1UGRB

Crystal structure of at109s mutant of co-type nitrile hydratase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile Hydratase alpha subunit
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 65
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugrB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugrB02
4KT0E 2CZ1B 2ZZDB 3A8GB 2PUKB 2CZ7B 3LW5E 1QP2A 4OB3B 2DD5A 2AHJB 1PSFA 5L8RE 3WVDB 3QZ5B 2PUOB 1UGPB 3VYGA 3A8MB 2WSFE 3X24B 2DD4A 4L6V5 4OB2B 3VYHB 2CZ6B 2DXBB 2DPPB 1PSEA 1UGSB 2DD4B 3HHTB 2ZCFB 2ZPEB 3QXEB 1IREB 3X20B 1JB0E 3A8HB 3X25B 1UGQB 3X26B 1UGRB 2DD5B 2PVOB 3QYHB 4OB0B 3VYGB 3QZ9B 2O01E 2ZPBB 3A8OB 2D0QB 4ZGEB 2DXCA 4FM4B 2CZ0B 2ZPHB 1V29B 4ZGJB 2DXCB 2PU9B 1QP3A 2WSEE 2ZPIB 4OB1B 1GXIE 2PVDB 3QYGB 3X28B 4XK8E 4RKUE 4ZGDB 1AHJB 2WSCE 3WVEB 2DXBA 3A8LB 2ZPGB 2PVGB 1DJ7B 2QDYB 4Y28E 2ZZDA 2CYZB 2ZPFB
chains in the Genus database with same CATH superfamily
1B34B 3KHIA 1N8RR 2UZBB 4FIBA 1GY3B 1OGUB 1W4SA 4J6YA 1K8AR 2W99A 1QVGS 1AISB 4EIKA 2EPDA 2RJFA 1ZA2B 5I2SA 1FX7A 1FXXA 2WACA 3EHRA 4OB2B 2HD0A 2MCNA 4DOWA 3CPWA 3PVLA 2QFZA 2JM9A 1AWXA 2GCXA 4PJNA 4N4HA 1OL2B 3CCRQ 4AFQC 3DOGB 4MDXA 1BU2A 3RR6A 4M7AE 2YXYA 3DDQB 1WXBA 4LDYA 2LP5A 1YITT 2YHTA 1YITA 4B9XA 8AT1B 1S1NA 3OYNA 1W70A 1R77A 4WF2A 5I22A 4HT8A 2C5OB 2E3HA 2KXCA 1E7PA 3QZ9B 3CC2T 4RTVA 3CC2A 2ENMA 3POMA 4LUDA 1O75A 4JDSA 2D6FA 1UG1A 2F1LA 2WFYB 4M7AD 4LOCA 2CH4A 3C95A 3OS1A 2UZEB 2C0OA 1KC8U 3D7SB 3FRNA 4LD6A 2PHGA 4BY6C 2W96A 2CZ0B 3CXCA 3CC7Q 1LVKA 3EGXB 4FW2A 4N4IA 2FB7A 3I56T 3I56A 4JRIA 1GFDA 1H25B 1YHQQ 2R7GA 1KG1A 1H28B 3RGFB 1NLOC 2DL3A 5D6WA 4J83A 2YRDA 4KUIA 4RTXA 4C92G 3OYGA 1V76A 2YLBA 1FMKA 3QSUA 2GFUA 4LDXA 1KXUA 3CC4Q 2NWMA 1PRMC 1G3SA 1AZEA 1AHJB 4GY5A 4JS4A 3A8LB 2I53A 2HQHA 4Y28E 3VRYA 3VS0A 2QQ8A 1IRXA 2ZZDA 1M8MA 2BTTA 4KRCB 2E70A 2DBMA 5KE3A 4OR5B 2QDJA 3RKWA 4BCGB 2YUPA 1Q95G 3EGDA 5GAN7 1TSFA 3M59A 4OB3B 3CCVQ 4BCQB 1F5QB 2AZVA 2YWWA 4M7AF 4MZMA 2EW3A 1H3HA 2X1NB 2LJ3A 2WIPB 4F7UA 5IT9E 3NMZC 3GOXA 3FIFA 4OMPA 3PIOA 2L3PA 3IQLA 2EJFA 5CVIA 2CZ6B 2DZCA 3PNWC 2RNAA 4J7FA 2IW6B 4A53A 2DIGA 4HNVA 1WDXA 3M57A 2DTHA 1FMWA 3KBGA 2F2VA 1W2BP 3EG0A 2FO0A 2YSQA 2CCHB 2R5MA 4MIMA 4EOQB 3X26B 2IN3A 1K1ZA 1Z9QA 3BFMA 1BIBA 3FDRA 4CC7A 3MEWA 1SF9A 4EMKC 4BBSM 3M0UA 1JXOA 2RF0A 2ZPBB 1H26B 2DEQA 2KYBA 3HKSA 4FYWB 4ZTJA 2EQUA 5HK3A 2DE0X 4II1A 2SRCA 5ACBA 2JTEA 4ROEA 2LQ8A 2FZGB 3UF4A 4E47A 2A28A 1VQ6T 1VQ6A 1KHIA 2A0FB 4RTTA 2QASA 2IVXA 2DTOA 2L5QA 4EOKB 2O9VA 4JZ4A 4BI4A 1KD1C 3JCMV 1N5ZA 2E6ZA 4JJNK 2LQKA 1JJ2A 2V1RA 5GMKi 1NEGA 1NG2A 5M9OA 1N27A 4M7DE 3QYGB 4QVCA 3S3NA 4JX6A 3TQ7P 2GQVA 1ZX6A 2ABLA 1U1SA 2QG9B 5AYFA 2DL5A 4PJMA 2Y90A 2A7YA 4J9DA 3OYKA 4NC6A 1UNHD 5J39A 1LCKA 4J6XA 1QLYA 2QA4T 1OV3A 2QA4A 5FRNA 3MY1B 1G3TA 4TTHA 4BE2A 1M90U 2VUBA 2K5LA 2LT1A 3CPWS 5GAOq 4CFWB 2KXDA 3HRSA 1W6XA 3EG3A 4V2SA 2H8HA 2DJZA 4N0AC 3HRUA 2FEIA 3PTAA 2DIQA 3H41A 4L6V5 3H4CA 2EGCA 2NYSA 4OGCA 1H1PB 1R8OB 4EMKA 3MJXA 1VQKT 2ECZA 3EH2A 2EKHA 2ZCFB 1VQKA 3OYHA 1D1AA 1Q81U 1RADB 4CFMB 3A8HB 2QEXT 4M78B 2QEXA 1K9AA 3LGLA 5FW9A 2JOYA 2CP2A 4O5VA 1ABQA 5BNJB 4JUVA 2M51A 1BI1A 5GANe 5I2MA 5FGKB 4WTOB 3M4GA 1TD6A 2RK1A 1RUWA 1B7TA 3E19A 1UE9A 2M0YA 2XHCA 3RMQA 2PK2A 5HNBB 1VQPQ 1Q7YU 4OMLA 4KULA 4QVZA 2RA2A 2QDLA 4JX4A 4EC8B 2RB6A 4HKEA 4C5GA 1GFCA 1BI0A 1QCNA 4YTLA 3A98A 2MWPA 2CP7A 1OU9A 3TNWB 4X34A 1VQOT 1VQOA 3EFOA 4M75B 3M5AA 2HCKA 2CP6A 3I5RA 2RI5A 4BCMB 2A36A 2SEMA 1I8FA 4NOYA 1BU1A 2X9HA 1VQ8T 1VQ8A 3REBB 5HBHB 1BIAA 2VVKA 3SWNB 1BBZA 4JJDA 4E7LA 2Y4YA 3VKGA 5LJ5f 3LW5E 2ATCB 2LCSA 4F7NB 1KD1R 5IDNB 1ZUUA 2VV5A 1YCSB 5DM7R 3QZ5B 1WPYA 3A8MB 4OMMA 2GF7A 1NLPC 3GNFB 2JZ2A 4RTYA 2PZ1A 4EC9B 1YIJT 5FU7B 1YIJA 4J9FA 1VQLQ 3FJPA 5C0MA 3M54A 1WGSA 1H3ZA 1Y57A 2OTLT 2EKOA 4R0KA 2OTLA 4PLIA 3G7ZA 2M1HA 3UPUA 4Z89A 1SHFA 1OKVB 1R0CB 2D8JA 2V1QA 2I2LA 4QQDA 2X3WD 5FU6B 4JX5A 1Y7XA 2F5TX 1PM3A 1WYXA 3OW2P 2X3XD 2DD5B 2DF6A 1M1GA 4FSSA 1M1KU 4LXCA 1TWBA 2XDDA 1X69A 1K73C 1D0ZA 2GNCA 2K79A 2XKOC 4CRLB 2HZYA 4C92C 3L2RA 5HVYB 2KK4A 4M4ZA 1U06A 3JB9H 2L8DA 4QQGA 4BUGA 2V26A 4JJCA 1TH7A 1T3SA 2K3XA 5LJ5d 4MFDA 5LQFB 7AT1B 3TW6A 2VXEA 1JJ2S 3H0IA 3NFCA 4RCCA 3V8KA 2LX9A 2JUFA 4ELYC 4FX3B 1Y96B 2WSEE 1TUDA 2CUDA 3PMTA 4LE9A 2RQVA 4DEXA 3QKJA 1R0BG 2HBWA 2DTIA 3PFSA 1X6GA 2O2OA 4PJOC 4BY7X 2IIMA 4CI0C 3CCQQ 5CR2A 1IHWA 4XK8E 4M7DA 1VQMT 1VQMA 1YBYA 1RI0A 2PQWA 2FRYA 2GQIA 3J7AF 2EJ9A 2BS3A 3VRZA 3O0GD 2QXFA 1MNEA 3ZFJA 3H9NA 1YJ9T 3QDRB 2L89A 1YJ9A 2W10A 1OX8A 3VU3C 2ZZDB 4XU0A 3OSSC 5L23A 2GTOA 1X43A 4Z88A 5FLXE 4E7SA 2OTJQ 1G3YA 4JRPA 2LVMA 5GAOm 1UB4A 2ZAEA 1I5LA 3MIAB 3EGDB 2EQMA 4YOZA 3OYFA 2FRWA 3H6ZA 2MF2A 5CKDA 1UHFA 2JTMA 2BKDN 2E5KA 1WHJA 4DQ2A 2C6TB 4FYYB 4M7AG 3VYHB 2RMOA 3BLRB 1EX4A 4MZPA 1WJRA 3MHXA 4Z6YA 1IZ6A 2WJ9A 2DNUA 5J3BA 3CD6Q 2NUPA 1PKDB 2X4JA 4AFSC 1GUXA 2YUNA 4C92A 1T0HA 1VQ7Q 2DRMA 1URCB 4PNOA 4DEYA 3V8JA 5LJ3g 1GCQA 2DZ9A 3G4ST 3G4SA 3GF5A 4OB0B 4OGRB 3VYGB 1C0MA 4Y72B 4RTZA 3J81E 4AT1B 2E41A 3JCMJ 2RN8A 4CFVB 2CSIA 3EHQA 2D0QB 3G6EQ 5ECAA 5DY9A 1M3AA 3RKYA 4PJOA 3FEOA 1Q86U 4JLIA 2DVEA 3LYIA 4FU6A 3JB9I 5GAOl 1ZP2A 4DOVA 5LJ5j 4B6MA 2LDMA 4PL6A 1BCOA 3DB4A 1VQ4Q 4M77E 4CC2A 1AWWA 1EFNA 4F16A 1K73R 4DBRA 4BXXX 3EH1A 2JJ9A 3X28B 3GLXA 1KIKA 5A0LA 1N4MA 1ZHIA 3DJBA 4M6VA 3INZA 5KCOA 3PT9A 4XU1A 3OBWA 4RCBA 3Q1JA 1IGUA 2KI7A 2CH4W 1W98B 2MYSA 4ZN3A 3SD4A 3CCST 3QWXX 3CCSA 4AMCA 2DFUA 2EQIA 2FPEA 3JCMg 1Y0MA 3MEVA 5GJWB 4BCOB 2FYKA 2AHJB 2LJ1A 3I55Q 4EONB 1E6GA 3JCMc 3FB9A 4OP0A 4J9HA 3M56A 2O4XA 2CT4A 1GBQA 2X4WA 4X9CA 5CYIB 1K4US 1YJWQ 1J3TA 2CUBA 1WNLA 2DD4A 2L0AA 3C94A 1MUZA 4F7UF 4LD9K 2KBTA 3DLMA 2AKKA 2JMAA 5CKHA 1W2BA 2DPPB 3I35A 4A4EA 3JCMP 1QQJA 2WMAB 5KYXB 2QQRA 2IG0A 5EC7A 2JM8A 3REAB 2P84A 3FC3A 2RJEA 1I1JA 3VV0A 1VIEA 2BZXA 2B8AA 2BZYA 2DXTA 2JTFA 3JCMb 4M7AB 5KYWA 1OIYB 1E6HA 2EJGA 1KJWA 3LWHA 1OYXA 3QHRB 2BIVA 3HL8A 4ELZC 1LJOA 2RI3A 2XU8A 1YN8A 1Y07A 3EOCB 1RABB 4EMGA 3DTOA 2MMPA 1NPPA 3NHNA 5IN1A 2RQRA 3DB3A 3R6OA 5FWBA 3PIPA 2DXCA 4FT2A 3ZL7C 3PE0A 3TNHB 1X6OA 1H8KA 2AZSA 3OYAA 1VQNT 1VQNA 5IXBA 2RH2A 2KMTA 1WXUA 1B3QA 3JB9F 2JS2A 4GLMA 3LX7A 2CKKA 2PK9B 1UNLD 1WJQA 1PNJA 3MEAA 4PFOA 3RKXA 3OYMA 4EOIB 1K9MC 4HT9A 3UT1A 1ZSGA 4X1VA 2WSCE 3OMCA 2EGAA 2RM4A 3M55A 3ZBDA 3HFNA 4C8QC 1H27B 3HTRA 4DBHA 3NPFA 1XNIA 1BI2A 2RHYA 4M77C 2BPMB 3CCLT 4IUVA 1OI9B 4JS5A 3CCLA 2C5VB 2E12A 2EAYA 2MK5A 2J6FA 1PSFA 3EG9B 2VXFA 5DQVA 1XTDA 5GAMg 4J5YA 4IMYB 3QYBA 3TREA 3NTKA 1K0SA 5IF1B 3BHTB 2DETA 4L5GA 2YT6A 1N8RU 2F69A 1YJNT 5LJ3h 1YJNA 1ZBJA 1M27C 3DL1A 1K8AU 3H0HA 1RAFB 1OU8A 3BDLA 5CIUA 1CKAA 4AKIA 3NDQA 2WXVB 3L2ZA 3CMEQ 4N4GA 1ZUYA 5D6XA 2NUTA 1JB0E 4XAXB 5GAN8 1Q82C 2BE7D 1D1CA 2LX7A 2MPXC 4E7JA 1ZSZB 2CT3A 2MIOA 1VIFA 2G6FX 4HCKA 3QYHB 4HCZA 3ME9A 4M78G 1ZLMA 1UEBA 3R6NA 2CP0A 3A8OB 3HFOA 4G6LB 3BG3A 3CBMA 2DILA 2CJMB 2DRKA 2I0NA 2DA9A 2V22B 4XTWA 1MMDA 2WMBB 2BUDA 2C0TA 3BW1A 3VS4A 1YWOA 1OPKA 3TW7A 1U3OA 2ED1A 2PU9B 1AOJA 4F6SB 1S72Q 4BDYA 1NPRA 5CEIB 2VYTA 4HCBA 4C8QA 5L2WB 5GANh 2FL7A 4A63B 3CCET 3CCEA 3S6WA 4BBRM 3CCUT 4M77A 3E1SA 3CCUA 4FCYA 2COZA 2QQBA 4PJJA 1N9RA 3C12A 1JOWA 3JCMh 2QQ9A 4AI6A 3C0CA 3BDUA 2XD0A 2DXBA 2JMCA 2L3QA 3MP8A 4RG2A 1CSKA 1OOTA 4C0DB 1DJ7B 4M7DB 3CCJQ 1OX9A 5A0DA 1YP5A 1A0NB 1HYOA 4M75G 1YI2Q 1NM7A 2XI9A 1VQ5T 3QO3A 1I4K1 2CZ1B 1VQ5A 2KQWA 3MCAB 3BHUB 1SRMA 2H3EB 4PFPA 3CMAQ 1QW1A 1UGPB 1VYUA 3QIIA 1W2BS 1E9HB 2HEQA 4QSHA 1K9MR 2EGEA 2J7IA 3M53A 3X24B 1O9KA 2BZ8A 2K2VA 3EAEA 1ABOA 4LN2A 3BY7A 2RK2A 3RNJA 1NZ9A 3RBBB 1WI7A 3VUBA 4ANJA 3SB2A 3TU4K 1AT1B 3M0PA 5LJ3e 4M7DD 1NJIC 1WXTA 1EIFA 2RO0A 2ZGWA 2AK5A 2LNHB 5GANj 3OW2A 4JRKA 5CKBA 2C4GB 2RHIA 4J9CA 3BG5A 3HBLA 4EOPB 4X9DA 3L2WA 1X75C 2KYMA 4BCJB 4CC4B 4BI8B 5FROA 4ZNXA 3TEEA 4C92E 3M0TA 2R57A 2OAWA 1RAHB 2FZCB 3CCRT 2LQWA 2HL3A 3G33B 3CPFA 3CCRA 1VQ9Q 4FYXB 4UN0A 1ZUKA 1SEMA 1G2BA 2PNIA 4OMNA 1Q82R 1ARKA 1M2VB 4KH1B 1OKWB 3V7RA 2MAMA 2RD1A 4RTUA 4CXAB 3CEYA 4MFEA 4D6WA 4C92D 2ROTA 2GFAA 2HMAA 1V1CA 1GXIE 1VA7A 3EIDB 2VWFA 4PJOE 3DLLA 5GAN3 2ZPGB 4M7DF 4HXJA 2KRMA 3PO3S 3JCMe 5GAMh 3OMGA 2EBPA 3J80E 2LNVA 3CC7T 5KCHA 2QYZA 3CC7A 5KYUA 1G8XA 1M1KR 2VB6A 4Y91A 4DBQA 1NE8A 2FVUA 4PJOD 3T9NA 3TSZA 2ESWA 2PTKA 1QVPA 1X2KA 3GPLA 3WVDB 4OMOA 2WHBB 4HCCA 1M3BA 2COWA 3RIRA 3CC4T 2LW4A 3CC4A 1E7OA 2DMOA 3QJYA 5FWCA 2OAUA 1CKBA 3NTHA 4N0AA 5IXFA 2DD4B 3E2UA 3EGXA 2RHUA 3EGUA 4F7UG 3UA6A 4F6WB 1SRLA 2KSSA 5CQYA 1TXQA 4C92F 1XOVA 4IUUA 3M0SA 1F1BB 1UGQB 2V8KA 3LGFA 1I5OB 3CCVT 1K0XA 3E9GA 3CCVA 4JLGA 3OA6A 4IKFA 5GAOn 3CCMQ 2W9FA 1KQ1A 4KUDK 4F70B 2LJ0A 5KE2A 2RJCA 2KRSA 2HAXA 1OQKA 1KQSP 2RQWA 2C0IA 3HO8A 4BDZA 4Z02A 1NJIR 1V29B 4PJOF 2DXCB 1TG0A 2KMGA 2P4RA 4MZTA 3VKIA 1KK7A 2V8JA 4FSXA 1YNZA 4OVAA 3P8HA 1PCXA 4VUBA 4OMQA 4XTVA 5GMKe 1AEYA 4AKGA 4C0GA 3VS5A 4BE1A 1YCYA 3JB9G 2HKNA 4ZGDB 3WVEB 4MMKA 4F04B 3V8LA 1AVZC 5IH2A 1QCOA 2AIRB 3U23A 2LT4A 4KGVB 3OSVA 1TUCA 4QW2A 4J9EA 2E6NA 3RESA 1YITQ 3EG2A 4BI3A 5GAMe 4CFNB 1N9SA 2CZ7B 2BS2A 1TFBA 2XG8D 5CKEA 4ELLA 2JXBA 3CC2Q 2YRVA 1BCMA 3QHSA 1M9SA 1Q86R 1T0JA 4HVVA 4PFZA 3RDVA 1M5Q1 3TN8B 3JAME 1VYWB 3M03A 3GTMS 1IHVA 2DK3A 2R5AA 4OMFB 4D8KA 1JQQA 3OW2S 3MKDA 4LDVA 4HLQA 4DA4A 3LH5A 3OS5A 1HD3A 1KD1U 4M78C 1RAAB 1MGQA 4YOSA 2ED0A 4LNPA 1LNXA 2KE9A 2ZPEB 2QQAA 2D9TA 3I56Q 2LC4A 2X4YA 3X20B 2NLUA 4F6UB 1OL1B 2DO3A 3X25B 2K57A 2PVOB 3A1PA 2BKZB 1SKUB 2DVJA 2WPAB 2CCIB 1WHMA 1RLQC 2QI2A 4F7UB 1PHTA 2YUOA 8ATCB 2HSEB 3LWIA 4MMLA 2M16A 4ZGEB 5LMKB 1D0XA 1B07A 3F5XB 5GAOp 1W1FA 4BCHB 2DKGA 2HSPA 4C0ZA 1YJNQ 2CP5A 2P4TA 1Y71A 1C9BA 5CO7A 2E4HA 2COYA 4GLKA 1WA7A 2P0KA 4HNUA 2VKNA 3RERA 1BYMA 4FW1A 3SDZA 4A4GA 2LZ6B 4BY6B 3AT1B 4M75C 2XIDA 4JPBW 3OYYA 3MP6A 1SSHA 3LH0A 2G3RA 3BHVB 2UZLB 4QKUA 1D3BA 3I5SA 4JZ3A 3SHWA 3OQ5A 2EYYA 3SWNC 4M77B 3N5BB 3QUIA 4C5HA 5GAN2 2KR3A 1WLPB 2PVGB 2PJQA 4RG8A 3PVQA 2KT8A 2M9UA 1PD1A 2G77A 1M3CA 4C8QE 4IURA 3HP9A 4EMHA 1NYGA 2O31A 3A8GB 2DXUA 5FU7C 2IPOB 2E64A 1VQPT 1VQPA 5L8RE 2VC8A 2PUOB 2E1HA 2XDPA 1TS9A 2HDAA 1RL2A 2YLCA 3UWNA 3CQTA 4CC3A 5GJVB 2X51A 4C8QD 5IHKA 3OB9A 1UJYA 3L2VA 2KY9A 3OYIA 1BB9A 1QVGP 1UUEA 2W9ZA 4M77D 4OF1A 5FU6C 1VOMA 2B86A 2EYQA 5EG2A 1WIEA 3RMSA 2DERA 2EYZA 1PWTA 1VQ6Q 3OYBA 1KC8R 4RMOA 4KGZB 2XDBA 5IHIA 3OYDA 4I3ZB 2KEAA 5CCAA 2H3JA 4MDWA 9ATCB 3HRTA 4BY1X 1UGRB 4ROCA 1Z9ZA 3OBYA 5LJ3f 2QQSA 4IIMA 2O01E 6AT1B 2A3LA 4XU2A 4HNTA 2FHDA 1VQLT 2KVQG 4CFXB 2OI3A 3OYCA 4M75A 1M90C 3UA7A 1VQLA 1H641 2RQUA 4IUTA 4EMKB 1D3UB 1X6BA 2C5XB 1MMAA 1I81A 1FVVB 3QHWB 1JSUB 1HK9A 4EOMB 2E65A 3SWNA 1KSWA 4E7HA 1ZBXA 2KAFA 2LRQA 3M4YA 4RTWA 1H1SB 2QA4Q 1IGQA 1U1TA 3URGA 5DLQE 1G5VA 1RAIB 1G3WA 2XMFA 2DAQA 1QLBA 4C8QF 2EYXA 2R58A 1GH6B 4C5EA 1FYNA 1Q81C 4M77F 1QKWA 1JXMA 4PKCC 3G71T 4RUGA 3G71A 3DKMA 4XTXA 3TSWA 4Z8AA 1VQKQ 3M58A 5GANf 4M7DG 5J26A 4AG2C 5LJ3d 1K73U 3QWLA 1M30A 3HB9A 1P92A 5KYUB 1QP2A 1PKTA 2QEXQ 1UECA 3JCMf 5GAN6 2DD5A 3MP1A 2MI6A 3L42A 1JO8A 2CSQA 2MOXA 5DQWA 2DL7A 3O5ZA 4ELJA 3OYEA 2C06A 3CCQT 3CCQA 3MPUB 3EFRA 4KGXB 1TOVA 1D1BA 4FT4A 1Q7YC 3META 3EFOB 3CBPA 1AWOA 4LDWA 4C5IA 1ZA1B 3BE3A 4ZN1A 1AWJA 1OI1A 2J6OA 2K5FA 1UHCA 2QAZA 2RHXA 4Q5WA 3VS2A 5EJCA 1Y96A 2DBKA 4PLLA 1QVFP 1BK2A 4CRIA 3ER0A 2OTJT 2J05A 2RJDA 1AZGB 2OTJA 4IUPA 2UZDB 1U5SA 4K11A 1XO2A 3QDFA 3BLHB 5DLOA 5HQ0B 1VQOQ 5GANd 3K7AM 2YRCA 3C4SA 4E7IA 1TTHB 2E10A 2YDLA 3S3MA 3SFMA 5FRMA 3CD6T 4BE0A 1M4ZA 3CD6A 1VQ8Q 5I5ZB 4ZGJB 1PRLC 3JCMd 2E3IA 1VQ7T 1VQ7A 4C0FA 3OS0A 2EFIA 3MO8A 2CGHA 4EPCA 4PJOG 1OEBA 5HK0A 3EFSA 2FG0A 2MWOA 3M0RA 2HQXA 1YIJQ 1YWPA 3FLGA 1M90R 3G6ET 2OTLQ 3G6EA 4CFUB 2K4YA 3DDPB 1QVFS 1C6VX 1M1KC 1HJDA 3B57A 1TUGB 1LOJA 2HNIA 4BCFB 4IIOA 1X01A 4J9GA 1KHCA 1JKWA 5CKFA 2EIFA 4J9IA 4NSTB 2OJ2A 3G1JA 5CK9A 5HBEB 5CQXA 2PUKB 1G83A 2QK0A 5LJ3j 1VQ4T 1VQ4A 1FKMA 1I07A 3VYGA 2K6DA 4FL6A 2WSFE 1X2QA 1Q81R 3KXTA 5GAMf 3QWYA 1H92A 2KNBB 4BCQD 1NEBA 4XTUA 1QCFA 1MMNA 2IVWA 5KYYA 1PSEA 4M7AC 1EZZB 4J6WA 3QBYA 3CPWP 4CFUD 1H24B 1JEGA 3OYLA 3LQ5B 2O88A 4BCKB 2E5QA 2FPDA 3QG1A 2QGSA 4BCNB 3UDCA 5HKCA 3FJ5A 2RI2A 1GBRA 3I55T 1XJWB 3I55A 1UTIA 2QGFB 4P5NA 2QTXA 1VQMQ 1YJWT 4BCPB 1Q7YR 1YJWA 2RQTA 1KQSA 3QJ6A 2LCLA 2VASA 1K76A 2WIHB 3JCMQ 4ESRA 4XTZA 4FM4B 4KBMB 2L3RA 2NUPB 4HVUA 2CDTA 4ME7A 3WXMB 1YJ9Q 1IO6A 1GUXB 4C92B 3CXCP 2F2XA 2V8IA 1G3NC 5I21A 4XU3A 2IW8B 2B9RA 4EOJB 5GAMd 5GAOr 1OZ3A 2K3BA 1QMZB 4BCND 1OIUB 2M0OA 4JRQA 1M1FA 3M0QA 1UNGD 5GMKm 2DL4A 2PVDB 3VUZA 2XICA 3KFVA 3AHUA 4EDUA 1B34A 1D3BB 3I9QA 3JCMX 1MV3A 5AT1B 4HVWA 4PJOB 5GMKh 5KYXA 3A5ZB 4KT0E 4A4FA 2KR6A 3JB9J 4ZTFA 2JVVA 4NS5A 5KH6A 5LJ5g 3MI9B 5IHYA 3L2UA 2K2MA 4M7AA 1Q86C 1MV0B 3G4SQ 4PK4A 2CP3A 4YOOA 1LPLA 1P5EB 5KYNA 4OGEA 1VUBA 3JSCA 5HY6A 5A0GA 2LMJA 4JJBA 1VINA 4KRDB 4KH0B 1RACB 4KRTA 2VGNA 2I40B 3CXCS 1H4LD 4E7KA 2EYWA 2D1XA 1ZSZC 2KGTA 2KRNA 4WCIA 1RI9A 1YHQT 3HPWA 4M78E 1YHQA 1IREB 4A4HA 1K9MU 1SPKA 1MHNA 1OZ2A 5GMKl 3GIBA 2WEVB 2Y4XA 1QWEA 3ULRB 2G9XB 1GRIA 4R55A 1JRIA 2A37A 2O4XB 5I11A 3JV3A 4M78D 2GTJA 2K3YA 5IDPB 3HZJA 2GBQA 2OX7A 5GMKj 2LTOA 4A4KA 4F14A 4YC3B 2EQJA 1OPLA 1QMCA 3GP8A 3V7CA 3JCMW 4BCIB 4EOLB 4QVDA 3CCSQ 3CMET 3P8DA 3CMEA 3BG9A 1WHKA 4XTYA 4FYVB 1H1QB 1FWZA 3VS1A 4F7SB 4GBQA 5KYWB 3EG9A 5D7UA 3L1AA 4UC4A 1JU5C 2HKQB 3JRZA 4C0DC 4M7DC 3F70A 4HL4A 4M75E 3OY9A 4OB1B 5GAMj 3OYJA 2F2CA 1H1RB 1JJ2P 4TVRA 2D0NA 1M2OA 4RKUE 4J9BA 1RAEB 4C8QG 5GAN4 1GL5A 2K7AA 1Q82U 4F7JB 1PKSA 4M77G 3ASKA 2ZPFB 3MEUA 1IB8A 2DEUA 4M75D 4AG1C 1S72T 3TVTA 1S72A 2EWNA 1WX6A 4BCMD 2VGMA 4HA8A 3UATA 1WHLA 1ZSZA 2HQEA 3TCJA 2DYIA 1QWFA 1AD6A 2K5IA 1MNDA 4E6RA 1HSQA 4M78F 3VKHA 2EUFA 4DBFA 1QVGA 1I0CA 1KQ2A 1HXDA 1NYFA 2HBPA 4A54A 2CS7A 3RUXA 3O8VA 1UGSB 4B9WA 3S3OA 3G71Q 3CCJT 3CCJA 3HHTB 2F5KA 1KC8C 1YI2T 1VQNQ 3QXEB 1YI2A 4EOSB 2L3SA 1GCQC 3QPHA 2F2WA 1KQSS 3EJ1B 3CBOA 2BE9B 4QQ6A 3CMAT 3CMAA 2X4XA 3E9FA 5A2QE 1RLPC 1SG5A 1TU0B 2JGZB 2LQNA 4J7IA 2UUEB 4IUQA 2EQKA 1FMVA 4F17A 2GGRA 4BACA 4M75F 2EVRA 1UJ0A 3P8BB 