1UGRB

Crystal structure of at109s mutant of co-type nitrile hydratase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile Hydratase alpha subunit
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 65
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugrB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugrB02
3QYHB 3HHTB 3A8LB 1PSEA 4ZGDB 4FM4B 2DD5A 2ZZDB 1GXIE 4Y28E 4ZGEB 2PUKB 2O01E 2WSEE 4OB0B 2PVDB 2QDYB 1DJ7B 2ZPIB 2ZPEB 2ZZDA 2AHJB 2ZPBB 1QP2A 3QZ5B 1AHJB 4OB1B 3X26B 1IREB 1UGQB 2CZ6B 1V29B 4KT0E 2CZ1B 1UGPB 2DXCB 2WSFE 3WVEB 3A8MB 3X20B 1JB0E 4RKUE 2DXBB 2ZPFB 3X28B 3X24B 2DD4B 2DXCA 3WVDB 4OB2B 2ZPGB 3QZ9B 2ZPHB 3VYGB 2WSCE 2DXBA 2CZ7B 3QXEB 2D0QB 2CYZB 4XK8E 5L8RE 4L6V5 2DD4A 3X25B 3A8HB 4OB3B 4ZGJB 3VYHB 3LW5E 2PUOB 3VYGA 2DPPB 1QP3A 2PU9B 2ZCFB 2DD5B 3A8OB 1PSFA 2PVGB 3QYGB 2PVOB 1UGSB 1UGRB 2CZ0B 3A8GB
chains in the Genus database with same CATH superfamily
1T3SA 5FRMA 2C0TA 2HSEB 2BIVA 3CCVA 1ZSGA 3OS2A 4EC8B 1O75A 1N8RU 1KQ1A 1ABQA 4FYYB 1YI2Q 1I0CA 4HVUA 1JU5C 3JCMf 2E6ZA 1YITA 2ZAEA 2L2PA 2IVWA 1FKMA 3OYKA 3LGFA 3GNGA 2Y4XA 1H1PB 2FO0A 2IG0A 2O9SA 1OX9A 3QSUA 2EUFA 3T9NA 2COZA 2OI3A 3CBPA 4M75A 2QG9B 2RF0A 1YIJQ 4F16A 1VQPA 2V8IA 4FL6A 1NJIC 3SWNC 1D0ZA 5HK0A 1K9AA 5A0DA 4LUDA 4A53A 3OYAA 4F6SB 2QQ8A 2A08A 4Y91A 3QWLA 1YJWA 1M3BA 3FJ5A 2DXTA 3Q1JA 4E7SA 1FWZA 3JB9D 5J3BA 4J9IA 7AT1B 4OB2B 4R56A 1AWXA 3M9QA 1YBYA 3TSWA 3PE0A 2EYYA 3SFMA 1GUXA 5EG2A 2QTXA 1S72A 1D1AA 3TEEA 1G3NC 1UTIA 3VJPA 1YWPA 4OMNA 2DERA 1AISB 3I5RA 2CCIB 1E9HB 2EIFA 4J9HA 2GQVA 1BI3A 2HQEA 4NC6A 2FZCB 1MNEA 5HVYB 5CR2A 2R5MA 2O4XA 2X4WA 1TOVA 3EG0A 5LJ5j 1Q86R 2OTJT 4RCCA 3EG3A 3RUXA 4DBRA 4F17A 1I5LA 4OVAA 1UGRB 4BI3A 3VUBA 3LX7A 1JBMA 2BS3A 4PJOE 1UNHD 2BS2A 4QVDA 2HEQA 3KBGA 4M7AF 2EVRA 2K4YA 4BDYA 1WIEA 4LDUA 1VQMQ 1C6VX 5HY6A 4ME7A 3MKDA 5GMKi 4KRCB 2DD5A 2C4GB 3QYBA 1PM3A 3F70A 3OMGA 5A2QE 3GOXA 4WF2A 2WIPB 2RA2A 4BE0A 2X4YA 3JCMb 1Z9ZA 1N8RR 3VRZA 4WCIA 4JZ4A 3TU4K 1VQKQ 2F69A 1OULA 2C0OA 4PJOC 2E4HA 1G3TA 1NM7A 2FL7A 1JJ2A 1WXBA 2DTOA 2RI5A 2E12A 2ZPIB 2ZZDA 3CCVQ 5CYIB 4NOYA 4OF1A 3MP8A 5AYFA 2DF6A 2A37A 1UNGD 5FLXE 1WYXA 1SF9A 1UDLA 2J06A 2HL3A 5IN1A 1YITQ 4C92F 2A7YA 1QCFA 4CFXB 2FYKA 4QQGA 2CSQA 4IUPA 2DMEA 3OYIA 2CZ1B 1OI9B 2EJ9A 1Q81C 3CCLA 4CFNB 4LD6A 3LWIA 4BBSM 5KCOA 3CCRT 4KUIA 3I55T 4Q5WA 2KT8A 3X20B 3P8BB 4BDZA 4RKUE 3M57A 1QQJA 3HFNA 1WDXA 3E9GA 2BZ8A 1IXDA 2DL8A 2XDBA 2E1HA 2JMAA 3JB9H 2LQNA 1M90C 3TW6A 2QQRA 2M0YA 1J3TA 1RAEB 3C4SA 2E3IA 2G9XB 1VQ7A 2QA4T 3QYEA 1VQPQ 2ZPHB 4X9CA 2VGMA 2I40B 1K9MC 1RAGB 1Q95G 2V8JA 4AG2C 5GAN4 2VYTA 5GANj 4M77F 2X35A 2EKHA 2R5AA 3M0UA 4YOOA 1OKWB 2GCXA 1YHQT 2VV5A 4C8QD 2V26A 5IH2A 1VQ6T 1YJWQ 2J05A 4C8QB 2GNCA 4M78F 2RHIA 3M4YA 3G71T 2RHXA 5KYXB 1D0YA 4LDYA 1VQ8A 3N5BB 4AG1C 1TUDA 3DB3A 1Y7XA 1I1JA 1B34B 5KH6A 3POMA 2AZVA 3FLGA 3NDQA 1RABB 1S72Q 2LT1A 5HQ0B 1C1AA 4KGZB 1SEMA 1QVGS 2KGTA 5HBHB 4GBQA 1H92A 2ABLA 2G3RA 4JRPA 5KYWA 2IVXA 4JLIA 2YRDA 4N4GA 3DLLA 1WX6A 4V2SA 2LT4A 2DL4A 1WHJA 1H3ZA 1G8XA 3CCST 2K57A 2C5XB 3CD6A 1B7TA 4JS4A 4M7DF 1BCMA 1OYXA 1QP2A 2QQ9A 2LTOA 3MEAA 1UGQB 1AEYA 4EOQB 5IF1B 3CC4A 3MEUA 2O88A 3RDVA 1FYNA 1F5QB 4F7UF 1X6BA 4PJOB 5GAOq 1D1CA 2CP2A 5GAN5 4F6WB 4BCHB 4ELJA 2L0AA 3EFOA 2RQWA 1PRLC 4M75F 2KEAA 1FINB 4E7ZA 1AWOA 2YHTA 1PG5B 2X3XD 1KD1U 2UZEB 1E6HA 1OZ2A 3IQLA 3OYMA 2WJ9A 1CKBA 2DD4B 3OS5A 2YXYA 1VUBA 2FEIA 2KQWA 4EOIB 3M4GA 5ICPB 4C0DC 3VYGB 1OX8A 1I81A 3OYFA 1B3QA 2DL3A 1OIUB 1ZBXA 1YN8A 2B86A 2H3JA 3OSVA 4PNOA 2CZ7B 3P8HA 3CCLQ 5EC7A 2ED1A 2KRMA 2EQJA 3R6OA 2QGSA 2O2OA 1FX7A 2MPXC 3VYHB 3I56T 1UG1A 2RHZA 4LOCA 1WHLA 5KYUA 1K8AC 3GTMS 3HL8A 1TD6A 3EG1A 1Y96A 2O9VA 3S6WA 2YT6A 4I3ZB 1VQ7Q 1X75C 3VRYA 4N4HA 4II5B 4J6YA 2DZCA 3VS6A 4CC3A 2FB7A 5D7UA 3L2WA 3HZJA 1PKDB 4LDXA 3EIDB 2OAUA 3JCMe 4XU1A 4C5HA 2M51A 2YWWA 4NS5A 1OV3A 1PSEA 1R77A 4JS5A 1VQ9T 3BLQB 1RL2A 3CCUA 2MCNA 2L3SA 3EG9A 5HCKA 4CFUD 3M59A 2K3BA 1B07A 4C5EA 1HJDA 4CFUB 4MFEA 1VQ8Q 3JCMd 2WSEE 2XU8A 4IKFA 4M7AC 2NUPA 3H0FA 4OMMA 3DJBA 3BDUA 3V7SA 3CPWA 2Y4YA 4DBQA 2HL5C 1X01A 2NUTA 4EPCA 4C92E 3JB9J 2RI2A 5BNJB 2LRQA 5GMKe 2M0OA 5CKHA 2DXUA 3QHWB 1Q7YU 4BCNB 2GF7A 1VINA 2C06A 5I2MA 4JDSA 1RACB 1VIEA 3VUZA 3LH0A 3UT1A 5LMKB 1YJNA 3G4ST 3CD6Q 2X3WD 2YUOA 2J7IA 4AKGA 3BW1A 3GP8A 2CP0A 4C92C 5CK9A 4BD3A 5GJWB 2JVVA 1PWTA 4XTWA 5L2WB 3CMAA 1WNLA 4CC7A 3CC4Q 4PJJA 1KD1R 3OA6A 2HQXA 2CJMB 3VS4A 1UJ0A 4M77E 1JOWA 1RAAB 2RK2A 1UFFA 2W2HA 4HCZA 4JX4A 1N27A 2LNHB 3C94A 2CH4A 1UHCA 4C0FA 4DEXA 1H27B 3CCJA 2YUQA 1M1KU 2CGHA 1QWFA 3HO8A 2BZYA 2UUEB 2DM1A 4PJNA 1UUEA 2XKOC 1E7PA 3HSBA 4M77C 1OQKA 1WFWA 1SSFA 4PFPA 1VQOT 1W6XA 2GTOA 3OYHA 3CMET 2EW3A 5KE3A 2E5KA 1O9KA 1NZ9A 2HMAA 1OL2B 2HNIA 1YI2A 4M78C 3BHUB 1KC8U 5ACBA 2LCLA 4OGCA 1MMGA 4ZTJA 1NBEB 3EH1A 1Q86C 2COYA 2KROA 1JXMA 1NLPC 3REBB 1ZP2A 4BCJB 3FRNA 5L23A 1NLOC 1HK9A 3OYEA 5FRNA 3VS5A 4M7DE 1QCOA 2KE9A 2HKNA 5CAIA 2HSPA 1BI2A 2LQKA 4ELYC 1ZLMA 1N4MA 1C0MA 4YTLA 3EGDA 2KXDA 4HLQA 4HNUA 4DOWA 1U1SA 5AT1B 2JT4A 3CCUQ 5GMKl 2ROTA 4M7AD 2LQWA 2KMGA 2RI3A 4XU2A 4M7AB 2LJ1A 1EX4A 2C5OB 1BKBA 1K0XA 4M7DC 4HXJA 4M75E 2WSFE 4J83A 2X4XA 2KR3A 1YJ9A 1Q7YR 2KI7A 2BPMB 4RCBA 3A8MB 4QT7A 3A98A 1G83A 2FPEA 3MPUB 1PNJA 2CH4W 3RKWA 8ATCB 2HKQB 3JSCA 2LP5A 3SB2A 5KCHA 4ZTFA 4EDUA 1RLPC 4XQ3A 3QZ9B 2EJGA 4JRKA 3RKYA 2PNIA 4BCIB 2DKGA 4C5GA 1VOLA 1QVFA 3GIBA 1U06A 2RQRA 2CP3A 1D09B 4PKCC 2DJQA 4M75C 1WHHA 3S3NA 1MNDA 2JN0A 2QI2A 1ACMB 2E3HA 4N4IA 3BFMA 1VQ4T 5HNBB 1YJNQ 2CUDA 3DDQB 4E7HA 3BLHB 1H4LD 2IW6B 2QTVA 5FROA 1M1KR 2D6FA 3CCQT 2DK3A 3NTHA 4ELLA 4JZ3A 5FU6C 3CMAQ 2PVGB 5CKBA 4KULA 1K73U 1VYWB 1WXTA 2DEQA 3JCMV 5LJ5g 2QQBA 1QVPA 4MDWA 3VS1A 1RAFB 1H1QB 5LL6S 3UWNA 1UECA 2K5LA 2D8JA 3CCJQ 3HB9A 2SRCA 1JSTB 1NEGA 1SPKA 1KQSS 1AD5A 4XTUA 3J81E 3OW2S 4X9DA 1X2QA 4VUBA 4X34A 3HBLA 4EOLB 5M9OA 3G6ET 4Y28E 3TCJA 4PJMA 2WHBB 3JB9G 2L3PA 2V1QA 1KC8R 2PTKA 4CRIA 2XI9A 2JTFA 1VQ5T 1K0SA 2EYXA 4M78D 1P92A 2XIDA 4OP0A 2PVDB 2QDYB 4CXAB 4M78B 1H1RB 2AT1B 2PZ1A 3PGGA 1FMWA 3SD4A 2Y90A 4DBHA 1F1BB 1PCXA 1AHJB 3PTAA 2DAQA 3QUIA 2V8KA 4JUVA 3PVQA 1ZHIA 1ZSZC 2LMJA 4R55A 1EFNA 3MP6A 2RM4A 5LJ3e 4F7SB 1VYUA 5GMKj 3WVEB 2E65A 4LN2A 4JJDA 4BXXX 1IZ6A 2VGNA 1OI1A 5GAOn 4OMPA 1FMKA 1E6GA 2AKLA 4RTZA 2GFAA 5LJ3d 1XO2A 1WJQA 3OBYA 4BY6B 3OSSC 2NWMA 2WXVB 4M7DB 2L3QA 2HD0A 4CC2A 4KH0B 1NYFA 3CCVT 3EG2A 2LNVA 4ELZC 1VQLT 1YJ9Q 1GBQA 3M0RA 4BBRM 5GAOl 1X6OA 1BU1A 2IPOB 5GANg 3VS3A 4F7UB 3VU3C 2MK5A 3NFCA 2VASA 3KFVA 3CCEQ 4Z88A 2ZCFB 3PNWC 3BG3A 3QWYA 3REAB 2L5QA 4OGRB 4KUDK 2F2XA 3JCMJ 4MDXA 3D7SB 2W9FA 2CCHB 2CUBA 1K73R 2P0KA 3M53A 3C0CA 2LVMA 2J6OA 4LE9A 5KE2A 1M4ZA 4IUTA 3QJYA 5FU6B 1VYVA 4B9WA 4ZGEB 2YUNA 4J9CA 2KDSA 4RTVA 3HRUA 1KHCA 1GFCA 1LJOA 3OY9A 2JS0A 2FRWA 1GH6B 3OS0A 1RUWA 1T0HA 1WQ7A 5GAMe 2ZPBB 1KHIA 2QQSA 3LQ5B 1XJWB 4X1VA 2OTLA 4XTYA 4CFWB 4C8QG 3OYJA 4IUQA 2M02A 4EOOB 2VB6A 4M6VA 4GLMA 4JX6A 2NUZA 2RN8A 3OBWA 5IHIA 5HKCA 5GAMd 3EAEA 