1UGRB

Crystal structure of at109s mutant of co-type nitrile hydratase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Nitrile Hydratase alpha subunit
total genus 65
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugrB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugrB02
1PSEA 2ZPEB 1GXIE 4Y28E 1UGRB 3A8MB 2PVOB 1UGQB 2DD5B 2PUKB 1UGPB 1UGSB 3WVDB 4L6V5 3X24B 3X28B 4XK8E 2ZZDB 2DXCA 3A8OB 2WSCE 2DD5A 4ZGJB 1QP2A 2ZPHB 3A8LB 3QYGB 4OB1B 3A8HB 4KT0E 2CZ1B 2DD4B 4OB3B 2CZ6B 2ZPIB 3X26B 1DJ7B 1AHJB 1QP3A 4ZGEB 2D0QB 1PSFA 2O01E 2PVGB 3VYGA 2DD4A 3LW5E 4ZGDB 2DXCB 2ZZDA 5L8RE 3QZ5B 2WSEE 2CZ0B 3A8GB 1V29B 2PVDB 3X20B 2DXBB 4OB0B 3QYHB 2QDYB 2ZPGB 2ZPFB 3QXEB 2CZ7B 1JB0E 2ZCFB 4FM4B 2DPPB 3VYGB 3HHTB 2CYZB 2DXBA 2PUOB 2PU9B 3VYHB 3X25B 1IREB 3WVEB 2AHJB 4OB2B 2ZPBB 2WSFE 3QZ9B 4RKUE
chains in the Genus database with same CATH superfamily
2MF2A 3L2VA 4ORZA 4FYVB 1QWEA 4FT4A 3CEYA 1LVKA 3EH2A 5IHYA 4J9DA 5AYFA 2LTOA 2RQVA 2RA2A 1ZX6A 1FINB 5LJ3f 1WHKA 3VKIA 2C4GB 2COZA 3H0HA 4FYYB 5GAMf 3RESA 4JX5A 2GTJA 2ED1A 4DBHA 4C0DC 4IKFA 3HBLA 5DQVA 4OB1B 3C4SA 3BG5A 1RAHB 4O6JA 4F7SB 3MEWA 3G71T 3TVTA 3L2UA 1VA7A 3JCMe 4HVVA 4KUDK 1X6BA 3I56T 4KBMB 1KQSA 4F04B 1S72A 1M5Q1 1X01A 1VQ4Q 3HRSA 3CBMA 4M77B 3CC2T 4M7DB 5A0LA 3GNFB 4C8QE 2EJFA 2I2LA 2LJ0A 1Q95G 2GTOA 5GAOp 5GANj 1FMKA 1PRMC 5LL6S 2CT4A 2KRNA 3CBOA 2F5KA 3QG1A 2K6DA 2RHXA 2MK5A 1KQ2A 1OU9A 4LDYA 3QYHB 2CGHA 2C6TB 3P8BB 1VOLA 3LGFA 3PT9A 3MO8A 4D6WA 2RF0A 1A0NB 1G83A 1O9SA 3G4SA 4OMLA 2LNVA 4BXXX 1QCFA 5KCOA 2EFIA 2RK1A 4AFZC 1TUDA 5L23A 1MMNA 3CMAT 4A4EA 2NUPA 4F7UG 3BLRB 4F7UE 1K73C 2M02A 5FU7B 3H41A 4UN0A 2WMAB 1JJ2P 3FJ5A 2LMJA 2XIDA 4HCBA 4FSXA 5I2MA 1VQ7Q 2DZ9A 1UJ0A 3OSVA 3EIDB 2V8IA 2X4WA 3PMTA 3DL1A 2DE0X 4M77G 4M7DG 3MY5B 3I55T 3M5AA 4PK4A 5KYWB 1U5SA 4RTZA 3RNJA 3EG9B 1VQMQ 2YLCA 3URGA 3QWXX 1OKVB 1KXUA 2DK3A 3WVDB 4XTZA 3CCUT 1PWTA 3EGUA 2MYSA 2BZXA 4PJOE 1B3QA 4MFEA 2YRDA 2DX1A 1YNZA 2EWNA 4ROEA 5CKEA 3OYIA 1Q82R 1M8MA 1QP3A 1Z9QA 1FXXA 2JZ2A 3CC7A 2V1RA 4M78D 4M75G 1Q82C 3BDLA 2KRMA 4OVAA 1GBRA 1M90R 2JJ9A 5KYUB 2YDLA 1H26B 2DD4A 3LW5E 4M75D 5HY6A 3JCMb 1VQLT 3CCSA 3PTAA 3UF4A 4F7UA 1WXUA 2JMCA 1C9BA 2LP5A 3M9QA 2L89A 1SHFA 1E7OA 1WGSA 5D6WA 3KFVA 4LXCA 2GQIA 1SRLA 4G6LB 4C0DB 1W2BS 3QXEB 5IXFA 2LX9A 1JXMA 3JB9I 1SKUB 4J9GA 2KEAA 3SHWA 1Y57A 2DL8A 3M0SA 4C8QA 3J80E 2KSSA 4KH1B 2GFAA 2LT4A 4HNTA 5HBJB 4F70B 2PJQA 2DA9A 2HDAA 3H9NA 2D0NA 2LRQA 5LJ5f 1D1AA 3G1JA 1SG5A 4JJBA 2FPDA 3TSWA 1KQSP 2WSFE 2LX7A 4HT9A 4B9XA 3JB9F 1PNJA 4MZPA 3JCMh 1XTDA 1MHNA 3QO3A 2DTOA 4LNPA 1FKMA 5KYXA 4QQ6A 1PKSA 2KR6A 3SD4A 2KT8A 2YT6A 3A8MB 4ZTFA 2IW6B 2G3RA 4BY6C 3OMCA 4O5VA 4PFZA 2XG8D 2RO0A 1YIJQ 1JJ2A 4EOQB 1Y71A 1FX7A 1AT1B 2F2VA 3VKGA 1M1KR 3NGPA 4KUIA 1OV3A 3CCSQ 2WFYB 3M0PA 1B7TA 3NPFA 2K3YA 2Y4XA 5LMKB 5EJCA 1SF9A 2C0TA 2QTVA 4C8QB 5CAIA 2OTLQ 4QQDA 4EOPB 1YJWQ 3QIIA 2LW4A 2AIRB 2FEIA 1AHJB 1KSWA 4EMHA 4J5YA 4BUGA 1YHQA 3PMIA 3OYKA 2CP7A 4C0ZA 1YWPA 1OX9A 4J7IA 1W70A 2F2WA 3TU4K 4PJOG 4ZGDB 2KMTA 3QWLA 2K57A 3CXCP 3DJBA 2DBKA 2DNUA 4BACA 3I35A 1VYTA 1M4ZA 4J6XA 4YC3B 2JMAA 2HSPA 4C0GA 5HBHB 1H641 1H1RB 4X9CA 4M77D 4M7DD 3M0TA 2DJZA 1Q7YC 2ZPFB 2BKDN 2ZGWA 1ZUKA 2EAYA 2CREA 2NUPB 4XTXA 2KYMA 3C0CA 3OY9A 2GFUA 3TNHB 2QAZA 1N9SA 2QF7A 1ZA1B 5LQFB 1RAFB 4FU6A 4DOVA 2KI7A 1JU5C 3WVEB 1KC8C 1VQPQ 4RG8A 1GCQA 4BBSM 2F2CA 3LWHA 4CI0C 4LOCA 4YTLA 2YUPA 1YN8A 3OYYA 2ED0A 1F5QB 1WJRA 2OTLA 2WIPB 4CC3A 4CFMB 1JSUB 2LT1A 5HCKA 1UGSB 4FSSA 2V1QA 4Y92A 3L42A 1QCOA 3HP9A 2DXCA 2DAQA 2BZ8A 2WSCE 1QKWA 4KGVB 3A8LB 4M78B 1ZBJA 2PMIB 2BUDA 4MMLA 1X2QA 4AMCA 1VQ4A 3V7RA 2A37A 1Y96A 3QBYA 3JCMf 1TS9A 3C94A 1AISB 1VQ8Q 2EYWA 2P4RA 1B34A 2LDMA 4IUTA 3JCMW 1MMDA 2D8JA 2X9HA 3OS1A 2P4TA 1YI2A 2O01E 2WACA 3VRZA 7AT1B 3F70A 2PVGB 2OJ2A 4QKUA 3UPUA 4OGRB 2VASA 2KNBB 1R77A 1G8XA 2BTTA 4OMOA 3CQTA 2EQKA 3CMAQ 2FO0A 1VQ6Q 1KHCA 2ATCB 4GLMA 2LNHB 4FW1A 4E6RA 4M7AA 2DZCA 3HFOA 3CD6Q 1UNGD 5IDPB 3C95A 2J06A 2E3IA 2HKNA 1JB0E 3EG1A 1YBYA 2KE9A 1I81A 1RAEB 3CCQA 4CFXB 5GAOr 2COWA 3OYFA 4NC6A 2A28A 2KK4A 2EGCA 1G3YA 1E6HA 1KK7A 4A4FA 3UWNA 4Z6YA 4II5B 3H4CA 1BCMA 4X9DA 1Q81C 4XU1A 2BE9B 4N0AC 6AT1B 4C92A 2DKGA 5GAOl 2DRMA 4TVRA 1WXBA 4EC8B 2P0QA 1H4LD 2QG9B 2C0OA 3RERA 2DVJA 3DKMA 3UA7A 1VQKQ 1OIUB 1M3BA 2L3RA 1VQ5A 3CC7Q 4M75C 4C5GA 4Z8AA 3NTIA 4HVWA 1Z9ZA 2MIOA 4OMQA 5KE3A 3GP8A 2DD5B 1NBEB 3S3NA 1OZ3A 2DRKA 1GBQA 1LCKA 5DLQE 2X4YA 1KG1A 1I5LA 1JQQA 3QHSA 1IZ6A 1RI9A 1XJWB 4EMGA 3MP8A 1QP2A 3VUBA 2W10A 3THKA 1SSHA 1VQ6A 3PFSA 3OW2S 1VYUA 2CP2A 4JX4A 3CC4T 3MEAA 3OS5A 4BCNB 4BCQB 1ZUYA 2J6OA 1W2BA 1QMCA 3RKXA 1OOTA 1X27A 4HCZA 4BCMB 1T3SA 2FZKB 2KQWA 1YITQ 3BHTB 1IB8A 2QQAA 3EGXA 2DFUA 1WLPB 1QMZB 4R56A 2QEXA 3BE3A 1TWBA 3QZ5B 2WSEE 4XU3A 3HTRA 1GUXA 1WHHA 2E70A 2HZYA 5KYWA 2D8HA 5CEIB 5IXBA 4X1VA 4J83A 1W4SA 1V29B 3X20B 1YJNA 4OMFB 4BY6B 4M78C 4RUGA 3TQ7P 4BY7X 4PFOA 3RBBB 2XMFA 4F17A 1VQ7A 4HLQA 2E64A 4F14A 2F2XA 3VYHB 1B07A 1UB4A 5GMKi 3LH5A 1AEYA 3LGLA 2ECZA 2RHYA 3PIPA 2UZLB 2CP6A 5GJVB 3PE0A 1VINA 2HQEA 4F7LB 4CC7A 3I56Q 4RG2A 3JCMX 4M77E 4M7DE 4DEYA 5GMKj 1PSEA 2W9ZA 4EMKA 1WZOA 4LDVA 2R58A 4IUUA 4F6UB 1M27C 2VGNA 1UGRB 2UUEB 4EMKC 2EUFA 3OYAA 1R8OB 5CK9A 