3GBQA 4AKHA 2HL5C 1N8RC 1MMGA 3CCLQ 1QP3A 2JN0A 2NUTB 2P0PA 1WQWA 1BI3A 4NL2A 5IAYA 1K8AC 1WZOA 4BB7A 3V7SA 4ATOA 4LUEA 2LCCA 2ZPIB 3VS6A 5LJ5h 1JBMA 1NJIU 4D8DA 5GAN5 5EFQB 2BS4A 2FPFA 1FINB 2QTVA 2KT1A 1WFWA 4AFUC 4XQ3A 2CYZB 1JSTB 4PJLA 2W2HA 1VQ9T 4F7LB 1YFNA 1VQ9A 3QYEA 3H0FA 2RPNA 5IHNA 1IXDA 1UDLA 2FZKB 4QT7A 2PMIB 2W0ZA 1D0YA 4R56A 1U8RA 4C8QB 3NGPA 1T3LA 3SEMA 1KFZA 4AFZC 5ICPB 5D6YA 1NBEB 4F7UE 2M02A 2K9GA 2KDSA 3MY5B 4Y92A 1RAGB 3BLQB 2DMEA 3THKA 4EORB 2YUQA 2DXBB 4II5B 1UGVA 2A08A 3VS3A 1AD5A 1QKXA 3PGGA 1OULA 5HCKA 2D8HA 2ROLA 2JT4A 1QVFA 5LL6S 5KYYB 4M78A 2IW9B 1M2VA 3KUFA 1WHHA 2O9SA 4EOOB 4J8OA 3CCEQ 2JNGA 3H8ZA 3CCUQ 1D09B 1C1AA 2C5NB 1M8VA 2CREA 2QF7A 3TNIB 3VS7A 1WHGA 1O9KB 1SHGA 5CAIA 4RODA 1PD0A 1ENWA 1O9SA 3M9QA 1UFFA 1GCPA 1X27A 2DX1A 2QGGA 4E7ZA 3LLRA 2XK0A 2DYBA 1WJSA 3PMIA 2ZPHB 5C6SA 4NL3A 1VQ5Q 1ACMB 1PC0A 1VYVA 4L59A 3L2QA 5GANg 1VOLA 1ZQ1A 2DL8A 2P0QA 1SSFA 3GNGA 2RHZA 4ORZA 1VYTA 3HSBA 2DJQA 4LDUA 2DM1A 2DLPA 2KROA 2Z0WA 1PG5B 2JW4A 1XQHA 2NUZA 2AT1B 3VJPA 4E2FB 3CCMT 4O6JA 3CCMA 2X35A 3EG1A 1N6AA 1BKBA 2AKLA 4BD3A 3JB9D 5LJ5e 1WQ7A 3ZEHA 5HBJB 2QDYB 3OS2A 2J06A 3NTIA 2J6KA 2L2PA 2JS0A
chains in the Genus database with same CATH topology
3CC7A 1B34B 3KHIA 3QDRB 2HNIA 2L89A 1YJ9T 1YJ9A 4FIBA 4Y91A 1X01A 1KHCA 3VU3C 2ZZDB 1W4SA 2EIFA 4XU0A 5CKFA 3OSSC 4J6YA 5CK9A 4JJNK 1QVGS 1NE8A 5CQXA 2PUKB 2FVUA 5FLXE 4PJOD 3T9NA 1G3YA 4JRPA 2LVMA 5GAOm 1QVPA 5LJ3j 1UB4A 1VQ4T 1I5LA 3GPLA 3WVDB 1VQ4A 1FKMA 2RJFA 3VYGA 4HCCA 2EQMA 4FL6A 3OYFA 5I2SA 3H6ZA 2MF2A 2WSFE 3RIRA 5CKDA 3CC4T 2JTMA 2BKDN 3KXTA 5GAMf 3CC4A 1FX7A 4DQ2A 1FXXA 2WACA 3QJYA 4OB2B 4M7AG 2HD0A 4XTUA 3VYHB 2OAUA 4DOWA 3CPWA 3NTHA 4MZPA 1WJRA 2IVWA 3MHXA 4N0AA 4Z6YA 2QFZA 1IZ6A 2WJ9A 1PSEA 2GCXA 5J3BA 4M7AC 4N4HA 2DD4B 4J6WA 2X4JA 3QBYA 2RHUA 4MDXA 4F7UG 4M7AE 3OYLA 4C92A 4LDYA 2KSSA 2E5QA 4PNOA 3QG1A 1YITT 5CQYA 2YHTA 1YITA 4C92F 1XOVA 4B9XA 3NTIA 3OYNA 4IUUA 3UDCA 5HKCA 1UGQB 3V8JA 4WF2A 2RI2A 2V8KA 3LGFA 5LJ3g 3CCVT 2DZ9A 4HT8A 3G4ST 3E9GA 3I55T 3CCVA 3G4SA 1E7PA 3I55A 3GF5A 4OB0B 3QZ9B 3VYGB 3CC2T 3J81E 3CC2A 2E41A 3JCMJ 1O75A 4JDSA 4JLGA 4P5NA 5GAOn 3OA6A 4IKFA 2D6FA 2QTXA 4M7AD 1YJWT 4LOCA 2D0QB 1KQ1A 3C95A 1YJWA 1KQSA 3QJ6A 3OS1A 2LCLA 4KUDK 1KC8U 3FRNA 4LD6A 5DY9A 5KE2A 2RJCA 3JCMQ 3RKYA 4BY6C 4XTZA 4PJOA 4FM4B 4KBMB 3FEOA 2CZ0B 1Q86U 2L3RA 3CXCA 4JLIA 2HAXA 4ME7A 3HO8A 2DVEA 3LYIA 3WXMB 4Z02A 4BDZA 4FU6A 1V29B 4PJOF 4N4IA 2DXCB 2FB7A 3JB9I 4C92B 5GAOl 3I56T 4DOVA 3I56A 2V8IA 2KMGA 4JRIA 5I21A 5LJ5j 1KG1A 4MZTA 4XU3A 3VKIA 2V8JA 4FSXA 5D6WA 4J83A 4OVAA 2LDMA 3P8HA 4KUIA 4VUBA 4PL6A 4C92G 5GAMd 3OYGA 2YLBA 3DB4A 5GAOr 1OZ3A 4M77E 3QSUA 4XTVA 5GMKe 2GFUA 2M0OA 4JRQA 4LDXA 1M1FA 4AKGA 5GMKm 4C0GA 1G3SA 1YCYA 2PVDB 4BE1A 3X28B 3JB9G 3GLXA 3VUZA 4ZGDB 1AHJB 2XICA 3AHUA 5A0LA 3WVEB 4GY5A 4MMKA 4EDUA 1ZHIA 3A8LB 4JS4A 3V8LA 4M6VA 1B34A 1D3BB 3INZA 3JCMX 4Y28E 5KCOA 4PJOB 2LT4A 2QQ8A 2ZZDA 3PT9A 4XU1A 3OBWA 4RCBA 3Q1JA 3OSVA 5GMKh 4QW2A 2E70A 3A5ZB 4KT0E 2E6NA 5KE3A 4A4FA 2KR6A 3JB9J 4ZN3A 4ZTFA 3SD4A 2JVVA 2QDJA 4NS5A 3RESA 3CCST 3RKWA 4BI3A 5GAMe 5KH6A 5LJ5g 3CCSA 3L2UA 1N9SA 5GAN7 2CZ7B 2BS2A 3JCMg 3MEVA 4M7AA 3M59A 2XG8D 4OB3B 2FYKA 1Q86C 2AHJB 5CKEA 3JCMc 4M7AF 3FB9A 2YRVA 4OP0A 3QHSA 4MZMA 1M9SA 1VUBA 4OGEA 3M56A 2LNVA 5IT9E 4F7UA 2O4XA 3JSCA 2X4WA 4X9CA 3GOXA 5HY6A 5A0GA 1M5Q1 3FIFA 3PIOA 1WNLA 2DD4A 3C94A 4F7UF 3JAME 2VGNA 2EJFA 4LD9K 3CXCS 2DK3A 2R5AA 4OMFB 2CZ6B 2DZCA 3PNWC 3DLMA 4J7FA 5CVIA 5CKHA 2DIGA 4A53A 4E7KA 4LDVA 1W2BA 2DPPB 4HLQA 4HNVA 4DA4A 4A4EA 3JCMP 3OS5A 1KD1U 4M78C 3M57A 2DTHA 1MGQA 3KBGA 1YHQT 1LNXA 2ZPEB 2QQAA 2QQRA 2D9TA 3HPWA 4M78E 1IREB 2IG0A 2LC4A 2X4YA 3FC3A 1YHQA 4A4HA 1K9MU 2RJEA 3X20B 3VV0A 1VIEA 2B8AA 2NLUA 1MHNA 1OZ2A 2DXTA 2JTFA 2R5MA 5GMKl 4MIMA 3JCMb 2Y4XA 2DO3A 4M7AB 3X25B 3GIBA 3X26B 3BFMA 2K57A 1BIBA 2EJGA 2PVOB 3LWHA 1OYXA 2BIVA 3FDRA 3HL8A 4ELZC 1LJOA 3MEWA 4EMKC 4R55A 2RI3A 2QI2A 1JRIA 2XU8A 4F7UB 4BBSM 1Y07A 2O4XB 4EMGA 2ZPBB 2DEQA 3HKSA 2MMPA 4ZTJA 1NPPA 5IN1A 2EQUA 5HK3A 4M78D 2K3YA 4MMLA 3LWIA 3HZJA 2M16A 3DB3A 4ZGEB 3R6OA 4II1A 5GMKj 2LTOA 3PIPA 2DXCA 4FT2A 4A4KA 5GAOp 4C0ZA 2DKGA 2P4TA 1Y71A 5CO7A 2EQJA 2LQ8A 4GLKA 3GP8A 1X6OA 3V7CA 3JCMW 2P0KA 3OYAA 4HNUA 4E47A 4QVDA 1VQNA 1VQNT 1VQ6T 3RERA 3CMET 1VQ6A 1KHIA 3P8DA 1BYMA 3CMEA 3SDZA 4A4GA 3BG9A 2DTOA 4XTYA 2RH2A 1FWZA 2L5QA 2KMTA 4BY6B 4BI4A 1KD1C 4M75C 3JB9F 2XIDA 3JCMV 2E6ZA 3LX7A 2CKKA 3L1AA 3MP6A 3OYYA 2LQKA 4UC4A 3JRZA 3LH0A 4C0DC 1WJQA 3MEAA 3F70A 4HL4A 2G3RA 4M75E 5GMKi 3OY9A 4M7DC 4OB1B 5GAMj 3RKXA 5M9OA 3OYMA 1N27A 1D3BA 3UT1A 3OYJA 1K9MC 4HT9A 4M7DE 3QYGB 3OQ5A 4TVRA 4QVCA 3SWNC 4RKUE 3S3NA 4M77B 4C8QG 2WSCE 4JX6A 3N5BB 5GAN4 2GQVA 3OMCA 3QUIA 4C5HA 1Q82U 5GAN2 2RM4A 2PVGB 1U1SA 3M55A 5AYFA 3ZBDA 3HFNA 4RG8A 2M9UA 4C8QC 2Y90A 4M77G 2A7YA 3ASKA 2ZPFB 2G77A 1XNIA 4C8QE 1BI2A 3MEUA 3OYKA 4IURA 4NC6A 2RHYA 4M77C 5J39A 3HP9A 4J6XA 4EMHA 4M75D 3CCLT 4IUVA 3A8GB 3ZFJA 4JS5A 2QA4T 1S72T 2DXUA 3CCLA 1S72A 2EWNA 2QA4A 5FU7C 2VGMA 1G3TA 5FRNA 2E12A 2E64A 4HA8A 2EAYA 1VQPT 4BE2A 1M90U 2HQEA 2VUBA 1PSFA 2K5LA 2LT1A 3TCJA 5L8RE 2K5IA 3CPWS 1VQPA 5GAOq 2VC8A 2PUOB 2VXFA 2E1HA 2XDPA 1XTDA 3HRSA 4M78F 3VKHA 5GAMg 4V2SA 1RL2A 2YLCA 4J5YA 3QYBA 3TREA 3NTKA 2DJZA 3UWNA 1QVGA 4N0AC 4L5GA 1N8RU 4C8QD 3HRUA 3PTAA 1KQ2A 2DIQA 1HXDA 2F69A 3H4CA 3OB9A 4L6V5 1YJNT 5LJ3h 3L2VA 2KY9A 3OYIA 2HBPA 1YJNA 4A54A 2CS7A 3DL1A 4M77D 4OF1A 5FU6C 3O8VA 3RUXA 1K8AU 1UGSB 1R8OB 4OGCA 4B9WA 3BDLA 5CIUA 4EMKA 3CCJT 3S3OA 4AKIA 3CCJA 3HHTB 2F5KA 1KC8C 2EYQA 5EG2A 1VQKT 3RMSA 1YI2T 2ZCFB 1VQKA 3QXEB 1YI2A 3L2ZA 3OYHA 3OYBA 4N4GA 4RMOA 2XDBA 5D6XA 1Q81U 1JB0E 4XAXB 5GAN8 1Q82C 3OYDA 3QPHA 5CCAA 2H3JA 3A8HB 4MDWA 4E7JA 2QEXT 1KQSS 3HRTA 4M78B 1UGRB 2QEXA 3CBOA 1VIFA 3LGLA 2JOYA 3OBYA 4QQ6A 5LJ3f 3CMAT 3QYHB 3CMAA 4HCZA 2X4XA 2QQSA 3ME9A 3E9FA 5A2QE 4M78G 2O01E 1UEBA 2A3LA 4O5VA 4XU2A 3A8OB 3HFOA 4HNTA 3CBMA 3BG3A 4JUVA 2FHDA 3OW2S 1VQLT 2KVQG 3OYCA 1M90C 1BI1A 4J7IA 4M75A 4IUQA 5GANe 1VQLA 5I2MA 2EQKA 1H641 4XTWA 2BUDA 3M4GA 3BW1A 4BACA 4IUTA 4M75F 4EMKB 2RK1A 3TW7A 1I81A 3P8BB 1HK9A 4AKHA 2PU9B 2E65A 3SWNA 4E7HA 1N8RC 1ZBXA 2KAFA 2LRQA 3M4YA 1QP3A 3E19A 2JN0A 4BDYA 1U1TA 1NPRA 2P0PA 3URGA 1WQWA 2XHCA 1BI3A 4NL2A 5DLQE 3RMQA 5IAYA 1G5VA 2VYTA 1K8AC 1G3WA 4HCBA 2DAQA 4C8QA 5GANh 1Q7YU 1QLBA 2FL7A 4KULA 3CCET 4QVZA 2RA2A 4JX4A 2RB6A 4HKEA 4BB7A 3S6WA 3V7SA 4C5GA 4C8QF 4BBRM 3CCEA 3CCUT 4M77A 4ATOA 3E1SA 2LCCA 2ZPIB 3CCUA 2R58A 1BI0A 4YTLA 2QQBA 5LJ5h 4C5EA 1JBMA 1Q81C 1NJIU 4M77F 2MWPA 5GAN5 1N9RA 3C12A 3JCMh 2BS4A 2QQ9A 4AI6A 4X34A 1VQOT 3BDUA 2XD0A 4PKCC 3G71T 1VQOA 2DXBA 3MP8A 4M75B 4RG2A 3DKMA 3M5AA 3G71A 4XTXA 4C0DB 1DJ7B 2RI5A 4M7DB 1I8FA 5A0DA 4NOYA 4XQ3A 2CYZB 3M58A 5GANf 4M75G 1VQ8T 1VQ9T 2XI9A 1VQ8A 1VQ9A 1BIAA 3QYEA 3SWNB 1VQ5T 5J26A 4M7DG 3QO3A 1I4K1 4E7LA 2CZ1B 5LJ3d 1K73U 1VQ5A 2KQWA 2Y4YA 3QWLA 3VKGA 3MCAB 3HB9A 1P92A 5LJ5f 3LW5E 1QP2A 4R56A 1U8RA 4C8QB 