4LD9K 3SHWA 5A0LA 3CCRA 2WMBB 3PT9A 3I55A 4IMYB 2DXBB 2W0ZA 3BY7A 1LVKA 2ZPFB 1ZSZB 4E7LA 1ZUYA 3TNIB 3E9FA 1N9SA 2QA4A 2EYWA 1GBRA 3C95A 1MGQA 3OB9A 4EOJB 1BI1A 3H41A 3R6NA 1AD6A 4Z02A 2GTJA 2L89A 2E10A 1KQ2A 1W2BS 2LW4A 2R7GA 2D0NA 4EOMB 4IUUA 2JZ2A 1YHQA 2I0NA 2QEXT 1NJIU 2E6NA 1VQ6A 5IDPB 3NTIA 5IXBA 1M2VB 2W10A 3SWNB 1KD1C 4JPBW 1ARKA 1M3AA 3CXCS 4EC9B 2X4JA 4FSSA 3FDRA 4ROEA 3OW2P 4FX3B 5D6XA 4PJOG 2BTTA 3PMIA 4ROCA 2RHYA 5GMKm 3JAME 4HNVA 2JJ9A 2CDTA 4C8QA 1TUCA 2NLUA 3H4CA 2K9GA 4UN0A 1YCYA 2RJCA 4Z8AA 5KYXA 3M0TA 2RJFA 2FG0A 3CBOA 2LZ6B 4YC3B 2KY9A 1GXIE 3EGXB 1B34A 4F14A 3CC2T 1AWWA 2OTJQ 2HAXA 3EJ1B 3CCSA 2IIMA 1YFNA 4E7KA 2DILA 2K5FA 1YWOA 2R57A 3NTKA 2HZYA 5DLQE 1KIKA 1X69A 2P84A 3CC7A 4C0ZA 1UJYA 1GFDA 4J9EA 5J39A 3KHIA 1NEBA 3JRZA 2BE7D 3UA7A 1V29B 1IGQA 2DBMA 5KYYB 5GANf 2SEMA 3I35A 1EIFA 2RQVA 3DLMA 3H6ZA 2E70A 2DYIA 1M3CA 2QK0A 2M1HA 5LJ3j 2CP5A 2A3LA 2JGZB 4PJOA 1QWEA 2OTLQ 2EJFA 3M5AA 3M54A 1NE8A 4PJOD 2AK5A 2KSSA 1S1NA 5DQVA 4II1A 1X6GA 1MMNA 3V8JA 3OYBA 3LH5A 3QHRB 1JRIA 1U1TA 2K2MA 4BI4A 2JM9A 3TVTA 5L8RE 1RADB 4FT4A 3CCRQ 3I55Q 2DD4A 4Y92A 4PK4A 3HRSA 4CRLB 2XG8D 1M1GA 3VYGA 3BE3A 3L2RA 1Q81U 4CI0C 2KAFA 1JQQA 3M0PA 4Y72B 5LJ5h 1NJIR 2QA4Q 4GY5A 1GCQA 1GCPA 3QYHB 1WI7A 1M90U 2XK0A 1I4K1 4HKEA 1VIFA 1I5OB 1YHQQ 1K9MU 3CC4T 2BKZB 1G5VA 2X51A 3QWXX 4J7IA 4FW1A 4F04B 1VQ9A 5LQFB 2PJQA 1VQ6Q 2X1NB 1T3LA 3MEWA 1RI9A 1AZEA 1G3YA 2I53A 3G71Q 1Q82C 5FW9A 2C6TB 4JJCA 5I21A 4ZN1A 3BDLA 2EFIA 2YLCA 4Z89A 2R58A 4N0AC 4HCBA 2ESWA 3DDPB 1D3BB 4OB1B 3BHVB 2F1LA 3PIPA 3PIOA 2CS7A 1HYOA 4FYXB 4RTWA 2JS2A 2RHUA 5GAMj 3OYNA 1Z9QA 4M4ZA 4KT0E 1QKWA 4JJBA 4XTVA 5EJCA 1CKAA 4RTYA 3CCSQ 2KMTA 2RB6A 1WHGA 2KXCA 3RKXA 1IHWA 3G4SA 4TVRA 1VQNT 1M30A 3JCMc 2EPDA 4FIBA 4PLIA 2AKKA 1K4US 4BCND 2VUBA 1RAHB 3CC7Q 1W1FA 1W2BP 3H0IA 5I5ZB 2XICA 3HTRA 2KVQG 1W98B 1UNLD 2K7AA 3V8LA 1U8RA 5GAN7 3P8DA 5GANh 2LDMA 1H25B 1QW1A 1WHMA 3RR6A 4MZTA 3LW5E 3JCMP 2IN3A 1OEBA 1QVGA 1H1SB 1NG2A 1A0NB 3MP1A 3JV3A 2W96A 2ATCB 2DYBA 3EH2A 4M7AG 1MUZA 1PSFA 4BCFB 1C9BA 5FU7C 1UGSB 1OOTA 4LDWA 1Q81R 2FPFA 4FW2A 4FCYA 4A4KA 4F7JB 1Y57A 1VQOA 4RMOA 2E5QA 3CMEA 1JKWA 5GAN3 1U3OA 1WZOA 1FVVB 3HFOA 2NYSA 3V7RA 2D8HA 3I56Q 1D1BA 1TH7A 1M90R 4C0DB 3GNFB 4AKHA 1MHNA 1QVGP 3INZA 2DA9A 2K5IA 2LC4A 3J7AF 4DQ2A 3JCMg 4C8QF 3DB4A 4JJNK 3UDCA 3VV0A 2F5KA 1DJ7B 2GFUA 3RNJA 4HL4A 1PD0A 4EMKC 3KUFA 3VKIA 4J5YA 3ME9A 3JB9I 1LCKA 3I9QA 5J26A 3OYGA 1VQ9Q 2O31A 3FEOA 4ANJA 1TXQA 3B57A 1G2BA 4RG2A 3MEVA 1LOJA 1ZA1B 1RI0A 1TUGB 1M1FA 2DMOA 3CCJT 5CIUA 1R0BG 3OYCA 4BCMD 4AFQC 2EGEA 3CCMT 5D6WA 4BCMB 1FXXA 3M0QA 4FYVB 4M7AA 1TG0A 1UGVA 2EWNA 1RAIB 3GF5A 1N8RC 3URGA 2PK2A 2WEVB 2VWFA 4L5GA 4DOVA 2JW4A 4MZPA 3G33B 4BACA 2BUDA 2RQTA 2RQUA 1M27C 3G7ZA 4M78G 1YI2T 3C12A 4XAXB 3M55A 5CKDA 4NSTB 4ZGJB 3G4SQ 2HBWA 2XDDA 1UEBA 3CCEA 3SEMA 2RMOA 4A4HA 4RODA 3CCQA 1URCB 4HT9A 4RTTA 4NL3A 2RO0A 4GLKA 4O5VA 4C92D 4BY1X 2JXBA 2DIQA 4C92B 2RNAA 2DL7A 4A4GA 5CCAA 4BCQD 5IHYA 4ZGDB 5I2SA 1YIJT 4BCQB 2E41A 1QLYA 1KJWA 4LDVA 5DM7R 1KK7A 5ECAA 5FU7B 3VKGA 2PUKB 3UF4A 2O01E 4M7DG 1I8FA 3G6EA 5GAMh 3QG1A 4K11A 1P5EB 3RGFB 3LLRA 1WJSA 5I11A 2QXFA 2DTIA 3VS7A 2ZPEB 1VQOQ 3F5XB 4A4EA 3CMEQ 4F7UG 1TSFA 1V76A 1OPLA 4E7JA 3K7AM 2C0IA 5C6SA 4M77D 1YNZA 4HNTA 3QPHA 1D3UB 2LX7A 4M77B 1BCOA 1D0XA 4M78A 4EOSB 3ZBDA 1WXUA 4Z6YA 2DXCB 1Y71A 1ZBJA 4EMHA 1QKXA 1JJ2S 4EMKB 2DBKA 2CT4A 4IUVA 4XU3A 2J6FA 2V22B 3NGPA 1QLBA 2LQ8A 4EIKA 2QGFB 2H8HA 2YLBA 3LYIA 4WTOB 1YP5A 2G6FX 2QQAA 1GRIA 1BIAA 1M2OA 4J9BA 4HT8A 3PO3S 2EYZA 3RERA 3TSZA 2ZPGB 2UZBB 4EOKB 4A54A 1HD3A 4FSXA 2FPDA 4CFMB 2ZGWA 4QQ6A 2DNUA 1KSWA 1IRXA 4G6LB 4KRDB 2D0QB 2MIOA 2C5NB 1VQMT 4OR5B 1VQLA 4XK8E 1MV3A 4XTZA 3GPLA 2WMAB 2HQHA 1JEGA 2B9RA 2HDAA 1QMCA 1XNIA 2JUFA 1M8VA 4M7DA 4FYWB 2CKKA 4FU6A 1BYMA 3G1JA 2DPPB 2WFYB 2KR6A 2GBQA 4M7DD 1VQKT 1M9SA 2LJ0A 1H641 4DBFA 2QYZA 3PVLA 5IHNA 2MI6A 5CQYA 4F7UA 1VOMA 4DEYA 4AFZC 3MY5B 2DTHA 1TTHB 3QJ6A 5IT9E 4D6WA 1YITT 2DETA 1VQ4Q 1O9SA 4A4FA 3BG5A 3QDRB 3U23A 3OYYA 2XMFA 1OZ3A 3OQ5A 4LXCA 3BLRB 4D8KA 3ZFJA 4M75D 4C8QE 4CFVB 3RMSA 4M75B 2OTJA 1R8OB 3O0GD 1JO8A 5HBEB 3CCQQ 4IIOA 5D6YA 2KBTA 3TQ7P 2WPAB 1AWJA 2DFUA 5GAN2 2I2LA 1ZUKA 3X26B 1VQPT 4C8QC 4EORB 1PC0A 4HCKA 4UC4A 2RPNA 3G6EQ 1UGPB 4LUEA 2V1RA 1FMVA 1W4SA 1VQ5Q 1M8MA 3L2ZA 1GUXB 1JB0E 1N9RA 3QDFA 1YJWT 2KT1A 5IXFA 5IDNB 1H28B 3BG9A 1AVZC 5LJ3g 1H8KA 2RH2A 1I07A 4RG8A 2DRKA 2FZKB 2O4XB 2AIRB 1S72T 2DXBA 4BCKB 2EQKA 2XD0A 2YUPA 1IHVA 2CYZB 4JRQA 2JMCA 1ZSZA 1PHTA 2KNBB 6AT1B 3A8HB 3GLXA 2M16A 4EOPB 1OU9A 2QDLA 5LJ5f 2EQUA 2QEXA 4KH1B 1UE9A 1KQSA 3OW2A 4TTHA 1QCNA 2GQIA 2VKNA 2DD5B 4QVZA 1K76A 2OJ2A 2F2CA 1HXDA 4PLLA 2FVUA 2LJ3A 1OKVB 2J6KA 4IURA 1GY3B 1VQLQ 3SDZA 3HHTB 3A8LB 2KRSA 3KXTA 1M2VA 3L2UA 2OTLT 1WA7A 3SWNA 1TWBA 1XQHA 1H26B 3AT1B 2ZZDB 3HKSA 3OYDA 3E1SA 1QMZB 2XHCA 3META 2DRMA 1E7OA 3JCMh 4PFOA 1KQSP 3G71A 3CC2A 2ROLA 1BBZA 3VKHA 4BCOB 3EGUA 2EQIA 2IW9B 4PFZA 1WPYA 3UPUA 4J8OA 1BK2A 5CEIB 2L8DA 1SRMA 3THKA 1JJ2P 5A0GA 3EGXA 3QZ5B 2YRCA 1WJRA 1GCQC 4OMOA 2JM8A 3PFSA 2DEUA 3LWHA 3FIFA 2QASA 1TU0B 1PRMC 3CPFA 3L2VA 4RTXA 3CCLT 3QBYA 5CQXA 5GAMg 2IW8B 4QSHA 5GJVB 3MI9B 4PL6A 1WQWA 3CPWS 5GMKh 4R0KA 2VC8A 3X28B 5KYYA 4F6UB 1KG1A 3FC3A 4C5IA 1VQ7T 1BB9A 3OYLA 3WVDB 3OMCA 5DQWA 2MWOA 4OMFB 2GGRA 3A5ZB 2FHDA 3BHTB 5HK3A 1K1ZA 3QXEB 2LCCA 1MMDA 3LGLA 4RTUA 2PK9B 5GAOr 2CREA 4BCPB 1OL1B 4OB3B 2ED0A 2HBPA 4KBMB 3DOGB 2HCKA 4KGVB 2A36A 1NPRA 2UZDB 1WLPB 1ZX6A 1G3WA 2D1XA 1ABOA 2EGAA 5FWBA 2C5VB 1AOJA 4E2FB 4BCGB 1VQ8T 4QKUA 2DL5A 4JRIA 4F70B 3UA6A 2QGGA 4AKIA 4YOSA 4ORZA 5KYWB 3JCMX 1Q7YC 3DKMA 4OMLA 2DZ9A 2K3XA 4NL2A 3OS1A 2BS4A 4FT2A 1XTDA 3RBBB 3CC7T 3M58A 4FM4B 2F2WA 2MWPA 2FRYA 3I56A 2VXEA 3ZEHA 4HVWA 2QEXQ 1KXUA 1IGUA 2QAZA 3ZL7C 4L59A 4HVVA 5FWCA 3MY1B 4BB7A 1SSHA 2A28A 3CD6T 1KFZA 5LJ3f 4MZMA 4J9GA 3JB9F 2G77A 1MMAA 2AHJB 3EFOB 4J6WA 3HRTA 4J9FA 1X43A 3EOCB 2D9TA 4A63B 1GL5A 2YRVA 1M1KC 1SHFA 4LNPA 3S3MA 1T0JA 1VYTA 3EFSA 1IB8A 2BZXA 2W9ZA 1AT1B 1N6AA 3ASKA 4E7IA 3FB9A 2ENMA 2CT3A 3E2UA 3CC2Q 3E19A 1TFBA 2YDLA 2RD1A 4O6JA 1D3BA 1HSQA 3TNHB 2P4TA 3AHUA 4E6RA 3MJXA 2OX7A 2EYQA 1W2BA 2DLPA 1VQNA 3CEYA 5GAOm 1KC8C 5KYUB 1OU8A 4KRTA 1NYGA 2EKOA 4QQDA 3CXCA 3NHNA 2WSCE 1X27A 2DX1A 1UHFA 4M7AE 1M5Q1 2OAWA 1Y96B 3DTOA 2YSQA 3QHSA 3QIIA 1PKSA 9ATCB 3H0HA 3CBMA 3ER0A 2PHGA 5EFQB 2KRNA 1H24B 2DE0X 3O5ZA 2AZSA 1QP3A 2DIGA 4MMKA 3QO3A 3M56A 1QVFS 3A8OB 2JOYA 3EG9B 2WIHB 4BE1A 2CZ0B 2MAMA 4C0GA 4MIMA 3TW7A 2ECZA 3CXCP 2L3RA 2K2VA 2NUPB 1SKUB 2VXFA 3CCUT 3V8KA 5GAMf 2RJEA 1NPPA 5DLOA 1LPLA 2EQMA 2X9HA 1SG5A 1PKTA 2NUTB 4F7NB 2CSIA 5DY9A 4CC4B 4OMQA 1OPKA 2A0FB 4AFUC 2UZLB 3L2QA 8AT1B 5GAOp 2JNGA 3QKJA 1BIBA 2BKDN 2EAYA 3H8ZA 2WACA 2DVEA 3MO8A 2FZGB 3CPWP 1IREB 4KGXB 1Y07A 3UATA 1W70A 3EHRA 2KK4A 1JSUB 2P0PA 5GAN8 1OGUB 1Y0MA 2KYBA 1K9MR 2QF7A 4XU0A 1YJNT 3MCAB 4AT1B 1K8AU 4C92G 1K73C 4J9DA 4QW2A 4M78E 2DO3A 2RK1A 3L42A 3O8VA 3CCMA 1UB4A 2LX9A 5LJ3h 