1MMNA
chains in the Genus database with same CATH topology
3CXCS 4NL3A 1VQ7A 3GF5A 2XICA 1RI0A 3RMSA 3PTAA 2PUOB 3MEVA 4PJOA 1D3BA 4HNTA 2G3RA 3JCMg 3L1AA 4BE1A 1S72A 3TCJA 3JCMX 1UGSB 4HKEA 5GAN6 1BIBA 1MGQA 1Q81U 1NZ9A 3GPLA 2RJCA 5HKCA 3LWIA 5DY9A 3S3MA 2QA4T 4ZGDB 4BI4A 1HXDA 1G3TA 3A8OB 3LH0A 4O6JA 4M75G 2QQ8A 2CS7A 1VQMA 3M57A 1K73U 3PIOA 4MIMA 4M77D 3E9FA 3CCUA 1O9SA 2H3JA 4J83A 4LD6A 3QJYA 4IUUA 1VQMT 2PVGB 4CI0C 2A7YA 4BB7A 3SDZA 2ZPBB 5FRNA 1X75C 3OA6A 4ATOA 4PJOC 3MP6A 4FT4A 4XTUA 4PJOE 3TW6A 4VUBA 1M1FA 1RL2A 2HQEA 3E1SA 3OYIA 2EQUA 1B34A 4ELJA 4OVAA 3CCRA 4J6WA 5LL6S 2BS2A 2DIQA 4C8QF 5GAOp 3HZJA 1VQPA 2MWOA 4FIBA 2FB7A 2PU9B 3JB9D 2YHTA 3DLMA 2DD4A 1R8OB 4X9CA 2HAXA 2IVWA 4Q5WA 1VQPT 4IURA 5EG2A 5GAMg 5KH6A 4LOCA 4M7AE 3OYBA 2A3LA 1I4K1 5GAOr 3GLXA 5GMKm 2EQKA 4LDUA 1N9RA 4HNVA 1JRIA 2X4JA 3LLRA 2KVQG 5D6WA 5CAIA 1VQ8A 3DKMA 4OGEA 2RJDA 3OBWA 3VJPA 1I8FA 5EJCA 1VQ4T 2VXFA 3FDRA 2E1HA 4JUVA 3LYIA 5A0GA 3CCVA 3BG3A 2L5QA 2M0OA 2XD0A 3CCLA 3BDLA 5GANh 3PMTA 1M9SA 1VQ4A 3G71T 2D0QB 4GLKA 3BG5A 1PSFA 5AYFA 2QF7A 3V8JA 4BE2A 4LDXA 4L5GA 5FRMA 4HLQA 2F69A 2ZPEB 4J8OA 3L2WA 3OSVA 1YHQA 3QUIA 5C6SA 4BI8B 5I2SA 5FU7B 3A8HB 3M58A 5LJ3h 4C0DB 2DD4B 5KE2A 4MMKA 2C06A 1BKBA 3CCJT 4XTXA 4A4HA 1M4ZA 4JS5A 2EIFA 1VQNA 4OB3B 3OW2A 4HT9A 2K4YA 3C95A 2XDBA 3QYEA 4XTYA 2QTXA 2EAYA 2FVUA 4N0AC 1BI2A 3ME9A 2DKGA 2LVMA 5LJ5h 3HRSA 4X9DA 4PJOG 5CCAA 5HK3A 4BI3A 3JCMb 1YJWT 2CZ7B 5GAN7 2OTLA 2DTHA 1EIFA 1JJ2S 3OYDA 4PLIA 2D6FA 4P5NA 1VIFA 4IUQA 4C8QD 1Q7YC 1VQ5A 2LTOA 3VKHA 2DZCA 4M7AB 4UC4A 4PJOD 2CZ1B 1JB0E 2XK0A 2DXBA 4M75A 1VIEA 4JRQA 3AHUA 4PJOF 1KG1A 1I5LA 5GMKl 3M4GA 1UGRB 5GAOq 4A53A 1NPRA 2VC8A 2CZ6B 3C94A 3OYHA 3JCMJ 1UB4A 4N0AA 5FU6C 1TH7A 3L42A 4M7AD 4PJOB 5CIUA 1B34B 2MWPA 2V8IA 3JCMe 4KUDK 1KC8U 1LOJA 4M77A 3X25B 4C92C 3CCEA 1Q81C 2K5FA 3OYNA 4EDUA 4X34A 1AHJB 2JTMA 1N6AA 2EJ9A 2GFUA 3M59A 2EYQA 3V7CA 4M7DF 4A4GA 1FXXA 2YRVA 2QEXT 2EJGA 2LCCA 5KCHA 4MDWA 1N8RC 4IKFA 2L3RA 1QVGA 4JRIA 3OW2S 3HSBA 3SB2A 4Z6YA 3ASKA 3OYCA 4M78F 1YI2A 2E41A 2ZGWA 2DXBB 2RK2A 3M54A 3LX7A 4M7DG 2XU8A 3HFOA 4ZTFA 3M5AA 5GANf 2OTJA 2XG8D 4F7UF 2EQMA 4C92D 5FU6B 2ZZDA 4EMHA 4E7LA 3PMIA 4NOYA 2VGNA 3PGGA 3WVEB 3EFSA 5J26A 2ZPHB 1VQOT 3CD6T 2EJFA 2ZZDB 4OGCA 1P92A 2MMPA 5M9OA 3RKXA 3SWNB 3HB9A 3CPWA 4KBMB 1VUBA 3OYEA 1JBMA 5GAN4 2PVDB 2LCLA 2LNVA 4BUGA 4L59A 1ZQ1A 4F7UG 2RHXA 2DZ9A 3QDRB 4M7DC 4V2SA 3FEOA 3CMEA 2KSSA 2EFIA 2CKKA 2LRQA 3V7SA 4C0DC 2E10A 5GAMh 4ZGEB 2WSCE 3OYKA 4XQ3A 4F7UA 1KQSA 3WVDB 2RJFA 2VV5A 5CVIA 2NLUA 2VGMA 4IUVA 1OYXA 4XAXB 3JCMQ 4F7UB 3OYGA 1XOVA 1Q7YU 3V7RA 1M5Q1 2RHYA 2DVEA 3QHSA 3CCQA 4ZTJA 2LQKA 2XHCA 3HFNA 4ZN1A 3CC7T 3JB9F 3FRNA 1M1GA 1IZ6A 5FU7C 1YITT 3QPHA 3VV0A 4M77E 3ER0A 2QQSA 4DQ2A 5GANd 3V8LA 3GNFB 1WJSA 3OMGA 5GAMe 4M7DB 3HP9A 3CCRT 3JCMW 3I56T 3H6ZA 1YJNT 4NS5A 1ZHIA 2WSFE 3QYBA 4YTLA 5GAMf 4M7DA 2BIVA 4JX4A 2RHIA 4C0GA 4QQDA 4C8QA 4C92F 1VQLT 5LJ3d 2XIDA 1W4SA 4QVCA 2DXCB 1X6OA 4M78B 2DTOA 1WNLA 2FHDA 3BFMA 5LJ5f 5A2QE 3LGLA 2KY9A 3JCMV 5CK9A 3CCSA 5GAOm 1DJ7B 3NTHA 1Q86C 2M1HA 2RI2A 3M4YA 4Z02A 3UT1A 3UWNA 4C0FA 4M78C 2DXUA 3G6ET 3E9GA 1Q86U 5LJ5d 2ZPFB 4C92E 1BI0A 3BG9A 1QP2A 3FIFA 1Y07A 1M8VA 1BIAA 3CPFA 5LJ5j 2K3XA 3G6EA 2XKOC 1W2BA 2XI9A 3X24B 3QKJA 3CBPA 3DB4A 4ELZC 4QW2A 1FWZA 4F7UE 3M56A 3P8HA 3CCJA 3OYMA 4E47A 5GAOl 4R56A 2KMTA 2RA2A 4HA8A 4AKIA 3OS2A 3QSUA 5A0DA 5GMKj 2GF7A 3CCET 3I56A 4OF1A 1K9MU 4DA4A 4MMLA 4MZPA 3L2QA 3VKIA 4E7JA 3MEUA 4A4KA 3TREA 2LT1A 3JCMh 2E6NA 2QXFA 2JVVA 2DXCA 2HNIA 4M77G 5LJ3f 4BE0A 3RERA 4M7DE 2HD0A 4BDYA 4EMGA 4C92A 3J7AF 3FLGA 4J7IA 3SFMA 3NFCA 5GANe 4C5IA 1FX7A 2JN0A 3BY7A 2OTLT 4N4GA 2P0QA 2DK3A 4C0ZA 1Q82U 2VXEA 3QZ5B 1G3YA 4M75F 3WXMB 3NTIA 3UDCA 1U1TA 3CCVT 2E70A 1QVGS 4HCZA 2DEQA 1VQ6T 2KR6A 4JLIA 4B9WA 4OB2B 4J6YA 3G71A 4JS4A 4KT0E 1Y7XA 2BS4A 4GY5A 3MO8A 2QQAA 3CCLT 4RCCA 3HBLA 1VQ6A 3HRUA 2EQJA 3GIBA 4M78D 4WF2A 5CKFA 2JNGA 2LDMA 2PUKB 2PVOB 3GOXA 1K8AU 2RK1A 2MF2A 3JRZA 4N4HA 4TVRA 4A54A 3L2RA 1VQKT 3JCMc 2GCXA 3S6WA 3H4CA 2E12A 5CKEA 5HK0A 3OYAA 4HCBA 5FROA 1KQSS 5LJ3g 1QVPA 3CMAA 4C8QB 2FYKA 2DXTA 1M1KU 4ZGJB 3S3OA 4B9XA 3JB9H 3A8GB 5LJ3e 3OYJA 4FSXA 3MHXA 1UGQB 1BI3A 4NL2A 2RB6A 2P4TA 1QVFS 3OS1A 3JB9J 1KD1C 5GAMd 4RMOA 1VQ9A 4FU6A 4M7AA 3ZEHA 3OSSC 5D6YA 2BKDN 4A4FA 2EWNA 3X26B 2GQVA 1VQOA 3CBMA 4RKUE 1YITA 1VQ9T 5LJ3j 2D9TA 4OMFB 2JOYA 5I2MA 4HCCA 3MP8A 2PQWA 2M16A 3G7ZA 1WJQA 4BDZA 3CC2T 4C8QG 5A0LA 3HHTB 4M78E 3S3NA 4PLLA 3T9NA 4JX6A 2RI3A 1PSEA 3FB9A 5CKDA 1QVFA 1ZBXA 2P0PA 2WACA 3BW1A 3OB9A 1VQLA 4MFEA 2HBPA 4XTVA 4QQGA 5HY6A 5J3BA 4C5EA 4ZN3A 3LWHA 5LJ5e 2QDYB 2M9UA 3VUZA 5GAN3 2X35A 4D6WA 2K5LA 3DB3A 2V8JA 2RI5A 4PNOA 4BD3A 4C5GA 2KDSA 4L6V5 1XTDA 3I55A 2I2LA 3URGA 2QA4A 3JB9G 2CGHA 2E64A 4QVZA 4MZMA 4E7HA 3X20B 3O8VA 1UGPB 3TU4K 1Q82C 4QVDA 2KAFA 4N4IA 4M75C 3FJPA 2X4WA 1YI2T 3CC7A 1XNIA 2K3YA 1KHIA 2O4XB 5CQYA 1KQ2A 1HK9A 3CCQT 3BDUA 3TW7A 4CRIA 4BBSM 3UPUA 4JLGA 3VYHB 1VQ7T 2MI6A 5GAN2 3MP1A 3QYHB 3OS0A 3CCMT 5GANj 4JDSA 4NC6A 4M77C 4XTWA 2VUBA 5DM7R 4R55A 3CC2A 