2VV5A 3JCMf 5GAN6 2DD5A 3MP1A 5DM7R 2MI6A 3L42A 3QZ5B 1QW1A 1WPYA 1JJ2A 1UGPB 5D6YA 3QIIA 1W2BS 3A8MB 4F7UE 4ELJA 2GF7A 4QSHA 3OYEA 2C06A 3M53A 3X24B 3GNFB 2JZ2A 3CCQT 3CCQA 3EFRA 1YIJT 2K2VA 2KDSA 5FU7B 1YIJA 3EAEA 3FJPA 4FT4A 5C0MA 3M54A 1WGSA 3META 1Q7YC 1H3ZA 2DXBB 2OTLT 2EKOA 3BY7A 3CBPA 2OTLA 3PGGA 2RK2A 4LDWA 4PLIA 3G7ZA 1NZ9A 3VUBA 4C5IA 3SB2A 3TU4K 2M1HA 5LJ3e 3UPUA 4M7DD 1NJIC 4ZN1A 1OI1A 1QVFA 1EIFA 2K5FA 2RO0A 2ZGWA 5LL6S 2RHXA 4M78A 4Q5WA 5GANj 5EJCA 1Y96A 3OW2A 4PLLA 2I2LA 4QQDA 3KUFA 4CRIA 4JRKA 3ER0A 5FU6B 5CKBA 2OTJT 4JX5A 2RJDA 1Y7XA 2F5TX 4J8OA 2OTJA 4IUPA 2JNGA 2DD5B 3H8ZA 2RHIA 1M1GA 3BG5A 1M1KU 1M8VA 2QF7A 2XDDA 3HBLA 1K73C 2XKOC 5CAIA 4X9DA 5DLOA 3L2WA 1X75C 4C92C 1O9SA 3M9QA 5GANd 3C4SA 4BI8B 3L2RA 5FROA 4E7IA 2KK4A 3TEEA 4C92E 3JB9H 2L8DA 2E10A 2R57A 3LLRA 2XK0A 4QQGA 4BUGA 3S3MA 3SFMA 5FRMA 3CD6T 1WJSA 4BE0A 1TH7A 1M4ZA 2K3XA 5LJ5d 3CCRT 3CD6A 3CPFA 3CCRA 4MFDA 3PMIA 2ZPHB 5C6SA 3TW6A 4ZGJB 3JCMd 2VXEA 4NL3A 1JJ2S 3NFCA 4RCCA 4L59A 3V8KA 1VQ7T 2LX9A 2JUFA 3L2QA 5GANg 1VQ7A 4C0FA 4ELYC 1ZQ1A 1Y96B 2P0QA 2WSEE 2EFIA 3OS0A 3MO8A 3PMTA 3V7RA 1SSFA 2MAMA 2CGHA 2RD1A 2RHZA 3CEYA 3GNGA 3QKJA 4EPCA 4PJOG 3HSBA 2DTIA 4LDUA 5HK0A 4MFEA 3PFSA 4D6WA 3EFSA 4C92D 4PJOC 2GFAA 2MWOA 4CI0C 5CR2A 1GXIE 2HQXA 1XQHA 4PJOE 3VJPA 4XK8E 3CCMT 4M7DA 3DLLA 5GAN3 1VQMT 3FLGA 4O6JA 3CCMA 2X35A 1YBYA 3G6ET 1VQMA 1RI0A 2PQWA 3G6EA 1N6AA 2ZPGB 1BKBA 4BD3A 3JB9D 4M7DF 5LJ5e 2K4YA 1WQ7A 2EJ9A 3ZEHA 1QVFS 2BS3A 2QDYB 3J7AF 3JCMe 5GAMh 3OMGA 3OS2A 1M1KC 3J80E 2QXFA 1LOJA 3CC7T 5KCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KT0 E;  2CZ1 B;  2ZZD B;  3A8G B;  2PUK B;  2CZ7 B;  3LW5 E;  1QP2 A;  4OB3 B;  2DD5 A;  2AHJ B;  1PSF A;  5L8R E;  3WVD B;  3QZ5 B;  2PUO B;  1UGP B;  3VYG A;  3A8M B;  2WSF E;  3X24 B;  2DD4 A;  4L6V 5;  4OB2 B;  3VYH B;  2CZ6 B;  2DXB B;  2DPP B;  1PSE A;  1UGS B;  2DD4 B;  3HHT B;  2ZCF B;  2ZPE B;  3QXE B;  1IRE B;  3X20 B;  1JB0 E;  3A8H B;  3X25 B;  1UGQ B;  3X26 B;  1UGR B;  2DD5 B;  2PVO B;  3QYH B;  4OB0 B;  3VYG B;  3QZ9 B;  2O01 E;  2ZPB B;  3A8O B;  2D0Q B;  4ZGE B;  2DXC A;  4FM4 B;  2CZ0 B;  2ZPH B;  1V29 B;  4ZGJ B;  2DXC B;  2PU9 B;  1QP3 A;  2WSE E;  2ZPI B;  4OB1 B;  1GXI E;  2PVD B;  3QYG B;  3X28 B;  4XK8 E;  4RKU E;  4ZGD B;  1AHJ B;  2WSC E;  3WVE B;  2DXB A;  3A8L B;  2ZPG B;  2PVG B;  1DJ7 B;  2QDY B;  4Y28 E;  2ZZD A;  2CYZ B;  2ZPF B; 
#chains in the Genus database with same CATH topology
 1B34 B;  3KHI A;  1N8R R;  2UZB B;  4FIB A;  1GY3 B;  1OGU B;  1W4S A;  4J6Y A;  1K8A R;  2W99 A;  1QVG S;  1AIS B;  4EIK A;  2EPD A;  2RJF A;  1ZA2 B;  5I2S A;  1FX7 A;  1FXX A;  2WAC A;  3EHR A;  4OB2 B;  2HD0 A;  2MCN A;  4DOW A;  3CPW A;  3PVL A;  2QFZ A;  2JM9 A;  1AWX A;  2GCX A;  4PJN A;  4N4H A;  1OL2 B;  3CCR Q;  4AFQ C;  3DOG B;  4MDX A;  1BU2 A;  3RR6 A;  4M7A E;  2YXY A;  3DDQ B;  1WXB A;  4LDY A;  2LP5 A;  1YIT T;  2YHT A;  1YIT A;  4B9X A;  8AT1 B;  1S1N A;  3OYN A;  1W70 A;  1R77 A;  4WF2 A;  5I22 A;  4HT8 A;  2C5O B;  2E3H A;  2KXC A;  1E7P A;  3QZ9 B;  3CC2 T;  4RTV A;  3CC2 A;  2ENM A;  3POM A;  4LUD A;  1O75 A;  4JDS A;  2D6F A;  1UG1 A;  2F1L A;  2WFY B;  4M7A D;  4LOC A;  2CH4 A;  3C95 A;  3OS1 A;  2UZE B;  2C0O A;  1KC8 U;  3D7S B;  3FRN A;  4LD6 A;  2PHG A;  4BY6 C;  2W96 A;  2CZ0 B;  3CXC A;  3CC7 Q;  1LVK A;  3EGX B;  4FW2 A;  4N4I A;  2FB7 A;  3I56 T;  3I56 A;  4JRI A;  1GFD A;  1H25 B;  1YHQ Q;  2R7G A;  1KG1 A;  1H28 B;  3RGF B;  1NLO C;  2DL3 A;  5D6W A;  4J83 A;  2YRD A;  4KUI A;  4RTX A;  4C92 G;  3OYG A;  1V76 A;  2YLB A;  1FMK A;  3QSU A;  2GFU A;  4LDX A;  1KXU A;  3CC4 Q;  2NWM A;  1PRM C;  1G3S A;  1AZE A;  1AHJ B;  4GY5 A;  4JS4 A;  3A8L B;  2I53 A;  2HQH A;  4Y28 E;  3VRY A;  3VS0 A;  2QQ8 A;  1IRX A;  2ZZD A;  1M8M A;  2BTT A;  4KRC B;  2E70 A;  2DBM A;  5KE3 A;  4OR5 B;  2QDJ A;  3RKW A;  4BCG B;  2YUP A;  1Q95 G;  3EGD A;  5GAN 7;  1TSF A;  3M59 A;  4OB3 B;  3CCV Q;  4BCQ B;  1F5Q B;  2AZV A;  2YWW A;  4M7A F;  4MZM A;  2EW3 A;  1H3H A;  2X1N B;  2LJ3 A;  2WIP B;  4F7U A;  5IT9 E;  3NMZ C;  3GOX A;  3FIF A;  4OMP A;  3PIO A;  2L3P A;  3IQL A;  2EJF A;  5CVI A;  2CZ6 B;  2DZC A;  3PNW C;  2RNA A;  4J7F A;  2IW6 B;  4A53 A;  2DIG A;  4HNV A;  1WDX A;  3M57 A;  2DTH A;  1FMW A;  3KBG A;  2F2V A;  1W2B P;  3EG0 A;  2FO0 A;  2YSQ A;  2CCH B;  2R5M A;  4MIM A;  4EOQ B;  3X26 B;  2IN3 A;  1K1Z A;  1Z9Q A;  3BFM A;  1BIB A;  3FDR A;  4CC7 A;  3MEW A;  1SF9 A;  4EMK C;  4BBS M;  3M0U A;  1JXO A;  2RF0 A;  2ZPB B;  1H26 B;  2DEQ A;  2KYB A;  3HKS A;  4FYW B;  4ZTJ A;  2EQU A;  5HK3 A;  2DE0 X;  4II1 A;  2SRC A;  5ACB A;  2JTE A;  4ROE A;  2LQ8 A;  2FZG B;  3UF4 A;  4E47 A;  2A28 A;  1VQ6 T;  1VQ6 A;  1KHI A;  2A0F B;  4RTT A;  2QAS A;  2IVX A;  2DTO A;  2L5Q A;  4EOK B;  2O9V A;  4JZ4 A;  4BI4 A;  1KD1 C;  3JCM V;  1N5Z A;  2E6Z A;  4JJN K;  2LQK A;  1JJ2 A;  2V1R A;  5GMK i;  1NEG A;  1NG2 A;  5M9O A;  1N27 A;  4M7D E;  3QYG B;  4QVC A;  3S3N A;  4JX6 A;  3TQ7 P;  2GQV A;  1ZX6 A;  2ABL A;  1U1S A;  2QG9 B;  5AYF A;  2DL5 A;  4PJM A;  2Y90 A;  2A7Y A;  4J9D A;  3OYK A;  4NC6 A;  1UNH D;  5J39 A;  1LCK A;  4J6X A;  1QLY A;  2QA4 T;  1OV3 A;  2QA4 A;  5FRN A;  3MY1 B;  1G3T A;  4TTH A;  4BE2 A;  1M90 U;  2VUB A;  2K5L A;  2LT1 A;  3CPW S;  5GAO q;  4CFW B;  2KXD A;  3HRS A;  1W6X A;  3EG3 A;  4V2S A;  2H8H A;  2DJZ A;  4N0A C;  3HRU A;  2FEI A;  3PTA A;  2DIQ A;  3H41 A;  4L6V 5;  3H4C A;  2EGC A;  2NYS A;  4OGC A;  1H1P B;  1R8O B;  4EMK A;  3MJX A;  1VQK T;  2ECZ A;  3EH2 A;  2EKH A;  2ZCF B;  1VQK A;  3OYH A;  1D1A A;  1Q81 U;  1RAD B;  4CFM B;  3A8H B;  2QEX T;  4M78 B;  2QEX A;  1K9A A;  3LGL A;  5FW9 A;  2JOY A;  2CP2 A;  4O5V A;  1ABQ A;  5BNJ B;  4JUV A;  2M51 A;  1BI1 A;  5GAN e;  5I2M A;  5FGK B;  4WTO B;  3M4G A;  1TD6 A;  2RK1 A;  1RUW A;  1B7T A;  3E19 A;  1UE9 A;  2M0Y A;  2XHC A;  3RMQ A;  2PK2 A;  5HNB B;  1VQP Q;  1Q7Y U;  4OML A;  4KUL A;  4QVZ A;  2RA2 A;  2QDL A;  4JX4 A;  4EC8 B;  2RB6 A;  4HKE A;  4C5G A;  1GFC A;  1BI0 A;  1QCN A;  4YTL A;  3A98 A;  2MWP A;  2CP7 A;  1OU9 A;  3TNW B;  4X34 A;  1VQO T;  1VQO A;  3EFO A;  4M75 B;  3M5A A;  2HCK A;  2CP6 A;  3I5R A;  2RI5 A;  4BCM B;  2A36 A;  2SEM A;  1I8F A;  4NOY A;  1BU1 A;  2X9H A;  1VQ8 T;  1VQ8 A;  3REB B;  5HBH B;  1BIA A;  2VVK A;  3SWN B;  1BBZ A;  4JJD A;  4E7L A;  2Y4Y A;  3VKG A;  5LJ5 f;  3LW5 E;  2ATC B;  2LCS A;  4F7N B;  1KD1 R;  5IDN B;  1ZUU A;  2VV5 A;  1YCS B;  5DM7 R;  3QZ5 B;  1WPY A;  3A8M B;  4OMM A;  2GF7 A;  1NLP C;  3GNF B;  2JZ2 A;  4RTY A;  2PZ1 A;  4EC9 B;  1YIJ T;  5FU7 B;  1YIJ A;  4J9F A;  1VQL Q;  3FJP A;  5C0M A;  3M54 A;  1WGS A;  1H3Z A;  1Y57 A;  2OTL T;  2EKO A;  4R0K A;  2OTL A;  4PLI A;  3G7Z A;  2M1H A;  3UPU A;  4Z89 A;  1SHF A;  1OKV B;  1R0C B;  2D8J A;  2V1Q A;  2I2L A;  4QQD A;  2X3W D;  5FU6 B;  4JX5 A;  1Y7X A;  2F5T X;  