3JCMW 2B8AA 2F5TX 1Q82U 3CMAT 1RLQC 2KYMA 4N0AA 4D8DA 1G3SA 4HA8A 4OGEA 2QFZA 2CP6A 1VA7A 3FJPA 4EMGA 2K6DA 1ZUUA 4IIMA 1MV0B 3GBQA 3MHXA 4L6V5 5LJ5e 4F7LB 4ZNXA 3X25B 1WGSA 1H3HA 1SHGA 1ZA2B 1U5SA 2COWA 2DJZA 1O9KB 2PU9B 1VQNQ 1BU2A 1SRLA 4M77G 3DL1A 5CKEA 2QDJA 1AZGB 2Z0WA 4B9XA 1X2KA 5LJ5d 3A1PA 3A8GB 2M9UA 1R0CB 5KYNA 1TS9A 1OIYB 2CP7A 2E64A 4J7FA 4J6XA 3JCMQ 4PJOF 1VQ4A 3S3OA 2XDPA 4F7UE 2JTEA 2PQWA 4P5NA 1YIJA 1WHKA 4JLGA 4EONB 4AFSC 3EGDB 4BY7X 2MMPA 1N5ZA 4BY6C 3VS2A 1LNXA 4C92A 3J80E 3HP9A 3EFRA 4OB0B 3VS0A 2MYSA 3M03A 4PJLA 2EBPA 4QVCA 4E47A 4DA4A 1V1CA 2BE9B 4ATOA 2K79A 3WXMB 4BE2A 2CZ6B 3NMZC 2JTMA 3M0SA 1YJ9T 3ULRB 2F2VA 1VQ5A 1ZQ1A 2RJDA 2K3YA 1IO6A 1EZZB 3HPWA 4BI8B 4RUGA 3H9NA 4M77A 3CCET 3RESA 3TNWB 5IAYA 3RIRA 3X24B 5CVIA 1JXOA 5GANe 2P0QA 4BUGA 1K8AR 2DXCA 2VVKA 3MIAB 4EMKA 1CSKA 2H3EB 4HCCA 3EHQA 4M75G 3NPFA 5I22A 3I5SA 3CQTA 4ZN3A 1Q82R 2PMIB 3V7CA 2EGCA 1ENWA 1QVFP 1YCSB 4YOZA 4JX5A 1BI0A 2LCSA 5FGKB 4AI6A 5CO7A 5C0MA 1Q86U 1VQMA 2P4RA 4ESRA 4XTXA 3TREA 5HBJB 5GANd 4MFDA 4B6MA 3CCMQ 2PUOB 5IHKA 3RMQA 2DVJA 4MMLA 3PMTA 2W99A 2MF2A 3L1AA 5CKFA 1PD1A 2MOXA 1VQKA 3QYGB 2PVOB 4AMCA 5GAN6 1XOVA 3TN8B
chains in the Genus database with same CATH topology
1SSFA 3QYHB 1VQOT 1M90U 5FRMA 3OYHA 2BIVA 3CMET 2XK0A 5KE3A 3CCVA 1I4K1 4IURA 3OS2A 1NZ9A 3SDZA 3HHTB 3A8LB 1O75A 1KQ1A 2HNIA 4HKEA 4M78C 3KXTA 3L2UA 1YI2A 1N8RU 3SWNA 2OTLT 1KC8U 2LCLA 1VIFA 3JCMf 4OGCA 2E6ZA 4ZTJA 1YITA 1K9MU 3CC4T 1XQHA 1G5VA 1Q86C 2ZZDB 3HKSA 4J7IA 1VQ9A 2IVWA 3OYDA 1FKMA 3MEWA 3FRNA 3E1SA 2XHCA 3META 3JCMh 1G3YA 3OYKA 1HK9A 3OYEA 5FRNA 3G71A 3LGFA 3GNGA 1Q82C 3CC2A 4M7DE 5I21A 2Y4XA 3VKHA 3BDLA 4ZN1A 1WPYA 3UPUA 4J8OA 5CAIA 2EFIA 2YLCA 2IG0A 1BI2A 2L8DA 2LQKA 4ELYC 2R58A 4N0AC 4YTLA 3QSUA 5A0GA 4HCBA 3QZ5B 3T9NA 4HLQA 1D3BB 4HNUA 4DOWA 4OB1B 1WJRA 1U1SA 3CBPA 3PIPA 4M75A 3PIOA 2CS7A 5GMKl 4M7AD 3PFSA 1JJ2A 2RHUA 5GAMj 3OYNA 1VQPA 2KMGA 2RI3A 2V8IA 3FIFA 4FL6A 4KT0E 3CPFA 4XU2A 4M7AB 3LWHA 3SWNC 3L2VA 1NJIC 3CCLT 1BKBA 3QBYA 5HK0A 4XTVA 5A0DA 5CQXA 4M7DC 5EJCA 5GAMg 4M75E 4QSHA 2WSFE 4J83A 2X4XA 4A53A 3OYAA 4PL6A 1YJ9A 1WQWA 2QQ8A 4RCBA 3CPWS 5GMKh 3A8MB 2KMTA 2RB6A 4Y91A 3QWLA 3RKXA 3G4SA 4TVRA 1YJWA 1VQNT 2DXTA 2VC8A 3Q1JA 3JCMc 3X28B 4FIBA 4PLIA 1FWZA 3RKWA 1KG1A 3FC3A 3JB9D 2VUBA 3JSCA 4C5IA 3SB2A 5KCHA 4ZTFA 5J3BA 4EDUA 3OYLA 1VQ7T 3WVDB 3OMCA 4OB2B 4R56A 2MWOA 4XQ3A 2XICA 3M9QA 1YBYA 3QZ9B 2EJGA 4JRKA 4OMFB 3RKYA 2DKGA 4C5GA 3SFMA 1QVFA 3A5ZB 3GIBA 2FHDA 5EG2A 4PKCC 4M75C 5HK3A 2KVQG 2QTXA 3S3NA 1S72A 3QXEB 2LCCA 3TEEA 2JN0A 3VJPA 3LGLA 2QI2A 3V8LA 1U8RA 5GAN7 5GAOr 4N4IA 3BFMA 3P8DA 2EIFA 5GANh 1VQ4T 2LDMA 2GQVA 1QW1A 1BI3A 4OB3B 2HQEA 4MZTA 3LW5E 4NC6A 2HBPA 3JCMP 4KBMB 1NPRA 1QVGA 1G3WA 4E7HA 5CR2A 2R5MA 2O4XA 2X4WA 3MP1A 5LJ5j 1VQ8T 5FROA 2OTJT 4JRIA 2D6FA 4RCCA 3CCQT 2DK3A 3NTHA 5FU6C 4M7AG 4AKIA 1PSFA 2PVGB 3RUXA 1I5LA 5CKBA 4OVAA 4KULA 1UGSB 5FU7C 1K73U 1UGRB 4BI3A 5LJ5g 2DEQA 3JCMV 3VUBA 3JCMX 1Q7YC 4LDWA 3LX7A 1JBMA 2QQBA 1QVPA 2BS3A 4MDWA 4PJOE 4A4KA 3DKMA 5LL6S 2BS2A 3UWNA 2DZ9A 2K3XA 4NL2A 3KBGA 2K5LA 4QVDA 4RMOA 2E5QA 3OS1A 2BS4A 2K4YA 4FT2A 3CMEA 4BDYA 1XTDA 4M7AF 4LDUA 3CC7T 5HY6A 5GAN3 3HB9A 4ME7A 3M58A 4FM4B 3HFOA 1KQSS 2MWPA 5GMKi 3I56A 2DD5A 2VXEA 4XTUA 3V7RA 3J81E 4X9DA 3QYBA 1TH7A 3ZEHA 3OW2S 3F70A 3OMGA 4VUBA 4C0DB 3GNFB 4WF2A 3HBLA 4X34A 5M9OA 4AKHA 2RA2A 3GOXA 3G6ET 1MHNA 2X4YA 4Y28E 3TCJA 3INZA 3JCMb 4BE0A 3JB9G 2K5IA 2LC4A 3J7AF 4L59A 3JCMg 4DQ2A 4CRIA 2XI9A 4C8QF 2JTFA 3DB4A 3TU4K 1VQ5T 2F69A 4BB7A 4M78D 1P92A 2XIDA 3CD6T 4JJNK 3UDCA 4OP0A 5LJ3f 4PJOC 1G3TA 2PVDB 4MZMA 3VV0A 2F5KA 2QDYB 2FL7A 1DJ7B 4M78B 2GFUA 2G77A 2DTOA 4HL4A 2RI5A 3PGGA 4EMKC 2E12A 2ZPIB 3KUFA 2ZZDA 3SD4A 2AHJB 2Y90A 4NOYA 4OF1A 3MP8A 4J6WA 4J5YA 5AYFA 3ME9A 3HRTA 3VKIA 5FLXE 3JB9I 1AHJB 3PTAA 2DAQA 2D9TA 5J26A 3OYGA 3QUIA 5IN1A 2V8KA 4JUVA 2YRVA 4C92F 1ZHIA 1M1KC 2A7YA 2FYKA 4R55A 4QQGA 3MP6A 3FEOA 2RM4A 4IUPA 3S3MA 3EFSA 5LJ3e 4RG2A 3MEVA 2CZ1B 1LOJA 1N6AA 2EJ9A 3ASKA 3FB9A 4LD6A 5GMKj 3LWIA 1Q81C 4BBSM 1RI0A 3CCLA 3E19A 5KCOA 3CCRT 3WVEB 2E65A 4KUIA 1M1FA 2RD1A 4O6JA 4Q5WA 5CIUA 3I55T 1D3BA 3CCJT 3OYCA 3X20B 3P8BB 4BDZA 4RKUE 2P4TA 3M57A 3HFNA 3AHUA 3CCMT 1IZ6A 3E9GA 5D6WA 2XDBA 2VGNA 1OI1A 1FXXA 2E1HA 2EYQA 1W2BA 3JB9H 5GAOn 1M90C 1VQNA 4M7AA 3TW6A 2QQRA 5LJ3d 2EWNA 2GFAA 1WJQA 3GF5A 3OBYA 4BY6B 3URGA 1N8RC 3C4SA 3CEYA 3OSSC 4L5GA 5GAOm 1KC8C 2QA4T 1VQ7A 3QYEA 4M7DB 2ZPHB 4DOVA 4X9CA 2VGMA 1K9MC 2EKOA 2HD0A 4QQDA 3CXCA 2WSCE 2V8JA 4MZPA 4BACA 1M5Q1 2BUDA 1Y96B 2QA4A 4M7AE 5GAN4 3CCVT 2VYTA 4E7IA 5GANj 3QHSA 2LNVA 4M77F 2X35A 4ELZC 1VQLT 3QIIA 3G7ZA 2R5AA 4M78G 1YI2T 3C12A 4BBRM 5GAOl 4XAXB 1X6OA 2GCXA 3CBMA 3ER0A 3M55A 5CKDA 1YHQT 5GANg 2VV5A 4ZGJB 4F7UB 3VU3C 4C8QD 1VQ6T 4C8QB 2XDDA 3NFCA 1QP3A 1UEBA 3CCEA 4M78F 2RHIA 3M4YA 2DIGA 4MMKA 3QO3A 3M56A 3G71T 2RHXA 1QVFS 2ZCFB 4A4HA 4LDYA 1VQ8A 3A8OB 3BG3A 3N5BB 3PNWC 2JOYA 3CCQA 3DB3A 4BE1A 1Y7XA 2L5QA 4HT9A 2CZ0B 2MAMA 4NL3A 1B34B 5KH6A 2RO0A 4GLKA 4O5VA 4C0GA 4C92D 3FLGA 4MIMA 3TW7A 4KUDK 3JCMJ 4MDXA 2L3RA 2LT1A 2DIQA 2K2VA 4C92B 4A4GA 5CCAA 2P0KA 1QVGS 2VXFA 4ZGDB 3CCUT 3V8KA 5I2SA 3M53A 1YIJT 5GAMf 2LVMA 2RJEA 2E41A 2G3RA 1NPPA 4JRPA 5KE2A 1M4ZA 4IUTA 3QJYA 4LDVA 2EQMA 5FU6B 5DLOA 4B9WA 5DM7R 4JLIA 5FU7B 4N4GA 3VKGA 4ZGEB 2PUKB 3DLLA 4V2SA 2O01E 4M7DG 1I8FA 2LT4A 2KDSA 3G6EA 5GAMh 3QG1A 3HRUA 1KHCA 5DY9A 1H3ZA 3CCST 1LJOA 2K57A 3OY9A 3LLRA 3L2QA 1WJSA 3OS0A 4JS4A 3CD6A 2QXFA 2DTIA 5GAOp 4M7DF 2JNGA 3QKJA 2ZPEB 1WQ7A 1BIBA 2ZPBB 2BKDN 5GAMe 4A4EA 2EAYA 1OYXA 3H8ZA 4F7UG 1QP2A 1KHIA 2QQSA 2QQ9A 2WACA 2DVEA 3MO8A 4E7JA 2LTOA 1IREB 2OTLA 3MEAA 4XTYA 4C8QG 1UGQB 1Y07A 4M77D 5C6SA 3OYJA 4IUQA 4HNTA 3QPHA 3CC4A 2KK4A 3MEUA 4M77B 4M6VA 4JX6A 4F7UF 2P0PA 5GAN8 3OBWA 4M78A 4PJOB 3ZBDA 5HKCA 5GAOq 4Z6YA 5GAN5 2DXCB 1Y71A 4EMHA 1JJ2S 4ELJA 2QF7A 4XU0A 4EMKB 5GAMd 4IUVA 1YJNT 3EAEA 4LD9K 3MCAB 4XU3A 5A0LA 1QLBA 3CCRA 2LQ8A 3PT9A 3I55A 4M75F 1K8AU 4C92G 2DXBB 1K73C 4QW2A 2YLBA 4M78E 2DO3A 2RK1A 2YHTA 3L42A 3LYIA 3O8VA 1UB4A 3BY7A 2LX9A 3CCMA 1KD1U 2ZPFB 2QQAA 5LJ3h 1OZ2A 3OYMA 1BIAA 3JCMW 2B8AA 2WJ9A 4HT8A 2F5TX 1Q82U 2DD4B 3CMAT 3RERA 4E7LA 3OS5A 1VUBA 2KQWA 2ZPGB 3M4GA 4C0DC 3VYGB 4A54A 4FSXA 4N0AA 1I81A 1N9SA 1G3SA 2ZGWA 3E9FA 4HA8A 3OSVA 4PNOA 4OGEA 1ZBXA 2QFZA 3FJPA 2H3JA 4EMGA 2CZ7B 3C95A 1MGQA 3OB9A 3P8HA 1BI1A 3R6OA 2EQJA 2D0QB 1VQMT 1FX7A 4Z02A 1VQLA 2L89A 4XK8E 3MHXA 2E10A 4L6V5 5LJ5e 1KQ2A 3JB9F 4XTZA 3GPLA 3X25B 1W2BS 3VYHB 4IUUA 3I56T 1WGSA 2JZ2A 2RHZA 1XNIA 2QEXT 1YHQA 2JUFA 1NJIU 2E6NA 4LOCA 1M8VA 4M7DA 1BYMA 2CKKA 2DJZA 4FU6A 3OYIA 1K8AC 1VQ6A 2DPPB 3HL8A 2PU9B 3NTIA 2KR6A 4M7DD 3S6WA 1Y96A 3SWNB 1M9SA 4M77G 1KD1C 3DL1A 3CXCS 1VQKT 1H641 2X4JA 3FDRA 5CKEA 2QDJA 1X75C 5D6XA 4PJOG 3PMIA 4N4HA 4J6YA 4B9XA 2DZCA 2MI6A 2RHYA 5LJ5d 2FB7A 5CQYA 3A8GB 2M9UA 4F7UA 3HZJA 3L2WA 5GMKm 3JAME 4LDXA 2OAUA 4HNVA 3JCMe 2DTHA 4XU1A 4C5HA 4C8QA 2E64A 4J7FA 2NLUA 3H4CA 4J6XA 4NS5A 