4PL6A 1S72T 1D3BB 4MDXA 1JJ2A 4LDVA 2E6ZA 2LC4A 1YIJA 5D6XA 2DIGA 3META 2QDJA 3A8LB 1YIJT 3DL1A 1N9SA 3JCMf 1N27A 3QJ6A 3F70A 5LJ5g 4HT8A 2DJZA 4II1A 5GAN5 2LT4A 5CQXA 3V8KA 4JJNK 4M7DD 3G4SA 4PKCC 3I55T 3CBOA 2R5MA 4IUTA 4FM4B 3R6OA 1SSFA 1QW1A 3JCMd 4M78A 3SD4A 1H3ZA 2Y4XA 1KD1U 5CR2A 1NE8A 2RHZA 1NJIC 4XU1A 4M75B 3P8DA 4M78G 3C4SA 4O5VA 2BS3A 3VU3C 3RKYA 2QFZA 3CC4A 2ZPGB 1YHQT 3VYGB 3Q1JA 3QYGB 4C5HA 3GP8A 1LNXA 2E5QA 1Y71A 1BI1A 3OBYA 2QQRA 4M77F 2LX9A 3MCAB 4OB0B 1VQNT 3QG1A 4MFDA 1KC8C 2K2VA 2RM4A 3OS5A 2JZ2A 4RCBA 2HQXA 3PIPA 2CYZB 2X4XA 2FL7A 4JX5A 2P0KA 3L2VA 2G77A 2QQ9A 3LW5E 4LDYA 3JB9I 3CXCA 3MEAA 3E19A 4M7AC 4M75E 1K8AC 1N8RU 1IREB 3DLLA 1YJNA 1YBYA 1YJWA 3M53A 1KQ1A 5GAN8 1W2BS 3HKSA 3M9QA 1YJ9T 3OMCA 2X4YA 3JAME 3MEWA 4RG2A 5GMKi 1VQ5T 5IN1A 4MZTA 1M90C 2YLCA 4ELYC 3QWLA 3CCST 1U1SA 1M90U 4Y28E 4QSHA 3CPWS 3EFRA 3J80E 2Y4YA 3M55A 2WJ9A 4KULA 4E7KA 1OZ2A 2R58A 2F5TX 3CEYA 4LDWA 1LJOA 2L89A 5L8RE 5FLXE 1XQHA 3VUBA 2V8KA 3OYYA 4M7AG 4AKHA 1Y96A 2R57A 3A5ZB 4IUPA 2JUFA 2B8AA 1YCYA 3VYGA 4ME7A 4Y91A 4XU2A 3L2ZA 5CKHA 4XTZA 3SWNA 2L8DA 3ZBDA 5J39A 1Y96B 2VYTA 3JCMP 1VQKA 3SWNC 4OP0A 2XDDA 4E7IA 1G5VA 1KHCA 1OZ3A 4C8QC 1OI1A 1K9MC 4M7AF 4BY6B 3QO3A 1FKMA 1MHNA 1WJRA 3OYLA 2QEXA 2K57A 3RMQA 2RO0A 2KMGA 3GNGA 4M75D 3RIRA 2K5IA 5KE3A 4C92B 5GAOn 1QLBA 3L2UA 1WGSA 1V29B 3HL8A 1GXIE 4AI6A 3CMAT 4LD9K 3VKGA 4QQ6A 5DLQE 4HL4A 1QP3A 3C12A 2KK4A 3QBYA 2ZPIB 5GAMj 1K73C 3QZ9B 1O75A 2F5KA 1NJIU 4EMKA 3CCUT 2YLBA 3HRTA 4XU3A 3EAEA 2OAUA 3JSCA 3P8BB 4JRKA 4A4EA 2QI2A 1U8RA 3KHIA 3X28B 3PT9A 5GMKh 3QXEB 2KQWA 2WSEE 3LGFA 3RUXA 3H8ZA 3J81E 3OY9A 1YJ9A 3CD6A 1WQ7A 4EPCA 4JRPA 2QQBA 2DD5A 4BY6C 3KBGA 3KXTA 4J5YA 2R5AA 2ZCFB 4KUIA 4M77B 3QIIA 3CMET 4C92G 2DAQA 3A8MB 1WPYA 2DO3A 1E7PA 5DLOA 2JTFA 4M6VA 3OYFA 3NTKA 2LQ8A 1M1KC 5KCOA 4FT2A 4EMKC 3ZFJA 3G4ST 2BUDA 1NPPA 4HNUA 5C0MA 2RHUA 4DOVA 5IAYA 4DOWA 3FC3A 3KUFA 1BYMA 3PFSA 4J7FA 3HO8A 1I81A 3HPWA 2RH2A 5GMKe 1G3SA 2RJEA 5CO7A 4C8QE 2Y90A 3OQ5A 2O01E 4AKGA 2MAMA 4XK8E 2EKOA 2E65A 1X01A 3CC4T 2DPPB 2CZ0B 4BBRM 2IG0A 3TEEA 4J6XA 4EMKB 4BACA 1VQ8T 4XU0A 3RKWA 1H641 2XDPA 3PNWC 3RESA 5I21A 4OB1B 5GANg 4RG8A 1UEBA 2O4XA 2GFAA 2DD5B 4FL6A 1WQWA 2AHJB 1G3WA 2DTIA 5CKBA 5IT9E 3CCMA 3INZA 2RD1A 2OTJT 3N5BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPG B;  3VYG B;  3QYG B;  1AHJ B;  3QZ5 B;  2PUO B;  4OB0 B;  1UGS B;  4OB2 B;  2CYZ B;  4KT0 E;  3LW5 E;  2DXB B;  4ZGD B;  3A8O B;  2PUK B;  2PVO B;  1IRE B;  2ZZD A;  3WVE B;  2ZPH B;  2ZZD B;  2PVG B;  2ZPB B;  4Y28 E;  4ZGJ B;  3A8G B;  2PVD B;  5L8R E;  1UGQ B;  3VYG A;  4ZGE B;  2PU9 B;  2WSC E;  2DD4 A;  3WVD B;  3X26 B;  4RKU E;  3HHT B;  1V29 B;  1GXI E;  1PSE A;  2QDY B;  2D0Q B;  1QP3 A;  1PSF A;  2ZPI B;  3QZ9 B;  2WSF E;  4L6V 5;  2ZPE B;  3A8H B;  3X20 B;  1UGP B;  2DD4 B;  3X28 B;  3QXE B;  2DXC B;  2WSE E;  4OB3 B;  2DD5 A;  1DJ7 B;  2ZCF B;  3A8M B;  3VYH B;  2ZPF B;  1QP2 A;  3QYH B;  2CZ7 B;  3X24 B;  3A8L B;  2CZ1 B;  1JB0 E;  2DXB A;  2O01 E;  1UGR B;  4XK8 E;  2DPP B;  2CZ6 B;  2CZ0 B;  4FM4 B;  2DXC A;  4OB1 B;  2DD5 B;  2AHJ B;  3X25 B; 
#chains in the Genus database with same CATH topology
 3CXC S;  1VIN A;  2O31 A;  3GF5 A;  1TUG B;  1AZG B;  3RMS A;  4BE1 A;  4BCG B;  2DVJ A;  1UGS B;  1VQ5 Q;  1X2Q A;  3E2U A;  3H0I A;  9ATC B;  5EC7 A;  5HKC A;  1UG1 A;  2LQW A;  5DY9 A;  3M0U A;  2J6F A;  1HXD A;  2ENM A;  2CS7 A;  3M57 A;  4LNP A;  1VQM T;  2PVG B;  2DF6 A;  1SRM A;  4PJO C;  2HQE A;  1FVV B;  5LL6 S;  2BS2 A;  5GAO p;  2DJQ A;  4C8Q F;  4FIB A;  2PU9 B;  3CD6 Q;  1TWB A;  3NDQ A;  4F70 B;  4X9C A;  1VQ4 Q;  1VQP T;  4LOC A;  1ZA1 B;  3CMA Q;  1X2K A;  2EQK A;  4BCJ B;  2DMO A;  4PFZ A;  4LDU A;  2KGT A;  1JRI A;  1SG5 A;  2AZS A;  2KVQ G;  5CAI A;  2L3P A;  3NPF A;  3DKM A;  2DER A;  1FMV A;  3VJP A;  1SRL A;  1I8F A;  5AT1 B;  5KYW B;  2E1H A;  1NBE B;  1FYN A;  1UHC A;  3PMT A;  4GLK A;  4BE2 A;  3BG5 A;  2QF7 A;  1OOT A;  1TUC A;  4LDX A;  2LJ1 A;  1FMW A;  1NJI R;  1LCK A;  3QUI A;  4BI8 B;  3A8H B;  3M58 A;  8AT1 B;  2DD4 B;  1X6B A;  2C06 A;  1VQN A;  3OW2 A;  1RLQ C;  3QYE A;  2QTX A;  1ZA2 B;  2LVM A;  1MUZ A;  3BE3 A;  2QDL A;  4BI3 A;  2DIL A;  1VYT A;  2P84 A;  3CCJ Q;  4P5N A;  1VIF A;  4C8Q D;  1W70 A;  3NMZ C;  3MIA B;  2HL5 C;  4UC4 A;  3G6E Q;  5IXB A;  1UFF A;  4E6R A;  4PJO F;  5GMK l;  3M4G A;  1UGR B;  2VC8 A;  2CZ6 B;  2OJ2 A;  3JCM J;  1UB4 A;  5KYU B;  3MI9 B;  1VOL A;  4PJO B;  1YWP A;  2H3E B;  2MWP A;  4M77 A;  3OYN A;  1G83 A;  4EDU A;  2JTM A;  2C6T B;  4EOI B;  1ABO A;  1UGV A;  2GFU A;  2EYQ A;  1N8R C;  2L3R A;  2MYS A;  3EG9 A;  3OW2 S;  3SB2 A;  3OYC A;  1NYF A;  2E41 A;  3M54 A;  4M7D G;  2XU8 A;  2OTJ A;  4EMH A;  8ATC B;  4NOY A;  1K73 R;  2VGN A;  5CYI B;  1GFD A;  2VKN A;  4BCM B;  3HB9 A;  4NST B;  4F17 A;  2G9X B;  1VUB A;  1JBM A;  4D8K A;  1YCS B;  3FEO A;  5D7U A;  2EFI A;  2MIO A;  4C0D C;  5GAM h;  4ZGE B;  2WSC E;  2VVK A;  4F7U A;  5CVI A;  2EGC A;  4ESR A;  3JCM Q;  2CUD A;  4DBQ A;  1T0H A;  2RHY A;  2DVE A;  3QHS A;  3G71 Q;  2XHC A;  3I56 Q;  3JB9 F;  5FU7 C;  1AZE A;  2DRK A;  1QMZ B;  2D0N A;  1WJS A;  3I56 T;  4NS5 A;  4BCI B;  4RTU A;  1WHG A;  1W4S A;  2ATC B;  2FHD A;  1E9H B;  2EQI A;  3BFM A;  3LGL A;  5GAO m;  3NTH A;  4C0F A;  4M78 C;  2DXU A;  2DL5 A;  1BB9 A;  1BI0 A;  4C92 E;  1OU8 A;  5LJ5 j;  2HBW A;  2K3X A;  2KT1 A;  1W2B A;  3X24 B;  2QAZ A;  2CT4 A;  2C0O A;  4E47 A;  1ZLM A;  4OF1 A;  4DA4 A;  4MML A;  3B57 A;  3MEU A;  4A4K A;  4BY6 C;  2QXF A;  4HVU A;  2HNI A;  3TVT A;  2O88 A;  3RER A;  4BDY A;  4C92 A;  3FLG A;  4J7I A;  3SFM A;  3THK A;  5GAN e;  1R0B G;  3EFO B;  2DL4 A;  4I3Z B;  1Z9Q A;  3QZ5 B;  1G3Y A;  5FWB A;  3NTI A;  1RAA B;  5I11 A;  4J6Y A;  4JS4 A;  2QQA A;  1VQ6 A;  2EQJ A;  1TUD A;  1M1K R;  2JNG A;  3JCM c;  4YOO A;  2F2V A;  1OGU B;  5LJ3 g;  4IMY B;  2CH4 A;  3LH5 A;  2DXT A;  5LMK B;  3JB9 H;  4LXC A;  2A28 A;  4ROE A;  2RB6 A;  2MK5 A;  2DET A;  1ZUU A;  2XMF A;  3O0G D;  1QVF P;  2D9T A;  2JOY A;  5I2M A;  2DE0 X;  2QAS A;  3MP8 A;  4HCC A;  2M16 A;  3G7Z A;  1WJQ A;  2D1X A;  1NLO C;  3HHT B;  4PLL A;  5HCK A;  1K0X A;  4JX6 A;  2RI3 A;  2AKK A;  1M3B A;  2WAC A;  5HY6 A;  4C5E A;  1SPK A;  2MCN A;  3LWH A;  2CDT A;  3VUZ A;  2IW9 B;  1YNZ A;  2K5L A;  4M7D E;  5GJW B;  2KDS A;  4FYW B;  4JJC A;  3JB9 G;  1M90 R;  5L23 A;  3EOC B;  4E7H A;  3TU4 K;  1UGP B;  1BCO A;  4WCI A;  1PD1 A;  1K4U S;  2K3Y A;  4OMQ A;  5CQY A;  1HK9 A;  4JLG A;  1WYX A;  4CFX B;  5GAN 2;  3MP1 A;  2EW3 A;  4NC6 A;  4M77 C;  1X43 A;  4PL6 A;  3EHR A;  4JPB W;  1JJ2 A;  2E6Z A;  4KGX B;  5D6X A;  2JW4 A;  3EG0 A;  3MET A;  4AG1 C;  1N27 A;  1T3L A;  3O5Z A;  3V8K A;  2HKN A;  2J6K A;  3G4S A;  1QCF A;  3I55 T;  4IUT A;  1SSF A;  4M78 A;  5CR2 A;  1AD6 A;  3MY1 B;  5I22 A;  4O5V A;  3C4S A;  3A98 A;  4BCH B;  3CC4 A;  2RNA A;  5IF1 B;  1H24 B;  3CCL Q;  3VYG B;  3Q1J A;  1PKT A;  1LNX A;  1NLP C;  1Y71 A;  2NUP B;  3BHU B;  3TSW A;  1VQN T;  2RMO A;  3PIP A;  2X4X A;  2FL7 A;  4JX5 A;  2P0K A;  1WXB A;  1YWO A;  3MEA A;  1K8A C;  1N8R U;  1IRE B;  4PFO A;  3M53 A;  3QHW B;  2AK5 A;  3TN8 B;  3IQL A;  3JAM E;  5IN1 A;  1RAD B;  2CRE A;  1WA7 A;  2YLC A;  1M90 C;  3QWL A;  3CCS T;  1M90 U;  4EOS B;  2Y4Y A;  3M55 A;  4E7K A;  3CEY A;  1JST B;  3CCU T;  2L89 A;  1XQH A;  2WHB B;  4AKH A;  2R57 A;  1YCY A;  4ME7 A;  3ZBD A;  1VQM Q;  1SF9 A;  2FRW A;  3JCM P;  2L8D A;  4OP0 A;  2XDD A;  1ZUY A;  2RQR A;  1RAF B;  1OI1 A;  4J9B A;  4J9H A;  3OYL A;  1MHN A;  1WJR A;  2K57 A;  2KMG A;  3QDF A;  3VS5 A;  5IDN B;  1GXI E;  1VQP Q;  3DJB A;  4QQ6 A;  2X3X D;  4HL4 A;  4CFU D;  1K73 C;  1QWF A;  2F5K A;  1NJI U;  2EKH A;  2I0N A;  2KRN A;  3HRT A;  2GBQ A;  4OMM A;  2C4G B;  4PJM A;  3P8B B;  3X28 B;  3PT9 A;  2KQW A;  2WSE E;  2BE7 D;  4BCQ D;  4JRP A;  4LN2 A;  2VWF A;  1Z9Z A;  1ACM B;  4M77 B;  2R5A A;  3KXT A;  4C92 G;  2HDA A;  2DO3 A;  2EUF A;  2LMJ A;  4FW2 A;  2K6D A;  3I35 A;  3ZFJ A;  4TTH A;  3G4S T;  2BUD A;  2J6O A;  2WIH B;  4DOW A;  3PFS A;  1YJ9 Q;  1G3S A;  2RJE A;  1OI9 B;  1OQK A;  3QWX X;  2O01 E;  5HNB B;  2MAM A;  1N4M A;  2IG0 A;  1VQ8 T;  1GH6 B;  2XDP A;  3PNW C;  1UEB A;  1VQ8 A;  2DD5 B;  5LQF B;  4FL6 A;  2AHJ B;  4KUD K;  2DTI A;  3UA7 A;  5AYF A;  2CSQ A;  1ARK A;  4NL3 A;  1VQ7 A;  2KR3 A;  3DTO A;  3PTA A;  1VQ8 Q;  5I5Z B;  2PUO B;  1S72 A;  3L1A A;  1VYV A;  2RQT A;  4HKE A;  3AT1 B;  5GAN 6;  1NZ9 A;  3GPL A;  2RPN A;  2FEI A;  4ZGD B;  4BI4 A;  2BKZ B;  3A8O B;  4UN0 A;  4O6J A;  2JS0 A;  1AEY A;  1K73 U;  3PIO A;  3E9F A;  3CCU A;  2H3J A;  3M0P A;  4IUU A;  1YP5 A;  2ZPB B;  1LPL A;  3SDZ A;  2EGA A;  4ATO A;  4FT4 A;  3TW6 A;  2CCI B;  3E1S A;  3OYI A;  4M7D A;  4OVA A;  2DIQ A;  1CKA A;  1VQO Q;  4BCO B;  2YHT A;  1K0S A;  1GL5 A;  2V1Q A;  4Q5W A;  1UJY A;  5GAM g;  4M7A E;  1P5E B;  3M0T A;  1ENW A;  1N9R A;  4HNV A;  3LLR A;  2IVX A;  1JXO A;  2FZK B;  2RJD A;  5EJC A;  1VQ4 T;  2KRS A;  3FDR A;  3CCV A;  5A0G A;  3LYI A;  1KSW A;  2M0O A;  1VQ4 A;  1PRL C;  3G71 T;  3V8J A;  5ECA A;  2PZ1 A;  2F69 A;  1M3A A;  5C6S A;  3MPU B;  5FU7 B;  2D8J A;  1H4L D;  4XTX A;  1M4Z A;  2EIF A;  1UTI A;  2YSQ A;  4HT9 A;  2K4Y A;  3C95 A;  3VRY A;  3TNW B;  3BLH B;  1C0M A;  2DFU A;  1Y57 A;  2EYY A;  4CFW B;  5HK3 A;  3JCM b;  1GCQ A;  4OMN A;  2CZ7 B;  2OTL A;  2D6F A;  4PLI A;  1EFN A;  2BZX A;  1VQ5 A;  1Y0M A;  4PJO D;  2OTJ Q;  2CJM B;  1QCN A;  4JRQ A;  3AHU A;  1M2O A;  5KYY B;  1AOJ A;  1I5L A;  5GAO q;  2L0A A;  1RAB B;  2QGS A;  2JM9 A;  1TH7 A;  2PMI B;  1B34 B;  4Z8A A;  1LOJ A;  3X25 B;  3CCE A;  4FSS A;  4X34 A;  1CKB A;  1AHJ B;  4M7D F;  1N6A A;  2EJ9 A;  3V7C A;  3CQT A;  4RTW A;  2IW6 B;  2QEX T;  4MDW A;  3JV3 A;  1VYU A;  4BCP B;  2FZC B;  3ASK A;  4BCQ B;  3EG9 B;  1WI7 A;  1YI2 A;  2ZGW A;  1M2V A;  3LX7 A;  4YOZ A;  3HFO A;  4ZTF A;  4K11 A;  1MNE A;  2Z0W A;  1QKX A;  3PGG A;  3EFS A;  4HVW A;  5J26 A;  1VQ6 Q;  4OGC A;  2MMP A;  3RKX A;  3SWN B;  4JZ3 