1PM3 A;  1WYX A;  3OW2 P;  2X3X D;  2DD5 B;  2DF6 A;  1M1G A;  4FSS A;  1M1K U;  4LXC A;  1TWB A;  2XDD A;  1X69 A;  1K73 C;  1D0Z A;  2GNC A;  2K79 A;  2XKO C;  4CRL B;  2HZY A;  4C92 C;  3L2R A;  5HVY B;  2KK4 A;  4M4Z A;  1U06 A;  3JB9 H;  2L8D A;  4QQG A;  4BUG A;  2V26 A;  4JJC A;  1TH7 A;  1T3S A;  2K3X A;  5LJ5 d;  4MFD A;  5LQF B;  7AT1 B;  3TW6 A;  2VXE A;  1JJ2 S;  3H0I A;  3NFC A;  4RCC A;  3V8K A;  2LX9 A;  2JUF A;  4ELY C;  4FX3 B;  1Y96 B;  2WSE E;  1TUD A;  2CUD A;  3PMT A;  4LE9 A;  2RQV A;  4DEX A;  3QKJ A;  1R0B G;  2HBW A;  2DTI A;  3PFS A;  1X6G A;  2O2O A;  4PJO C;  4BY7 X;  2IIM A;  4CI0 C;  3CCQ Q;  5CR2 A;  1IHW A;  4XK8 E;  4M7D A;  1VQM T;  1VQM A;  1YBY A;  1RI0 A;  2PQW A;  2FRY A;  2GQI A;  3J7A F;  2EJ9 A;  2BS3 A;  3VRZ A;  3O0G D;  2QXF A;  1MNE A;  3ZFJ A;  3H9N A;  1YJ9 T;  3QDR B;  2L89 A;  1YJ9 A;  2W10 A;  1OX8 A;  3VU3 C;  2ZZD B;  4XU0 A;  3OSS C;  5L23 A;  2GTO A;  1X43 A;  4Z88 A;  5FLX E;  4E7S A;  2OTJ Q;  1G3Y A;  4JRP A;  2LVM A;  5GAO m;  1UB4 A;  2ZAE A;  1I5L A;  3MIA B;  3EGD B;  2EQM A;  4YOZ A;  3OYF A;  2FRW A;  3H6Z A;  2MF2 A;  5CKD A;  1UHF A;  2JTM A;  2BKD N;  2E5K A;  1WHJ A;  4DQ2 A;  2C6T B;  4FYY B;  4M7A G;  3VYH B;  2RMO A;  3BLR B;  1EX4 A;  4MZP A;  1WJR A;  3MHX A;  4Z6Y A;  1IZ6 A;  2WJ9 A;  2DNU A;  5J3B A;  3CD6 Q;  2NUP A;  1PKD B;  2X4J A;  4AFS C;  1GUX A;  2YUN A;  4C92 A;  1T0H A;  1VQ7 Q;  2DRM A;  1URC B;  4PNO A;  4DEY A;  3V8J A;  5LJ3 g;  1GCQ A;  2DZ9 A;  3G4S T;  3G4S A;  3GF5 A;  4OB0 B;  4OGR B;  3VYG B;  1C0M A;  4Y72 B;  4RTZ A;  3J81 E;  4AT1 B;  2E41 A;  3JCM J;  2RN8 A;  4CFV B;  2CSI A;  3EHQ A;  2D0Q B;  3G6E Q;  5ECA A;  5DY9 A;  1M3A A;  3RKY A;  4PJO A;  3FEO A;  1Q86 U;  4JLI A;  2DVE A;  3LYI A;  4FU6 A;  3JB9 I;  5GAO l;  1ZP2 A;  4DOV A;  5LJ5 j;  4B6M A;  2LDM A;  4PL6 A;  1BCO A;  3DB4 A;  1VQ4 Q;  4M77 E;  4CC2 A;  1AWW A;  1EFN A;  4F16 A;  1K73 R;  4DBR A;  4BXX X;  3EH1 A;  2JJ9 A;  3X28 B;  3GLX A;  1KIK A;  5A0L A;  1N4M A;  1ZHI A;  3DJB A;  4M6V A;  3INZ A;  5KCO A;  3PT9 A;  4XU1 A;  3OBW A;  4RCB A;  3Q1J A;  1IGU A;  2KI7 A;  2CH4 W;  1W98 B;  2MYS A;  4ZN3 A;  3SD4 A;  3CCS T;  3QWX X;  3CCS A;  4AMC A;  2DFU A;  2EQI A;  2FPE A;  3JCM g;  1Y0M A;  3MEV A;  5GJW B;  4BCO B;  2FYK A;  2AHJ B;  2LJ1 A;  3I55 Q;  4EON B;  1E6G A;  3JCM c;  3FB9 A;  4OP0 A;  4J9H A;  3M56 A;  2O4X A;  2CT4 A;  1GBQ A;  2X4W A;  4X9C A;  5CYI B;  1K4U S;  1YJW Q;  1J3T A;  2CUB A;  1WNL A;  2DD4 A;  2L0A A;  3C94 A;  1MUZ A;  4F7U F;  4LD9 K;  2KBT A;  3DLM A;  2AKK A;  2JMA A;  5CKH A;  1W2B A;  2DPP B;  3I35 A;  4A4E A;  3JCM P;  1QQJ A;  2WMA B;  5KYX B;  2QQR A;  2IG0 A;  5EC7 A;  2JM8 A;  3REA B;  2P84 A;  3FC3 A;  2RJE A;  1I1J A;  3VV0 A;  1VIE A;  2BZX A;  2B8A A;  2BZY A;  2DXT A;  2JTF A;  3JCM b;  4M7A B;  5KYW A;  1OIY B;  1E6H A;  2EJG A;  1KJW A;  3LWH A;  1OYX A;  3QHR B;  2BIV A;  3HL8 A;  4ELZ C;  1LJO A;  2RI3 A;  2XU8 A;  1YN8 A;  1Y07 A;  3EOC B;  1RAB B;  4EMG A;  3DTO A;  2MMP A;  1NPP A;  3NHN A;  5IN1 A;  2RQR A;  3DB3 A;  3R6O A;  5FWB A;  3PIP A;  2DXC A;  4FT2 A;  3ZL7 C;  3PE0 A;  3TNH B;  1X6O A;  1H8K A;  2AZS A;  3OYA A;  1VQN T;  1VQN A;  5IXB A;  2RH2 A;  2KMT A;  1WXU A;  1B3Q A;  3JB9 F;  2JS2 A;  4GLM A;  3LX7 A;  2CKK A;  2PK9 B;  1UNL D;  1WJQ A;  1PNJ A;  3MEA A;  4PFO A;  3RKX A;  3OYM A;  4EOI B;  1K9M C;  4HT9 A;  3UT1 A;  1ZSG A;  4X1V A;  2WSC E;  3OMC A;  2EGA A;  2RM4 A;  3M55 A;  3ZBD A;  3HFN A;  4C8Q C;  1H27 B;  3HTR A;  4DBH A;  3NPF A;  1XNI A;  1BI2 A;  2RHY A;  4M77 C;  2BPM B;  3CCL T;  4IUV A;  1OI9 B;  4JS5 A;  3CCL A;  2C5V B;  2E12 A;  2EAY A;  2MK5 A;  2J6F A;  1PSF A;  3EG9 B;  2VXF A;  5DQV A;  1XTD A;  5GAM g;  4J5Y A;  4IMY B;  3QYB A;  3TRE A;  3NTK A;  1K0S A;  5IF1 B;  3BHT B;  2DET A;  4L5G A;  2YT6 A;  1N8R U;  2F69 A;  1YJN T;  5LJ3 h;  1YJN A;  1ZBJ A;  1M27 C;  3DL1 A;  1K8A U;  3H0H A;  1RAF B;  1OU8 A;  3BDL A;  5CIU A;  1CKA A;  4AKI A;  3NDQ A;  2WXV B;  3L2Z A;  3CME Q;  4N4G A;  1ZUY A;  5D6X A;  2NUT A;  1JB0 E;  4XAX B;  5GAN 8;  1Q82 C;  2BE7 D;  1D1C A;  2LX7 A;  2MPX C;  4E7J A;  1ZSZ B;  2CT3 A;  2MIO A;  1VIF A;  2G6F X;  4HCK A;  3QYH B;  4HCZ A;  3ME9 A;  4M78 G;  1ZLM A;  1UEB A;  3R6N A;  2CP0 A;  3A8O B;  3HFO A;  4G6L B;  3BG3 A;  3CBM A;  2DIL A;  2CJM B;  2DRK A;  2I0N A;  2DA9 A;  2V22 B;  4XTW A;  1MMD A;  2WMB B;  2BUD A;  2C0T A;  3BW1 A;  3VS4 A;  1YWO A;  1OPK A;  3TW7 A;  1U3O A;  2ED1 A;  2PU9 B;  1AOJ A;  4F6S B;  1S72 Q;  4BDY A;  1NPR A;  5CEI B;  2VYT A;  4HCB A;  4C8Q A;  5L2W B;  5GAN h;  2FL7 A;  4A63 B;  3CCE T;  3CCE A;  3S6W A;  4BBR M;  3CCU T;  4M77 A;  3E1S A;  3CCU A;  4FCY A;  2COZ A;  2QQB A;  4PJJ A;  1N9R A;  3C12 A;  1JOW A;  3JCM h;  2QQ9 A;  4AI6 A;  3C0C A;  3BDU A;  2XD0 A;  2DXB A;  2JMC A;  2L3Q A;  3MP8 A;  4RG2 A;  1CSK A;  1OOT A;  4C0D B;  1DJ7 B;  4M7D B;  3CCJ Q;  1OX9 A;  5A0D A;  1YP5 A;  1A0N B;  1HYO A;  4M75 G;  1YI2 Q;  1NM7 A;  2XI9 A;  1VQ5 T;  3QO3 A;  1I4K 1;  2CZ1 B;  1VQ5 A;  2KQW A;  3MCA B;  3BHU B;  1SRM A;  2H3E B;  4PFP A;  3CMA Q;  1QW1 A;  1UGP B;  1VYU A;  3QII A;  1W2B S;  1E9H B;  2HEQ A;  4QSH A;  1K9M R;  2EGE A;  2J7I A;  3M53 A;  3X24 B;  1O9K A;  2BZ8 A;  2K2V A;  3EAE A;  1ABO A;  4LN2 A;  3BY7 A;  2RK2 A;  3RNJ A;  1NZ9 A;  3RBB B;  1WI7 A;  3VUB A;  4ANJ A;  3SB2 A;  3TU4 K;  1AT1 B;  3M0P A;  5LJ3 e;  4M7D D;  1NJI C;  1WXT A;  1EIF A;  2RO0 A;  2ZGW A;  2AK5 A;  2LNH B;  5GAN j;  3OW2 A;  4JRK A;  5CKB A;  2C4G B;  2RHI A;  4J9C A;  3BG5 A;  3HBL A;  4EOP B;  4X9D A;  3L2W A;  1X75 C;  2KYM A;  4BCJ B;  4CC4 B;  4BI8 B;  5FRO A;  4ZNX A;  3TEE A;  4C92 E;  3M0T A;  2R57 A;  2OAW A;  1RAH B;  2FZC B;  3CCR T;  2LQW A;  2HL3 A;  3G33 B;  3CPF A;  3CCR A;  1VQ9 Q;  4FYX B;  4UN0 A;  1ZUK A;  1SEM A;  1G2B A;  2PNI A;  4OMN A;  1Q82 R;  1ARK A;  1M2V B;  4KH1 B;  1OKW B;  3V7R A;  2MAM A;  2RD1 A;  4RTU A;  4CXA B;  3CEY A;  4MFE A;  4D6W A;  4C92 D;  2ROT A;  2GFA A;  2HMA A;  1V1C A;  1GXI E;  1VA7 A;  3EID B;  2VWF A;  4PJO E;  3DLL A;  5GAN 3;  2ZPG B;  4M7D F;  4HXJ A;  2KRM A;  3PO3 S;  3JCM e;  5GAM h;  3OMG A;  2EBP A;  3J80 E;  2LNV A;  3CC7 T;  5KCH A;  2QYZ A;  3CC7 A;  5KYU A;  1G8X A;  1M1K R;  2VB6 A;  4Y91 A;  4DBQ A;  1NE8 A;  2FVU A;  4PJO D;  3T9N A;  3TSZ A;  2ESW A;  2PTK A;  1QVP A;  1X2K A;  3GPL A;  3WVD B;  4OMO A;  2WHB B;  4HCC A;  1M3B A;  2COW A;  3RIR A;  3CC4 T;  2LW4 A;  3CC4 A;  1E7O A;  2DMO A;  3QJY A;  5FWC A;  2OAU A;  1CKB A;  3NTH A;  4N0A A;  5IXF A;  2DD4 B;  3E2U A;  3EGX A;  2RHU A;  3EGU A;  4F7U G;  3UA6 A;  4F6W B;  1SRL A;  2KSS A;  5CQY A;  1TXQ A;  4C92 F;  1XOV A;  4IUU A;  3M0S A;  1F1B B;  1UGQ B;  2V8K A;  3LGF A;  1I5O B;  3CCV T;  1K0X A;  3E9G A;  3CCV A;  4JLG A;  3OA6 A;  4IKF A;  5GAO n;  3CCM Q;  2W9F