4F6SB 2C0IA 3M57A 4L6V5 2H3JA 2EJ9A 3HO8A 2C5XB 2QDJA 2DIQA 3CCQT 2HAXA 1WYXA 5LJ3h 3GTMS 1MV0B 2K2MA 1YJNT 1NPPA 2XHCA 1VQLA 5FWBA 4QQGA 4RCBA 5IHKA 2CH4A 4HKEA 3CMAA 1NJIC 3VJPA 2EGEA 2CP3A 4LUDA 3EAEA 4EOMB 2VKNA 4CRLB 3PGGA 1H3ZA 3QYEA 1RAGB 4IUVA 1K1ZA 4M75E 1NEGA 2YXYA 5GAMg 4PKCC 1FWZA 3FC3A 3N5BB 1UFFA 1YJNQ 1Q81U 5LJ3e 2J6FA 2O4XA 5I21A 1UE9A 4A4HA 3OYGA 1NYFA 2R57A 1IGUA 2CS7A 4AFQC 2IN3A 1UDLA 1OKWB 2CP0A 1OGUB 3MKDA 3RDVA 2CT3A 2IPOB 4A53A 5GAN6 1WI7A 2D1XA 3OYBA 3G71A 1QCNA 1W6XA 3B57A 5EFQB 2XU8A 2UZEB 4F7JB 1WJSA 3A8GB 5CQXA 2VC8A 4JZ3A 3CCLQ 2KGTA 1YJ9A 4HCCA 3EHQA 4MDWA 1D0ZA 4JRPA 3G6EQ 1RLQC 2R5AA 1YCSB 1QLYA 1OIYB 3PVQA 1F1BB 1VQMT 2K9GA 2CKKA 2SEMA 5FLXE 2LCLA 2OAUA 1VQPA 5L2WB 1MMAA 4ANJA 4ELJA 2QEXQ 3G33B 3I5RA 9ATCB 5CKHA 1MUZA 3CCVA 2LVMA 2YRVA 1ZHIA 4BBRM 4JRKA 1UEBA 1M8VA 3CCEA 1I8FA 4R55A 1PRLC 2IVWA 3O0GD 2A36A 1D3BB 1C1AA 4F6WB 2EKHA 4NOYA 2KXDA 1GXIE 1YITT 2RQRA 2BIVA 3SWNC 2W0ZA 2NWMA 4HNVA 3G4SQ 2FPFA 2XD0A 2X4XA 2EYXA 2JTMA 1KQSS 4EMKB 2ESWA 2M51A 2QGFB 4KULA 1OU8A 4ESRA 2CCHB 5KYYB 1N9RA 3HFNA 3EH1A 2EIFA 3JCMd 1UHFA 1VQOT 5KYXB 3OB9A 3ER0A 5FRNA 5GAN7 3DB3A 2DXTA 2UZDB 3VS6A 5DM7R 3A8HB 5KYUA 1YIJA 1MMGA 1BI3A 2FYKA 3CD6A 2VVKA 2O88A 4M6VA 1DJ7B 1RI0A 1M9SA 2K3BA 2DLPA 1WA7A 1C0MA 4F7UB 4C92E 1QVFP 4LDWA 5GAMj 3CMET 2HNIA 2X3WD 3H0IA 4EDUA 1X2KA 4HA8A 2EKOA 4LE9A 1JOWA 4OGCA 3RGFB 4LN2A 4PJOB 3OYLA 5GAN4 4BE1A 4N4GA 2LC4A 1HSQA 4M7AC 2CSQA 1VQKA 2R7GA 5IN1A 4BCJB 4ZN3A 3UT1A 1T3LA 3VS3A 2WEVB 2BS3A 5HQ0B 1N8RR 1EX4A 1N5ZA 4J7FA 1M1KU 3V7SA 4NS5A 2QGGA 3M0RA 3CXCS 4OMNA 2DEUA 2CYZB 2H8HA 2M0OA 2YUNA 5CKBA 3UATA 4F7UF 1U06A 3SEMA 5GAN8 1M3AA 3A1PA 4ZN1A 1YIJT 3TW6A 3MHXA 3CPWP 2CUBA 1ZSZC 3M4GA 1OI9B 3PVLA 2DEQA 3M55A 2KBTA 1MNEA 4KRDB 4YOSA 2AHJB 1I07A 3BHVB 4UC4A 1J3TA 3KUFA 3CCLA 3RR6A 3RKWA 4DBQA 2AT1B 4KGZB 1JXOA 3JB9H 3EFOB 4C92D 4GY5A 4M77F 4M7DF 4Z02A 3RKYA 3PIOA 2QI2A 1CKAA 3O5ZA 1TXQA 1WPYA 3QHRB 5I22A 1RADB 4JJCA 3E19A 3FRNA 3S6WA 1BI2A 2K5FA 2I0NA 4AKGA 1UJYA 4JLGA 4L59A 4XTVA 2XDBA 1PC0A 4LDUA 2CH4W 5I5ZB 4OB3B 4HVUA 3GIBA 2CZ6B 2W9FA 2EPDA 1BU2A 1VQMA 3CMEA 4XTUA 2NUZA 3INZA 4PJJA 2Y90A 1RUWA 1VQ9T 2DXUA 4ELLA 1Q86R 3VYGA 1GFCA 1FVVB 1VQ7T 1M30A 2R5MA 2ZZDA 5GANg 3M0QA 2X3XD 2H3EB 1OL2B 1MV3A 2DVEA 4NL2A 5GAOm 3JCMP 2HEQA 2C5NB 2EYYA 4Z89A 1VQOA 4DOWA 2DXBB 1GH6B 3QSUA 3TEEA 1YJWA 1G3TA 3FIFA 1Y0MA 2ZPGB 3OQ5A 3QDFA 1SRMA 4ELZC 4MZTA 4BY1X 4QW2A 5GMKl 2EQIA 4A4KA 1TG0A 4WCIA 4GLKA 3HHTB 5A2QE 2GF7A 3I5SA 3VRYA 2CDTA 3L2RA 2M16A 4YOZA 2RHUA 5D6YA 1K73R 4HL4A 3CCQQ 1W1FA 2EQMA 1IREB 1NE8A 2MWPA 3FEOA 3RIRA 4AKHA 5HKCA 3UDCA 4RTTA 2DL3A 4C8QF 5M9OA 2EJGA 2QXFA 4JJDA 1H1PB 4E7HA 1Q7YR 1P5EB 4N4IA 4A54A 5GMKm 2OTJT 3OBYA 4CFNB 1JJ2S 5CYIB 1WHMA 2VB6A 2VWFA 1QQJA 3QPHA 4E7KA 1WIEA 4C8QD 4JRQA 3JCMQ 2RJEA 1GCPA 4JS4A 4BE0A 2QFZA 1WHGA 2JVVA 4RCCA 4XK8E 1GFDA 1S72Q 3ZFJA 5D6XA 1BBZA 1BCOA 2MMPA 1B34B 5KYNA 1X6GA 3TSZA 3V8LA 2DD5A 4M78E 2L3SA 3QYGB 5KH6A 4YOOA 4CXAB 1OI1A 3X26B 2HMAA 2L2PA 4BCGB 1RLPC 3CD6T 3LWIA 1AWXA 2JS0A 3V8JA 3MEUA 3ZBDA 2LZ6B 4C92F 4JX6A 4PJOA 1S72T 4PJLA 1OULA 3GPLA 2JW4A 1Q7YU 3E1SA 3OMGA 3AHUA 1KC8R 3OYHA 1OQKA 1YJWT 1PCXA 1G2BA 1FMVA 1RAAB 3VU3C 3H6ZA 3CCJT 4A63B 1C6VX 4QT7A 4EOOB 4EPCA 2EGAA 2WJ9A 1PD1A 3EFOA 5IH2A 4TTHA 3RMSA 1KFZA 1TSFA 4LD6A 2QQSA 4J6YA 1AD5A 4EC9B 3CCRA 2EQUA 5D7UA 5DLOA 2ABLA 4AFSC 2E6NA 1Q82U 2PU9B 5I2SA 4C92C 2O31A 2JUFA 5GMKe 1PKTA 2HSEB 4AT1B 5C6SA 4E2FB 5IHNA 1M90U 1NJIU 4L5GA 4C5HA 1VQOQ 2HQXA 2OTJQ 3BW1A 3MP1A 5FU6B 3ZL7C 1KC8U 1OPKA 1VQNQ 1H1SB 2DYBA 1H92A 1UGQB 2RQWA 1H1QB 3QJYA 1MNDA 1T0JA 3E9GA 3MY1B 2FRWA 4OMPA 1RACB 4LUEA 3TREA 1K9MR 1H27B 2ZZDB 2DTIA 2RI5A 5GANf 3EG9A 2P0PA 4IIMA 2COYA 2DO3A 4OGEA 3M53A 3EHRA 3MP6A 1D0XA 4ZGJB 2GCXA 4M75F 2ZPHB 4CC4B 3DLMA 2QEXT 3VS5A 4B9WA 2DYIA 1N6AA 3HSBA 2FPEA 1UUEA 3CCUQ 1G3NC 1BYMA 1KIKA 3MCAB 3BLHB 3L2ZA 2K4YA 3HPWA 2EVRA 2FVUA 4I3ZB 5FU7C 4XTWA 1IO6A 2HCKA 1AWWA 4ZGEB 2NUTB 3BY7A 2FG0A 2RM4A 4A4GA 5AT1B 1VQ6T 1JKWA 4C5EA 1BI1A 4PJNA 5BNJB 3BDUA 2QA4T 1TUCA 4DQ2A 4FYWB 1D3BA 2CUDA 1K9MC 5KCHA 2DF6A 1SPKA 2E3HA 2QK0A 5LJ3j 4F7NB 4B6MA 8AT1B 2XICA 1UNHD 5CKDA 3JV3A 5HNBB 5GAN2 2RI3A 3QUIA 2OX7A 3VKHA 1I1JA 2YLBA 1KJWA 3OS2A 2QQ9A 3CCET 1ZP2A 5HBEB 2BS2A 1SSFA 2FRYA 4RTYA 1X43A 5J39A 3U23A 2ENMA 2W2HA 4N4HA 3S3MA 2C06A 1ZLMA 1BK2A 1AD6A 1V76A 1T0HA 3M4YA 1X75C 4HCKA 3TNWB 4D8KA 3G6EA 2HQHA 3E2UA 4Y72B 2IG0A 1Y7XA 2JT4A 1PM3A 3ZEHA 4DBFA 3EFSA 2JOYA 2JM8A 2HBWA 2PK2A 4QVZA 1K4US 1Q86C 4DEXA 4CRIA 3FJPA 1N27A 1K76A 4Z88A 3OYMA 2AZSA 2RI2A 2GGRA 4P5NA 5FWCA 2L3PA 1ZQ1A 4E7JA 5GANd 2KDSA 2YHTA 3IQLA 4JPBW 1BB9A 3OS0A 3TCJA 3C12A 3CC4Q 1K0SA 2BZYA 1W2BP 4XQ3A 3GF5A 1YITA 2RD1A 1VYWB 2KAFA 3CMEQ 2LCSA 3L2WA 3PNWC 3JCMc 2PZ1A 3JAME 1JO8A 2DD4B 3I55A 1K8AR 2RJCA 4OP0A 4VUBA 3CBPA 4EOSB 1G3SA 2W99A 3KBGA 2HKQB 4BE2A 2JS2A 2X35A 3HB9A 3TW7A 5IT9E 1D0YA 4KRTA 3VS2A 3OYJA 3CC2Q 5CR2A 2BKZB 4D8DA 4BCOB 2WHBB 1XQHA 3QWYA 3QKJA 4PFPA 2QGSA 1VIEA 2L0AA 1VQ4T 5LJ3g 1M90C 3I55Q 1ABQA 2WXVB 1KD1U 2CZ0B 3PO3S 3DOGB 3EJ1B 3CPFA 3NDQA 2G9XB 1VQ8A 3M03A 4HNUA 1X6OA 3T9NA 2AKKA 2A7YA 1ZA2B 1VQ5T 2EW3A 2ZCFB 4FX3B 1VIFA 4M78G 1CKBA 2K2VA 2ROLA 1U1SA 1M2VA 2MI6A 