4PJOF 3JCMQ 1PSEA 4JS5A 3QJ6A 5IT9E 4D6WA 1YCYA 1VQ4A 2RJCA 1YITT 1O9SA 4A4FA 3BG5A 3QDRB 1VQ9T 1RL2A 3OYYA 3CCUA 3S3OA 2XDPA 1OZ3A 2RJFA 3OQ5A 3CBOA 2PQWA 4P5NA 4F7UE 3OYFA 1YIJA 4JLGA 3M59A 2KY9A 3ZFJA 1GXIE 4M75D 4C8QE 1B34A 4C5EA 2MMPA 4BY6C 3RMSA 4M75B 3CC2T 4MFEA 2OTJA 1R8OB 1LNXA 3JCMd 4C92A 3J80E 2WSEE 3HP9A 2XU8A 4IKFA 3EFRA 4M7AC 4OB0B 5D6YA 2HAXA 3CCSA 3BDUA 3V7SA 4E7KA 3CPWA 5GAN2 2Y4YA 2I2LA 4QVCA 2K5FA 2R57A 3NTKA 1X01A 5DLQE 4E47A 4C92E 4EPCA 4DA4A 3JB9J 4ATOA 2RI2A 3X26B 2LRQA 3CC7A 5GMKe 2M0OA 5CKHA 4C0ZA 4QQ6A 3WXMB 2DXUA 1VQPT 5J39A 1Q7YU 3KHIA 4C8QC 3JRZA 2GF7A 4BE2A 2CZ6B 1V29B 2C06A 5I2MA 5GANf 4JDSA 4UC4A 1VIEA 3VUZA 2JTMA 1UGPB 1EIFA 1YJ9T 3DLMA 3LH0A 3UT1A 3H6ZA 2E70A 1W4SA 1VQ5A 1ZQ1A 2RJDA 2K3YA 1YJNA 3L2ZA 3G4ST 2M1HA 1JB0E 1N9RA 1YJWT 4AKGA 3BW1A 5LJ3j 3HPWA 3GP8A 4BI8B 4C92C 4M77A 3CCET 2A3LA 5CK9A 3RESA 4BD3A 5IAYA 3BG9A 2JVVA 3RIRA 5LJ3g 4PJOA 3X24B 4XTWA 5CVIA 5GANe 2P0QA 4BUGA 2EJFA 2DXCA 2RH2A 3CMAA 1WNLA 4EMKA 3M5AA 4RG8A 3M54A 1NE8A 4HCCA 4PJOD 2KSSA 4M75G 2HQXA 3OA6A 4M77E 3V8JA 2O4XB 4II1A 3OYBA 1S72T 2DXBA 2RK2A 4ZN3A 2EQKA 2XD0A 4HCZA 4JX4A 1JRIA 1N27A 3V7CA 1U1TA 5A2QE 4JX5A 2CYZB 1BI0A 4JRQA 4BI4A 4AI6A 3C94A 5CO7A 4C0FA 5C0MA 5L8RE 4FT4A 1VQMA 1Q86U 3CCJA 1M1KU 2DD4A 4XTXA 2CGHA 3A8HB 3TREA 3GLXA 5GANd 2M16A 3HRSA 4MFDA 3HO8A 2XG8D 2PUOB 1M1GA 3VYGA 2EQUA 5LJ5f 2QEXA 3RMQA 3L2RA 4MMLA 4CI0C 1Q81U 1KQSA 2XKOC 3OW2A 1E7PA 2KAFA 3HSBA 3PMTA 2MF2A 3L1AA 5CKFA 1VQKA 2DD5B 4M77C 3QYGB 2PVOB 4QVZA 5LJ5h 5GAN6 1XOVA 1VQOA 1HXDA 4PLLA 2FVUA 4GY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYH B;  3HHT B;  3A8L B;  1PSE A;  4ZGD B;  4FM4 B;  2DD5 A;  2ZZD B;  1GXI E;  4Y28 E;  4ZGE B;  2PUK B;  2O01 E;  2WSE E;  4OB0 B;  2PVD B;  2QDY B;  1DJ7 B;  2ZPI B;  2ZPE B;  2ZZD A;  2AHJ B;  2ZPB B;  1QP2 A;  3QZ5 B;  1AHJ B;  4OB1 B;  3X26 B;  1IRE B;  1UGQ B;  2CZ6 B;  1V29 B;  4KT0 E;  2CZ1 B;  1UGP B;  2DXC B;  2WSF E;  3WVE B;  3A8M B;  3X20 B;  1JB0 E;  4RKU E;  2DXB B;  2ZPF B;  3X28 B;  3X24 B;  2DD4 B;  2DXC A;  3WVD B;  4OB2 B;  2ZPG B;  3QZ9 B;  2ZPH B;  3VYG B;  2WSC E;  2DXB A;  2CZ7 B;  3QXE B;  2D0Q B;  2CYZ B;  4XK8 E;  5L8R E;  4L6V 5;  2DD4 A;  3X25 B;  3A8H B;  4OB3 B;  4ZGJ B;  3VYH B;  3LW5 E;  2PUO B;  3VYG A;  2DPP B;  1QP3 A;  2PU9 B;  2ZCF B;  2DD5 B;  3A8O B;  1PSF A;  2PVG B;  3QYG B;  2PVO B;  1UGS B;  1UGR B;  2CZ0 B;  3A8G B; 
#chains in the Genus database with same CATH topology
 1T3S A;  5FRM A;  2C0T A;  2HSE B;  2BIV A;  3CCV A;  1ZSG A;  3OS2 A;  4EC8 B;  1O75 A;  1N8R U;  1KQ1 A;  1ABQ A;  4FYY B;  1YI2 Q;  1I0C A;  4HVU A;  1JU5 C;  3JCM f;  2E6Z A;  1YIT A;  2ZAE A;  2L2P A;  2IVW A;  1FKM A;  3OYK A;  3LGF A;  3GNG A;  2Y4X A;  1H1P B;  2FO0 A;  2IG0 A;  2O9S A;  1OX9 A;  3QSU A;  2EUF A;  3T9N A;  2COZ A;  2OI3 A;  3CBP A;  4M75 A;  2QG9 B;  2RF0 A;  1YIJ Q;  4F16 A;  1VQP A;  2V8I A;  4FL6 A;  1NJI C;  3SWN C;  1D0Z A;  5HK0 A;  1K9A A;  5A0D A;  4LUD A;  4A53 A;  3OYA A;  4F6S B;  2QQ8 A;  2A08 A;  4Y91 A;  3QWL A;  1YJW A;  1M3B A;  3FJ5 A;  2DXT A;  3Q1J A;  4E7S A;  1FWZ A;  3JB9 D;  5J3B A;  4J9I A;  7AT1 B;  4OB2 B;  4R56 A;  1AWX A;  3M9Q A;  1YBY A;  3TSW A;  3PE0 A;  2EYY A;  3SFM A;  1GUX A;  5EG2 A;  2QTX A;  1S72 A;  1D1A A;  3TEE A;  1G3N C;  1UTI A;  3VJP A;  1YWP A;  4OMN A;  2DER A;  1AIS B;  3I5R A;  2CCI B;  1E9H B;  2EIF A;  4J9H A;  2GQV A;  1BI3 A;  2HQE A;  4NC6 A;  2FZC B;  1MNE A;  5HVY B;  5CR2 A;  2R5M A;  2O4X A;  2X4W A;  1TOV A;  3EG0 A;  5LJ5 j;  1Q86 R;  2OTJ T;  4RCC A;  3EG3 A;  3RUX A;  4DBR A;  4F17 A;  1I5L A;  4OVA A;  1UGR B;  4BI3 A;  3VUB A;  3LX7 A;  1JBM A;  2BS3 A;  4PJO E;  1UNH D;  2BS2 A;  4QVD A;  2HEQ A;  3KBG A;  4M7A F;  2EVR A;  2K4Y A;  4BDY A;  1WIE A;  4LDU A;  1VQM Q;  1C6V X;  5HY6 A;  4ME7 A;  3MKD A;  5GMK i;  4KRC B;  2DD5 A;  2C4G B;  3QYB A;  1PM3 A;  3F70 A;  3OMG A;  5A2Q E;  3GOX A;  4WF2 A;  2WIP B;  2RA2 A;  4BE0 A;  2X4Y A;  3JCM b;  1Z9Z A;  1N8R R;  3VRZ A;  4WCI A;  4JZ4 A;  3TU4 K;  1VQK Q;  2F69 A;  1OUL A;  2C0O A;  4PJO C;  2E4H A;  1G3T A;  1NM7 A;  2FL7 A;  1JJ2 A;  1WXB A;  2DTO A;  2RI5 A;  2E12 A;  2ZPI B;  2ZZD A;  3CCV Q;  5CYI B;  4NOY A;  4OF1 A;  3MP8 A;  5AYF A;  2DF6 A;  2A37 A;  1UNG D;  5FLX E;  1WYX A;  1SF9 A;  1UDL A;  2J06 A;  2HL3 A;  5IN1 A;  1YIT Q;  4C92 F;  2A7Y A;  1QCF A;  4CFX B;  2FYK A;  4QQG A;  2CSQ A;  4IUP A;  2DME A;  3OYI A;  2CZ1 B;  1OI9 B;  2EJ9 A;  1Q81 C;  3CCL A;  4CFN B;  4LD6 A;  3LWI A;  4BBS M;  5KCO A;  3CCR T;  4KUI A;  3I55 T;  4Q5W A;  2KT8 A;  3X20 B;  3P8B B;  4BDZ A;  4RKU E;  3M57 A;  1QQJ A;  3HFN A;  1WDX A;  3E9G A;  2BZ8 A;  1IXD A;  2DL8 A;  2XDB A;  2E1H A;  2JMA A;  3JB9 H;  2LQN A;  1M90 C;  3TW6 A;  2QQR A;  2M0Y A;  1J3T A;  1RAE B;  3C4S A;  2E3I A;  2G9X B;  1VQ7 A;  2QA4 T;  3QYE A;  1VQP Q;  2ZPH B;  4X9C A;  2VGM A;  2I40 B;  1K9M C;  1RAG B;  1Q95 G;  2V8J A;  4AG2 C;  5GAN 4;  2VYT A;  5GAN j;  4M77 F;  2X35 A;  2EKH A;  2R5A A;  3M0U A;  4YOO A;  1OKW B;  2GCX A;  1YHQ T;  2VV5 A;  4C8Q D;  2V26 A;  5IH2 A;  1VQ6 T;  1YJW Q;  2J05 A;  4C8Q B;  2GNC A;  4M78 F;  2RHI A;  3M4Y A;  3G71 T;  2RHX A;  5KYX B;  1D0Y A;  4LDY A;  1VQ8 A;  3N5B B;  4AG1 C;  1TUD A;  3DB3 A;  1Y7X A;  1I1J A;  1B34 B;  5KH6 A;  3POM A;  2AZV A;  3FLG A;  3NDQ A;  1RAB B;  1S72 Q;  2LT1 A;  5HQ0 B;  1C1A A;  4KGZ B;  1SEM A;  1QVG S;  2KGT A;  5HBH B;  4GBQ A;  1H92 A;  2ABL A;  2G3R A;  4JRP A;  5KYW A;  2IVX A;  4JLI A;  2YRD A;  4N4G A;  3DLL A;  1WX6 A;  4V2S A;  2LT4 A;  2DL4 A;  1WHJ A;  1H3Z A;  1G8X A;  3CCS T;  2K57 A;  2C5X B;  3CD6 A;  1B7T A;  4JS4 A;  4M7D F;  1BCM A;  1OYX A;  1QP2 A;  2QQ9 A;  2LTO A;  3MEA A;  1UGQ B;  1AEY A;  4EOQ B;  5IF1 B;  3CC4 A;  3MEU A;  2O88 A;  3RDV A;  1FYN A;  1F5Q B;  4F7U F;  1X6B A;  4PJO B;  5GAO q;  1D1C A;  2CP2 A;  5GAN 5;  4F6W B;  4BCH B;  4ELJ A;  2L0A A;  3EFO A;  2RQW A;  1PRL C;  4M75 F;  2KEA A;  1FIN B;  4E7Z A;  1AWO A;  2YHT A;  1PG5 B;  2X3X D;  1KD1 U;  2UZE B;  1E6H A;  1OZ2 A;  3IQL A;  3OYM A;  2WJ9 A;  1CKB A;  2DD4 B;  3OS5 A;  2YXY A;  1VUB A;  2FEI A;  2KQW A;  4EOI B;  3M4G A;  5ICP B;  4C0D C;  3VYG B;  1OX8 A;  1I81 A;  3OYF A;  1B3Q A;  2DL3 A;  1OIU B;  1ZBX A;  1YN8 A;  2B86 A;  2H3J A;  3OSV A;  4PNO A;  2CZ7 B;  3P8H A;  3CCL Q;  5EC7 A;  2ED1 A;  2KRM A;  2EQJ A;  3R6O A;  2QGS A;  2O2O A;  1FX7 A;  2MPX C;  3VYH B;  3I56 T;  1UG1 A;  2RHZ A;  4LOC A;  1WHL A;  5KYU A;  1K8A C;  3GTM S;  3HL8 A;  1TD6 A;  3EG1 A;  1Y96 A;  2O9V A;  3S6W A;  2YT6 A;  4I3Z B;  1VQ7 Q;  1X75 C;  3VRY A;  4N4H A;  4II5 B;  4J6Y A;  2DZC A;  3VS6 A;  4CC3 A;  2FB7 A;  5D7U A;  3L2W A;  3HZJ A;  1PKD B;  4LDX A;  3EID B;  2OAU A;  3JCM e;  4XU1 A;  4C5H A;  2M51 A;  2YWW A;  4NS5 A;  1OV3 A;  1PSE A;  1R77 A;  4JS5 A;  1VQ9 T;  3BLQ B;  1RL2 A;  3CCU A;  2MCN A;  