A;  1KQ1 A;  4KUD K;  4F70 B;  2LJ0 A;  5KE2 A;  2RJC A;  2KRS A;  2HAX A;  1OQK A;  1KQS P;  2RQW A;  2C0I A;  3HO8 A;  4BDZ A;  4Z02 A;  1NJI R;  1V29 B;  4PJO F;  2DXC B;  1TG0 A;  2KMG A;  2P4R A;  4MZT A;  3VKI A;  1KK7 A;  2V8J A;  4FSX A;  1YNZ A;  4OVA A;  3P8H A;  1PCX A;  4VUB A;  4OMQ A;  4XTV A;  5GMK e;  1AEY A;  4AKG A;  4C0G A;  3VS5 A;  4BE1 A;  1YCY A;  3JB9 G;  2HKN A;  4ZGD B;  3WVE B;  4MMK A;  4F04 B;  3V8L A;  1AVZ C;  5IH2 A;  1QCO A;  2AIR B;  3U23 A;  2LT4 A;  4KGV B;  3OSV A;  1TUC A;  4QW2 A;  4J9E A;  2E6N A;  3RES A;  1YIT Q;  3EG2 A;  4BI3 A;  5GAM e;  4CFN B;  1N9S A;  2CZ7 B;  2BS2 A;  1TFB A;  2XG8 D;  5CKE A;  4ELL A;  2JXB A;  3CC2 Q;  2YRV A;  1BCM A;  3QHS A;  1M9S A;  1Q86 R;  1T0J A;  4HVV A;  4PFZ A;  3RDV A;  1M5Q 1;  3TN8 B;  3JAM E;  1VYW B;  3M03 A;  3GTM S;  1IHV A;  2DK3 A;  2R5A A;  4OMF B;  4D8K A;  1JQQ A;  3OW2 S;  3MKD A;  4LDV A;  4HLQ A;  4DA4 A;  3LH5 A;  3OS5 A;  1HD3 A;  1KD1 U;  4M78 C;  1RAA B;  1MGQ A;  4YOS A;  2ED0 A;  4LNP A;  1LNX A;  2KE9 A;  2ZPE B;  2QQA A;  2D9T A;  3I56 Q;  2LC4 A;  2X4Y A;  3X20 B;  2NLU A;  4F6U B;  1OL1 B;  2DO3 A;  3X25 B;  2K57 A;  2PVO B;  3A1P A;  2BKZ B;  1SKU B;  2DVJ A;  2WPA B;  2CCI B;  1WHM A;  1RLQ C;  2QI2 A;  4F7U B;  1PHT A;  2YUO A;  8ATC B;  2HSE B;  3LWI A;  4MML A;  2M16 A;  4ZGE B;  5LMK B;  1D0X A;  1B07 A;  3F5X B;  5GAO p;  1W1F A;  4BCH B;  2DKG A;  2HSP A;  4C0Z A;  1YJN Q;  2CP5 A;  2P4T A;  1Y71 A;  1C9B A;  5CO7 A;  2E4H A;  2COY A;  4GLK A;  1WA7 A;  2P0K A;  4HNU A;  2VKN A;  3RER A;  1BYM A;  4FW1 A;  3SDZ A;  4A4G A;  2LZ6 B;  4BY6 B;  3AT1 B;  4M75 C;  2XID A;  4JPB W;  3OYY A;  3MP6 A;  1SSH A;  3LH0 A;  2G3R A;  3BHV B;  2UZL B;  4QKU A;  1D3B A;  3I5S A;  4JZ3 A;  3SHW A;  3OQ5 A;  2EYY A;  3SWN C;  4M77 B;  3N5B B;  3QUI A;  4C5H A;  5GAN 2;  2KR3 A;  1WLP B;  2PVG B;  2PJQ A;  4RG8 A;  3PVQ A;  2KT8 A;  2M9U A;  1PD1 A;  2G77 A;  1M3C A;  4C8Q E;  4IUR A;  3HP9 A;  4EMH A;  1NYG A;  2O31 A;  3A8G B;  2DXU A;  5FU7 C;  2IPO B;  2E64 A;  1VQP T;  1VQP A;  5L8R E;  2VC8 A;  2PUO B;  2E1H A;  2XDP A;  1TS9 A;  2HDA A;  1RL2 A;  2YLC A;  3UWN A;  3CQT A;  4CC3 A;  5GJV B;  2X51 A;  4C8Q D;  5IHK A;  3OB9 A;  1UJY A;  3L2V A;  2KY9 A;  3OYI A;  1BB9 A;  1QVG P;  1UUE A;  2W9Z A;  4M77 D;  4OF1 A;  5FU6 C;  1VOM A;  2B86 A;  2EYQ A;  5EG2 A;  1WIE A;  3RMS A;  2DER A;  2EYZ A;  1PWT A;  1VQ6 Q;  3OYB A;  1KC8 R;  4RMO A;  4KGZ B;  2XDB A;  5IHI A;  3OYD A;  4I3Z B;  2KEA A;  5CCA A;  2H3J A;  4MDW A;  9ATC B;  3HRT A;  4BY1 X;  1UGR B;  4ROC A;  1Z9Z A;  3OBY A;  5LJ3 f;  2QQS A;  4IIM A;  2O01 E;  6AT1 B;  2A3L A;  4XU2 A;  4HNT A;  2FHD A;  1VQL T;  2KVQ G;  4CFX B;  2OI3 A;  3OYC A;  4M75 A;  1M90 C;  3UA7 A;  1VQL A;  1H64 1;  2RQU A;  4IUT A;  4EMK B;  1D3U B;  1X6B A;  2C5X B;  1MMA A;  1I81 A;  1FVV B;  3QHW B;  1JSU B;  1HK9 A;  4EOM B;  2E65 A;  3SWN A;  1KSW A;  4E7H A;  1ZBX A;  2KAF A;  2LRQ A;  3M4Y A;  4RTW A;  1H1S B;  2QA4 Q;  1IGQ A;  1U1T A;  3URG A;  5DLQ E;  1G5V A;  1RAI B;  1G3W A;  2XMF A;  2DAQ A;  1QLB A;  4C8Q F;  2EYX A;  2R58 A;  1GH6 B;  4C5E A;  1FYN A;  1Q81 C;  4M77 F;  1QKW A;  1JXM A;  4PKC C;  3G71 T;  4RUG A;  3G71 A;  3DKM A;  4XTX A;  3TSW A;  4Z8A A;  1VQK Q;  3M58 A;  5GAN f;  4M7D G;  5J26 A;  4AG2 C;  5LJ3 d;  1K73 U;  3QWL A;  1M30 A;  3HB9 A;  1P92 A;  5KYU B;  1QP2 A;  1PKT A;  2QEX Q;  1UEC A;  3JCM f;  5GAN 6;  2DD5 A;  3MP1 A;  2MI6 A;  3L42 A;  1JO8 A;  2CSQ A;  2MOX A;  5DQW A;  2DL7 A;  3O5Z A;  4ELJ A;  3OYE A;  2C06 A;  3CCQ T;  3CCQ A;  3MPU B;  3EFR A;  4KGX B;  1TOV A;  1D1B A;  4FT4 A;  1Q7Y C;  3MET A;  3EFO B;  3CBP A;  1AWO A;  4LDW A;  4C5I A;  1ZA1 B;  3BE3 A;  4ZN1 A;  1AWJ A;  1OI1 A;  2J6O A;  2K5F A;  1UHC A;  2QAZ A;  2RHX A;  4Q5W A;  3VS2 A;  5EJC A;  1Y96 A;  2DBK A;  4PLL A;  1QVF P;  1BK2 A;  4CRI A;  3ER0 A;  2OTJ T;  2J05 A;  2RJD A;  1AZG B;  2OTJ A;  4IUP A;  2UZD B;  1U5S A;  4K11 A;  1XO2 A;  3QDF A;  3BLH B;  5DLO A;  5HQ0 B;  1VQO Q;  5GAN d;  3K7A M;  2YRC A;  3C4S A;  4E7I A;  1TTH B;  2E10 A;  2YDL A;  3S3M A;  3SFM A;  5FRM A;  3CD6 T;  4BE0 A;  1M4Z A;  3CD6 A;  1VQ8 Q;  5I5Z B;  4ZGJ B;  1PRL C;  3JCM d;  2E3I A;  1VQ7 T;  1VQ7 A;  4C0F A;  3OS0 A;  2EFI A;  3MO8 A;  2CGH A;  4EPC A;  4PJO G;  1OEB A;  5HK0 A;  3EFS A;  2FG0 A;  2MWO A;  3M0R A;  2HQX A;  1YIJ Q;  1YWP A;  3FLG A;  1M90 R;  3G6E T;  2OTL Q;  3G6E A;  4CFU B;  2K4Y A;  3DDP B;  1QVF S;  1C6V X;  1M1K C;  1HJD A;  3B57 A;  1TUG B;  1LOJ A;  2HNI A;  4BCF B;  4IIO A;  1X01 A;  4J9G A;  1KHC A;  1JKW A;  5CKF A;  2EIF A;  4J9I A;  4NST B;  2OJ2 A;  3G1J A;  5CK9 A;  5HBE B;  5CQX A;  2PUK B;  1G83 A;  2QK0 A;  5LJ3 j;  1VQ4 T;  1VQ4 A;  1FKM A;  1I07 A;  3VYG A;  2K6D A;  4FL6 A;  2WSF E;  1X2Q A;  1Q81 R;  3KXT A;  5GAM f;  3QWY A;  1H92 A;  2KNB B;  4BCQ D;  1NEB A;  4XTU A;  1QCF A;  1MMN A;  2IVW A;  5KYY A;  1PSE A;  4M7A C;  1EZZ B;  4J6W A;  3QBY A;  3CPW P;  4CFU D;  1H24 B;  1JEG A;  3OYL A;  3LQ5 B;  2O88 A;  4BCK B;  2E5Q A;  2FPD A;  3QG1 A;  2QGS A;  4BCN B;  3UDC A;  5HKC A;  3FJ5 A;  2RI2 A;  1GBR A;  3I55 T;  1XJW B;  3I55 A;  1UTI A;  2QGF B;  4P5N A;  2QTX A;  1VQM Q;  1YJW T;  4BCP B;  1Q7Y R;  1YJW A;  2RQT A;  1KQS A;  3QJ6 A;  2LCL A;  2VAS A;  1K76 A;  2WIH B;  3JCM Q;  4ESR A;  4XTZ A;  4FM4 B;  4KBM B;  2L3R A;  2NUP B;  4HVU A;  2CDT A;  4ME7 A;  3WXM B;  1YJ9 Q;  1IO6 A;  1GUX B;  4C92 B;  3CXC P;  2F2X A;  2V8I A;  1G3N C;  5I21 A;  4XU3 A;  2IW8 B;  2B9R A;  4EOJ B;  5GAM d;  5GAO r;  1OZ3 A;  2K3B A;  1QMZ B;  4BCN D;  1OIU B;  2M0O A;  4JRQ A;  1M1F A;  3M0Q A;  1UNG D;  5GMK m;  2DL4 A;  2PVD B;  3VUZ A;  2XIC A;  3KFV A;  3AHU A;  4EDU A;  1B34 A;  1D3B B;  3I9Q A;  3JCM X;  1MV3 A;  5AT1 B;  4HVW A;  4PJO B;  5GMK h;  5KYX A;  3A5Z B;  4KT0 E;  4A4F A;  2KR6 A;  3JB9 J;  4ZTF A;  2JVV A;  4NS5 A;  5KH6 A;  5LJ5 g;  3MI9 B;  5IHY A;  3L2U A;  2K2M A;  4M7A A;  1Q86 C;  1MV0 B;  3G4S Q;  4PK4 A;  2CP3 A;  4YOO A;  1LPL A;  1P5E B;  5KYN A;  4OGE A;  1VUB A;  3JSC A;  5HY6 A;  5A0G A;  2LMJ A;  4JJB A;  1VIN A;  4KRD B;  4KH0 B;  1RAC B;  4KRT A;  2VGN A;  2I40 B;  3CXC S;  1H4L D;  4E7K A;  2EYW A;  2D1X A;  1ZSZ C;  2KGT A;  2KRN A;  4WCI A;  1RI9 A;  1YHQ T;  3HPW A;  4M78 E;  1YHQ A;  1IRE B;  4A4H A;  1K9M U;  1SPK A;  1MHN A;  1OZ2 A;  5GMK l;  3GIB A;  2WEV B;  2Y4X A;  1QWE A;  3ULR B;  2G9X B;  1GRI A;  4R55 A;  1JRI A;  2A37 A;  2O4X B;  5I11 A;  3JV3 A;  4M78 D;  2GTJ A;  2K3Y A;  5IDP B;  3HZJ A;  2GBQ A;  2OX7 A;  5GMK j;  2LTO A;  4A4K A;  4F14 A;  4YC3 B;  2EQJ A;  1OPL A;  1QMC A;  3GP8 A;  3V7C A;  3JCM W;  4BCI B;  4EOL B;  4QVD A;  3CCS Q;  3CME T;  3P8D A;  3CME A;  3BG9 A;  1WHK A;  4XTY A;  4FYV B;  1H1Q B;  1FWZ A;  3VS1 A;  4F7S B;  4GBQ A;  5KYW B;  3EG9 A;  5D7U A;  3L1A A;  4UC4 A;  1JU5 