A;  4KBM B;  5GAN 4;  4KRD B;  4QT7 A;  2LNV A;  4BUG A;  1ZQ1 A;  3CXC P;  2LRQ A;  3ZL7 C;  3CC7 Q;  1TS9 A;  3WVD B;  3VS6 A;  1KJW A;  3OYG A;  1XOV A;  4ZTJ A;  2KXC A;  3CCQ A;  2JS2 A;  1YJN Q;  2L3S A;  1M1G A;  4PJN A;  1I5O B;  2QQS A;  4DQ2 A;  2JM8 A;  5HQ0 B;  3EJ1 B;  5GAN d;  3V8L A;  1TSF A;  2O2O A;  3GTM S;  3M0R A;  4M7D B;  1UDL A;  3CCR T;  2WSF E;  3QYB A;  4ELL A;  2DRM A;  2BIV A;  4GLM A;  2K7A A;  4C0G A;  2XID A;  2DXC B;  1X6O A;  2J7I A;  1WNL A;  5LJ5 f;  5A2Q E;  4AT1 B;  3JCM V;  5CK9 A;  1ZBJ A;  1DJ7 B;  3M4Y A;  2WEV B;  3E9G A;  2PHG A;  4G6L B;  2DL7 A;  5LJ5 d;  2ZPF B;  1QP2 A;  1M8V A;  3CPF A;  2XI9 A;  1D0Y A;  3QKJ A;  3DB4 A;  4QW2 A;  4F7U E;  2C0I A;  3P8H A;  3CCJ A;  3OYM A;  5GAO l;  4R56 A;  2KMT A;  2RA2 A;  5A0D A;  4R0K A;  2IW8 B;  2NWM A;  3CCE T;  1K9M U;  4MZP A;  2UZE B;  2HQH A;  3CCV Q;  2E6N A;  5LJ3 f;  2KEA A;  2HD0 A;  1H1P B;  1KIK A;  2BTT A;  1FX7 A;  1V76 A;  3VS2 A;  2OTL T;  4CFV B;  2P0Q A;  3EGD B;  3I55 Q;  3CCV T;  2KR6 A;  4B9W A;  4FYX B;  1ZP2 A;  2BS4 A;  4EON B;  3CCL T;  2A36 A;  4RCC A;  2LDM A;  2PUK B;  1K8A U;  1NEB A;  3GOX A;  2CP0 A;  2F2W A;  4N4H A;  3L2R A;  1JU5 C;  1C6V X;  3K7A M;  3S6W A;  3H4C A;  4F7J B;  2E12 A;  2YUN A;  1F5Q B;  2X9H A;  1MMG A;  3BHV B;  1PD0 A;  4KGV B;  1VQ9 Q;  3A8G B;  2L2P A;  3OYJ A;  4FSX A;  1I07 A;  1BI3 A;  4NL2 A;  2CSI A;  2CP6 A;  1QVF S;  3OS1 A;  2OAW A;  2KT8 A;  1VQ9 A;  5D6Y A;  2BKD N;  4BCN D;  1IGQ A;  2EWN A;  1VOM A;  4FYY B;  4J9I A;  1VQO A;  1JQQ A;  1YIT A;  1GFC A;  4E7Z A;  2CP3 A;  3DOG B;  4BDZ A;  1JOW A;  4C8Q G;  1H25 B;  3T9N A;  1BU1 A;  1PSE A;  4RTZ A;  1QVF A;  1ZBX A;  3BW1 A;  5IHY A;  1RAC B;  2J06 A;  4J9E A;  1K9M R;  2M9U A;  1GCQ C;  2X35 A;  2V8J A;  4PNO A;  4BD3 A;  4C5G A;  4L6V 5;  3I55 A;  4D8D A;  1N5Z A;  1I1J A;  1VQ7 Q;  4QVZ A;  3X20 B;  2LNH B;  1S72 Q;  2HL3 A;  2EVR A;  5GJV B;  1XNI A;  1KHI A;  2PK2 A;  3M03 A;  2WMA B;  1E7O A;  3TW7 A;  1YIJ Q;  3UPU A;  4F04 B;  2MI6 A;  4JDS A;  3CC2 A;  2WFY B;  2RN8 A;  4XTW A;  3EGX A;  4MDX A;  1S72 T;  1WHM A;  1GUX B;  1YIJ A;  3LQ5 B;  4BXX X;  1NG2 A;  1J3T A;  2M51 A;  2FPE A;  3POM A;  1YFN A;  1YIJ T;  1JXM A;  1RI9 A;  3JCM f;  5EFQ B;  5LJ5 g;  5GAN 5;  4M7D D;  4GBQ A;  4PKC C;  1OKW B;  2R5M A;  4FM4 B;  2AT1 B;  3R6O A;  3VRZ A;  3JCM d;  3G4S Q;  5ACB A;  1UE9 A;  1H3Z A;  1OU9 A;  1RAG B;  1NJI C;  4XU1 A;  3RGF B;  4M75 B;  3P8D A;  1TG0 A;  1NM7 A;  3QYG B;  3CC4 Q;  1M2V B;  2E5Q A;  1AWO A;  3OBY A;  3M0Q A;  2QQR A;  2QG9 B;  4BY7 X;  3QG1 A;  3OS5 A;  4HXJ A;  1MV3 A;  3JB9 I;  4FYV B;  1ABQ A;  4YOS A;  7AT1 B;  2O9V A;  3DLL A;  1YJN A;  1YBY A;  4Y72 B;  3QWY A;  1I0C A;  1ZSZ C;  1G3N C;  3OMC A;  4RG2 A;  1VQ5 T;  1GBR A;  4MZT A;  4ELY C;  4EOK B;  1OV3 A;  4QSH A;  3CPW S;  3EFR A;  3J80 E;  1QKW A;  2WJ9 A;  4KUL A;  1OZ2 A;  3OYA A;  2M02 A;  4M7A G;  2V8K A;  5DQV A;  2KBT A;  3L2Z A;  5J39 A;  4XTZ A;  3SWN A;  1OIY B;  1VQK A;  4E7I A;  2CP7 A;  1G5V A;  4ORZ A;  2FO0 A;  1JO8 A;  5KYU A;  1N8R R;  4AFS C;  3QO3 A;  2QEX A;  2NUT A;  1GBQ A;  5KE3 A;  3GNG A;  2C5O B;  4JZ4 A;  3HL8 A;  1E6H A;  1IO6 A;  1QLY A;  4AI6 A;  3CMA T;  1IGU A;  2IIM A;  3VKG A;  2YRC A;  1K1Z A;  1OKV B;  3QZ9 B;  1G8X A;  2QK0 A;  2YUQ A;  3CME Q;  4JRK A;  3I5S A;  3UAT A;  3M0S A;  3J81 E;  3LGF A;  3OY9 A;  2JTE A;  3RUX A;  3H8Z A;  2F1L A;  4Y92 A;  3CD6 A;  1OL2 B;  2M0Y A;  5IHI A;  4KUI A;  2V22 B;  3CME T;  2DAQ A;  3A8M B;  1WPY A;  5DLO A;  1WHJ A;  3REA B;  3OYF A;  2QTV A;  2PTK A;  4FT2 A;  1O9K B;  4HNU A;  1AT1 B;  2RHU A;  3FC3 A;  3KUF A;  5KYW A;  1I81 A;  1RAH B;  3HPW A;  2RH2 A;  4IIO A;  2LCS A;  2X1N B;  1AWJ A;  4C8Q E;  2Y90 A;  3OQ5 A;  4XK8 E;  2EKO A;  1X01 A;  2DPP B;  2CZ0 B;  2HCK A;  4KRC B;  2CCH B;  1FIN B;  1H1Q B;  5ICP B;  1H64 1;  1ZSG A;  2UZL B;  2FRY A;  4RG8 A;  1KD1 R;  1G3W A;  3INZ A;  1YJ9 T;  1KXU A;  2HKQ B;  2CP2 A;  4F6W B;  2XIC A;  1D3B A;  2G3R A;  3DDP B;  4PFP A;  3RBB B;  3TCJ A;  1HSQ A;  1IB8 A;  3JCM X;  2GGR A;  1MGQ A;  1Q81 U;  2E3I A;  1K9A A;  3LWI A;  1WIE A;  2C0T A;  3S3M A;  2W9F A;  2QQ8 A;  4MIM A;  4M77 D;  4JJB A;  4J83 A;  3QJY A;  2A7Y A;  1SHF A;  2BZ8 A;  2KI7 A;  5FRN A;  1X75 C;  3OA6 A;  4EOP B;  3MP6 A;  4VUB A;  1RL2 A;  3CCR A;  2EQU A;  1B34 A;  4Z88 A;  3HZJ A;  1BK2 A;  2FB7 A;  3JB9 D;  1LVK A;  2HAX A;  3HTR A;  4IUR A;  5EG2 A;  1B3Q A;  4M4Z A;  3OYB A;  5GAO r;  2KYM A;  3GLX A;  2DEU A;  1H3H A;  5D6W A;  2WMB B;  4OGE A;  3OBW A;  2A0F B;  1U5S A;  2VXF A;  1ZSZ B;  3BG3 A;  2L5Q A;  3CCL A;  1M9S A;  5FRM A;  1UNL D;  1YHQ A;  3TQ7 P;  4C0D B;  4MMK A;  4A4H A;  1SEM A;  4JS5 A;  1H1S B;  1KC8 R;  2FVU A;  4N0A C;  1BI2 A;  2EPD A;  5LJ5 h;  2AZV A;  1NEG A;  1UNG D;  4DBF A;  5GAN 7;  2JXB A;  2DTH A;  1EIF A;  3OYD A;  1Q7Y C;  2JMC A;  5CEI B;  1KK7 A;  4M7A B;  2OI3 A;  1JB0 E;  5L2W B;  2DXB A;  1VIE A;  2SEM A;  2WPA