2L3S A;  3EG9 A;  5HCK A;  4CFU D;  3M59 A;  2K3B A;  1B07 A;  4C5E A;  1HJD A;  4CFU B;  4MFE A;  1VQ8 Q;  3JCM d;  2WSE E;  2XU8 A;  4IKF A;  4M7A C;  2NUP A;  3H0F A;  4OMM A;  3DJB A;  3BDU A;  3V7S A;  3CPW A;  2Y4Y A;  4DBQ A;  2HL5 C;  1X01 A;  2NUT A;  4EPC A;  4C92 E;  3JB9 J;  2RI2 A;  5BNJ B;  2LRQ A;  5GMK e;  2M0O A;  5CKH A;  2DXU A;  3QHW B;  1Q7Y U;  4BCN B;  2GF7 A;  1VIN A;  2C06 A;  5I2M A;  4JDS A;  1RAC B;  1VIE A;  3VUZ A;  3LH0 A;  3UT1 A;  5LMK B;  1YJN A;  3G4S T;  3CD6 Q;  2X3W D;  2YUO A;  2J7I A;  4AKG A;  3BW1 A;  3GP8 A;  2CP0 A;  4C92 C;  5CK9 A;  4BD3 A;  5GJW B;  2JVV A;  1PWT A;  4XTW A;  5L2W B;  3CMA A;  1WNL A;  4CC7 A;  3CC4 Q;  4PJJ A;  1KD1 R;  3OA6 A;  2HQX A;  2CJM B;  3VS4 A;  1UJ0 A;  4M77 E;  1JOW A;  1RAA B;  2RK2 A;  1UFF A;  2W2H A;  4HCZ A;  4JX4 A;  1N27 A;  2LNH B;  3C94 A;  2CH4 A;  1UHC A;  4C0F A;  4DEX A;  1H27 B;  3CCJ A;  2YUQ A;  1M1K U;  2CGH A;  1QWF A;  3HO8 A;  2BZY A;  2UUE B;  2DM1 A;  4PJN A;  1UUE A;  2XKO C;  1E7P A;  3HSB A;  4M77 C;  1OQK A;  1WFW A;  1SSF A;  4PFP A;  1VQO T;  1W6X A;  2GTO A;  3OYH A;  3CME T;  2EW3 A;  5KE3 A;  2E5K A;  1O9K A;  1NZ9 A;  2HMA A;  1OL2 B;  2HNI A;  1YI2 A;  4M78 C;  3BHU B;  1KC8 U;  5ACB A;  2LCL A;  4OGC A;  1MMG A;  4ZTJ A;  1NBE B;  3EH1 A;  1Q86 C;  2COY A;  2KRO A;  1JXM A;  1NLP C;  3REB B;  1ZP2 A;  4BCJ B;  3FRN A;  5L23 A;  1NLO C;  1HK9 A;  3OYE A;  5FRN A;  3VS5 A;  4M7D E;  1QCO A;  2KE9 A;  2HKN A;  5CAI A;  2HSP A;  1BI2 A;  2LQK A;  4ELY C;  1ZLM A;  1N4M A;  1C0M A;  4YTL A;  3EGD A;  2KXD A;  4HLQ A;  4HNU A;  4DOW A;  1U1S A;  5AT1 B;  2JT4 A;  3CCU Q;  5GMK l;  2ROT A;  4M7A D;  2LQW A;  2KMG A;  2RI3 A;  4XU2 A;  4M7A B;  2LJ1 A;  1EX4 A;  2C5O B;  1BKB A;  1K0X A;  4M7D C;  4HXJ A;  4M75 E;  2WSF E;  4J83 A;  2X4X A;  2KR3 A;  1YJ9 A;  1Q7Y R;  2KI7 A;  2BPM B;  4RCB A;  3A8M B;  4QT7 A;  3A98 A;  1G83 A;  2FPE A;  3MPU B;  1PNJ A;  2CH4 W;  3RKW A;  8ATC B;  2HKQ B;  3JSC A;  2LP5 A;  3SB2 A;  5KCH A;  4ZTF A;  4EDU A;  1RLP C;  4XQ3 A;  3QZ9 B;  2EJG A;  4JRK A;  3RKY A;  2PNI A;  4BCI B;  2DKG A;  4C5G A;  1VOL A;  1QVF A;  3GIB A;  1U06 A;  2RQR A;  2CP3 A;  1D09 B;  4PKC C;  2DJQ A;  4M75 C;  1WHH A;  3S3N A;  1MND A;  2JN0 A;  2QI2 A;  1ACM B;  2E3H A;  4N4I A;  3BFM A;  1VQ4 T;  5HNB B;  1YJN Q;  2CUD A;  3DDQ B;  4E7H A;  3BLH B;  1H4L D;  2IW6 B;  2QTV A;  5FRO A;  1M1K R;  2D6F A;  3CCQ T;  2DK3 A;  3NTH A;  4ELL A;  4JZ3 A;  5FU6 C;  3CMA Q;  2PVG B;  5CKB A;  4KUL A;  1K73 U;  1VYW B;  1WXT A;  2DEQ A;  3JCM V;  5LJ5 g;  2QQB A;  1QVP A;  4MDW A;  3VS1 A;  1RAF B;  1H1Q B;  5LL6 S;  3UWN A;  1UEC A;  2K5L A;  2D8J A;  3CCJ Q;  3HB9 A;  2SRC A;  1JST B;  1NEG A;  1SPK A;  1KQS S;  1AD5 A;  4XTU A;  3J81 E;  3OW2 S;  4X9D A;  1X2Q A;  4VUB A;  4X34 A;  3HBL A;  4EOL B;  5M9O A;  3G6E T;  4Y28 E;  3TCJ A;  4PJM A;  2WHB B;  3JB9 G;  2L3P A;  2V1Q A;  1KC8 R;  2PTK A;  4CRI A;  2XI9 A;  2JTF A;  1VQ5 T;  1K0S A;  2EYX A;  4M78 D;  1P92 A;  2XID A;  4OP0 A;  2PVD B;  2QDY B;  4CXA B;  4M78 B;  1H1R B;  2AT1 B;  2PZ1 A;  3PGG A;  1FMW A;  3SD4 A;  2Y90 A;  4DBH A;  1F1B B;  1PCX A;  1AHJ B;  3PTA A;  2DAQ A;  3QUI A;  2V8K A;  4JUV A;  3PVQ A;  1ZHI A;  1ZSZ C;  2LMJ A;  4R55 A;  1EFN A;  3MP6 A;  2RM4 A;  5LJ3 e;  4F7S B;  1VYU A;  5GMK j;  3WVE B;  2E65 A;  4LN2 A;  4JJD A;  4BXX X;  1IZ6 A;  2VGN A;  1OI1 A;  5GAO n;  4OMP A;  1FMK A;  1E6G A;  2AKL A;  4RTZ A;  2GFA A;  5LJ3 d;  1XO2 A;  1WJQ A;  3OBY A;  4BY6 B;  3OSS C;  2NWM A;  2WXV B;  4M7D B;  2L3Q A;  2HD0 A;  4CC2 A;  4KH0 B;  1NYF A;  3CCV T;  3EG2 A;  2LNV A;  4ELZ C;  1VQL T;  1YJ9 Q;  1GBQ A;  3M0R A;  4BBR M;  5GAO l;  1X6O A;  1BU1 A;  2IPO B;  5GAN g;  3VS3 A;  4F7U B;  3VU3 C;  2MK5 A;  3NFC A;  2VAS A;  3KFV A;  3CCE Q;  4Z88 A;  2ZCF B;  3PNW C;  3BG3 A;  3QWY A;  3REA B;  2L5Q A;  4OGR B;  4KUD K;  2F2X A;  3JCM J;  4MDX A;  3D7S B;  2W9F A;  2CCH B;  2CUB A;  1K73 R;  2P0K A;  3M53 A;  3C0C A;  2LVM A;  2J6O A;  4LE9 A;  5KE2 A;  1M4Z A;  4IUT A;  3QJY A;  5FU6 B;  1VYV A;  4B9W A;  4ZGE B;  2YUN A;  4J9C A;  2KDS A;  4RTV A;  3HRU A;  1KHC A;  1GFC A;  1LJO A;  3OY9 A;  2JS0 A;  2FRW A;  1GH6 B;  3OS0 A;  1RUW A;  1T0H A;  1WQ7 A;  5GAM e;  2ZPB B;  1KHI A;  2QQS A;  3LQ5 B;  1XJW B;  4X1V A;  2OTL A;  4XTY A;  4CFW B;  4C8Q G;  3OYJ A;  4IUQ A;  2M02 A;  4EOO B;  2VB6 A;  4M6V A;  4GLM A;  4JX6 A;  2NUZ A;  2RN8 A;  3OBW A;  5IHI A;  5HKC A;  5GAM d;  3EAE A;  4LD9 K;  3SHW A;  5A0L A;  3CCR A;  2WMB B;  3PT9 A;  3I55 A;  4IMY B;  2DXB B;  2W0Z A;  3BY7 A;  1LVK A;  2ZPF B;  1ZSZ B;  4E7L A;  1ZUY A;  3TNI B;  3E9F A;  1N9S A;  2QA4 A;  2EYW A;  1GBR A;  3C95 A;  1MGQ A;  3OB9 A;  4EOJ B;  1BI1 A;  3H41 A;  3R6N A;  1AD6 A;  4Z02 A;  2GTJ A;  2L89 A;  2E10 A;  1KQ2 A;  1W2B S;  2LW4 A;  2R7G A;  2D0N A;  4EOM B;  4IUU A;  2JZ2 A;  1YHQ A;  2I0N A;  2QEX T;  1NJI U;  2E6N A;  1VQ6 A;  5IDP B;  3NTI A;  5IXB A;  1M2V B;  2W10 A;  3SWN B;  1KD1 C;  4JPB W;  1ARK A;  1M3A A;  3CXC S;  4EC9 B;  2X4J A;  4FSS A;  3FDR A;  4ROE A;  3OW2 P;  4FX3 B;  5D6X A;  4PJO G;  2BTT A;  3PMI A;  4ROC A;  2RHY A;  5GMK m;  3JAM E;  4HNV A;  2JJ9 A;  2CDT A;  4C8Q A;  1TUC A;  2NLU A;  3H4C A;  2K9G A;  4UN0 A;  1YCY A;  2RJC A;  4Z8A A;  5KYX A;  3M0T A;  2RJF A;  2FG0 A;  3CBO A;  2LZ6 B;  4YC3 B;  2KY9 A;  1GXI E;  3EGX B;  1B34 A;  4F14 A;  3CC2 T;  1AWW A;  2OTJ Q;  2HAX A;  3EJ1 B;  3CCS A;  2IIM A;  1YFN A;  4E7K A;  2DIL A;  2K5F A;  1YWO A;  2R57 A;  3NTK A;  2HZY A;  5DLQ E;  1KIK A;  1X69 A;  2P84 A;  3CC7 A;  4C0Z A;  1UJY A;  1GFD A;  4J9E A;  5J39 A;  3KHI A;  1NEB A;  3JRZ A;  2BE7 D;  3UA7 A;  1V29 B;  1IGQ A;  2DBM A;  5KYY B;  5GAN f;  2SEM A;  3I35 A;  1EIF A;  2RQV A;  3DLM A;  3H6Z A;  2E70 A;  2DYI A;  1M3C A;  2QK0 A;  2M1H A;  5LJ3 j;  2CP5 A;  2A3L A;  2JGZ B;  4PJO A;  1QWE A;  2OTL Q;  2EJF A;  3M5A A;  3M54 A;  1NE8 A;  4PJO D;  2AK5 A;  2KSS A;  1S1N A;  5DQV A;  4II1 A;  1X6G A;  1MMN A;  3V8J A;  3OYB A;  3LH5 A;  3QHR B;  1JRI A;  1U1T A;  2K2M A;  4BI4 A;  2JM9 A;  3TVT A;  5L8R E;  1RAD B;  4FT4 A;  3CCR Q;  3I55 Q;  2DD4 A;  4Y92 A;  4PK4 A;  3HRS A;  4CRL B;  2XG8 D;  1M1G A;  3VYG A;  3BE3 A;  3L2R A;  1Q81 U;  4CI0 C;  2KAF A;  1JQQ A;  3M0P A;  4Y72 B;  5LJ5 h;  1NJI R;  2QA4 Q;  4GY5 A;  1GCQ A;  1GCP A;  3QYH B;  1WI7 A;  1M90 U;  2XK0 A;  1I4K 1;  4HKE A;  1VIF A;  1I5O B;  1YHQ Q;  1K9M U;  3CC4 T;  2BKZ B;  1G5V A;  2X51 A;  3QWX X;  4J7I A;  4FW1 A;  4F04 B;  1VQ9 A;  5LQF B;  2PJQ A;  1VQ6 Q;  2X1N B;  1T3L A;  3MEW A;  1RI9 A;  1AZE A;  1G3Y A;  2I53 A;  3G71 Q;  1Q82 C;  5FW9 A;  2C6T B;  4JJC A;  5I21 A;  4ZN1 A;  3BDL A;  2EFI A;  2YLC A;  4Z89 A;  2R58 A;  4N0A C;  4HCB A;  2ESW A;  3DDP B;  1D3B B;  4OB1 B;  3BHV B;  2F1L A;  3PIP A;  3PIO A;  2CS7 A;  1HYO A;  4FYX B;  