3META 2E41A 1ZSZB 5GAMd 3BHUB 1N8RC 2O9SA 2RN8A 1WQ7A 4M75A 1OEBA 3MEVA 5IHIA 5HK3A 4C5IA 3P8DA 3CC7T 5HVYB 5A0GA 5KYYA 4X34A 2KY9A 3VS4A 4ELYC 3JCMV 5IAYA 2HL3A 1D1CA 2PNIA 2JTFA 1IRXA 4M7AE 3HRTA 4C8QC 2Y4YA 2J05A 2XDPA 2GBQA 2ZPEB 1EFNA 4Y28E 3FDRA 2HD0A 3OA6A 3NHNA 5EC7A 1KD1R 3OYNA 2Z0WA 4IMYB 1UG1A 3CCEQ 2WPAB 1TTHB 3K7AM 4FYXB 3EFRA 4CFUD 1TFBA 2PUKB 2EYZA 1UGPB 8ATCB 3X28B 1HK9A 3KXTA 2QTXA 4CC2A 4BCMD 2FZCB 1VQ8T 1ZUUA 2AK5A 3A8OB 1H8KA 1UHCA 2DL7A 1O75A 2VXEA 2C5VB 5I11A 3KHIA 1AWOA 4XU0A 2IW9B 4J9FA 2I53A 3OYDA 2GQVA 4EOLB 2CZ1B 4MMKA 1XNIA 1I5OB 4RTVA 2E65A 2B8AA 2VGMA 5GAN3 4BDZA 3OSSC 3CCLT 1WQWA 2EQJA 3OW2P 3CCRQ 3LH0A 1QW1A 3EGDA 4CFUB 5CIUA 4EOJB 2RH2A 4M7AB 1BI0A 1K0XA 3LX7A 3VS1A 4BD3A 2KR3A 4ZNXA 4R0KA 4IIOA 2JNGA 3FLGA 1UECA 4RODA 2LQ8A 1U1TA 3WXMB 2I40B 4JJNK 1CSKA 4OB0B 4M4ZA 2F1LA 1HYOA 2F5TX 1FMWA 4FT2A 3NMZC 4FL6A 1GUXB 3EG2A 1WX6A 2NYSA 4WF2A 2KMGA 3GNGA 5GAMe 4FM4B 1QVGS 2DPPB 1XOVA 5CO7A 5GAOn 1JEGA 4MDXA 1H3HA 4RMOA 2F69A 4J9IA 3QYBA 4EORB 3HKSA 2A08A 4OB2B 1QVFA 2A3LA 3RMQA 4RKUE 3CCMT 1EIFA 2JN0A 4PLLA 4GBQA 3P8HA 3EG0A 1QVGA 1PHTA 3HRUA 3H0FA 4BCND 2E1HA 2FHDA 2YUQA 4LDXA 2KVQG 2OAWA 1NPRA 4QVDA 1NEBA 1QWFA 5GANh 3BG3A 1JRIA 1OZ2A 2K7AA 1YJ9T 2RQTA 2WIHB 1IXDA 1PKDB 3MPUB 4RTUA 3I9QA 4PNOA 4M77A 4M7DA 1K9AA 3CCST 1YHQT 2RQUA 2CSIA 3QJ6A 2ZPIB 1EZZB 2MPXC 5ACBA 2KRSA 2X51A 1SEMA 3GLXA 2RNAA 1M1GA 1FYNA 1Y07A 5GANe 2IVXA 5IDNB 2V22B 1URCB 1V1CA 2VXFA 1WJQA 2FB7A 2BPMB 1AVZC 1GL5A 4DBRA 4OR5B 1UGVA 1O9KB 4E7ZA 4J9EA 5FW9A 1RABB 1S1NA 1KHIA 3BFMA 4LD9K 3V8KA 2X4JA 2EBPA 4AFUC 3NTHA 4AG1C 1IHWA 2DIGA 3TNIB 4C92G 3SFMA 5FRMA 5GAOq 1NM7A 2PVDB 3VV0A 2DMEA 2RB6A 2QQRA 1ZBXA 3G7ZA 1K9MU 2O4XB 1VQKT 4BCKB 4WTOB 3S3OA 3R6OA 5FGKB 5HK0A 4PJOC 2E10A 2IW8B 2M0YA 3JB9J 2RHZA 2LQKA 1D09B 2OTJA 3SWNA 1TOVA 2IIMA 1Q81R 4PL6A 2DL5A 3LQ5B 5C0MA 5KE2A 1E6GA 2V26A 2DL4A 3D7SB 3BLQB 2K79A 2V8KA 4PJMA 3R6NA 2PHGA 4KH0B 3HL8A 3VS0A 1R0BG 2NUTA 4Y91A 4CFWB 5CCAA 1H24B 1VQLQ 4E7LA 1GY3B 1IGQA 3REAB 1O9KA 3QHWB 1YHQQ 2K5LA 1NLOC 2LQNA 4N0AA 2AKLA 2XDDA 2DERA 2D6FA 5LJ3d 3X24B 5GAMh 4FCYA 2DM1A 2JXBA 2DJQA 1YI2Q 3EGXB 4FIBA 3J81E 1TD6A 2E4HA 4E47A 4ZTJA 1I0CA 2KXCA 3DDPB 3L2QA 2SRCA 4AKIA 5CVIA 4Q5WA 4M7AD 4BCQD 2DMOA 5DQWA 2QDLA 2QA4Q 1NZ9A 3JCMg 4AG2C 5J26A 3DDQB 1LNXA 3OBWA 5LJ5g 3DTOA 3LYIA 3J7AF 2P0KA 3G6ET 1PSFA 1NJIR 4XTYA 2VUBA 2DXCB 5L8RE 4BI8B 1I4K1 4M7AF 1U8RA 4NSTB 5GMKh 3EG3A 1BIBA 1UNLD 2G6FX 2K5IA 3ME9A 3CPWS 3EGDB 2RMOA 2YWWA 2XKOC 1YWOA 1X69A 3JB9D 4MIMA 4J6WA 1QKXA 2MOXA 1Y96B 2ROTA 4C0FA 1G5VA 5IF1B 1ABOA 4ME7A 2JGZB 1AWJA 2CZ7B 1U3OA 3DB4A 3M54A 3CCVT 3JRZA 2XI9A 1QVPA 2J7IA 2X1NB 1YFNA 1NLPC 4RTXA 1VQNT 1VQPT 3V7CA 3MJXA 2PUOB 2AZVA 1R0CB 1QVGP 1HJDA 2ZAEA 1K8AU 4NL3A 1WHJA 3X25B 3OYEA 2RJFA 2RPNA 5EG2A 1D1BA 4BDYA 5FU6C 3FB9A 5CQYA 1BKBA 2CP5A 2DTHA 2DBMA 4HXJA 2NLUA 1SHGA 1H28B 4QSHA 3TN8B 5A0DA 4KRCB 4JZ4A 1TH7A 4MFDA 1WDXA 4OMMA 1XO2A 2CCIB 2GNCA 2QA4A 1PD0A 2PVOB 4PLIA 5LJ5h 4EOKB 1ACMB 1W98B 2QQBA 5GJWB 1LOJA 3SDZA 3QDRB 2KROA 1LJOA 5CKFA 1N8RU 3VS7A 1TUGB 1GRIA 2RHIA 4EOIB 1IHVA 1AOJA 1BU1A 1JBMA 4M78F 2MCNA 3E9FA 4M77C 4M7DC 1M3CA 2E5QA 3CC2A 3G71Q 4C8QG 1MGQA 1M2VB 4J9BA 3UA6A 2J6KA 3A98A 3CCJA 2YRCA 5LJ5j 2DILA 4JRIA 1YJ9Q 2BS4A 2OI3A 1K8AC 3JSCA 3A5ZB 2QASA 5ECAA 1WHLA 1VQ9Q 3DLLA 1E9HB 2D0QB 3M58A 2BE7D 4E7IA 3CPWA 4BCIB 3M56A 1RL2A 2HL5C 4HT8A 3JB9G 1ARKA 4BCPB 1TU0B 2E12A 4FW2A 1OL1B 3M0UA 4BB7A 3GBQA 1WFWA 5GAN5 3OW2A 4PJOF 1VQ9A 1QLBA 1WXTA 1ENWA 4EIKA 3VUZA 1VQ5Q 3AT1B 2CJMB 1GCQC 2LJ1A 4E7SA 3SB2A 4II1A 1AZGB 1HXDA 2OTLT 1VUBA 2PQWA 4J9CA 3LLRA 3ULRB 3VYGB 2DXBA 2C5OB 2E5KA 1HD3A 4PJOD 1M1FA 4JDSA 2VV5A 3CCMQ 2L3QA 4ATOA 3OYCA 1KD1C 3JCMJ 4BI4A 3SWNB 2O2OA 1OX8A 2G77A 1Q86U 2ZPBB 4CFVB 4M75B 4V2SA 1KQ1A 3M59A 1PG5B 2LQWA 2YUOA 4QVCA 2EYQA 4DA4A 4J8OA 4C92B 5DY9A 1JSTB 3Q1JA 2L8DA 1VOMA 2RJDA 3CCUA 1ZSGA 4MZMA 2M1HA 4IUPA 4XU2A 2B9RA 2FL7A 1NG2A 2MWOA 2WMBB 4EONB 2KT1A 1NYGA 3NTKA 3I56A 2K3XA 2QYZA 1AZEA 2A0FB 2DETA 5ICPB 3MI9B 1QVFS 4K11A 3CC4A 1VYVA 3CCVQ 2QQ8A 4KT0E 4J9HA 4KGXB 1VQNA 4BCHB 2E6ZA 4JLIA 1K73U 5LJ5d 1E7PA 2UZBB 2KYBA 1LPLA 4IUQA 3F5XB 1M2OA 1WNLA 2V8JA 3EOCB 2VYTA 3CCRT 3MIAB 4AI6A 1OYXA 5LJ5e 2XK0A 3HZJA 1D3UB 4XAXB 4RTWA 4JS5A 2PTKA 4JUVA 4M7AG 2FZGB 3CCMA 3BG9A 4IURA 3REBB 5J3BA 4BCFB 2RK2A 5FROA 1RAIB 1ZSZA 3O8VA 3RUXA 2QDYB 4F16A 2MAMA 1G3WA 4BI3A 2PK9B 3CCJQ 1M1KC 1H25B 1YCYA 4M78A 2JTEA 2HBPA 3L1AA 3ASKA 2D9TA 1N4MA 3G4ST 4OF1A 2W96A 1BIAA 1OPLA 1UTIA 3CXCA 3NFCA 2O9VA 3GOXA 2M9UA 1YI2T 3H8ZA 4ROCA 3POMA 2JM9A 2LJ3A 2LCCA 2L5QA 2YSQA 2P84A 3QZ9B 1P92A 2B86A 1YP5A
chains in the Genus database with same CATH topology