B;  1NPR A;  3C94 A;  4CC4 B;  5FU6 C;  3L42 A;  3EH2 A;  5CIU A;  4EOO B;  2NUT B;  1BU2 A;  1D3U B;  4JJD A;  2K5F A;  3CCE Q;  3M59 A;  1GRI A;  1UJ0 A;  4A4G A;  1FXX A;  1SHG A;  1UUE A;  2EJG A;  2LCC A;  2YRV A;  1M27 C;  4Z6Y A;  1W2B P;  4M78 F;  2ABL A;  2IN3 A;  5FW9 A;  2EYW A;  3M5A A;  2R7G A;  2QEX Q;  2EQM A;  2GTJ A;  2QGG A;  2F2X A;  4C92 D;  4E7L A;  3PMI A;  2ZPH B;  2ZZD B;  2KRM A;  5M9O A;  3EGU A;  3H0H A;  3OYE A;  2PVD B;  2BZY A;  4F7U G;  2RHX A;  2DZ9 A;  3QDR B;  4M7D C;  3CME A;  2MPX C;  2NYS A;  1IRX A;  3QHR B;  5FGK B;  3OYK A;  4XQ3 A;  1KQS A;  1AWX A;  1T0J A;  2RJF A;  2VV5 A;  2NLU A;  2VGM A;  3RNJ A;  1Q7Y U;  1M5Q 1;  3MY5 B;  2LQK A;  2VAS A;  4KGZ B;  1TOV A;  4ANJ A;  4ZN1 A;  2YDL A;  3CC7 T;  1Q95 G;  3FRN A;  4J9C A;  1YIT T;  1VQL Q;  3VV0 A;  4KH0 B;  4M77 E;  3EID B;  1UEC A;  5GAM e;  3HP9 A;  3H6Z A;  1YJN T;  1ZHI A;  5GAM f;  5KYX A;  4JX4 A;  4C8Q A;  3H41 A;  4CC7 A;  1YIT Q;  1VQL T;  5LJ3 d;  2H8H A;  4YC3 B;  4B6M A;  4QVC A;  2BE9 B;  4M78 B;  2KY9 A;  1Q86 C;  2M1H A;  3UT1 A;  2DBM A;  3UWN A;  3G6E T;  2VB6 A;  3BG9 A;  1X69 A;  1Y07 A;  1Q82 R;  1K76 A;  2E5K A;  3CBP A;  4ELZ C;  1FWZ A;  2LJ3 A;  4CFU B;  5GMK j;  2GF7 A;  3L2Q A;  3VKI A;  2CT3 A;  3TRE A;  2LT1 A;  2DXC A;  3RR6 A;  3UF4 A;  4EMG A;  2YWW A;  3BY7 A;  1TU0 B;  2DK3 A;  2YUP A;  4ZNX A;  2ECZ A;  3WXM B;  2I40 B;  1U1T A;  2E70 A;  4CFN B;  1QVG S;  4HCZ A;  2DEQ A;  4JLI A;  3G71 A;  4KT0 E;  4GY5 A;  3MO8 A;  2OTL Q;  3HRU A;  4M78 D;  5CKF A;  2RK1 A;  1HJD A;  2MF2 A;  4TVR A;  4RTX A;  5HK0 A;  4HCB A;  3KFV A;  5FRO A;  3CMA A;  1MND A;  2ED1 A;  2KNB B;  4C8Q B;  1AIS B;  1M1K U;  4ZGJ B;  2K79 A;  4B9X A;  5KYN A;  3S3O A;  5LJ3 e;  4BCF B;  1UGQ B;  4X1V A;  2WXV B;  3NGP A;  2W0Z A;  1KD1 C;  2LP5 A;  4M7A A;  3ZEH A;  3MJX A;  4RUG A;  1D1C A;  4RKU E;  1VQ9 T;  1PWT A;  3CCU Q;  1WXU A;  2PQW A;  3PE0 A;  3CC2 T;  3S3N A;  5CKD A;  2P0P A;  1VQL A;  4MFE A;  1TFB A;  2HBP A;  3BHT B;  3GBQ A;  1O9K A;  1C9B A;  5LJ5 e;  2QDY B;  4D6W A;  2RI5 A;  5IHN A;  2I2L A;  2QA4 A;  2CGH A;  2E64 A;  2DA9 A;  3R6N A;  3O8V A;  3CCM Q;  1B07 A;  1Q82 C;  4QVD A;  2KAF A;  1TTH B;  1D1A A;  5HBJ B;  2X4W A;  1YI2 T;  3CC7 A;  2O4X B;  2DLP A;  4CRI A;  3VYH B;  1VQ7 T;  4KH1 B;  4OMP A;  1R77 A;  3QYH B;  5GAN j;  4R55 A;  2PK9 B;  1OL1 B;  2DIG A;  4CC2 A;  2NUZ A;  3A8L B;  4DBR A;  1N9S A;  3QJ6 A;  3EH1 A;  2W96 A;  4HT8 A;  4II1 A;  2LT4 A;  1QWE A;  1H1R B;  4JJN K;  3CBO A;  1QW1 A;  4E7S A;  2HZY A;  2Y4X A;  1KD1 U;  1SSH A;  2YT6 A;  1NE8 A;  4M78 G;  3VU3 C;  3RKY A;  1YHQ T;  3OW2 P;  2JT4 A;  3GP8 A;  1BI1 A;  2D8H A;  1PHT A;  2E3H A;  2V1R A;  2LX9 A;  2NUP A;  1VQK Q;  1M3C A;  2O9S A;  4MFD A;  2K2V A;  2RM4 A;  2JZ2 A;  4RCB A;  2HQX A;  5KYX B;  2CYZ B;  1VYW B;  2LQN A;  5IXF A;  4II5 B;  3CXC A;  3E19 A;  4EOJ B;  4M75 E;  4FX3 B;  2SRC A;  3CPW P;  1HD3 A;  2L3Q A;  5GAN 8;  3HKS A;  2RQV A;  2X4Y A;  3MEW A;  5GMK i;  3PO3 S;  2QYZ A;  2EGE A;  1CSK A;  4Y28 E;  1T3S A;  2I53 A;  1W1F A;  2F5T X;  4ROD A;  3VUB A;  1X6G A;  1Y96 A;  4LUE A;  2VYT A;  4C8Q C;  1K9M C;  2FG0 A;  2C5X B;  4M7A F;  4BY6 B;  2FPF A;  1RLP C;  2CH4 W;  2RO0 A;  2W9Z A;  3RMQ A;  3RIR A;  3VS3 A;  2K5I A;  1F1B B;  4C92 B;  1A0N B;  4EC8 B;  1RAI B;  4OMO A;  5DLQ E;  3TSZ A;  1QP3 A;  3C12 A;  2GQI A;  4EMK A;  2YLB A;  4F6U B;  2LX7 A;  4XU3 A;  4LE9 A;  2OAU A;  1U8R A;  3KHI A;  5GMK h;  3QXE B;  3EG2 A;  1YJ9 A;  2FPD A;  4EPC A;  2QQB A;  1AD5 A;  3KBG A;  4J5Y A;  3QII A;  1E7P A;  2JTF A;  2KE9 A;  1M1K C;  5KCO A;  3I9Q A;  1NPP A;  1M8M A;  5IAY A;  2UZB B;  4J7F A;  4IIM A;  4F14 A;  5IDP B;  2K9G A;  3PVQ A;  1PNJ A;  2YRD A;  2UUE B;  4J6X A;  2ED0 A;  4XU0 A;  3RKW A;  3RES A;  1EZZ B;  5I21 A;  4OB1 B;  5GAN g;  1VQN Q;  5IT9 E;  1WQW A;  5CKB A;  5KYY A;  2OTJ T;  2RD1 A;  3DDQ B;  3N5B B;  1OPK A;  2QA4 Q;  5IH2 A;  1RI0 A;  3MEV A;  4PJO A;  4HNT A;  3JCM g;  1JSU B;  3U23 A;  2DM1 A;  1JJ2 P;  1BIB A;  1X27 A;  1W98 B;  2RJC A;  3CCS Q;  2QA4 T;  1MMD A;  1G3T A;  1H27 B;  3LH0 A;  4BCM D;  4M75 G;  1VQM A;  1ZSZ A;  3VS0 A;  1O9S A;  1XO2 A;  1V1C A;  4LD6 A;  4CI0 C;  4BB7 A;  4XTU A;  4PJO E;  2COZ A;  2KYB A;  4AG2 C;  1M1F A;  4ELJ A;  1OUL A;  4J6W A;  4BCK B;  1VQP A;  2MWO A;  1M30 A;  3DLM A;  2DD4 A;  4EC9 B;  1R8O B;  1H92 A;  2IVW A;  1Q81 R;  1PG5 B;  5KH6 A;  2A3L A;  1I4K 1;  1EX4 A;  5GMK m;  2X4J A;  3G1J A;  2DL3 A;  4JUV A;  4RTT A;  3REB B;  2XD0 A;  2EYZ A;  3SEM A;  1PKS A;  3BDL A;  5GAN h;  2HSE B;  2D0Q B;  1PSF A;  1NYG A;  4L5G A;  4HLQ A;  4J8O A;  2ZPE B;  3L2W A;  3OSV A;  4F6S B;  2LZ6 B;  2JMA A;  5I2S A;  5LJ3 h;  1BCM A;  1WLP B;  5HBH B;  1VA7 A;  1BBZ A;  5KE2 A;  1YJW Q;  2W10 A;  1BKB A;  3EGX B;  3CCJ T;  4BCN B;  4OB3 B;  2HMA A;  2XDB A;  2MOX A;  4XTY A;  2EAY A;  2JJ9 A;  3ME9 A;  4PJJ A;  2DKG A;  3HRS A;  4X9D A;  4PJO G;  5CCA A;  3G33 B;  