4RTW A;  2JS2 A;  2RHU A;  5GAM j;  3OYN A;  1Z9Q A;  4M4Z A;  4KT0 E;  1QKW A;  4JJB A;  4XTV A;  5EJC A;  1CKA A;  4RTY A;  3CCS Q;  2KMT A;  2RB6 A;  1WHG A;  2KXC A;  3RKX A;  1IHW A;  3G4S A;  4TVR A;  1VQN T;  1M30 A;  3JCM c;  2EPD A;  4FIB A;  4PLI A;  2AKK A;  1K4U S;  4BCN D;  2VUB A;  1RAH B;  3CC7 Q;  1W1F A;  1W2B P;  3H0I A;  5I5Z B;  2XIC A;  3HTR A;  2KVQ G;  1W98 B;  1UNL D;  2K7A A;  3V8L A;  1U8R A;  5GAN 7;  3P8D A;  5GAN h;  2LDM A;  1H25 B;  1QW1 A;  1WHM A;  3RR6 A;  4MZT A;  3LW5 E;  3JCM P;  2IN3 A;  1OEB A;  1QVG A;  1H1S B;  1NG2 A;  1A0N B;  3MP1 A;  3JV3 A;  2W96 A;  2ATC B;  2DYB A;  3EH2 A;  4M7A G;  1MUZ A;  1PSF A;  4BCF B;  1C9B A;  5FU7 C;  1UGS B;  1OOT A;  4LDW A;  1Q81 R;  2FPF A;  4FW2 A;  4FCY A;  4A4K A;  4F7J B;  1Y57 A;  1VQO A;  4RMO A;  2E5Q A;  3CME A;  1JKW A;  5GAN 3;  1U3O A;  1WZO A;  1FVV B;  3HFO A;  2NYS A;  3V7R A;  2D8H A;  3I56 Q;  1D1B A;  1TH7 A;  1M90 R;  4C0D B;  3GNF B;  4AKH A;  1MHN A;  1QVG P;  3INZ A;  2DA9 A;  2K5I A;  2LC4 A;  3J7A F;  4DQ2 A;  3JCM g;  4C8Q F;  3DB4 A;  4JJN K;  3UDC A;  3VV0 A;  2F5K A;  1DJ7 B;  2GFU A;  3RNJ A;  4HL4 A;  1PD0 A;  4EMK C;  3KUF A;  3VKI A;  4J5Y A;  3ME9 A;  3JB9 I;  1LCK A;  3I9Q A;  5J26 A;  3OYG A;  1VQ9 Q;  2O31 A;  3FEO A;  4ANJ A;  1TXQ A;  3B57 A;  1G2B A;  4RG2 A;  3MEV A;  1LOJ A;  1ZA1 B;  1RI0 A;  1TUG B;  1M1F A;  2DMO A;  3CCJ T;  5CIU A;  1R0B G;  3OYC A;  4BCM D;  4AFQ C;  2EGE A;  3CCM T;  5D6W A;  4BCM B;  1FXX A;  3M0Q A;  4FYV B;  4M7A A;  1TG0 A;  1UGV A;  2EWN A;  1RAI B;  3GF5 A;  1N8R C;  3URG A;  2PK2 A;  2WEV B;  2VWF A;  4L5G A;  4DOV A;  2JW4 A;  4MZP A;  3G33 B;  4BAC A;  2BUD A;  2RQT A;  2RQU A;  1M27 C;  3G7Z A;  4M78 G;  1YI2 T;  3C12 A;  4XAX B;  3M55 A;  5CKD A;  4NST B;  4ZGJ B;  3G4S Q;  2HBW A;  2XDD A;  1UEB A;  3CCE A;  3SEM A;  2RMO A;  4A4H A;  4ROD A;  3CCQ A;  1URC B;  4HT9 A;  4RTT A;  4NL3 A;  2RO0 A;  4GLK A;  4O5V A;  4C92 D;  4BY1 X;  2JXB A;  2DIQ A;  4C92 B;  2RNA A;  2DL7 A;  4A4G A;  5CCA A;  4BCQ D;  5IHY A;  4ZGD B;  5I2S A;  1YIJ T;  4BCQ B;  2E41 A;  1QLY A;  1KJW A;  4LDV A;  5DM7 R;  1KK7 A;  5ECA A;  5FU7 B;  3VKG A;  2PUK B;  3UF4 A;  2O01 E;  4M7D G;  1I8F A;  3G6E A;  5GAM h;  3QG1 A;  4K11 A;  1P5E B;  3RGF B;  3LLR A;  1WJS A;  5I11 A;  2QXF A;  2DTI A;  3VS7 A;  2ZPE B;  1VQO Q;  3F5X B;  4A4E A;  3CME Q;  4F7U G;  1TSF A;  1V76 A;  1OPL A;  4E7J A;  3K7A M;  2C0I A;  5C6S A;  4M77 D;  1YNZ A;  4HNT A;  3QPH A;  1D3U B;  2LX7 A;  4M77 B;  1BCO A;  1D0X A;  4M78 A;  4EOS B;  3ZBD A;  1WXU A;  4Z6Y A;  2DXC B;  1Y71 A;  1ZBJ A;  4EMH A;  1QKX A;  1JJ2 S;  4EMK B;  2DBK A;  2CT4 A;  4IUV A;  4XU3 A;  2J6F A;  2V22 B;  3NGP A;  1QLB A;  2LQ8 A;  4EIK A;  2QGF B;  2H8H A;  2YLB A;  3LYI A;  4WTO B;  1YP5 A;  2G6F X;  2QQA A;  1GRI A;  1BIA A;  1M2O A;  4J9B A;  4HT8 A;  3PO3 S;  2EYZ A;  3RER A;  3TSZ A;  2ZPG B;  2UZB B;  4EOK B;  4A54 A;  1HD3 A;  4FSX A;  2FPD A;  4CFM B;  2ZGW A;  4QQ6 A;  2DNU A;  1KSW A;  1IRX A;  4G6L B;  4KRD B;  2D0Q B;  2MIO A;  2C5N B;  1VQM T;  4OR5 B;  1VQL A;  4XK8 E;  1MV3 A;  4XTZ A;  3GPL A;  2WMA B;  2HQH A;  1JEG A;  2B9R A;  2HDA A;  1QMC A;  1XNI A;  2JUF A;  1M8V A;  4M7D A;  4FYW B;  2CKK A;  4FU6 A;  1BYM A;  3G1J A;  2DPP B;  2WFY B;  2KR6 A;  2GBQ A;  4M7D D;  1VQK T;  1M9S A;  2LJ0 A;  1H64 1;  4DBF A;  2QYZ A;  3PVL A;  5IHN A;  2MI6 A;  5CQY A;  4F7U A;  1VOM A;  4DEY A;  4AFZ C;  3MY5 B;  2DTH A;  1TTH B;  3QJ6 A;  5IT9 E;  4D6W A;  1YIT T;  2DET A;  1VQ4 Q;  1O9S A;  4A4F A;  3BG5 A;  3QDR B;  3U23 A;  3OYY A;  2XMF A;  1OZ3 A;  3OQ5 A;  4LXC A;  3BLR B;  4D8K A;  3ZFJ A;  4M75 D;  4C8Q E;  4CFV B;  3RMS A;  4M75 B;  2OTJ A;  1R8O B;  3O0G D;  1JO8 A;  5HBE B;  3CCQ Q;  4IIO A;  5D6Y A;  2KBT A;  3TQ7 P;  2WPA B;  1AWJ A;  2DFU A;  5GAN 2;  2I2L A;  1ZUK A;  3X26 B;  1VQP T;  4C8Q C;  4EOR B;  1PC0 A;  4HCK A;  4UC4 A;  2RPN A;  3G6E Q;  1UGP B;  4LUE A;  2V1R A;  1FMV A;  1W4S A;  1VQ5 Q;  1M8M A;  3L2Z A;  1GUX B;  1JB0 E;  1N9R A;  3QDF A;  1YJW T;  2KT1 A;  5IXF A;  5IDN B;  1H28 B;  3BG9 A;  1AVZ C;  5LJ3 g;  1H8K A;  2RH2 A;  1I07 A;  4RG8 A;  2DRK A;  2FZK B;  2O4X B;  2AIR B;  1S72 T;  2DXB A;  4BCK B;  2EQK A;  2XD0 A;  2YUP A;  1IHV A;  2CYZ B;  4JRQ A;  2JMC A;  1ZSZ A;  1PHT A;  2KNB B;  6AT1 B;  3A8H B;  3GLX A;  2M16 A;  4EOP B;  1OU9 A;  2QDL A;  5LJ5 f;  2EQU A;  2QEX A;  4KH1 B;  1UE9 A;  1KQS A;  3OW2 A;  4TTH A;  1QCN A;  2GQI A;  2VKN A;  2DD5 B;  4QVZ A;  1K76 A;  2OJ2 A;  2F2C A;  1HXD A;  4PLL A;  2FVU A;  2LJ3 A;  1OKV B;  2J6K A;  4IUR A;  1GY3 B;  1VQL Q;  3SDZ A;  3HHT B;  3A8L B;  2KRS A;  3KXT A;  1M2V A;  3L2U A;  2OTL T;  1WA7 A;  3SWN A;  1TWB A;  1XQH A;  1H26 B;  3AT1 B;  2ZZD B;  3HKS A;  3OYD A;  3E1S A;  1QMZ B;  2XHC A;  3MET A;  2DRM A;  1E7O A;  3JCM h;  4PFO A;  1KQS P;  3G71 A;  3CC2 A;  2ROL A;  1BBZ A;  3VKH A;  4BCO B;  3EGU A;  2EQI A;  2IW9 B;  4PFZ A;  1WPY A;  3UPU A;  4J8O A;  1BK2 A;  5CEI B;  2L8D A;  1SRM A;  3THK A;  1JJ2 P;  5A0G A;  3EGX A;  3QZ5 B;  2YRC A;  1WJR A;  1GCQ C;  4OMO A;  2JM8 A;  3PFS A;  2DEU A;  3LWH A;  3FIF A;  2QAS A;  1TU0 B;  1PRM C;  3CPF A;  3L2V A;  4RTX A;  3CCL T;  3QBY A;  5CQX A;  5GAM g;  2IW8 B;  4QSH A;  5GJV B;  3MI9 B;  4PL6 A;  1WQW A;  3CPW S;  5GMK h;  4R0K A;  2VC8 A;  3X28 B;  5KYY A;  4F6U B;  1KG1 A;  3FC3 A;  4C5I A;  1VQ7 T;  1BB9 A;  3OYL A;  3WVD B;  3OMC A;  5DQW A;  2MWO A;  4OMF B;  2GGR A;  3A5Z B;  2FHD A;  3BHT B;  5HK3 A;  1K1Z A;  3QXE B;  2LCC A;  1MMD A;  3LGL A;  4RTU A;  2PK9 B;  5GAO r;  2CRE A;  4BCP B;  1OL1 B;  4OB3 B;  2ED0 A;  2HBP A;  4KBM B;  3DOG B;  2HCK A;  4KGV B;  2A36 A;  1NPR A;  2UZD B;  1WLP B;  1ZX6 A;  1G3W A;  2D1X A;  1ABO A;  2EGA A;  5FWB A;  2C5V B;  1AOJ A;  4E2F B;  4BCG B;  1VQ8 T;  4QKU A;  2DL5 A;  4JRI A;  4F70 B;  3UA6 A;  2QGG A;  4AKI A;  4YOS A;  4ORZ A;  5KYW B;  3JCM X;  1Q7Y C;  3DKM A;  4OML A;  2DZ9 A;  2K3X A;  4NL2 A;  3OS1 A;  2BS4 A;  4FT2 A;  1XTD A;  3RBB B;  3CC7 T;  3M58 A;  4FM4 B;  2F2W A;  2MWP A;  2FRY A;  3I56 A;  2VXE A;  3ZEH A;  4HVW A;  2QEX Q;  1KXU A;  1IGU A;  2QAZ A;  3ZL7 C;  4L59 A;  4HVV A;  5FWC A;  3MY1 B;  4BB7 A;  1SSH A;  2A28 A;  3CD6 T;  1KFZ A;  5LJ3 f;  4MZM A;  4J9G A;  3JB9 F;  2G77 A;  1MMA A;  2AHJ B;  3EFO B;  4J6W A;  3HRT A;  4J9F A;  1X43 A;  3EOC B;  2D9T A;  4A63 B;  1GL5 A;  2YRV A;  1M1K C;  1SHF A;  4LNP A;  3S3M A;  1T0J A;  1VYT A;  3EFS A;  1IB8 A;  2BZX A;  2W9Z A;  1AT1 B;  1N6A A;  3ASK A;  4E7I A;  3FB9 A;  2ENM A;  2CT3 A;  3E2U A;  3CC2 Q;  3E19 A;  1TFB A;  2YDL A;  2RD1 A;  4O6J A;  1D3B A;  1HSQ A;  3TNH B;  2P4T A;  3AHU A;  4E6R A;  3MJX A;  2OX7 A;  2EYQ A;  1W2B A;  2DLP A;  1VQN A;  3CEY A;  5GAO m;  1KC8 C;  5KYU B;  1OU8 A;  4KRT A;  1NYG A;  2EKO A;  4QQD A;  3CXC A;  3NHN A;  2WSC