2MF2A 3CCMT 4N4IA 4A54A 1EIFA 2JN0A 3NTIA 4PLLA 3OBYA 5GMKm 3P8HA 3L2VA 1VQ6A 2OTJT 1JJ2S 5KE3A 1QVGA 4FT4A 3HRUA 3CEYA 2E1HA 3QPHA 4E7KA 2FHDA 3GP8A 5AYFA 2DD5B 4LDXA 2LTOA 4C8QD 4JRQA 3JCMQ 2RJEA 2KVQG 4JS4A 3S3NA 1OZ3A 1NPRA 4QVDA 4BE0A 2RA2A 2QFZA 5GANh 3BG3A 1JRIA 1OZ2A 1YJ9T 2JVVA 5DLQE 4RCCA 4XK8E 5LJ3f 2X4YA 1KG1A 3VKIA 5D6XA 3ZFJA 1I5LA 3QHSA 2MMPA 5GAMf 1B34B 3RESA 1IZ6A 4JX5A 3V8LA 4C0DC 2DD5A 4M78E 4EMGA 3MP8A 3HBLA 1QP2A 4IKFA 4PNOA 3QYGB 4OB1B 3C4SA 4M77A 3BG5A 4O6JA 3PFSA 3VUBA 5KH6A 3MEWA 3G71T 3CCST 3OW2S 1YHQT 3L2UA 4JX4A 3CC4T 1OI1A 3QJ6A 2ZPIB 3X26B 3MEAA 3JCMe 3OS5A 3GLXA 1M1GA 4KUDK 1W2BA 3RKXA 1Y07A 3CD6T 3I56T 5GANe 3LWIA 4KBMB 1KQSA 4HCZA 3V8JA 1S72A 1M5Q1 1X01A 2KQWA 3HRSA 3CBMA 3MEUA 4M77B 3ZBDA 3CC2T 4M7DB 2VXFA 4C92F 4JX6A 1WJQA 2FB7A 2QQAA 5A0LA 1S72T 4PJOA 3GNFB 4R56A 4C8QE 3GPLA 2QEXA 2EJFA 1Q7YU 3E1SA 3QZ5B 2WSEE 2I2LA 3OMGA 4XU3A 1KHIA 3AHUA 2E70A 3BFMA 4LD9K 3V8KA 5GAOp 5GANj 2X4JA 3NTHA 3OYHA 2DIGA 5LL6S 4C92G 3SFMA 5FRMA 4J83A 5GAOq 1YJWT 1W4SA 1V29B 2PVDB 3X20B 3CBOA 2F5KA 2RB6A 3H6ZA 3QG1A 2RHXA 4OMFB 3VV0A 4LDYA 1YJNA 1KQ2A 2QQRA 3QYHB 1ZBXA 2CGHA 3CCJT 3P8BB 3G7ZA 4BY6B 3LGFA 1K9MU 4M78C 3PT9A 2O4XB 3MO8A 4EPCA 1VQKT 2WJ9A 3S3OA 3R6OA 4D6WA 1O9SA 5HK0A 3RMSA 3G4SA 4PJOC 2E10A 4LD6A 2LNVA 2QQSA 4J6YA 3CCRA 2EQUA 5DLOA 1VQ7A 4HLQA 2E64A 5KCOA 2EFIA 2RK1A 2E6NA 3JB9J 1Q82U 2RHZA 2LQKA 2PU9B 5I2SA 4C92C 3CMAT 4A4EA 4F7UG 4F7UE 1K73C 2OTJA 3VYHB 1UB4A 2JUFA 5GMKi 3SWNA 5GMKe 3LGLA 5FU7B 4PL6A 2RHYA 3PIPA 5C0MA 5KE2A 5C6SA 2XIDA 4HCBA 4FSXA 2V8KA 1NJIU 1M90U 2HQEA 5I2MA 4L5GA 2DZ9A 3OSVA 3HL8A 4C5HA 3PMTA 2V8IA 2X4WA 4RG2A 4Y91A 5CCAA 3JCMX 4E7LA 2HQXA 4M77E 3DL1A 4M77G 4M7DG 4M7DE 5GMKj 3BW1A 1PSEA 3M5AA 3I55T 3MP1A 5FU6B 4EMKA 4LDVA 2R58A 4IUUA 1KC8U 2K5LA 1UGRB 2VGNA 4EMKC 4N0AA 3OYAA 4M75C 1R8OB 2YLCA 3URGA 5CK9A 2XDDA 1UGQB 2DK3A 3WVDB 3M57A 3QJYA 2H3JA 4L6V5 5LJ3d 3X24B 3E9GA 4XTZA 5GAMh 2EJ9A 3HO8A 2D6FA 3CCUT 2QDJA 2DIQA 3CCQT 2HAXA 4PJOE 5LJ3h 4FIBA 3TREA 3J81E 1YJNT 1NPPA 2ZZDB 2DTIA 2RI5A 2XHCA 5GANf 1VQLA 4QQGA 4E47A 4MFEA 2P0PA 4RCBA 2DO3A 4OGEA 4ZTJA 4HKEA 3M53A 3CMAA 1NJIC 3MP6A 3VJPA 4ZGJB 2GCXA 4M75F 2ZPHB 3DLMA 1YITT 2EWNA 3EAEA 3L2QA 5CKEA 2QEXT 3OYIA 4AKIA 4B9WA 3PGGA 1N6AA 4Q5WA 5CVIA 4M7AD 1H3ZA 3QYEA 4IUVA 3HSBA 4M75E 3VU3C 1BYMA 3MCAB 3L2ZA 4PKCC 1NZ9A 1QP3A 1FWZA 3JCMg 2K4YA 3HPWA 2FVUA 5J26A 3N5BB 5FU7C 1FXXA 3FC3A 1LNXA 1Q81U 3OBWA 2JZ2A 4XTWA 5LJ3e 2O4XA 5I21A 5LJ5g 3CC7A 4A4HA 4M78D 4M75G 3OYGA 3BDLA 1Q82C 4ZGEB 2R57A 2CS7A 3LYIA 4OVAA 3J7AF 2P0KA 3G6ET 1PSFA 4XTYA 3BY7A 2DD4A 2VUBA 3LW5E 4M75D 1VQLT 2RM4A 4A4GA 5HY6A 4A53A 3JCMb 2DXCB 5L8RE 4BI8B 1BI1A 4C5EA 5GAN6 3OYBA 3G71A 1I4K1 3BDUA 3PTAA 3CCSA 4DQ2A 2QA4T 1U8RA 4M7AF 1D3BA 5GMKh 1K9MC 1BIBA 5KCHA 2K5IA 3ME9A 4F7UA 3CPWS 5LJ3j 2XU8A 2XKOC 1WJSA 3A8GB 5CQXA 2XICA 3M9QA 5CKDA 2L89A 2VC8A 5GAN2 3JB9D 2RI3A 4MIMA 3QUIA 4J6WA 3VKHA 2YLBA 1YJ9A 4HCCA 1WGSA 1Y96B 5D6WA 4MDWA 3OS2A 4C0FA 2QQ9A 1G5VA 3CCET 4ME7A 2BS2A 4C0DB 1W2BS 3QXEB 2CZ7B 1SSFA 3DB4A 2LX9A 3M54A 3CCVT 1VQ6T 3JRZA 2XI9A 4JRPA 3JB9I 1QVPA 5J39A 2R5AA 4N4HA 3S3MA 2C06A 4C8QA 1VQMT 1VQPT 1VQNT 3V7CA 2CKKA 3J80E 2PUOB 5FLXE 2KSSA 1K8AU 2LCLA 2GFAA 2LT4A 4NL3A 2OAUA 4HNTA 1VQPA 3X25B 3OYEA 3M4YA 4ELJA 1X75C 2RJFA 5EG2A 3G6EA 5CKHA 3CCVA 4BDYA 2LRQA 2LVMA 2IG0A 2YRVA 3FB9A 5CQYA 5FU6C 1BKBA 2DTHA 5LJ5f 1ZHIA 4BBRM 2NLUA 4JRKA 1Y7XA 3ZEHA 1UEBA 1M8VA 3CCEA 2WSFE 1I8FA 3EFSA 4R55A 2JOYA 4QSHA 2IVWA 1D3BB 4QVZA 1Q86C 4HT9A 4B9XA 3JB9F 4NOYA 4MZPA 5A0DA 3JCMh 4CRIA 1XTDA 1MHNA 2BIVA 2DTOA 3FJPA 1FKMA 1N27A 3QO3A 4QQ6A 1TH7A 3SWNC 2KR6A 3SD4A 3OYMA 4MFDA 4HNVA 2XD0A 3A8MB 2QA4A 2RI2A 2X4XA 4ZTFA 2JTMA 4P5NA 2G3RA 2PVOB 4BY6C 3OMCA 4PLIA 4O5VA 4EMKB 1KQSS 1ZQ1A 5LJ5h 4E7JA 2QQBA 4KULA 2KDSA 2RO0A 2XG8D 2YHTA 1LOJA 5GANd 1JJ2A 3SDZA 3QDRB 1N9RA 3HFNA 3OS0A 3TCJA 1LJOA 3C12A 2EIFA 5CKFA 3JCMd 1N8RU 1VQOT 1Y71A 2RHIA 1FX7A 3GF5A 4XQ3A 3OB9A 1YITA 1JBMA 4M78F 3VKGA 2RD1A 2KAFA 3E9FA 3ER0A 4M77C 4M7DC 5FRNA 4KUIA 2E5QA 3DB3A 5GAN7 3CC2A 4C8QG 2DXTA 1MGQA 2K3YA 2Y4XA 3L2WA 3PNWC 3JCMc 5DM7R 5EJCA 3A8HB 1YIJA 3JAME 1BI3A 4C8QB 2DD4B 5CAIA 2FYKA 4QQDA 3I55A 2RJCA 3QIIA 4OP0A 3CBPA 4VUBA 3CCJA 1G3SA 3CD6A 5LJ5j 4M6VA 1DJ7B 1AHJB 3KBGA 5GAMg 1RI0A 1M9SA 4BE2A 4EMHA 4J5YA 4JRIA 2X35A 4BUGA 2BS4A 1YHQA 3HB9A 3TW7A 3PMIA 4F7UB 5IT9E 3OYKA 4C92E 3JSCA 4LDWA 4C0ZA 3A5ZB 5GAMj 3OYJA 1K8AC 3CMET 2HNIA 3DLLA 5CR2A 2D0QB 3M58A 4J7IA 1XQHA 4E7IA 3QKJA 4EDUA 3CPWA 3TU4K 4PJOG 3M56A 1VIEA 4ZGDB 2KMTA 4HA8A 1VQ4T 2EKOA 5LJ3g 3QWLA 1RL2A 1M90C 2K57A 4HT8A 4OGCA 3JB9G 4PJOB 4BACA 3OYLA 5GAN4 2E12A 1M4ZA 4J6XA 4BB7A 4BE1A 1KD1U 2CZ0B 5GAN5 4N4GA 3CPFA 4C0GA 2LC4A 1H641 3OW2A 4PJOF 4X9CA 4M7AC 1VQ9A 1VQKA 4M77D 1QLBA 1VQ8A 4M7DD 5IN1A 4ZN3A 3UT1A 2DJZA 3VUZA 2BS3A 4HNUA 1X6OA 3T9NA 1Q7YC 2ZPFB 2A7YA 2BKDN 1VQ5T 2ZCFB 1VIFA 3SB2A 4M78G 2K2VA 4II1A 4J7FA 1HXDA 1U1SA 2ZGWA 1VUBA 2PQWA 2MI6A 3META 3V7SA 2EAYA 2OTLT 4NS5A 3LLRA 2E41A 3VYGB 3CXCS 2CYZB 2M0OA 5CKBA 4XTXA 2DXBA 4F7UF 5GAMd 3OY9A 1N8RC 2GFUA 4PJOD 1WQ7A 4M75A 5GAN8 1M1FA 3MEVA 4JDSA 2VV5A 5HK3A 4ZN1A 4C5IA 3P8DA 3CC7T 5A0GA 1YIJT 4X34A 1N9SA 2KY9A 2QF7A 3TW6A 4ATOA 3MHXA 4ELYC 3OYCA 1KD1C 3JCMV 5IAYA 3JCMJ 4FU6A 3M4GA 4BI4A 4DOVA 2DEQA 3M55A 3WVEB 1KC8C 3SWNB 2JTFA 2AHJB 2G77A 4M7AE 3HRTA 4RG8A 1Q86U 4UC4A 2ZPBB 4BBSM 4M75B 4C8QC 2Y4YA 4V2SA 3LWHA 1KQ1A 3M59A 4CI0C 2XDPA 3KUFA 3CCLA 4LOCA 3RKWA 4YTLA 4QVCA 2EYQA 4DA4A 2ZPEB 3JB9H 4J8OA 3FDRA 4Y28E 3OYYA 4C92D 2HD0A 5DY9A 4C92B 4GY5A 4M77F 1WJRA 4Z02A 3OA6A 2OTLA 4M7DF 3OYNA 3Q1JA 2L8DA 3RKYA 3PIOA 2RJDA 2QI2A 3CCUA 2LT1A 4MZMA 3EFRA 2M1HA 2PUKB 1UGPB 1UGSB 4IUPA 4XU2A 2FL7A 3X28B 1WPYA 1HK9A 3L42A 2MWOA 3KXTA 2QTXA 1VQ8T 3HP9A 2DXCA 