2DL8 A;  1YJW T;  3VS1 A;  1JJ2 S;  2V26 A;  4IUQ A;  2LTO A;  3TNH B;  4BY1 X;  3VKH A;  2RF0 A;  2DZC A;  2DYI A;  2CZ1 B;  2XK0 A;  4M75 A;  3EHQ A;  5HBE B;  3MKD A;  1KG1 A;  4CFM B;  1PRM C;  4A53 A;  4RTV A;  1QCO A;  1UNH D;  3OYH A;  2GTO A;  4N0A A;  4M7A D;  1G2B A;  2V8I A;  3JCM e;  1KC8 U;  4C92 C;  2EYX A;  1Q81 C;  1KFZ A;  2JGZ B;  2CUB A;  5KCH A;  3C0C A;  4IKF A;  1QVG A;  4JRI A;  2QGF B;  1Q86 R;  4A63 B;  3HSB A;  5IHK A;  2DX1 A;  2A08 A;  2DXB B;  2G6F X;  2RK2 A;  5GAN f;  4FW1 A;  2XG8 D;  4F7U F;  5FU6 B;  2ZZD A;  4F7L B;  4E2F B;  3WVE B;  2OX7 A;  1VQO T;  3CD6 T;  2EJF A;  2HEQ A;  1P92 A;  1S1N A;  1WHH A;  2AKL A;  3CPW A;  3BLR B;  4EOM B;  2LCL A;  1OPL A;  4L59 A;  4V2S A;  2KSS A;  3V7S A;  2CKK A;  2E10 A;  4PJL A;  2ESW A;  1TD6 A;  4IUV A;  1OYX A;  4XAX B;  5HVY B;  2DYB A;  4F7U B;  1W6X A;  3V7R A;  3FJ5 A;  4PK4 A;  1H28 B;  4CC3 A;  3HFN A;  1IZ6 A;  1UHF A;  3QPH A;  3ER0 A;  2LW4 A;  1KQS P;  1D0X A;  3GNF B;  1XJW B;  3OMG A;  2P4R A;  1PC0 A;  3JCM W;  4YTL A;  2KXD A;  2RHI A;  4QQD A;  4C92 F;  2DNU A;  4F7N B;  1SKU B;  2DTO A;  2J05 A;  1AVZ C;  1MV0 B;  1WZO A;  1Q7Y R;  2C5N B;  1ZUK A;  3CCS A;  2RI2 A;  4Z02 A;  2PJQ A;  1Q86 U;  1H8K A;  3RDV A;  2ROT A;  1C1A A;  3FIF A;  2IPO B;  1BIA A;  1OX9 A;  3G6E A;  2XKO C;  2WIP B;  1YI2 Q;  2AIR B;  4OGR B;  2ZAE A;  1WHL A;  3M56 A;  3NHN A;  4DEX A;  2PNI A;  3H9N A;  4HA8 A;  4AKI A;  3OS2 A;  3QSU A;  1JEG A;  4F7S B;  3I56 A;  3TNI B;  4EOL B;  3JCM h;  2JVV A;  1IHV A;  4M77 G;  4BE0 A;  4AFQ C;  3J7A F;  1IHW A;  2CP5 A;  3NFC A;  2K3B A;  4C5I A;  2JN0 A;  4N4G A;  4ROC A;  4C0Z A;  1Q82 U;  2VXE A;  4M75 F;  3UDC A;  1VQ6 T;  4EOQ B;  4OB2 B;  1Y7X A;  1D09 B;  1YHQ Q;  3HBL A;  3GIB A;  1GUX A;  4WF2 A;  2PVO B;  4J9F A;  4AFU C;  3VS7 A;  3JRZ A;  6AT1 B;  4A54 A;  1VQK T;  2GCX A;  5CKE A;  2B9R A;  1KQS S;  1QVP A;  2FYK A;  1U3O A;  1WFW A;  2COW A;  1K8A R;  3MHX A;  3UA6 A;  2DME A;  2P4T A;  3JB9 J;  5GAM d;  4RMO A;  4FU6 A;  3OSS C;  4A4F A;  3X26 B;  2GQV A;  1GCP A;  3CBM A;  1WXT A;  3H0F A;  5LJ3 j;  4OMF B;  3ULR B;  3BLQ B;  1WDX A;  3CCR Q;  5A0L A;  2X3W D;  4M78 E;  4KRT A;  3FB9 A;  1PM3 A;  3OB9 A;  4XTV A;  4QQG A;  5J3B A;  4ZN3 A;  5GAN 3;  3DB3 A;  3CC2 Q;  1D0Z A;  3CCQ Q;  1YN8 A;  1XTD A;  3URG A;  1QMC A;  4MZM A;  5FWC A;  4N4I A;  4Z89 A;  4M75 C;  3FJP A;  1QQJ A;  1D1B A;  2RQU A;  1KQ2 A;  3CCQ T;  2F2C A;  3BDU A;  4BBS M;  4QKU A;  4DEY A;  4HVV A;  3OS0 A;  3CCM T;  2VUB A;  5DM7 R;  1D3B B;  1U06 A;  4LDV A;  2LC4 A;  2DBK A;  2RQW A;  2QDJ A;  2W2H A;  3DL1 A;  2YXY A;  3F70 A;  2DJZ A;  1GY3 B;  5CQX A;  2W99 A;  4AFZ C;  1PCX A;  2A37 A;  3EGD A;  3SD4 A;  1FMK A;  4EOR B;  4OR5 B;  2RHZ A;  1R0C B;  2C5V B;  1OEB A;  2BS3 A;  2KRO A;  1OX8 A;  2QFZ A;  2ZPG B;  4C5H A;  2COY A;  4M77 F;  3MCA B;  4OB0 B;  1KC8 C;  2LJ0 A;  3A1P A;  2HSP A;  3L2V A;  2G77 A;  1WX6 A;  3LW5 E;  2QQ9 A;  4LDY A;  4M7A C;  2UZD B;  1RAE B;  1YJW A;  5DQW A;  1KQ1 A;  1W2B S;  3I5R A;  3M9Q A;  1MMA A;  1U1S A;  4LDW A;  2R58 A;  5L8R E;  3VS4 A;  1LJO A;  5FLX E;  2B86 A;  3OYY A;  3A5Z B;  4IUP A;  2JUF A;  2B8A A;  3VYG A;  2K2M A;  4HCK A;  2BPM B;  4XU2 A;  2GNC A;  5CKH A;  4Y91 A;  1Y96 B;  1QVG P;  1H26 B;  3SWN C;  1HYO A;  1KHC A;  1OZ3 A;  4CRL B;  1TXQ A;  3EG1 A;  2ROL A;  1B7T A;  1FKM A;  4M75 D;  5GAO n;  3L2U A;  1QLB A;  1WGS A;  1V29 B;  4LUD A;  1PKD B;  3D7S B;  2FZG B;  3EG3 A;  1ZX6 A;  4LD9 K;  4RTY A;  2KK4 A;  3QBY A;  2ZPI B;  5GAM j;  1O75 A;  1OIU B;  3PVL A;  3EAE A;  3JSC A;  4A4E A;  2QI2 A;  4DBH A;  1WQ7 A;  2DD5 A;  4J9D A;  2ZCF B;  1E6G A;  4OML A;  4CXA B;  1WHK A;  4M6V A;  3NTK A;  4WTO B;  2LQ8 A;  4FCY A;  4J9G A;  4AMC A;  4EMK C;  1JKW A;  2EBP A;  4EIK A;  5C0M A;  4DOV A;  3F5X B;  1BYM A;  2X51 A;  3HO8 A;  5GMK e;  5CO7 A;  1AWW A;  4E7J A;  4AKG A;  3CC4 T;  2E4H A;  5BNJ B;  2E65 A;  3EFO A;  4BBR M;  1RUW A;  3TEE A;  4EMK B;  4F16 A;  4BAC A;  1URC B;  2YUO A;  2O4X A;  1IXD A;  2GFA A;  3SHW A;  3CCM A;  1MMN A; 
#chains in the Genus database with same CATH homology
 3CXC S;  4NL3 A;  1VQ7 A;  3GF5 A;  2XIC A;  1RI0 A;  3RMS A;  3PTA A;  2PUO B;  3MEV A;  4PJO A;  1D3B A;  4HNT A;  2G3R A;  3JCM g;  3L1A A;  4BE1 A;  1S72 A;  3TCJ A;  3JCM X;  1UGS B;  4HKE A;  5GAN 6;  1BIB A;  1MGQ A;  1Q81 U;  1NZ9 A;  3GPL A;  2RJC A;  5HKC A;  3LWI A;  5DY9 A;  3S3M A;  2QA4 T;  4ZGD B;  4BI4 A;  1HXD A;  1G3T A;  3A8O B;  3LH0 A;  4O6J A;  4M75 G;  2QQ8 A;  2CS7 A;  1VQM A;  3M57 A;  1K73 U;  3PIO A;  4MIM A;  4M77 D;  3E9F A;  3CCU A;  1O9S A;  2H3J A;  4J83 A;  4LD6 A;  3QJY A;  4IUU A;  1VQM T;  2PVG B;  4CI0 C;  2A7Y A;  4BB7 A;  3SDZ A;  2ZPB B;  5FRN A;  1X75 C;  3OA6 A;  4ATO A;  4PJO C;  3MP6 A;  4FT4 A;  4XTU A;  4PJO E;  3TW6 A;  4VUB A;  1M1F A;  1RL2 A;  2HQE A;  3E1S A;  3OYI A;  2EQU A;  1B34 A;  4ELJ A;  4OVA A;  3CCR A;  4J6W A;  5LL6 S;  2BS2 A;  2DIQ A;  