E;  1X27 A;  2DX1 A;  1UHF A;  4M7A E;  1M5Q 1;  2OAW A;  1Y96 B;  3DTO A;  2YSQ A;  3QHS A;  3QII A;  1PKS A;  9ATC B;  3H0H A;  3CBM A;  3ER0 A;  2PHG A;  5EFQ B;  2KRN A;  1H24 B;  2DE0 X;  3O5Z A;  2AZS A;  1QP3 A;  2DIG A;  4MMK A;  3QO3 A;  3M56 A;  1QVF S;  3A8O B;  2JOY A;  3EG9 B;  2WIH B;  4BE1 A;  2CZ0 B;  2MAM A;  4C0G A;  4MIM A;  3TW7 A;  2ECZ A;  3CXC P;  2L3R A;  2K2V A;  2NUP B;  1SKU B;  2VXF A;  3CCU T;  3V8K A;  5GAM f;  2RJE A;  1NPP A;  5DLO A;  1LPL A;  2EQM A;  2X9H A;  1SG5 A;  1PKT A;  2NUT B;  4F7N B;  2CSI A;  5DY9 A;  4CC4 B;  4OMQ A;  1OPK A;  2A0F B;  4AFU C;  2UZL B;  3L2Q A;  8AT1 B;  5GAO p;  2JNG A;  3QKJ A;  1BIB A;  2BKD N;  2EAY A;  3H8Z A;  2WAC A;  2DVE A;  3MO8 A;  2FZG B;  3CPW P;  1IRE B;  4KGX B;  1Y07 A;  3UAT A;  1W70 A;  3EHR A;  2KK4 A;  1JSU B;  2P0P A;  5GAN 8;  1OGU B;  1Y0M A;  2KYB A;  1K9M R;  2QF7 A;  4XU0 A;  1YJN T;  3MCA B;  4AT1 B;  1K8A U;  4C92 G;  1K73 C;  4J9D A;  4QW2 A;  4M78 E;  2DO3 A;  2RK1 A;  3L42 A;  3O8V A;  3CCM A;  1UB4 A;  2LX9 A;  5LJ3 h;  3JCM W;  2B8A A;  2F5T X;  1Q82 U;  3CMA T;  1RLQ C;  2KYM A;  4N0A A;  4D8D A;  1G3S A;  4HA8 A;  4OGE A;  2QFZ A;  2CP6 A;  1VA7 A;  3FJP A;  4EMG A;  2K6D A;  1ZUU A;  4IIM A;  1MV0 B;  3GBQ A;  3MHX A;  4L6V 5;  5LJ5 e;  4F7L B;  4ZNX A;  3X25 B;  1WGS A;  1H3H A;  1SHG A;  1ZA2 B;  1U5S A;  2COW A;  2DJZ A;  1O9K B;  2PU9 B;  1VQN Q;  1BU2 A;  1SRL A;  4M77 G;  3DL1 A;  5CKE A;  2QDJ A;  1AZG B;  2Z0W A;  4B9X A;  1X2K A;  5LJ5 d;  3A1P A;  3A8G B;  2M9U A;  1R0C B;  5KYN A;  1TS9 A;  1OIY B;  2CP7 A;  2E64 A;  4J7F A;  4J6X A;  3JCM Q;  4PJO F;  1VQ4 A;  3S3O A;  2XDP A;  4F7U E;  2JTE A;  2PQW A;  4P5N A;  1YIJ A;  1WHK A;  4JLG A;  4EON B;  4AFS C;  3EGD B;  4BY7 X;  2MMP A;  1N5Z A;  4BY6 C;  3VS2 A;  1LNX A;  4C92 A;  3J80 E;  3HP9 A;  3EFR A;  4OB0 B;  3VS0 A;  2MYS A;  3M03 A;  4PJL A;  2EBP A;  4QVC A;  4E47 A;  4DA4 A;  1V1C A;  2BE9 B;  4ATO A;  2K79 A;  3WXM B;  4BE2 A;  2CZ6 B;  3NMZ C;  2JTM A;  3M0S A;  1YJ9 T;  3ULR B;  2F2V A;  1VQ5 A;  1ZQ1 A;  2RJD A;  2K3Y A;  1IO6 A;  1EZZ B;  3HPW A;  4BI8 B;  4RUG A;  3H9N A;  4M77 A;  3CCE T;  3RES A;  3TNW B;  5IAY A;  3RIR A;  3X24 B;  5CVI A;  1JXO A;  5GAN e;  2P0Q A;  4BUG A;  1K8A R;  2DXC A;  2VVK A;  3MIA B;  4EMK A;  1CSK A;  2H3E B;  4HCC A;  3EHQ A;  4M75 G;  3NPF A;  5I22 A;  3I5S A;  3CQT A;  4ZN3 A;  1Q82 R;  2PMI B;  3V7C A;  2EGC A;  1ENW A;  1QVF P;  1YCS B;  4YOZ A;  4JX5 A;  1BI0 A;  2LCS A;  5FGK B;  4AI6 A;  5CO7 A;  5C0M A;  1Q86 U;  1VQM A;  2P4R A;  4ESR A;  4XTX A;  3TRE A;  5HBJ B;  5GAN d;  4MFD A;  4B6M A;  3CCM Q;  2PUO B;  5IHK A;  3RMQ A;  2DVJ A;  4MML A;  3PMT A;  2W99 A;  2MF2 A;  3L1A A;  5CKF A;  1PD1 A;  2MOX A;  1VQK A;  3QYG B;  2PVO B;  4AMC A;  5GAN 6;  1XOV A;  3TN8 B; 
#chains in the Genus database with same CATH homology
 1SSF A;  3QYH B;  1VQO T;  1M90 U;  5FRM A;  3OYH A;  2BIV A;  3CME T;  2XK0 A;  5KE3 A;  3CCV A;  1I4K 1;  4IUR A;  3OS2 A;  1NZ9 A;  3SDZ A;  3HHT B;  3A8L B;  1O75 A;  1KQ1 A;  2HNI A;  4HKE A;  4M78 C;  3KXT A;  3L2U A;  1YI2 A;  1N8R U;  3SWN A;  2OTL T;  1KC8 U;  2LCL A;  1VIF A;  3JCM f;  4OGC A;  2E6Z A;  4ZTJ A;  1YIT A;  1K9M U;  3CC4 T;  1XQH A;  1G5V A;  1Q86 C;  2ZZD B;  3HKS A;  4J7I A;  1VQ9 A;  2IVW A;  3OYD A;  1FKM A;  3MEW A;  3FRN A;  3E1S A;  2XHC A;  3MET A;  3JCM h;  1G3Y A;  3OYK A;  1HK9 A;  3OYE A;  5FRN A;  3G71 A;  3LGF A;  3GNG A;  1Q82 C;  3CC2 A;  4M7D E;  5I21 A;  2Y4X A;  3VKH A;  3BDL A;  4ZN1 A;  1WPY A;  3UPU A;  4J8O A;  5CAI A;  2EFI A;  2YLC A;  2IG0 A;  1BI2 A;  2L8D A;  2LQK A;  4ELY C;  2R58 A;  4N0A C;  4YTL A;  3QSU A;  5A0G A;  4HCB A;  3QZ5 B;  3T9N A;  4HLQ A;  1D3B B;  4HNU A;  4DOW A;  4OB1 B;  1WJR A;  1U1S A;  3CBP A;  3PIP A;  4M75 A;  3PIO A;  2CS7 A;  5GMK l;  4M7A D;  3PFS A;  1JJ2 A;  2RHU A;  5GAM j;  3OYN A;  1VQP A;  2KMG A;  2RI3 A;  2V8I A;  3FIF A;  4FL6 A;  4KT0 E;  3CPF A;  4XU2 A;  4M7A B;  3LWH A;  3SWN C;  3L2V A;  1NJI C;  3CCL T;  1BKB A;  3QBY A;  5HK0 A;  4XTV A;  5A0D A;  5CQX A;  4M7D C;  5EJC A;  5GAM g;  4M75 E;  4QSH A;  2WSF E;  4J83 A;  2X4X A;  4A53 A;  3OYA A;  4PL6 A;  1YJ9 A;  1WQW A;  2QQ8 A;  4RCB A;  3CPW S;  5GMK h;  3A8M B;  2KMT A;  2RB6 A;  4Y91 A;  3QWL A;  3RKX A;  3G4S A;  4TVR A;  1YJW A;  1VQN T;  2DXT A;  2VC8 A;  3Q1J A;  3JCM c;  3X28 B;  4FIB A;  4PLI A;  1FWZ A;  3RKW A;  1KG1 A;  3FC3 A;  3JB9 D;  2VUB A;  3JSC A;  4C5I A;  3SB2 A;  5KCH A;  4ZTF A;  5J3B A;  4EDU A;  3OYL A;  1VQ7 T;  3WVD B;  3OMC A;  4OB2 B;  4R56 A;  2MWO A;  4XQ3 A;  2XIC A;  3M9Q A;  1YBY A;  3QZ9 B;  2EJG A;  4JRK A;  4OMF B;  3RKY A;  2DKG A;  4C5G A;  3SFM A;  1QVF A;  3A5Z B;  3GIB A;  2FHD A;  5EG2 A;  4PKC C;  4M75 C;  5HK3 A;  2KVQ G;  2QTX A;  3S3N A;  1S72 A;  3QXE B;  2LCC A;  3TEE A;  2JN0 A;  3VJP A;  3LGL A;  2QI2 A;  3V8L A;  1U8R A;  5GAN 7;  5GAO r;  4N4I A;  3BFM A;  3P8D A;  2EIF A;  5GAN h;  1VQ4 T;  2LDM A;  2GQV A;  1QW1 A;  1BI3 A;  4OB3 B;  2HQE A;  4MZT A;  3LW5 E;  4NC6 A;  2HBP A;  3JCM P;  4KBM B;  1NPR A;  1QVG A;  1G3W A;  4E7H A;  5CR2 A;  2R5M A;  2O4X A;  2X4W A;  3MP1 A;  5LJ5 j;  1VQ8 T;  5FRO A;  2OTJ T;  4JRI A;  2D6F A;  4RCC A;  3CCQ T;  2DK3 A;  3NTH A;  5FU6 C;  4M7A G;  4AKI A;  1PSF A;  2PVG B;  3RUX A;  1I5L A;  5CKB A;  4OVA A;  4KUL A;  1UGS B;  5FU7 C;  1K73 U;  1UGR B;  4BI3 A;  5LJ5 g;  2DEQ A;  3JCM V;  3VUB A;  3JCM X;  1Q7Y C;  4LDW A;  3LX7 A;  1JBM A;  2QQB A;  1QVP A;  2BS3 A;  4MDW A;  4PJO E;  4A4K A;  3DKM A;  5LL6 S;  2BS2 A;  3UWN A;  2DZ9 A;  2K3X A;  4NL2 A;  3KBG A;  2K5L A;  4QVD A;  4RMO A;  2E5Q A;  3OS1 A;  2BS4 A;  2K4Y A;  4FT2 A;  3CME A;  4BDY A;  1XTD A;  4M7A F;  4LDU A;  3CC7 T;  5HY6 A;  5GAN 3;  3HB9 A;  4ME7 A;  3M58 A;  4FM4 B;  3HFO A;  1KQS S;  2MWP A;  5GMK i;  3I56 A;  2DD5 A;  2VXE A;  4XTU A;  3V7R A;  3J81 E;  4X9D A;  3QYB A;  1TH7 A;  3ZEH A;  3OW2 S;  3F70 A;  3OMG A;  4VUB A;  4C0D B;  3GNF B;  4WF2 A;  3HBL A;  4X34 A;  5M9O A;  4AKH A;  2RA2 A;  3GOX A;  3G6E T;  1MHN A;  2X4Y A;  4Y28 E;  3TCJ A;  3INZ A;  3JCM b;  4BE0 A;  3JB9 G;  2K5I A;  2LC4 A;  3J7A F;  4L59 A;  3JCM g;  4DQ2 A;  4CRI A;  2XI9 A;  4C8Q F;  2JTF A;  3DB4 A;  3TU4 K;  1VQ5 T;  2F69 A;  4BB7 A;  4M78 D;  1P92 A;  2XID A;  3CD6 T;  4JJN K;  3UDC A;  4OP0 A;  5LJ3 f;  4PJO C;  1G3T A;  2PVD B;  4MZM A;  3VV0 A;  2F5K A;  2QDY B;  2FL7 A;  1DJ7 B;  4M78 B;  2GFU A;  2G77 A;  2DTO A;  4HL4 A;  2RI5 A;  3PGG A;  4EMK C;  2E12 A;  2ZPI B;  3KUF A;  2ZZD A;  3SD4 A;  2AHJ B;  2Y90 A;  4NOY A;  4OF1 A;  3MP8 A;  4J6W A;  4J5Y A;  5AYF A;  3ME9 A;  3HRT A;  3VKI A;  5FLX E;  3JB9 I;  1AHJ B;  3PTA A;  2DAQ A;  2D9T A;  5J26 A;  3OYG A;  3QUI A;  5IN1 A;  2V8K A;  4JUV A;  2YRV A;  4C92 F;  1ZHI A;  1M1K C;  2A7Y A;  2FYK A;  4R55 A;  4QQG A;  3MP6 A;  