2DAQA 3NTKA 3E19A 3A8OB 3FRNA 3S6WA 2K3XA 1O75A 2VXEA 3I56A 1BI2A 2WSCE 2K5FA 3KHIA 4AKGA 4XU0A 1GXIE 4M7DA 4JLGA 1QVFS 4L59A 4XTVA 3CC4A 4M78B 3A8LB 3OYDA 2XDBA 2QQ8A 4KT0E 2BUDA 4LDUA 4MMLA 2GQVA 2CZ1B 4OB3B 1VQ4A 4MMKA 1XNIA 2CZ6B 3V7RA 3GIBA 3QBYA 1Y96A 3JCMf 3C94A 1VQMA 1VQNA 3CMEA 4XTUA 2E65A 3INZA 2B8AA 2E6ZA 4JLIA 1K73U 5LJ5d 1E7PA 1B34A 2LDMA 4IUTA 3JCMW 2Y90A 2VGMA 4IUQA 5GAN3 3OS1A 4BDZA 3OSSC 3CCLT 1WNLA 1WQWA 2EQJA 2P4TA 1YI2A 2O01E 2V8JA 2WACA 1VQ9T 2DXUA 3F70A 2PVGB 3LH0A 3VYGA 2VYTA 1VQ7T 1QW1A 2R5MA 5CIUA 3CCRT 2ZZDA 3UPUA 4AI6A 2RH2A 5GANg 1OYXA 1BI0A 4M7AB 5LJ5e 2XK0A 3LX7A 4BD3A 3HZJA 4XAXB 4JS5A 2EQKA 4JUVA 4M7AG 1KHCA 2JNGA 3CCMA 2DVEA 3FLGA 4NL2A 5GAOm 3BG9A 4IURA 3JCMP 5J3BA 2RK2A 5FROA 1VQOA 2LQ8A 1U1TA 3WXMB 4DOWA 4JJNK 2DXBB 3O8VA 4OB0B 3QSUA 3TEEA 3RUXA 1YJWA 2QDYB 2DZCA 2F5TX 1G3TA 3HFOA 3FIFA 3C95A 4M7AA 2MAMA 4FT2A 2ZPGB 1G3WA 4FL6A 3OQ5A 1JB0E 4BI3A 4ELZC 4MZTA 1YBYA 4QW2A 5GMKl 1I81A 2KMGA 4WF2A 3CCQA 4A4KA 3GNGA 1M1KC 5GAMe 1YCYA 5GAOr 4FM4B 4M78A 3OYFA 4NC6A 4GLKA 1QVGS 2KK4A 2DPPB 3HHTB 5A2QE 1M1KU 2HBPA 1XOVA 2GF7A 2D9TA 3ASKA 3L1AA 5CO7A 3G4ST 4OF1A 1G3YA 1BIAA 5GAOn 4A4FA 3UWNA 4Z6YA 3L2RA 3H4CA 2M16A 2RHUA 3CXCA 4X9DA 3NFCA 1Q81C 4MDXA 3GOXA 5D6YA 4XU1A 4RMOA 2M9UA 4N0AC 4C92A 2F69A 4HL4A 2DKGA 1YI2T 5GAOl 2EQMA 1IREB 1NE8A 3QYBA 4TVRA 2MWPA 3FEOA 3RIRA 3H8ZA 4AKHA 5HKCA 3HKSA 3UDCA 4C8QF 2P0QA 2LCCA 5M9OA 2EJGA 3RERA 4OB2B 2QXFA 3DKMA 2L5QA 1QVFA 2A3LA 3RMQA 4E7HA 2L3RA 1VQ5A 3QZ9B 1P92A 4C5GA 4RKUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PSE A;  2ZPE B;  1GXI E;  4Y28 E;  1UGR B;  3A8M B;  2PVO B;  1UGQ B;  2DD5 B;  2PUK B;  1UGP B;  1UGS B;  3WVD B;  4L6V 5;  3X24 B;  3X28 B;  4XK8 E;  2ZZD B;  2DXC A;  3A8O B;  2WSC E;  2DD5 A;  4ZGJ B;  1QP2 A;  2ZPH B;  3A8L B;  3QYG B;  4OB1 B;  3A8H B;  4KT0 E;  2CZ1 B;  2DD4 B;  4OB3 B;  2CZ6 B;  2ZPI B;  3X26 B;  1DJ7 B;  1AHJ B;  1QP3 A;  4ZGE B;  2D0Q B;  1PSF A;  2O01 E;  2PVG B;  3VYG A;  2DD4 A;  3LW5 E;  4ZGD B;  2DXC B;  2ZZD A;  5L8R E;  3QZ5 B;  2WSE E;  2CZ0 B;  3A8G B;  1V29 B;  2PVD B;  3X20 B;  2DXB B;  4OB0 B;  3QYH B;  2QDY B;  2ZPG B;  2ZPF B;  3QXE B;  2CZ7 B;  1JB0 E;  2ZCF B;  4FM4 B;  2DPP B;  3VYG B;  3HHT B;  2CYZ B;  2DXB A;  2PUO B;  2PU9 B;  3VYH B;  3X25 B;  1IRE B;  3WVE B;  2AHJ B;  4OB2 B;  2ZPB B;  2WSF E;  3QZ9 B;  4RKU E; 
#chains in the Genus database with same CATH topology
 2MF2 A;  3L2V A;  4ORZ A;  4FYV B;  1QWE A;  4FT4 A;  3CEY A;  1LVK A;  3EH2 A;  5IHY A;  4J9D A;  5AYF A;  2LTO A;  2RQV A;  2RA2 A;  1ZX6 A;  1FIN B;  5LJ3 f;  1WHK A;  3VKI A;  2C4G B;  2COZ A;  3H0H A;  4FYY B;  5GAM f;  3RES A;  4JX5 A;  2GTJ A;  2ED1 A;  4DBH A;  4C0D C;  4IKF A;  3HBL A;  5DQV A;  4OB1 B;  3C4S A;  3BG5 A;  1RAH B;  4O6J A;  4F7S B;  3MEW A;  3G71 T;  3TVT A;  3L2U A;  1VA7 A;  3JCM e;  4HVV A;  4KUD K;  1X6B A;  3I56 T;  4KBM B;  1KQS A;  4F04 B;  1S72 A;  1M5Q 1;  1X01 A;  1VQ4 Q;  3HRS A;  3CBM A;  4M77 B;  3CC2 T;  4M7D B;  5A0L A;  3GNF B;  4C8Q E;  2EJF A;  2I2L A;  2LJ0 A;  1Q95 G;  2GTO A;  5GAO p;  5GAN j;  1FMK A;  1PRM C;  5LL6 S;  2CT4 A;  2KRN A;  3CBO A;  2F5K A;  3QG1 A;  2K6D A;  2RHX A;  2MK5 A;  1KQ2 A;  1OU9 A;  4LDY A;  3QYH B;  2CGH A;  2C6T B;  3P8B B;  1VOL A;  3LGF A;  3PT9 A;  3MO8 A;  4D6W A;  2RF0 A;  1A0N B;  1G83 A;  1O9S A;  3G4S A;  4OML A;  2LNV A;  4BXX X;  1QCF A;  5KCO A;  2EFI A;  2RK1 A;  4AFZ C;  1TUD A;  5L23 A;  1MMN A;  3CMA T;  4A4E A;  2NUP A;  4F7U G;  3BLR B;  4F7U E;  1K73 C;  2M02 A;  5FU7 B;  3H41 A;  4UN0 A;  2WMA B;  1JJ2 P;  3FJ5 A;  2LMJ A;  2XID A;  4HCB A;  4FSX A;  5I2M A;  1VQ7 Q;  2DZ9 A;  1UJ0 A;  3OSV A;  3EID B;  2V8I A;  2X4W A;  3PMT A;  3DL1 A;  2DE0 X;  4M77 G;  4M7D G;  3MY5 B;  3I55 T;  3M5A A;  4PK4 A;  5KYW B;  1U5S A;  4RTZ A;  3RNJ A;  3EG9 B;  1VQM Q;  2YLC A;  3URG A;  3QWX X;  1OKV B;  1KXU A;  2DK3 A;  3WVD B;  4XTZ A;  3CCU T;  1PWT A;  3EGU A;  2MYS A;  2BZX A;  4PJO E;  1B3Q A;  4MFE A;  2YRD A;  2DX1 A;  1YNZ A;  2EWN A;  4ROE A;  5CKE A;  3OYI A;  1Q82 R;  1M8M A;  1QP3 A;  1Z9Q A;  1FXX A;  2JZ2 A;  3CC7 A;  2V1R A;  4M78 D;  4M75 G;  1Q82 C;  3BDL A;  2KRM A;  4OVA A;  1GBR A;  1M90 R;  2JJ9 A;  5KYU B;  2YDL A;  1H26 B;  2DD4 A;  3LW5 E;  4M75 D;  5HY6 A;  3JCM b;  1VQL T;  3CCS A;  3PTA A;  3UF4 A;  4F7U A;  1WXU A;  2JMC A;  1C9B A;  2LP5 A;  3M9Q A;  2L89 A;  1SHF A;  1E7O A;  1WGS A;  5D6W A;  3KFV A;  4LXC A;  2GQI A;  1SRL A;  4G6L B;  4C0D B;  1W2B S;  3QXE B;  5IXF A;  2LX9 A;  1JXM A;  3JB9 I;  1SKU B;  4J9G A;  2KEA A;  3SHW A;  1Y57 A;  2DL8 A;  3M0S A;  4C8Q A;  3J80 E;  2KSS A;  4KH1 B;  2GFA A;  2LT4 A;  4HNT A;  5HBJ B;  4F70 B;  2PJQ A;  2DA9 A;  2HDA A;  3H9N A;  2D0N A;  2LRQ A;  5LJ5 f;  1D1A A;  3G1J A;  1SG5 A;  4JJB A;  2FPD A;  3TSW A;  1KQS P;  2WSF E;  2LX7 A;  4HT9 A;  4B9X A;  3JB9 F;  1PNJ A;  4MZP A;  3JCM h;  1XTD A;  1MHN A;  3QO3 A;  2DTO A;  4LNP A;  1FKM A;  5KYX A;  4QQ6 A;  1PKS A;  2KR6 A;  3SD4 A;  2KT8 A;  2YT6 A;  3A8M B;  4ZTF A;  2IW6 B;  2G3R A;  4BY6 C;  3OMC A;  4O5V A;  4PFZ A;  2XG8 D;  2RO0 A;  1YIJ Q;  1JJ2 A;  4EOQ B;  1Y71 A;  