4C8Q F;  5GAO p;  3HZJ A;  1VQP A;  2MWO A;  4FIB A;  2FB7 A;  2PU9 B;  3JB9 D;  2YHT A;  3DLM A;  2DD4 A;  1R8O B;  4X9C A;  2HAX A;  2IVW A;  4Q5W A;  1VQP T;  4IUR A;  5EG2 A;  5GAM g;  5KH6 A;  4LOC A;  4M7A E;  3OYB A;  2A3L A;  1I4K 1;  5GAO r;  3GLX A;  5GMK m;  2EQK A;  4LDU A;  1N9R A;  4HNV A;  1JRI A;  2X4J A;  3LLR A;  2KVQ G;  5D6W A;  5CAI A;  1VQ8 A;  3DKM A;  4OGE A;  2RJD A;  3OBW A;  3VJP A;  1I8F A;  5EJC A;  1VQ4 T;  2VXF A;  3FDR A;  2E1H A;  4JUV A;  3LYI A;  5A0G A;  3CCV A;  3BG3 A;  2L5Q A;  2M0O A;  2XD0 A;  3CCL A;  3BDL A;  5GAN h;  3PMT A;  1M9S A;  1VQ4 A;  3G71 T;  2D0Q B;  4GLK A;  3BG5 A;  1PSF A;  5AYF A;  2QF7 A;  3V8J A;  4BE2 A;  4LDX A;  4L5G A;  5FRM A;  4HLQ A;  2F69 A;  2ZPE B;  4J8O A;  3L2W A;  3OSV A;  1YHQ A;  3QUI A;  5C6S A;  4BI8 B;  5I2S A;  5FU7 B;  3A8H B;  3M58 A;  5LJ3 h;  4C0D B;  2DD4 B;  5KE2 A;  4MMK A;  2C06 A;  1BKB A;  3CCJ T;  4XTX A;  4A4H A;  1M4Z A;  4JS5 A;  2EIF A;  1VQN A;  4OB3 B;  3OW2 A;  4HT9 A;  2K4Y A;  3C95 A;  2XDB A;  3QYE A;  4XTY A;  2QTX A;  2EAY A;  2FVU A;  4N0A C;  1BI2 A;  3ME9 A;  2DKG A;  2LVM A;  5LJ5 h;  3HRS A;  4X9D A;  4PJO G;  5CCA A;  5HK3 A;  4BI3 A;  3JCM b;  1YJW T;  2CZ7 B;  5GAN 7;  2OTL A;  2DTH A;  1EIF A;  1JJ2 S;  3OYD A;  4PLI A;  2D6F A;  4P5N A;  1VIF A;  4IUQ A;  4C8Q D;  1Q7Y C;  1VQ5 A;  2LTO A;  3VKH A;  2DZC A;  4M7A B;  4UC4 A;  4PJO D;  2CZ1 B;  1JB0 E;  2XK0 A;  2DXB A;  4M75 A;  1VIE A;  4JRQ A;  3AHU A;  4PJO F;  1KG1 A;  1I5L A;  5GMK l;  3M4G A;  1UGR B;  5GAO q;  4A53 A;  1NPR A;  2VC8 A;  2CZ6 B;  3C94 A;  3OYH A;  3JCM J;  1UB4 A;  4N0A A;  5FU6 C;  1TH7 A;  3L42 A;  4M7A D;  4PJO B;  5CIU A;  1B34 B;  2MWP A;  2V8I A;  3JCM e;  4KUD K;  1KC8 U;  1LOJ A;  4M77 A;  3X25 B;  4C92 C;  3CCE A;  1Q81 C;  2K5F A;  3OYN A;  4EDU A;  4X34 A;  1AHJ B;  2JTM A;  1N6A A;  2EJ9 A;  2GFU A;  3M59 A;  2EYQ A;  3V7C A;  4M7D F;  4A4G A;  1FXX A;  2YRV A;  2QEX T;  2EJG A;  2LCC A;  5KCH A;  4MDW A;  1N8R C;  4IKF A;  2L3R A;  1QVG A;  4JRI A;  3OW2 S;  3HSB A;  3SB2 A;  4Z6Y A;  3ASK A;  3OYC A;  4M78 F;  1YI2 A;  2E41 A;  2ZGW A;  2DXB B;  2RK2 A;  3M54 A;  3LX7 A;  4M7D G;  2XU8 A;  3HFO A;  4ZTF A;  3M5A A;  5GAN f;  2OTJ A;  2XG8 D;  4F7U F;  2EQM A;  4C92 D;  5FU6 B;  2ZZD A;  4EMH A;  4E7L A;  3PMI A;  4NOY A;  2VGN A;  3PGG A;  3WVE B;  3EFS A;  5J26 A;  2ZPH B;  1VQO T;  3CD6 T;  2EJF A;  2ZZD B;  4OGC A;  1P92 A;  2MMP A;  5M9O A;  3RKX A;  3SWN B;  3HB9 A;  3CPW A;  4KBM B;  1VUB A;  3OYE A;  1JBM A;  5GAN 4;  2PVD B;  2LCL A;  2LNV A;  4BUG A;  4L59 A;  1ZQ1 A;  4F7U G;  2RHX A;  2DZ9 A;  3QDR B;  4M7D C;  4V2S A;  3FEO A;  3CME A;  2KSS A;  2EFI A;  2CKK A;  2LRQ A;  3V7S A;  4C0D C;  2E10 A;  5GAM h;  4ZGE B;  2WSC E;  3OYK A;  4XQ3 A;  4F7U A;  1KQS A;  3WVD B;  2RJF A;  2VV5 A;  5CVI A;  2NLU A;  2VGM A;  4IUV A;  1OYX A;  4XAX B;  3JCM Q;  4F7U B;  3OYG A;  1XOV A;  1Q7Y U;  3V7R A;  1M5Q 1;  2RHY A;  2DVE A;  3QHS A;  3CCQ A;  4ZTJ A;  2LQK A;  2XHC A;  3HFN A;  4ZN1 A;  3CC7 T;  3JB9 F;  3FRN A;  1M1G A;  1IZ6 A;  5FU7 C;  1YIT T;  3QPH A;  3VV0 A;  4M77 E;  3ER0 A;  2QQS A;  4DQ2 A;  5GAN d;  3V8L A;  3GNF B;  1WJS A;  3OMG A;  5GAM e;  4M7D B;  3HP9 A;  3CCR T;  3JCM W;  3I56 T;  3H6Z A;  1YJN T;  4NS5 A;  1ZHI A;  2WSF E;  3QYB A;  4YTL A;  5GAM f;  4M7D A;  2BIV A;  4JX4 A;  2RHI A;  4C0G A;  4QQD A;  4C8Q A;  4C92 F;  1VQL T;  5LJ3 d;  2XID A;  1W4S A;  4QVC A;  2DXC B;  1X6O A;  4M78 B;  2DTO A;  1WNL A;  2FHD A;  3BFM A;  5LJ5 f;  5A2Q E;  3LGL A;  2KY9 A;  3JCM V;  5CK9 A;  3CCS A;  5GAO m;  1DJ7 B;  3NTH A;  1Q86 C;  2M1H A;  2RI2 A;  3M4Y A;  4Z02 A;  3UT1 A;  3UWN A;  4C0F A;  4M78 C;  2DXU A;  3G6E T;  3E9G A;  1Q86 U;  5LJ5 d;  2ZPF B;  4C92 E;  1BI0 A;  3BG9 A;  1QP2 A;  3FIF A;  1Y07 A;  1M8V A;  1BIA A;  3CPF A;  5LJ5 j;  2K3X A;  3G6E A;  2XKO C;  1W2B A;  2XI9 A;  3X24 B;  3QKJ A;  3CBP A;  3DB4 A;  4ELZ C;  4QW2 A;  1FWZ A;  4F7U E;  3M56 A;  3P8H A;  3CCJ A;  3OYM A;  4E47 A;  5GAO l;  4R56 A;  2KMT A;  2RA2 A;  4HA8 A;  4AKI A;  3OS2 A;  3QSU A;  5A0D A;  5GMK j;  2GF7 A;  3CCE T;  3I56 A;  4OF1 A;  1K9M U;  4DA4 A;  4MML A;  4MZP A;  3L2Q A;  3VKI A;  4E7J A;  3MEU A;  4A4K A;  3TRE A;  2LT1 A;  3JCM h;  2E6N A;  2QXF A;  2JVV A;  2DXC A;  2HNI A;  4M77 G;  5LJ3 f;  4BE0 A;  3RER A;  4M7D E;  2HD0 A;  4BDY A;  4EMG A;  4C92 A;  3J7A F;  3FLG A;  4J7I A;  3SFM A;  3NFC A;  5GAN e;  4C5I A;  1FX7 A;  2JN0 A;  3BY7 A;  2OTL T;  4N4G A;  2P0Q A;  2DK3 A;  4C0Z A;  1Q82 U;  2VXE A;  3QZ5 B;  1G3Y A;  4M75 F;  3WXM B;  3NTI A;  3UDC A;  1U1T A;  3CCV T;  2E70 A;  1QVG S;  4HCZ A;  2DEQ A;  1VQ6 T;  2KR6 A;  4JLI A;  4B9W A;  4OB2 B;  4J6Y A;  3G71 A;  4JS4 A;  4KT0 E;  1Y7X A;  2BS4 A;  4GY5 A;  3MO8 A;  2QQA A;  3CCL T;  4RCC A;  3HBL A;  1VQ6 A;  3HRU A;  2EQJ A;  3GIB A;  4M78 D;  4WF2 A;  5CKF A;  2JNG A;  2LDM A;  2PUK B;  2PVO B;  3GOX A;  1K8A U;  2RK1 A;  2MF2 A;  3JRZ A;  4N4H A;  4TVR A;  4A54 A;  