C;  2HKQ B;  3JRZ A;  4C0D C;  4M7D C;  3F70 A;  4HL4 A;  4M75 E;  3OY9 A;  4OB1 B;  5GAM j;  3OYJ A;  2F2C A;  1H1R B;  1JJ2 P;  4TVR A;  2D0N A;  1M2O A;  4RKU E;  4J9B A;  1RAE B;  4C8Q G;  5GAN 4;  1GL5 A;  2K7A A;  1Q82 U;  4F7J B;  1PKS A;  4M77 G;  3ASK A;  2ZPF B;  3MEU A;  1IB8 A;  2DEU A;  4M75 D;  4AG1 C;  1S72 T;  3TVT A;  1S72 A;  2EWN A;  1WX6 A;  4BCM D;  2VGM A;  4HA8 A;  3UAT A;  1WHL A;  1ZSZ A;  2HQE A;  3TCJ A;  2DYI A;  1QWF A;  1AD6 A;  2K5I A;  1MND A;  4E6R A;  1HSQ A;  4M78 F;  3VKH A;  2EUF A;  4DBF A;  1QVG A;  1I0C A;  1KQ2 A;  1HXD A;  1NYF A;  2HBP A;  4A54 A;  2CS7 A;  3RUX A;  3O8V A;  1UGS B;  4B9W A;  3S3O A;  3G71 Q;  3CCJ T;  3CCJ A;  3HHT B;  2F5K A;  1KC8 C;  1YI2 T;  1VQN Q;  3QXE B;  1YI2 A;  4EOS B;  2L3S A;  1GCQ C;  3QPH A;  2F2W A;  1KQS S;  3EJ1 B;  3CBO A;  2BE9 B;  4QQ6 A;  3CMA T;  3CMA A;  2X4X A;  3E9F A;  5A2Q E;  1RLP C;  1SG5 A;  1TU0 B;  2JGZ B;  2LQN A;  4J7I A;  2UUE B;  4IUQ A;  2EQK A;  1FMV A;  4F17 A;  2GGR A;  4BAC A;  4M75 F;  2EVR A;  1UJ0 A;  3P8B B;  3GBQ A;  4AKH A;  2HL5 C;  1N8R C;  1MMG A;  3CCL Q;  1QP3 A;  2JN0 A;  2NUT B;  2P0P A;  1WQW A;  1BI3 A;  4NL2 A;  5IAY A;  1K8A C;  1WZO A;  4BB7 A;  3V7S A;  4ATO A;  4LUE A;  2LCC A;  2ZPI B;  3VS6 A;  5LJ5 h;  1JBM A;  1NJI U;  4D8D A;  5GAN 5;  5EFQ B;  2BS4 A;  2FPF A;  1FIN B;  2QTV A;  2KT1 A;  1WFW A;  4AFU C;  4XQ3 A;  2CYZ B;  1JST B;  4PJL A;  2W2H A;  1VQ9 T;  4F7L B;  1YFN A;  1VQ9 A;  3QYE A;  3H0F A;  2RPN A;  5IHN A;  1IXD A;  1UDL A;  2FZK B;  4QT7 A;  2PMI B;  2W0Z A;  1D0Y A;  4R56 A;  1U8R A;  4C8Q B;  3NGP A;  1T3L A;  3SEM A;  1KFZ A;  4AFZ C;  5ICP B;  5D6Y A;  1NBE B;  4F7U E;  2M02 A;  2K9G A;  2KDS A;  3MY5 B;  4Y92 A;  1RAG B;  3BLQ B;  2DME A;  3THK A;  4EOR B;  2YUQ A;  2DXB B;  4II5 B;  1UGV A;  2A08 A;  3VS3 A;  1AD5 A;  1QKX A;  3PGG A;  1OUL A;  5HCK A;  2D8H A;  2ROL A;  2JT4 A;  1QVF A;  5LL6 S;  5KYY B;  4M78 A;  2IW9 B;  1M2V A;  3KUF A;  1WHH A;  2O9S A;  4EOO B;  4J8O A;  3CCE Q;  2JNG A;  3H8Z A;  3CCU Q;  1D09 B;  1C1A A;  2C5N B;  1M8V A;  2CRE A;  2QF7 A;  3TNI B;  3VS7 A;  1WHG A;  1O9K B;  1SHG A;  5CAI A;  4ROD A;  1PD0 A;  1ENW A;  1O9S A;  3M9Q A;  1UFF A;  1GCP A;  1X27 A;  2DX1 A;  2QGG A;  4E7Z A;  3LLR A;  2XK0 A;  2DYB A;  1WJS A;  3PMI A;  2ZPH B;  5C6S A;  4NL3 A;  1VQ5 Q;  1ACM B;  1PC0 A;  1VYV A;  4L59 A;  3L2Q A;  5GAN g;  1VOL A;  1ZQ1 A;  2DL8 A;  2P0Q A;  1SSF A;  3GNG A;  2RHZ A;  4ORZ A;  1VYT A;  3HSB A;  2DJQ A;  4LDU A;  2DM1 A;  2DLP A;  2KRO A;  2Z0W A;  1PG5 B;  2JW4 A;  1XQH A;  2NUZ A;  2AT1 B;  3VJP A;  4E2F B;  3CCM T;  4O6J A;  3CCM A;  2X35 A;  3EG1 A;  1N6A A;  1BKB A;  2AKL A;  4BD3 A;  3JB9 D;  5LJ5 e;  1WQ7 A;  3ZEH A;  5HBJ B;  2QDY B;  3OS2 A;  2J06 A;  3NTI A;  2J6K A;  2L2P A;  2JS0 A; 
#chains in the Genus database with same CATH homology
 3CC7 A;  1B34 B;  3KHI A;  3QDR B;  2HNI A;  2L89 A;  1YJ9 T;  1YJ9 A;  4FIB A;  4Y91 A;  1X01 A;  1KHC A;  3VU3 C;  2ZZD B;  1W4S A;  2EIF A;  4XU0 A;  5CKF A;  3OSS C;  4J6Y A;  5CK9 A;  4JJN K;  1QVG S;  1NE8 A;  5CQX A;  2PUK B;  2FVU A;  5FLX E;  4PJO D;  3T9N A;  1G3Y A;  4JRP A;  2LVM A;  5GAO m;  1QVP A;  5LJ3 j;  1UB4 A;  1VQ4 T;  1I5L A;  3GPL A;  3WVD B;  1VQ4 A;  1FKM A;  2RJF A;  3VYG A;  4HCC A;  2EQM A;  4FL6 A;  3OYF A;  5I2S A;  3H6Z A;  2MF2 A;  2WSF E;  3RIR A;  5CKD A;  3CC4 T;  2JTM A;  2BKD N;  3KXT A;  5GAM f;  3CC4 A;  1FX7 A;  4DQ2 A;  1FXX A;  2WAC A;  3QJY A;  4OB2 B;  4M7A G;  2HD0 A;  4XTU A;  3VYH B;  2OAU A;  4DOW A;  3CPW A;  3NTH A;  4MZP A;  1WJR A;  2IVW A;  3MHX A;  4N0A A;  4Z6Y A;  2QFZ A;  1IZ6 A;  2WJ9 A;  1PSE A;  2GCX A;  5J3B A;  4M7A C;  4N4H A;  2DD4 B;  4J6W A;  2X4J A;  3QBY A;  2RHU A;  4MDX A;  4F7U G;  4M7A E;  3OYL A;  4C92 A;  4LDY A;  2KSS A;  2E5Q A;  4PNO A;  3QG1 A;  1YIT T;  5CQY A;  2YHT A;  1YIT A;  4C92 F;  1XOV A;  4B9X A;  3NTI A;  3OYN A;  4IUU A;  3UDC A;  5HKC A;  1UGQ B;  3V8J A;  4WF2 A;  2RI2 A;  2V8K A;  3LGF A;  5LJ3 g;  3CCV T;  2DZ9 A;  4HT8 A;  3G4S T;  3E9G A;  3I55 T;  3CCV A;  3G4S A;  1E7P A;  3I55 A;  3GF5 A;  4OB0 B;  3QZ9 B;  3VYG B;  3CC2 T;  3J81 E;  3CC2 A;  2E41 A;  3JCM J;  1O75 A;  4JDS A;  4JLG A;  4P5N A;  5GAO n;  3OA6 A;  4IKF A;  2D6F A;  2QTX A;  4M7A D;  1YJW T;  4LOC A;  2D0Q B;  1KQ1 A;  3C95 A;  1YJW A;  1KQS A;  3QJ6 A;  3OS1 A;  2LCL A;  4KUD K;  1KC8 U;  3FRN A;  4LD6 A;  5DY9 A;  5KE2 A;  2RJC A;  3JCM Q;  3RKY A;  4BY6 C;  4XTZ A;  4PJO A;  4FM4 B;  4KBM B;  3FEO A;  2CZ0 B;  1Q86 U;  2L3R A;  3CXC A;  4JLI A;  2HAX A;  4ME7 A;  3HO8 A;  2DVE A;  3LYI A;  3WXM B;  4Z02 A;  4BDZ A;  4FU6 A;  1V29 B;  4PJO F;  4N4I A;  2DXC B;  2FB7 A;  3JB9 I;  4C92 B;  5GAO l;  3I56 T;  4DOV A;  3I56 A;  2V8I A;  2KMG A;  4JRI A;  5I21 A;  5LJ5 j;  1KG1 A;  4MZT A;  4XU3 A;  3VKI A;  2V8J A;  4FSX A;  5D6W A;  4J83 A;  4OVA A;  2LDM A;  3P8H A;  4KUI A;  4VUB A;  4PL6 A;  4C92 G;  5GAM d;  3OYG A;  2YLB A;  3DB4 A;  5GAO r;  1OZ3 A;  4M77 E;  3QSU A;  4XTV A;  5GMK e;  2GFU A;  2M0O A;  4JRQ A;  4LDX A;  1M1F A;  4AKG A;  5GMK m;  4C0G A;  1G3S A;  1YCY A;  2PVD B;  4BE1 A;  3X28 B;  3JB9 G;  3GLX A;  3VUZ A;  4ZGD B;  1AHJ B;  2XIC A;  3AHU A;  5A0L A;  3WVE B;  4GY5 A;  4MMK A;  4EDU A;  1ZHI A;  3A8L B;  4JS4 A;  3V8L A;  4M6V A;  1B34 A;  1D3B B;  3INZ A;  3JCM X;  4Y28 E;  5KCO A;  4PJO B;  2LT4 A;  2QQ8 A;  2ZZD A;  3PT9 A;  4XU1 A;  3OBW A;  4RCB A;  3Q1J A;  3OSV A;  5GMK h;  4QW2 A;  2E70 A;  3A5Z B;  4KT0 E;  2E6N A;  5KE3 A;  4A4F A;  2KR6 A;  3JB9 J;  4ZN3 A;  4ZTF A;  3SD4 A;  2JVV A;  2QDJ A;  4NS5 A;  3RES A;  3CCS T;  3RKW A;  4BI3 A;  5GAM e;  5KH6 A;  5LJ5 g;  3CCS A;  3L2U A;  1N9S A;  5GAN 7;  2CZ7 B;  2BS2 A;  3JCM g;  3MEV A;  4M7A A;  3M59 A;  2XG8 D;  4OB3 B;  2FYK A;  1Q86 C;  2AHJ B;  5CKE A;  3JCM c;  4M7A F;  3FB9 A;  2YRV A;  4OP0 A;  3QHS A;  4MZM A;  1M9S A;  1VUB A;  4OGE A;  3M56 A;  2LNV A;  5IT9 E;  4F7U A;  2O4X A;  3JSC A;  2X4W A;  4X9C A;  3GOX A;  5HY6 A;  5A0G A;  1M5Q 1;  3FIF A;  3PIO A;  1WNL A;  2DD4 A;  3C94 A;  4F7U F;  3JAM E;  2VGN A;  2EJF A;  4LD9 K;  3CXC S;  2DK3 A;  2R5A A;  4OMF B;  2CZ6 B;  2DZC A;  3PNW C;  3DLM A;  4J7F A;  5CVI A;  5CKH A;  2DIG A;  4A53 A;  4E7K A;  4LDV A;  1W2B A;  2DPP B;  4HLQ A;  4HNV A;  4DA4 A;  4A4E A;  3JCM P;  3OS5 A;  1KD1 U;  4M78 C;  3M57 A;  2DTH A;  1MGQ A;  3KBG A;  1YHQ T;  1LNX A;  2ZPE B;  2QQA A;  2QQR A;  2D9T A;  3HPW A;  4M78 E;  1IRE B;  2IG0 A;  2LC4 A;  2X4Y A;  3FC3 A;  1YHQ A;  4A4H A;  1K9M U;  2RJE A;  3X20 B;  3VV0 A;  1VIE A;  2B8A A;  2NLU A;  1MHN A;  1OZ2 A;  2DXT A;  2JTF A;  2R5M A;  5GMK l;  4MIM A;  3JCM b;  2Y4X A;  2DO3 A;  4M7A B;  3X25 B;  3GIB A;  3X26 B;  3BFM A;  2K57 A;  1BIB A;  2EJG A;  2PVO B;  3LWH A;  1OYX A;  2BIV A;  3FDR A;  3HL8 A;  4ELZ C;  1LJO A;  3MEW A;  