1FX7 A;  1AT1 B;  2F2V A;  3VKG A;  1M1K R;  3NGP A;  4KUI A;  1OV3 A;  3CCS Q;  2WFY B;  3M0P A;  1B7T A;  3NPF A;  2K3Y A;  2Y4X A;  5LMK B;  5EJC A;  1SF9 A;  2C0T A;  2QTV A;  4C8Q B;  5CAI A;  2OTL Q;  4QQD A;  4EOP B;  1YJW Q;  3QII A;  2LW4 A;  2AIR B;  2FEI A;  1AHJ B;  1KSW A;  4EMH A;  4J5Y A;  4BUG A;  1YHQ A;  3PMI A;  3OYK A;  2CP7 A;  4C0Z A;  1YWP A;  1OX9 A;  4J7I A;  1W70 A;  2F2W A;  3TU4 K;  4PJO G;  4ZGD B;  2KMT A;  3QWL A;  2K57 A;  3CXC P;  3DJB A;  2DBK A;  2DNU A;  4BAC A;  3I35 A;  1VYT A;  1M4Z A;  4J6X A;  4YC3 B;  2JMA A;  2HSP A;  4C0G A;  5HBH B;  1H64 1;  1H1R B;  4X9C A;  4M77 D;  4M7D D;  3M0T A;  2DJZ A;  1Q7Y C;  2ZPF B;  2BKD N;  2ZGW A;  1ZUK A;  2EAY A;  2CRE A;  2NUP B;  4XTX A;  2KYM A;  3C0C A;  3OY9 A;  2GFU A;  3TNH B;  2QAZ A;  1N9S A;  2QF7 A;  1ZA1 B;  5LQF B;  1RAF B;  4FU6 A;  4DOV A;  2KI7 A;  1JU5 C;  3WVE B;  1KC8 C;  1VQP Q;  4RG8 A;  1GCQ A;  4BBS M;  2F2C A;  3LWH A;  4CI0 C;  4LOC A;  4YTL A;  2YUP A;  1YN8 A;  3OYY A;  2ED0 A;  1F5Q B;  1WJR A;  2OTL A;  2WIP B;  4CC3 A;  4CFM B;  1JSU B;  2LT1 A;  5HCK A;  1UGS B;  4FSS A;  2V1Q A;  4Y92 A;  3L42 A;  1QCO A;  3HP9 A;  2DXC A;  2DAQ A;  2BZ8 A;  2WSC E;  1QKW A;  4KGV B;  3A8L B;  4M78 B;  1ZBJ A;  2PMI B;  2BUD A;  4MML A;  1X2Q A;  4AMC A;  1VQ4 A;  3V7R A;  2A37 A;  1Y96 A;  3QBY A;  3JCM f;  1TS9 A;  3C94 A;  1AIS B;  1VQ8 Q;  2EYW A;  2P4R A;  1B34 A;  2LDM A;  4IUT A;  3JCM W;  1MMD A;  2D8J A;  2X9H A;  3OS1 A;  2P4T A;  1YI2 A;  2O01 E;  2WAC A;  3VRZ A;  7AT1 B;  3F70 A;  2PVG B;  2OJ2 A;  4QKU A;  3UPU A;  4OGR B;  2VAS A;  2KNB B;  1R77 A;  1G8X A;  2BTT A;  4OMO A;  3CQT A;  2EQK A;  3CMA Q;  2FO0 A;  1VQ6 Q;  1KHC A;  2ATC B;  4GLM A;  2LNH B;  4FW1 A;  4E6R A;  4M7A A;  2DZC A;  3HFO A;  3CD6 Q;  1UNG D;  5IDP B;  3C95 A;  2J06 A;  2E3I A;  2HKN A;  1JB0 E;  3EG1 A;  1YBY A;  2KE9 A;  1I81 A;  1RAE B;  3CCQ A;  4CFX B;  5GAO r;  2COW A;  3OYF A;  4NC6 A;  2A28 A;  2KK4 A;  2EGC A;  1G3Y A;  1E6H A;  1KK7 A;  4A4F A;  3UWN A;  4Z6Y A;  4II5 B;  3H4C A;  1BCM A;  4X9D A;  1Q81 C;  4XU1 A;  2BE9 B;  4N0A C;  6AT1 B;  4C92 A;  2DKG A;  5GAO l;  2DRM A;  4TVR A;  1WXB A;  4EC8 B;  2P0Q A;  1H4L D;  2QG9 B;  2C0O A;  3RER A;  2DVJ A;  3DKM A;  3UA7 A;  1VQK Q;  1OIU B;  1M3B A;  2L3R A;  1VQ5 A;  3CC7 Q;  4M75 C;  4C5G A;  4Z8A A;  3NTI A;  4HVW A;  1Z9Z A;  2MIO A;  4OMQ A;  5KE3 A;  3GP8 A;  2DD5 B;  1NBE B;  3S3N A;  1OZ3 A;  2DRK A;  1GBQ A;  1LCK A;  5DLQ E;  2X4Y A;  1KG1 A;  1I5L A;  1JQQ A;  3QHS A;  1IZ6 A;  1RI9 A;  1XJW B;  4EMG A;  3MP8 A;  1QP2 A;  3VUB A;  2W10 A;  3THK A;  1SSH A;  1VQ6 A;  3PFS A;  3OW2 S;  1VYU A;  2CP2 A;  4JX4 A;  3CC4 T;  3MEA A;  3OS5 A;  4BCN B;  4BCQ B;  1ZUY A;  2J6O A;  1W2B A;  1QMC A;  3RKX A;  1OOT A;  1X27 A;  4HCZ A;  4BCM B;  1T3S A;  2FZK B;  2KQW A;  1YIT Q;  3BHT B;  1IB8 A;  2QQA A;  3EGX A;  2DFU A;  1WLP B;  1QMZ B;  4R56 A;  2QEX A;  3BE3 A;  1TWB A;  3QZ5 B;  2WSE E;  4XU3 A;  3HTR A;  1GUX A;  1WHH A;  2E70 A;  2HZY A;  5KYW A;  2D8H A;  5CEI B;  5IXB A;  4X1V A;  4J83 A;  1W4S A;  1V29 B;  3X20 B;  1YJN A;  4OMF B;  4BY6 B;  4M78 C;  4RUG A;  3TQ7 P;  4BY7 X;  4PFO A;  3RBB B;  2XMF A;  4F17 A;  1VQ7 A;  4HLQ A;  2E64 A;  4F14 A;  2F2X A;  3VYH B;  1B07 A;  1UB4 A;  5GMK i;  3LH5 A;  1AEY A;  3LGL A;  2ECZ A;  2RHY A;  3PIP A;  2UZL B;  2CP6 A;  5GJV B;  3PE0 A;  1VIN A;  2HQE A;  4F7L B;  4CC7 A;  3I56 Q;  4RG2 A;  3JCM X;  4M77 E;  4M7D E;  4DEY A;  5GMK j;  1PSE A;  2W9Z A;  4EMK A;  1WZO A;  4LDV A;  2R58 A;  4IUU A;  4F6U B;  1M27 C;  2VGN A;  1UGR B;  2UUE B;  4EMK C;  2EUF A;  3OYA A;  1R8O B;  5CK9 A;  4F6S B;  2C0I A;  3M57 A;  4L6V 5;  2H3J A;  2EJ9 A;  3HO8 A;  2C5X B;  2QDJ A;  2DIQ A;  3CCQ T;  2HAX A;  1WYX A;  5LJ3 h;  3GTM S;  1MV0 B;  2K2M A;  1YJN T;  1NPP A;  2XHC A;  1VQL A;  5FWB A;  4QQG A;  4RCB A;  5IHK A;  2CH4 A;  4HKE A;  3CMA A;  1NJI C;  3VJP A;  2EGE A;  2CP3 A;  4LUD A;  3EAE A;  4EOM B;  2VKN A;  4CRL B;  3PGG A;  1H3Z A;  3QYE A;  1RAG B;  4IUV A;  1K1Z A;  4M75 E;  1NEG A;  2YXY A;  5GAM g;  4PKC C;  1FWZ A;  3FC3 A;  3N5B B;  1UFF A;  1YJN Q;  1Q81 U;  5LJ3 e;  2J6F A;  2O4X A;  5I21 A;  1UE9 A;  4A4H A;  3OYG A;  1NYF A;  2R57 A;  1IGU A;  2CS7 A;  4AFQ C;  2IN3 A;  1UDL A;  1OKW B;  2CP0 A;  1OGU B;  3MKD A;  3RDV A;  2CT3 A;  2IPO B;  4A53 A;  5GAN 6;  1WI7 A;  2D1X A;  3OYB A;  3G71 A;  1QCN A;  1W6X A;  3B57 A;  5EFQ B;  2XU8 A;  2UZE B;  4F7J B;  1WJS A;  3A8G B;  5CQX A;  2VC8 A;  4JZ3 A;  3CCL Q;  2KGT A;  1YJ9 A;  4HCC A;  3EHQ A;  4MDW A;  1D0Z A;  4JRP A;  3G6E Q;  1RLQ C;  2R5A A;  1YCS B;  1QLY A;  1OIY B;  3PVQ A;  1F1B B;  1VQM T;  2K9G A;  2CKK A;  2SEM A;  5FLX E;  2LCL A;  2OAU A;  1VQP A;  5L2W B;  1MMA A;  4ANJ A;  4ELJ A;  2QEX Q;  3G33 B;  3I5R A;  9ATC B;  5CKH A;  1MUZ A;  3CCV A;  2LVM A;  2YRV A;  1ZHI A;  4BBR M;  4JRK A;  1UEB A;  1M8V A;  3CCE A;  1I8F A;  4R55 A;  1PRL C;  2IVW A;  3O0G D;  2A36 A;  1D3B B;  1C1A A;  4F6W B;  2EKH A;  4NOY A;  2KXD A;  1GXI E;  1YIT T;  2RQR A;  2BIV A;  3SWN C;  2W0Z A;  2NWM A;  4HNV A;  3G4S Q;  2FPF A;  2XD0 