3FEO A;  2RM4 A;  4IUP A;  3S3M A;  3EFS A;  5LJ3 e;  4RG2 A;  3MEV A;  2CZ1 B;  1LOJ A;  1N6A A;  2EJ9 A;  3ASK A;  3FB9 A;  4LD6 A;  5GMK j;  3LWI A;  1Q81 C;  4BBS M;  1RI0 A;  3CCL A;  3E19 A;  5KCO A;  3CCR T;  3WVE B;  2E65 A;  4KUI A;  1M1F A;  2RD1 A;  4O6J A;  4Q5W A;  5CIU A;  3I55 T;  1D3B A;  3CCJ T;  3OYC A;  3X20 B;  3P8B B;  4BDZ A;  4RKU E;  2P4T A;  3M57 A;  3HFN A;  3AHU A;  3CCM T;  1IZ6 A;  3E9G A;  5D6W A;  2XDB A;  2VGN A;  1OI1 A;  1FXX A;  2E1H A;  2EYQ A;  1W2B A;  3JB9 H;  5GAO n;  1M90 C;  1VQN A;  4M7A A;  3TW6 A;  2QQR A;  5LJ3 d;  2EWN A;  2GFA A;  1WJQ A;  3GF5 A;  3OBY A;  4BY6 B;  3URG A;  1N8R C;  3C4S A;  3CEY A;  3OSS C;  4L5G A;  5GAO m;  1KC8 C;  2QA4 T;  1VQ7 A;  3QYE A;  4M7D B;  2ZPH B;  4DOV A;  4X9C A;  2VGM A;  1K9M C;  2EKO A;  2HD0 A;  4QQD A;  3CXC A;  2WSC E;  2V8J A;  4MZP A;  4BAC A;  1M5Q 1;  2BUD A;  1Y96 B;  2QA4 A;  4M7A E;  5GAN 4;  3CCV T;  2VYT A;  4E7I A;  5GAN j;  3QHS A;  2LNV A;  4M77 F;  2X35 A;  4ELZ C;  1VQL T;  3QII A;  3G7Z A;  2R5A A;  4M78 G;  1YI2 T;  3C12 A;  4BBR M;  5GAO l;  4XAX B;  1X6O A;  2GCX A;  3CBM A;  3ER0 A;  3M55 A;  5CKD A;  1YHQ T;  5GAN g;  2VV5 A;  4ZGJ B;  4F7U B;  3VU3 C;  4C8Q D;  1VQ6 T;  4C8Q B;  2XDD A;  3NFC A;  1QP3 A;  1UEB A;  3CCE A;  4M78 F;  2RHI A;  3M4Y A;  2DIG A;  4MMK A;  3QO3 A;  3M56 A;  3G71 T;  2RHX A;  1QVF S;  2ZCF B;  4A4H A;  4LDY A;  1VQ8 A;  3A8O B;  3BG3 A;  3N5B B;  3PNW C;  2JOY A;  3CCQ A;  3DB3 A;  4BE1 A;  1Y7X A;  2L5Q A;  4HT9 A;  2CZ0 B;  2MAM A;  4NL3 A;  1B34 B;  5KH6 A;  2RO0 A;  4GLK A;  4O5V A;  4C0G A;  4C92 D;  3FLG A;  4MIM A;  3TW7 A;  4KUD K;  3JCM J;  4MDX A;  2L3R A;  2LT1 A;  2DIQ A;  2K2V A;  4C92 B;  4A4G A;  5CCA A;  2P0K A;  1QVG S;  2VXF A;  4ZGD B;  3CCU T;  3V8K A;  5I2S A;  3M53 A;  1YIJ T;  5GAM f;  2LVM A;  2RJE A;  2E41 A;  2G3R A;  1NPP A;  4JRP A;  5KE2 A;  1M4Z A;  4IUT A;  3QJY A;  4LDV A;  2EQM A;  5FU6 B;  5DLO A;  4B9W A;  5DM7 R;  4JLI A;  5FU7 B;  4N4G A;  3VKG A;  4ZGE B;  2PUK B;  3DLL A;  4V2S A;  2O01 E;  4M7D G;  1I8F A;  2LT4 A;  2KDS A;  3G6E A;  5GAM h;  3QG1 A;  3HRU A;  1KHC A;  5DY9 A;  1H3Z A;  3CCS T;  1LJO A;  2K57 A;  3OY9 A;  3LLR A;  3L2Q A;  1WJS A;  3OS0 A;  4JS4 A;  3CD6 A;  2QXF A;  2DTI A;  5GAO p;  4M7D F;  2JNG A;  3QKJ A;  2ZPE B;  1WQ7 A;  1BIB A;  2ZPB B;  2BKD N;  5GAM e;  4A4E A;  2EAY A;  1OYX A;  3H8Z A;  4F7U G;  1QP2 A;  1KHI A;  2QQS A;  2QQ9 A;  2WAC A;  2DVE A;  3MO8 A;  4E7J A;  2LTO A;  1IRE B;  2OTL A;  3MEA A;  4XTY A;  4C8Q G;  1UGQ B;  1Y07 A;  4M77 D;  5C6S A;  3OYJ A;  4IUQ A;  4HNT A;  3QPH A;  3CC4 A;  2KK4 A;  3MEU A;  4M77 B;  4M6V A;  4JX6 A;  4F7U F;  2P0P A;  5GAN 8;  3OBW A;  4M78 A;  4PJO B;  3ZBD A;  5HKC A;  5GAO q;  4Z6Y A;  5GAN 5;  2DXC B;  1Y71 A;  4EMH A;  1JJ2 S;  4ELJ A;  2QF7 A;  4XU0 A;  4EMK B;  5GAM d;  4IUV A;  1YJN T;  3EAE A;  4LD9 K;  3MCA B;  4XU3 A;  5A0L A;  1QLB A;  3CCR A;  2LQ8 A;  3PT9 A;  3I55 A;  4M75 F;  1K8A U;  4C92 G;  2DXB B;  1K73 C;  4QW2 A;  2YLB A;  4M78 E;  2DO3 A;  2RK1 A;  2YHT A;  3L42 A;  3LYI A;  3O8V A;  1UB4 A;  3BY7 A;  2LX9 A;  3CCM A;  1KD1 U;  2ZPF B;  2QQA A;  5LJ3 h;  1OZ2 A;  3OYM A;  1BIA A;  3JCM W;  2B8A A;  2WJ9 A;  4HT8 A;  2F5T X;  1Q82 U;  2DD4 B;  3CMA T;  3RER A;  4E7L A;  3OS5 A;  1VUB A;  2KQW A;  2ZPG B;  3M4G A;  4C0D C;  3VYG B;  4A54 A;  4FSX A;  4N0A A;  1I81 A;  1N9S A;  1G3S A;  2ZGW A;  3E9F A;  4HA8 A;  3OSV A;  4PNO A;  4OGE A;  1ZBX A;  2QFZ A;  3FJP A;  2H3J A;  4EMG A;  2CZ7 B;  3C95 A;  1MGQ A;  3OB9 A;  3P8H A;  1BI1 A;  3R6O A;  2EQJ A;  2D0Q B;  1VQM T;  1FX7 A;  4Z02 A;  1VQL A;  2L89 A;  4XK8 E;  3MHX A;  2E10 A;  4L6V 5;  5LJ5 e;  1KQ2 A;  3JB9 F;  4XTZ A;  3GPL A;  3X25 B;  1W2B S;  3VYH B;  4IUU A;  3I56 T;  1WGS A;  2JZ2 A;  2RHZ A;  1XNI A;  2QEX T;  1YHQ A;  2JUF A;  1NJI U;  2E6N A;  4LOC A;  1M8V A;  4M7D A;  1BYM A;  2CKK A;  2DJZ A;  4FU6 A;  3OYI A;  1K8A C;  1VQ6 A;  2DPP B;  3HL8 A;  2PU9 B;  3NTI A;  2KR6 A;  4M7D D;  3S6W A;  1Y96 A;  3SWN B;  1M9S A;  4M77 G;  1KD1 C;  3DL1 A;  3CXC S;  1VQK T;  1H64 1;  2X4J A;  3FDR A;  5CKE A;  2QDJ A;  1X75 C;  5D6X A;  4PJO G;  3PMI A;  4N4H A;  4J6Y A;  4B9X A;  2DZC A;  2MI6 A;  2RHY A;  5LJ5 d;  2FB7 A;  5CQY A;  3A8G B;  2M9U A;  4F7U A;  3HZJ A;  3L2W A;  5GMK m;  3JAM E;  4LDX A;  2OAU A;  4HNV A;  3JCM e;  2DTH A;  4XU1 A;  4C5H A;  4C8Q A;  2E64 A;  4J7F A;  2NLU A;  3H4C A;  4J6X A;  4NS5 A;  4PJO F;  3JCM Q;  1PSE A;  4JS5 A;  3QJ6 A;  5IT9 E;  4D6W A;  1YCY A;  1VQ4 A;  2RJC A;  1YIT T;  1O9S A;  4A4F A;  3BG5 A;  3QDR B;  1VQ9 T;  1RL2 A;  3OYY A;  3CCU A;  3S3O A;  2XDP A;  1OZ3 A;  2RJF A;  3OQ5 A;  3CBO A;  2PQW A;  4P5N A;  4F7U E;  3OYF A;  1YIJ A;  4JLG A;  3M59 A;  2KY9 A;  3ZFJ A;  1GXI E;  4M75 D;  4C8Q E;  1B34 A;  4C5E A;  2MMP A;  4BY6 C;  3RMS A;  4M75 B;  3CC2 T;  4MFE A;  2OTJ A;  1R8O B;  1LNX A;  3JCM d;  4C92 A;  3J80 E;  2WSE E;  3HP9 A;  2XU8 A;  4IKF A;  3EFR A;  4M7A C;  4OB0 B;  5D6Y A;  2HAX A;  3CCS A;  3BDU A;  3V7S A;  4E7K A;  3CPW A;  5GAN 2;  2Y4Y A;  2I2L A;  4QVC A;  2K5F A;  2R57 A;  3NTK A;  1X01 A;  5DLQ E;  4E47 A;  4C92 E;  4EPC A;  4DA4 A;  3JB9 J;  4ATO A;  2RI2 A;  3X26 B;  2LRQ A;  3CC7 A;  5GMK e;  2M0O A;  5CKH A;  4C0Z A;  4QQ6 A;  3WXM B;  2DXU A;  1VQP T;  5J39 A;  1Q7Y U;  3KHI A;  4C8Q C;  3JRZ A;  2GF7 A;  4BE2 A;  2CZ6 B;  1V29 B;  2C06 A;  5I2M A;  5GAN f;  4JDS A;  4UC4 A;  1VIE A;  3VUZ A;  2JTM A;  1UGP B;  1EIF A;  1YJ9 T;  3DLM A;  3LH0 A;  3UT1 A;  3H6Z A;  2E70 A;  1W4S A;  1VQ5 A;  1ZQ1 A;  2RJD A;  2K3Y A;  1YJN A;  3L2Z A;  3G4S T;  2M1H A;  1JB0 E;  1N9R A;  1YJW T;  4AKG A;  3BW1 A;  5LJ3 j;  3HPW A;  3GP8 A;  4BI8 B;  4C92 C;  4M77 A;  3CCE T;  2A3L A;  5CK9 A;  3RES A;  4BD3 A;  5IAY A;  3BG9 A;  2JVV A;  3RIR A;  5LJ3 g;  4PJO A;  3X24 B;  4XTW A;  5CVI A;  5GAN e;  2P0Q A;  4BUG A;  2EJF A;  2DXC A;  2RH2 A;  3CMA A;  1WNL A;  4EMK A;  3M5A A;  4RG8 A;  3M54 A;  1NE8 A;  4HCC A;  4PJO D;  2KSS A;  4M75 G;  2HQX A;  3OA6 A;  4M77 E;  3V8J A;  2O4X B;  4II1 A;  3OYB A;  1S72 T;  2DXB A;  2RK2 A;  4ZN3 A;  2EQK A;  2XD0 A;  4HCZ A;  4JX4 A;  1JRI A;  1N27 A;  3V7C A;  1U1T A;  5A2Q E;  4JX5 A;  2CYZ B;  1BI0 A;  4JRQ A;  4BI4 A;  4AI6 A;  3C94 A;  5CO7 A;  4C0F A;  5C0M A;  5L8R E;  4FT4 A;  1VQM A;  1Q86 U;  3CCJ A;  1M1K U;  2DD4 A;  4XTX A;  2CGH A;  3A8H B;  3TRE A;  3GLX A;  5GAN d;  2M16 A;  3HRS A;  4MFD A;  3HO8 A;  2XG8 D;  2PUO B;  1M1G A;  3VYG A;  2EQU A;  5LJ5 f;  2QEX A;  3RMQ A;  3L2R A;  4MML A;  4CI0 C;  1Q81 U;  1KQS A;  2XKO C;  3OW2 A;  1E7P A;  2KAF A;  3HSB A;  3PMT A;  2MF2 A;  3L1A A;  5CKF A;  1VQK A;  2DD5 B;  4M77 C;  3QYG B;  2PVO B;  4QVZ A;  5LJ5 h;  5GAN 6;  1XOV A;  1VQO A;  1HXD A;  4PLL A;  2FVU A;  4GY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...