4EMK C;  4R55 A;  2RI3 A;  2QI2 A;  1JRI A;  2XU8 A;  4F7U B;  4BBS M;  1Y07 A;  2O4X B;  4EMG A;  2ZPB B;  2DEQ A;  3HKS A;  2MMP A;  4ZTJ A;  1NPP A;  5IN1 A;  2EQU A;  5HK3 A;  4M78 D;  2K3Y A;  4MML A;  3LWI A;  3HZJ A;  2M16 A;  3DB3 A;  4ZGE B;  3R6O A;  4II1 A;  5GMK j;  2LTO A;  3PIP A;  2DXC A;  4FT2 A;  4A4K A;  5GAO p;  4C0Z A;  2DKG A;  2P4T A;  1Y71 A;  5CO7 A;  2EQJ A;  2LQ8 A;  4GLK A;  3GP8 A;  1X6O A;  3V7C A;  3JCM W;  2P0K A;  3OYA A;  4HNU A;  4E47 A;  4QVD A;  1VQN A;  1VQN T;  1VQ6 T;  3RER A;  3CME T;  1VQ6 A;  1KHI A;  3P8D A;  1BYM A;  3CME A;  3SDZ A;  4A4G A;  3BG9 A;  2DTO A;  4XTY A;  2RH2 A;  1FWZ A;  2L5Q A;  2KMT A;  4BY6 B;  4BI4 A;  1KD1 C;  4M75 C;  3JB9 F;  2XID A;  3JCM V;  2E6Z A;  3LX7 A;  2CKK A;  3L1A A;  3MP6 A;  3OYY A;  2LQK A;  4UC4 A;  3JRZ A;  3LH0 A;  4C0D C;  1WJQ A;  3MEA A;  3F70 A;  4HL4 A;  2G3R A;  4M75 E;  5GMK i;  3OY9 A;  4M7D C;  4OB1 B;  5GAM j;  3RKX A;  5M9O A;  3OYM A;  1N27 A;  1D3B A;  3UT1 A;  3OYJ A;  1K9M C;  4HT9 A;  4M7D E;  3QYG B;  3OQ5 A;  4TVR A;  4QVC A;  3SWN C;  4RKU E;  3S3N A;  4M77 B;  4C8Q G;  2WSC E;  4JX6 A;  3N5B B;  5GAN 4;  2GQV A;  3OMC A;  3QUI A;  4C5H A;  1Q82 U;  5GAN 2;  2RM4 A;  2PVG B;  1U1S A;  3M55 A;  5AYF A;  3ZBD A;  3HFN A;  4RG8 A;  2M9U A;  4C8Q C;  2Y90 A;  4M77 G;  2A7Y A;  3ASK A;  2ZPF B;  2G77 A;  1XNI A;  4C8Q E;  1BI2 A;  3MEU A;  3OYK A;  4IUR A;  4NC6 A;  2RHY A;  4M77 C;  5J39 A;  3HP9 A;  4J6X A;  4EMH A;  4M75 D;  3CCL T;  4IUV A;  3A8G B;  3ZFJ A;  4JS5 A;  2QA4 T;  1S72 T;  2DXU A;  3CCL A;  1S72 A;  2EWN A;  2QA4 A;  5FU7 C;  2VGM A;  1G3T A;  5FRN A;  2E12 A;  2E64 A;  4HA8 A;  2EAY A;  1VQP T;  4BE2 A;  1M90 U;  2HQE A;  2VUB A;  1PSF A;  2K5L A;  2LT1 A;  3TCJ A;  5L8R E;  2K5I A;  3CPW S;  1VQP A;  5GAO q;  2VC8 A;  2PUO B;  2VXF A;  2E1H A;  2XDP A;  1XTD A;  3HRS A;  4M78 F;  3VKH A;  5GAM g;  4V2S A;  1RL2 A;  2YLC A;  4J5Y A;  3QYB A;  3TRE A;  3NTK A;  2DJZ A;  3UWN A;  1QVG A;  4N0A C;  4L5G A;  1N8R U;  4C8Q D;  3HRU A;  3PTA A;  1KQ2 A;  2DIQ A;  1HXD A;  2F69 A;  3H4C A;  3OB9 A;  4L6V 5;  1YJN T;  5LJ3 h;  3L2V A;  2KY9 A;  3OYI A;  2HBP A;  1YJN A;  4A54 A;  2CS7 A;  3DL1 A;  4M77 D;  4OF1 A;  5FU6 C;  3O8V A;  3RUX A;  1K8A U;  1UGS B;  1R8O B;  4OGC A;  4B9W A;  3BDL A;  5CIU A;  4EMK A;  3CCJ T;  3S3O A;  4AKI A;  3CCJ A;  3HHT B;  2F5K A;  1KC8 C;  2EYQ A;  5EG2 A;  1VQK T;  3RMS A;  1YI2 T;  2ZCF B;  1VQK A;  3QXE B;  1YI2 A;  3L2Z A;  3OYH A;  3OYB A;  4N4G A;  4RMO A;  2XDB A;  5D6X A;  1Q81 U;  1JB0 E;  4XAX B;  5GAN 8;  1Q82 C;  3OYD A;  3QPH A;  5CCA A;  2H3J A;  3A8H B;  4MDW A;  4E7J A;  2QEX T;  1KQS S;  3HRT A;  4M78 B;  1UGR B;  2QEX A;  3CBO A;  1VIF A;  3LGL A;  2JOY A;  3OBY A;  4QQ6 A;  5LJ3 f;  3CMA T;  3QYH B;  3CMA A;  4HCZ A;  2X4X A;  2QQS A;  3ME9 A;  3E9F A;  5A2Q E;  4M78 G;  2O01 E;  1UEB A;  2A3L A;  4O5V A;  4XU2 A;  3A8O B;  3HFO A;  4HNT A;  3CBM A;  3BG3 A;  4JUV A;  2FHD A;  3OW2 S;  1VQL T;  2KVQ G;  3OYC A;  1M90 C;  1BI1 A;  4J7I A;  4M75 A;  4IUQ A;  5GAN e;  1VQL A;  5I2M A;  2EQK A;  1H64 1;  4XTW A;  2BUD A;  3M4G A;  3BW1 A;  4BAC A;  4IUT A;  4M75 F;  4EMK B;  2RK1 A;  3TW7 A;  1I81 A;  3P8B B;  1HK9 A;  4AKH A;  2PU9 B;  2E65 A;  3SWN A;  4E7H A;  1N8R C;  1ZBX A;  2KAF A;  2LRQ A;  3M4Y A;  1QP3 A;  3E19 A;  2JN0 A;  4BDY A;  1U1T A;  1NPR A;  2P0P A;  3URG A;  1WQW A;  2XHC A;  1BI3 A;  4NL2 A;  5DLQ E;  3RMQ A;  5IAY A;  1G5V A;  2VYT A;  1K8A C;  1G3W A;  4HCB A;  2DAQ A;  4C8Q A;  5GAN h;  1Q7Y U;  1QLB A;  2FL7 A;  4KUL A;  3CCE T;  4QVZ A;  2RA2 A;  4JX4 A;  2RB6 A;  4HKE A;  4BB7 A;  3S6W A;  3V7S A;  4C5G A;  4C8Q F;  4BBR M;  3CCE A;  3CCU T;  4M77 A;  4ATO A;  3E1S A;  2LCC A;  2ZPI B;  3CCU A;  2R58 A;  1BI0 A;  4YTL A;  2QQB A;  5LJ5 h;  4C5E A;  1JBM A;  1Q81 C;  1NJI U;  4M77 F;  2MWP A;  5GAN 5;  1N9R A;  3C12 A;  3JCM h;  2BS4 A;  2QQ9 A;  4AI6 A;  4X34 A;  1VQO T;  3BDU A;  2XD0 A;  4PKC C;  3G71 T;  1VQO A;  2DXB A;  3MP8 A;  4M75 B;  4RG2 A;  3DKM A;  3M5A A;  3G71 A;  4XTX A;  4C0D B;  1DJ7 B;  2RI5 A;  4M7D B;  1I8F A;  5A0D A;  4NOY A;  4XQ3 A;  2CYZ B;  3M58 A;  5GAN f;  4M75 G;  1VQ8 T;  1VQ9 T;  2XI9 A;  1VQ8 A;  1VQ9 A;  1BIA A;  3QYE A;  3SWN B;  1VQ5 T;  5J26 A;  4M7D G;  3QO3 A;  1I4K 1;  4E7L A;  2CZ1 B;  5LJ3 d;  1K73 U;  1VQ5 A;  2KQW A;  2Y4Y A;  3QWL A;  3VKG A;  3MCA B;  3HB9 A;  1P92 A;  5LJ5 f;  3LW5 E;  1QP2 A;  4R56 A;  1U8R A;  4C8Q B;  2VV5 A;  3JCM f;  5GAN 6;  2DD5 A;  3MP1 A;  5DM7 R;  2MI6 A;  3L42 A;  3QZ5 B;  1QW1 A;  1WPY A;  1JJ2 A;  1UGP B;  5D6Y A;  3QII A;  1W2B S;  3A8M B;  4F7U E;  4ELJ A;  2GF7 A;  4QSH A;  3OYE A;  2C06 A;  3M53 A;  3X24 B;  3GNF B;  2JZ2 A;  3CCQ T;  3CCQ A;  3EFR A;  1YIJ T;  2K2V A;  2KDS A;  5FU7 B;  1YIJ A;  3EAE A;  3FJP A;  4FT4 A;  5C0M A;  3M54 A;  1WGS A;  3MET A;  1Q7Y C;  1H3Z A;  2DXB B;  2OTL T;  2EKO A;  3BY7 A;  3CBP A;  2OTL A;  3PGG A;  2RK2 A;  4LDW A;  4PLI A;  3G7Z A;  1NZ9 A;  3VUB A;  4C5I A;  3SB2 A;  3TU4 K;  2M1H A;  5LJ3 e;  3UPU A;  4M7D D;  1NJI C;  4ZN1 A;  1OI1 A;  1QVF A;  1EIF A;  2K5F A;  2RO0 A;  2ZGW A;  5LL6 S;  2RHX A;  4M78 A;  4Q5W A;  5GAN j;  5EJC A;  1Y96 A;  3OW2 A;  4PLL A;  2I2L A;  4QQD A;  3KUF A;  4CRI A;  4JRK A;  3ER0 A;  5FU6 B;  5CKB A;  2OTJ T;  4JX5 A;  2RJD A;  1Y7X A;  2F5T X;  4J8O A;  2OTJ A;  4IUP A;  2JNG A;  2DD5 B;  3H8Z A;  2RHI A;  1M1G A;  3BG5 A;  1M1K U;  1M8V A;  2QF7 A;  2XDD A;  3HBL A;  1K73 C;  2XKO C;  5CAI A;  4X9D A;  5DLO A;  3L2W A;  1X75 C;  4C92 C;  1O9S A;  3M9Q A;  5GAN d;  3C4S A;  4BI8 B;  3L2R A;  5FRO A;  4E7I A;  2KK4 A;  3TEE A;  4C92 E;  3JB9 H;  2L8D A;  2E10 A;  2R57 A;  3LLR A;  2XK0 A;  4QQG A;  4BUG A;  3S3M A;  3SFM A;  5FRM A;  3CD6 T;  1WJS A;  4BE0 A;  1TH7 A;  1M4Z A;  2K3X A;  5LJ5 d;  3CCR T;  3CD6 A;  3CPF A;  3CCR A;  4MFD A;  3PMI A;  2ZPH B;  5C6S A;  3TW6 A;  4ZGJ B;  3JCM d;  2VXE A;  4NL3 A;  1JJ2 S;  3NFC A;  4RCC A;  4L59 A;  3V8K A;  1VQ7 T;  2LX9 A;  2JUF A;  3L2Q A;  5GAN g;  1VQ7 A;  4C0F A;  4ELY C;  1ZQ1 A;  1Y96 B;  2P0Q A;  2WSE E;  2EFI A;  3OS0 A;  3MO8 A;  3PMT A;  3V7R A;  1SSF A;  2MAM A;  2CGH A;  2RD1 A;  2RHZ A;  3CEY A;  3GNG A;  3QKJ A;  4EPC A;  4PJO G;  3HSB A;  2DTI A;  4LDU A;  5HK0 A;  4MFE A;  3PFS A;  4D6W A;  3EFS A;  4C92 D;  4PJO C;  2GFA A;  2MWO A;  4CI0 C;  5CR2 A;  1GXI E;  2HQX A;  1XQH A;  4PJO E;  3VJP A;  4XK8 E;  3CCM T;  4M7D A;  3DLL A;  5GAN 3;  1VQM T;  3FLG A;  4O6J A;  3CCM A;  2X35 A;  1YBY A;  3G6E T;  1VQM A;  1RI0 A;  2PQW A;  3G6E A;  1N6A A;  2ZPG B;  1BKB A;  4BD3 A;  3JB9 D;  4M7D F;  5LJ5 e;  2K4Y A;  1WQ7 A;  2EJ9 A;  3ZEH A;  1QVF S;  2BS3 A;  2QDY B;  3J7A F;  3JCM e;  5GAM h;  3OMG A;  3OS2 A;  1M1K C;  3J80 E;  2QXF A;  1LOJ A;  3CC7 T;  5KCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...