A;  2X4X A;  2EYX A;  2JTM A;  1KQS S;  4EMK B;  2ESW A;  2M51 A;  2QGF B;  4KUL A;  1OU8 A;  4ESR A;  2CCH B;  5KYY B;  1N9R A;  3HFN A;  3EH1 A;  2EIF A;  3JCM d;  1UHF A;  1VQO T;  5KYX B;  3OB9 A;  3ER0 A;  5FRN A;  5GAN 7;  3DB3 A;  2DXT A;  2UZD B;  3VS6 A;  5DM7 R;  3A8H B;  5KYU A;  1YIJ A;  1MMG A;  1BI3 A;  2FYK A;  3CD6 A;  2VVK A;  2O88 A;  4M6V A;  1DJ7 B;  1RI0 A;  1M9S A;  2K3B A;  2DLP A;  1WA7 A;  1C0M A;  4F7U B;  4C92 E;  1QVF P;  4LDW A;  5GAM j;  3CME T;  2HNI A;  2X3W D;  3H0I A;  4EDU A;  1X2K A;  4HA8 A;  2EKO A;  4LE9 A;  1JOW A;  4OGC A;  3RGF B;  4LN2 A;  4PJO B;  3OYL A;  5GAN 4;  4BE1 A;  4N4G A;  2LC4 A;  1HSQ A;  4M7A C;  2CSQ A;  1VQK A;  2R7G A;  5IN1 A;  4BCJ B;  4ZN3 A;  3UT1 A;  1T3L A;  3VS3 A;  2WEV B;  2BS3 A;  5HQ0 B;  1N8R R;  1EX4 A;  1N5Z A;  4J7F A;  1M1K U;  3V7S A;  4NS5 A;  2QGG A;  3M0R A;  3CXC S;  4OMN A;  2DEU A;  2CYZ B;  2H8H A;  2M0O A;  2YUN A;  5CKB A;  3UAT A;  4F7U F;  1U06 A;  3SEM A;  5GAN 8;  1M3A A;  3A1P A;  4ZN1 A;  1YIJ T;  3TW6 A;  3MHX A;  3CPW P;  2CUB A;  1ZSZ C;  3M4G A;  1OI9 B;  3PVL A;  2DEQ A;  3M55 A;  2KBT A;  1MNE A;  4KRD B;  4YOS A;  2AHJ B;  1I07 A;  3BHV B;  4UC4 A;  1J3T A;  3KUF A;  3CCL A;  3RR6 A;  3RKW A;  4DBQ A;  2AT1 B;  4KGZ B;  1JXO A;  3JB9 H;  3EFO B;  4C92 D;  4GY5 A;  4M77 F;  4M7D F;  4Z02 A;  3RKY A;  3PIO A;  2QI2 A;  1CKA A;  3O5Z A;  1TXQ A;  1WPY A;  3QHR B;  5I22 A;  1RAD B;  4JJC A;  3E19 A;  3FRN A;  3S6W A;  1BI2 A;  2K5F A;  2I0N A;  4AKG A;  1UJY A;  4JLG A;  4L59 A;  4XTV A;  2XDB A;  1PC0 A;  4LDU A;  2CH4 W;  5I5Z B;  4OB3 B;  4HVU A;  3GIB A;  2CZ6 B;  2W9F A;  2EPD A;  1BU2 A;  1VQM A;  3CME A;  4XTU A;  2NUZ A;  3INZ A;  4PJJ A;  2Y90 A;  1RUW A;  1VQ9 T;  2DXU A;  4ELL A;  1Q86 R;  3VYG A;  1GFC A;  1FVV B;  1VQ7 T;  1M30 A;  2R5M A;  2ZZD A;  5GAN g;  3M0Q A;  2X3X D;  2H3E B;  1OL2 B;  1MV3 A;  2DVE A;  4NL2 A;  5GAO m;  3JCM P;  2HEQ A;  2C5N B;  2EYY A;  4Z89 A;  1VQO A;  4DOW A;  2DXB B;  1GH6 B;  3QSU A;  3TEE A;  1YJW A;  1G3T A;  3FIF A;  1Y0M A;  2ZPG B;  3OQ5 A;  3QDF A;  1SRM A;  4ELZ C;  4MZT A;  4BY1 X;  4QW2 A;  5GMK l;  2EQI A;  4A4K A;  1TG0 A;  4WCI A;  4GLK A;  3HHT B;  5A2Q E;  2GF7 A;  3I5S A;  3VRY A;  2CDT A;  3L2R A;  2M16 A;  4YOZ A;  2RHU A;  5D6Y A;  1K73 R;  4HL4 A;  3CCQ Q;  1W1F A;  2EQM A;  1IRE B;  1NE8 A;  2MWP A;  3FEO A;  3RIR A;  4AKH A;  5HKC A;  3UDC A;  4RTT A;  2DL3 A;  4C8Q F;  5M9O A;  2EJG A;  2QXF A;  4JJD A;  1H1P B;  4E7H A;  1Q7Y R;  1P5E B;  4N4I A;  4A54 A;  5GMK m;  2OTJ T;  3OBY A;  4CFN B;  1JJ2 S;  5CYI B;  1WHM A;  2VB6 A;  2VWF A;  1QQJ A;  3QPH A;  4E7K A;  1WIE A;  4C8Q D;  4JRQ A;  3JCM Q;  2RJE A;  1GCP A;  4JS4 A;  4BE0 A;  2QFZ A;  1WHG A;  2JVV A;  4RCC A;  4XK8 E;  1GFD A;  1S72 Q;  3ZFJ A;  5D6X A;  1BBZ A;  1BCO A;  2MMP A;  1B34 B;  5KYN A;  1X6G A;  3TSZ A;  3V8L A;  2DD5 A;  4M78 E;  2L3S A;  3QYG B;  5KH6 A;  4YOO A;  4CXA B;  1OI1 A;  3X26 B;  2HMA A;  2L2P A;  4BCG B;  1RLP C;  3CD6 T;  3LWI A;  1AWX A;  2JS0 A;  3V8J A;  3MEU A;  3ZBD A;  2LZ6 B;  4C92 F;  4JX6 A;  4PJO A;  1S72 T;  4PJL A;  1OUL A;  3GPL A;  2JW4 A;  1Q7Y U;  3E1S A;  3OMG A;  3AHU A;  1KC8 R;  3OYH A;  1OQK A;  1YJW T;  1PCX A;  1G2B A;  1FMV A;  1RAA B;  3VU3 C;  3H6Z A;  3CCJ T;  4A63 B;  1C6V X;  4QT7 A;  4EOO B;  4EPC A;  2EGA A;  2WJ9 A;  1PD1 A;  3EFO A;  5IH2 A;  4TTH A;  3RMS A;  1KFZ A;  1TSF A;  4LD6 A;  2QQS A;  4J6Y A;  1AD5 A;  4EC9 B;  3CCR A;  2EQU A;  5D7U A;  5DLO A;  2ABL A;  4AFS C;  2E6N A;  1Q82 U;  2PU9 B;  5I2S A;  4C92 C;  2O31 A;  2JUF A;  5GMK e;  1PKT A;  2HSE B;  4AT1 B;  5C6S A;  4E2F B;  5IHN A;  1M90 U;  1NJI U;  4L5G A;  4C5H A;  1VQO Q;  2HQX A;  2OTJ Q;  3BW1 A;  3MP1 A;  5FU6 B;  3ZL7 C;  1KC8 U;  1OPK A;  1VQN Q;  1H1S B;  2DYB A;  1H92 A;  1UGQ B;  2RQW A;  1H1Q B;  3QJY A;  1MND A;  1T0J A;  3E9G A;  3MY1 B;  2FRW A;  4OMP A;  1RAC B;  4LUE A;  3TRE A;  1K9M R;  1H27 B;  2ZZD B;  2DTI A;  2RI5 A;  5GAN f;  3EG9 A;  2P0P A;  4IIM A;  2COY A;  2DO3 A;  4OGE A;  3M53 A;  3EHR A;  3MP6 A;  1D0X A;  4ZGJ B;  2GCX A;  4M75 F;  2ZPH B;  4CC4 B;  3DLM A;  2QEX T;  3VS5 A;  4B9W A;  2DYI A;  1N6A A;  3HSB A;  2FPE A;  1UUE A;  3CCU Q;  1G3N C;  1BYM A;  1KIK A;  3MCA B;  3BLH B;  3L2Z A;  2K4Y A;  3HPW A;  2EVR A;  2FVU A;  4I3Z B;  5FU7 C;  4XTW A;  1IO6 A;  2HCK A;  1AWW A;  4ZGE B;  2NUT B;  3BY7 A;  2FG0 A;  2RM4 A;  4A4G A;  5AT1 B;  1VQ6 T;  1JKW A;  4C5E A;  1BI1 A;  4PJN A;  5BNJ B;  3BDU A;  2QA4 T;  1TUC A;  4DQ2 A;  4FYW B;  1D3B A;  2CUD A;  1K9M C;  5KCH A;  2DF6 A;  1SPK A;  2E3H A;  2QK0 A;  5LJ3 j;  4F7N B;  4B6M A;  8AT1 B;  2XIC A;  1UNH D;  5CKD A;  3JV3 A;  5HNB B;  5GAN 2;  2RI3 A;  3QUI A;  2OX7 A;  3VKH A;  1I1J A;  2YLB A;  1KJW A;  3OS2 A;  2QQ9 A;  3CCE T;  1ZP2 A;  5HBE B;  2BS2 A;  1SSF A;  2FRY A;  4RTY A;  1X43 A;  5J39 A;  3U23 A;  2ENM A;  2W2H A;  4N4H A;  3S3M A;  2C06 A;  1ZLM A;  1BK2 A;  1AD6 A;  1V76 A;  1T0H A;  3M4Y A;  1X75 C;  4HCK A;  3TNW B;  4D8K A;  3G6E A;  2HQH A;  3E2U A;  4Y72 B;  2IG0 A;  1Y7X A;  2JT4 A;  1PM3 A;  3ZEH A;  4DBF A;  3EFS A;  2JOY A;  