3L2R A;  1VQK T;  3JCM c;  2GCX A;  3S6W A;  3H4C A;  2E12 A;  5CKE A;  5HK0 A;  3OYA A;  4HCB A;  5FRO A;  1KQS S;  5LJ3 g;  1QVP A;  3CMA A;  4C8Q B;  2FYK A;  2DXT A;  1M1K U;  4ZGJ B;  3S3O A;  4B9X A;  3JB9 H;  3A8G B;  5LJ3 e;  3OYJ A;  4FSX A;  3MHX A;  1UGQ B;  1BI3 A;  4NL2 A;  2RB6 A;  2P4T A;  1QVF S;  3OS1 A;  3JB9 J;  1KD1 C;  5GAM d;  4RMO A;  1VQ9 A;  4FU6 A;  4M7A A;  3ZEH A;  3OSS C;  5D6Y A;  2BKD N;  4A4F A;  2EWN A;  3X26 B;  2GQV A;  1VQO A;  3CBM A;  4RKU E;  1YIT A;  1VQ9 T;  5LJ3 j;  2D9T A;  4OMF B;  2JOY A;  5I2M A;  4HCC A;  3MP8 A;  2PQW A;  2M16 A;  3G7Z A;  1WJQ A;  4BDZ A;  3CC2 T;  4C8Q G;  5A0L A;  3HHT B;  4M78 E;  3S3N A;  4PLL A;  3T9N A;  4JX6 A;  2RI3 A;  1PSE A;  3FB9 A;  5CKD A;  1QVF A;  1ZBX A;  2P0P A;  2WAC A;  3BW1 A;  3OB9 A;  1VQL A;  4MFE A;  2HBP A;  4XTV A;  4QQG A;  5HY6 A;  5J3B A;  4C5E A;  4ZN3 A;  3LWH A;  5LJ5 e;  2QDY B;  2M9U A;  3VUZ A;  5GAN 3;  2X35 A;  4D6W A;  2K5L A;  3DB3 A;  2V8J A;  2RI5 A;  4PNO A;  4BD3 A;  4C5G A;  2KDS A;  4L6V 5;  1XTD A;  3I55 A;  2I2L A;  3URG A;  2QA4 A;  3JB9 G;  2CGH A;  2E64 A;  4QVZ A;  4MZM A;  4E7H A;  3X20 B;  3O8V A;  1UGP B;  3TU4 K;  1Q82 C;  4QVD A;  2KAF A;  4N4I A;  4M75 C;  3FJP A;  2X4W A;  1YI2 T;  3CC7 A;  1XNI A;  2K3Y A;  1KHI A;  2O4X B;  5CQY A;  1KQ2 A;  1HK9 A;  3CCQ T;  3BDU A;  3TW7 A;  4CRI A;  4BBS M;  3UPU A;  4JLG A;  3VYH B;  1VQ7 T;  2MI6 A;  5GAN 2;  3MP1 A;  3QYH B;  3OS0 A;  3CCM T;  5GAN j;  4JDS A;  4NC6 A;  4M77 C;  4XTW A;  2VUB A;  5DM7 R;  4R55 A;  3CC2 A;  4PL6 A;  1S72 T;  1D3B B;  4MDX A;  1JJ2 A;  4LDV A;  2E6Z A;  2LC4 A;  1YIJ A;  5D6X A;  2DIG A;  3MET A;  2QDJ A;  3A8L B;  1YIJ T;  3DL1 A;  1N9S A;  3JCM f;  1N27 A;  3QJ6 A;  3F70 A;  5LJ5 g;  4HT8 A;  2DJZ A;  4II1 A;  5GAN 5;  2LT4 A;  5CQX A;  3V8K A;  4JJN K;  4M7D D;  3G4S A;  4PKC C;  3I55 T;  3CBO A;  2R5M A;  4IUT A;  4FM4 B;  3R6O A;  1SSF A;  1QW1 A;  3JCM d;  4M78 A;  3SD4 A;  1H3Z A;  2Y4X A;  1KD1 U;  5CR2 A;  1NE8 A;  2RHZ A;  1NJI C;  4XU1 A;  4M75 B;  3P8D A;  4M78 G;  3C4S A;  4O5V A;  2BS3 A;  3VU3 C;  3RKY A;  2QFZ A;  3CC4 A;  2ZPG B;  1YHQ T;  3VYG B;  3Q1J A;  3QYG B;  4C5H A;  3GP8 A;  1LNX A;  2E5Q A;  1Y71 A;  1BI1 A;  3OBY A;  2QQR A;  4M77 F;  2LX9 A;  3MCA B;  4OB0 B;  1VQN T;  3QG1 A;  4MFD A;  1KC8 C;  2K2V A;  2RM4 A;  3OS5 A;  2JZ2 A;  4RCB A;  2HQX A;  3PIP A;  2CYZ B;  2X4X A;  2FL7 A;  4JX5 A;  2P0K A;  3L2V A;  2G77 A;  2QQ9 A;  3LW5 E;  4LDY A;  3JB9 I;  3CXC A;  3MEA A;  3E19 A;  4M7A C;  4M75 E;  1K8A C;  1N8R U;  1IRE B;  3DLL A;  1YJN A;  1YBY A;  1YJW A;  3M53 A;  1KQ1 A;  5GAN 8;  1W2B S;  3HKS A;  3M9Q A;  1YJ9 T;  3OMC A;  2X4Y A;  3JAM E;  3MEW A;  4RG2 A;  5GMK i;  1VQ5 T;  5IN1 A;  4MZT A;  1M90 C;  2YLC A;  4ELY C;  3QWL A;  3CCS T;  1U1S A;  1M90 U;  4Y28 E;  4QSH A;  3CPW S;  3EFR A;  3J80 E;  2Y4Y A;  3M55 A;  2WJ9 A;  4KUL A;  4E7K A;  1OZ2 A;  2R58 A;  2F5T X;  3CEY A;  4LDW A;  1LJO A;  2L89 A;  5L8R E;  5FLX E;  1XQH A;  3VUB A;  2V8K A;  3OYY A;  4M7A G;  4AKH A;  1Y96 A;  2R57 A;  3A5Z B;  4IUP A;  2JUF A;  2B8A A;  1YCY A;  3VYG A;  4ME7 A;  4Y91 A;  4XU2 A;  3L2Z A;  5CKH A;  4XTZ A;  3SWN A;  2L8D A;  3ZBD A;  5J39 A;  1Y96 B;  2VYT A;  3JCM P;  1VQK A;  3SWN C;  4OP0 A;  2XDD A;  4E7I A;  1G5V A;  1KHC A;  1OZ3 A;  4C8Q C;  1OI1 A;  1K9M C;  4M7A F;  4BY6 B;  3QO3 A;  1FKM A;  1MHN A;  1WJR A;  3OYL A;  2QEX A;  2K57 A;  3RMQ A;  2RO0 A;  2KMG A;  3GNG A;  4M75 D;  3RIR A;  2K5I A;  5KE3 A;  4C92 B;  5GAO n;  1QLB A;  3L2U A;  1WGS A;  1V29 B;  3HL8 A;  1GXI E;  4AI6 A;  3CMA T;  4LD9 K;  3VKG A;  4QQ6 A;  5DLQ E;  4HL4 A;  1QP3 A;  3C12 A;  2KK4 A;  3QBY A;  2ZPI B;  5GAM j;  1K73 C;  3QZ9 B;  1O75 A;  2F5K A;  1NJI U;  4EMK A;  3CCU T;  2YLB A;  3HRT A;  4XU3 A;  3EAE A;  2OAU A;  3JSC A;  3P8B B;  4JRK A;  4A4E A;  2QI2 A;  1U8R A;  3KHI A;  3X28 B;  3PT9 A;  5GMK h;  3QXE B;  2KQW A;  2WSE E;  3LGF A;  3RUX A;  3H8Z A;  3J81 E;  3OY9 A;  1YJ9 A;  3CD6 A;  1WQ7 A;  4EPC A;  4JRP A;  2QQB A;  2DD5 A;  4BY6 C;  3KBG A;  3KXT A;  4J5Y A;  2R5A A;  2ZCF B;  4KUI A;  4M77 B;  3QII A;  3CME T;  4C92 G;  2DAQ A;  3A8M B;  1WPY A;  2DO3 A;  1E7P A;  5DLO A;  2JTF A;  4M6V A;  3OYF A;  3NTK A;  2LQ8 A;  1M1K C;  5KCO A;  4FT2 A;  4EMK C;  3ZFJ A;  3G4S T;  2BUD A;  1NPP A;  4HNU A;  5C0M A;  2RHU A;  4DOV A;  5IAY A;  4DOW A;  3FC3 A;  3KUF A;  1BYM A;  3PFS A;  4J7F A;  3HO8 A;  1I81 A;  3HPW A;  2RH2 A;  5GMK e;  1G3S A;  2RJE A;  5CO7 A;  4C8Q E;  2Y90 A;  3OQ5 A;  2O01 E;  4AKG A;  2MAM A;  4XK8 E;  2EKO A;  2E65 A;  1X01 A;  3CC4 T;  2DPP B;  2CZ0 B;  4BBR M;  2IG0 A;  3TEE A;  4J6X A;  4EMK B;  4BAC A;  1VQ8 T;  4XU0 A;  3RKW A;  1H64 1;  2XDP A;  3PNW C;  3RES A;  5I21 A;  4OB1 B;  5GAN g;  4RG8 A;  1UEB A;  2O4X A;  2GFA A;  2DD5 B;  4FL6 A;  1WQW A;  2AHJ B;  1G3W A;  2DTI A;  5CKB A;  5IT9 E;  3CCM A;  3INZ A;  2RD1 A;  2OTJ T;  3N5B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...