2JM8 A;  2HBW A;  2PK2 A;  4QVZ A;  1K4U S;  1Q86 C;  4DEX A;  4CRI A;  3FJP A;  1N27 A;  1K76 A;  4Z88 A;  3OYM A;  2AZS A;  2RI2 A;  2GGR A;  4P5N A;  5FWC A;  2L3P A;  1ZQ1 A;  4E7J A;  5GAN d;  2KDS A;  2YHT A;  3IQL A;  4JPB W;  1BB9 A;  3OS0 A;  3TCJ A;  3C12 A;  3CC4 Q;  1K0S A;  2BZY A;  1W2B P;  4XQ3 A;  3GF5 A;  1YIT A;  2RD1 A;  1VYW B;  2KAF A;  3CME Q;  2LCS A;  3L2W A;  3PNW C;  3JCM c;  2PZ1 A;  3JAM E;  1JO8 A;  2DD4 B;  3I55 A;  1K8A R;  2RJC A;  4OP0 A;  4VUB A;  3CBP A;  4EOS B;  1G3S A;  2W99 A;  3KBG A;  2HKQ B;  4BE2 A;  2JS2 A;  2X35 A;  3HB9 A;  3TW7 A;  5IT9 E;  1D0Y A;  4KRT A;  3VS2 A;  3OYJ A;  3CC2 Q;  5CR2 A;  2BKZ B;  4D8D A;  4BCO B;  2WHB B;  1XQH A;  3QWY A;  3QKJ A;  4PFP A;  2QGS A;  1VIE A;  2L0A A;  1VQ4 T;  5LJ3 g;  1M90 C;  3I55 Q;  1ABQ A;  2WXV B;  1KD1 U;  2CZ0 B;  3PO3 S;  3DOG B;  3EJ1 B;  3CPF A;  3NDQ A;  2G9X B;  1VQ8 A;  3M03 A;  4HNU A;  1X6O A;  3T9N A;  2AKK A;  2A7Y A;  1ZA2 B;  1VQ5 T;  2EW3 A;  2ZCF B;  4FX3 B;  1VIF A;  4M78 G;  1CKB A;  2K2V A;  2ROL A;  1U1S A;  1M2V A;  2MI6 A;  3MET A;  2E41 A;  1ZSZ B;  5GAM d;  3BHU B;  1N8R C;  2O9S A;  2RN8 A;  1WQ7 A;  4M75 A;  1OEB A;  3MEV A;  5IHI A;  5HK3 A;  4C5I A;  3P8D A;  3CC7 T;  5HVY B;  5A0G A;  5KYY A;  4X34 A;  2KY9 A;  3VS4 A;  4ELY C;  3JCM V;  5IAY A;  2HL3 A;  1D1C A;  2PNI A;  2JTF A;  1IRX A;  4M7A E;  3HRT A;  4C8Q C;  2Y4Y A;  2J05 A;  2XDP A;  2GBQ A;  2ZPE B;  1EFN A;  4Y28 E;  3FDR A;  2HD0 A;  3OA6 A;  3NHN A;  5EC7 A;  1KD1 R;  3OYN A;  2Z0W A;  4IMY B;  1UG1 A;  3CCE Q;  2WPA B;  1TTH B;  3K7A M;  4FYX B;  3EFR A;  4CFU D;  1TFB A;  2PUK B;  2EYZ A;  1UGP B;  8ATC B;  3X28 B;  1HK9 A;  3KXT A;  2QTX A;  4CC2 A;  4BCM D;  2FZC B;  1VQ8 T;  1ZUU A;  2AK5 A;  3A8O B;  1H8K A;  1UHC A;  2DL7 A;  1O75 A;  2VXE A;  2C5V B;  5I11 A;  3KHI A;  1AWO A;  4XU0 A;  2IW9 B;  4J9F A;  2I53 A;  3OYD A;  2GQV A;  4EOL B;  2CZ1 B;  4MMK A;  1XNI A;  1I5O B;  4RTV A;  2E65 A;  2B8A A;  2VGM A;  5GAN 3;  4BDZ A;  3OSS C;  3CCL T;  1WQW A;  2EQJ A;  3OW2 P;  3CCR Q;  3LH0 A;  1QW1 A;  3EGD A;  4CFU B;  5CIU A;  4EOJ B;  2RH2 A;  4M7A B;  1BI0 A;  1K0X A;  3LX7 A;  3VS1 A;  4BD3 A;  2KR3 A;  4ZNX A;  4R0K A;  4IIO A;  2JNG A;  3FLG A;  1UEC A;  4ROD A;  2LQ8 A;  1U1T A;  3WXM B;  2I40 B;  4JJN K;  1CSK A;  4OB0 B;  4M4Z A;  2F1L A;  1HYO A;  2F5T X;  1FMW A;  4FT2 A;  3NMZ C;  4FL6 A;  1GUX B;  3EG2 A;  1WX6 A;  2NYS A;  4WF2 A;  2KMG A;  3GNG A;  5GAM e;  4FM4 B;  1QVG S;  2DPP B;  1XOV A;  5CO7 A;  5GAO n;  1JEG A;  4MDX A;  1H3H A;  4RMO A;  2F69 A;  4J9I A;  3QYB A;  4EOR B;  3HKS A;  2A08 A;  4OB2 B;  1QVF A;  2A3L A;  3RMQ A;  4RKU E;  3CCM T;  1EIF A;  2JN0 A;  4PLL A;  4GBQ A;  3P8H A;  3EG0 A;  1QVG A;  1PHT A;  3HRU A;  3H0F A;  4BCN D;  2E1H A;  2FHD A;  2YUQ A;  4LDX A;  2KVQ G;  2OAW A;  1NPR A;  4QVD A;  1NEB A;  1QWF A;  5GAN h;  3BG3 A;  1JRI A;  1OZ2 A;  2K7A A;  1YJ9 T;  2RQT A;  2WIH B;  1IXD A;  1PKD B;  3MPU B;  4RTU A;  3I9Q A;  4PNO A;  4M77 A;  4M7D A;  1K9A A;  3CCS T;  1YHQ T;  2RQU A;  2CSI A;  3QJ6 A;  2ZPI B;  1EZZ B;  2MPX C;  5ACB A;  2KRS A;  2X51 A;  1SEM A;  3GLX A;  2RNA A;  1M1G A;  1FYN A;  1Y07 A;  5GAN e;  2IVX A;  5IDN B;  2V22 B;  1URC B;  1V1C A;  2VXF A;  1WJQ A;  2FB7 A;  2BPM B;  1AVZ C;  1GL5 A;  4DBR A;  4OR5 B;  1UGV A;  1O9K B;  4E7Z A;  4J9E A;  5FW9 A;  1RAB B;  1S1N A;  1KHI A;  3BFM A;  4LD9 K;  3V8K A;  2X4J A;  2EBP A;  4AFU C;  3NTH A;  4AG1 C;  1IHW A;  2DIG A;  3TNI B;  4C92 G;  3SFM A;  5FRM A;  5GAO q;  1NM7 A;  2PVD B;  3VV0 A;  2DME A;  2RB6 A;  2QQR A;  1ZBX A;  3G7Z A;  1K9M U;  2O4X B;  1VQK T;  4BCK B;  4WTO B;  3S3O A;  3R6O A;  5FGK B;  5HK0 A;  4PJO C;  2E10 A;  2IW8 B;  2M0Y A;  3JB9 J;  2RHZ A;  2LQK A;  1D09 B;  2OTJ A;  3SWN A;  1TOV A;  2IIM A;  1Q81 R;  4PL6 A;  2DL5 A;  3LQ5 B;  5C0M A;  5KE2 A;  1E6G A;  2V26 A;  2DL4 A;  3D7S B;  3BLQ B;  2K79 A;  2V8K A;  4PJM A;  3R6N A;  2PHG A;  4KH0 B;  3HL8 A;  3VS0 A;  1R0B G;  2NUT A;  4Y91 A;  4CFW B;  5CCA A;  1H24 B;  1VQL Q;  4E7L A;  1GY3 B;  1IGQ A;  3REA B;  1O9K A;  3QHW B;  1YHQ Q;  2K5L A;  1NLO C;  2LQN A;  4N0A A;  2AKL A;  2XDD A;  2DER A;  2D6F A;  5LJ3 d;  3X24 B;  5GAM h;  4FCY A;  2DM1 A;  2JXB A;  2DJQ A;  1YI2 Q;  3EGX B;  4FIB A;  3J81 E;  1TD6 A;  2E4H A;  4E47 A;  4ZTJ A;  1I0C A;  2KXC A;  3DDP B;  3L2Q A;  2SRC A;  4AKI A;  5CVI A;  4Q5W A;  4M7A D;  4BCQ D;  2DMO A;  5DQW A;  2QDL A;  2QA4 Q;  1NZ9 A;  3JCM g;  4AG2 C;  5J26 A;  3DDQ B;  1LNX A;  3OBW A;  5LJ5 g;  3DTO A;  3LYI A;  3J7A F;  2P0K A;  3G6E T;  1PSF A;  1NJI R;  4XTY A;  2VUB A;  2DXC B;  5L8R E;  4BI8 B;  1I4K 1;  4M7A F;  1U8R A;  4NST B;  5GMK h;  3EG3 A;  1BIB A;  1UNL D;  2G6F X;  2K5I A;  3ME9 A;  3CPW S;  3EGD B;  2RMO A;  2YWW A;  2XKO C;  1YWO A;  1X69 A;  3JB9 D;  4MIM A;  4J6W A;  1QKX A;  2MOX A;  1Y96 B;  2ROT A;  4C0F A;  1G5V A;  5IF1 B;  1ABO A;  4ME7 A;  2JGZ B;  1AWJ A;  2CZ7 B;  1U3O A;  3DB4 A;  3M54 A;  3CCV T;  3JRZ A;  2XI9 A;  1QVP A;  2J7I A;  2X1N B;  1YFN A;  1NLP C;  4RTX A;  1VQN T;  1VQP T;  3V7C A;  3MJX A;  2PUO B;  2AZV A;  1R0C B;  1QVG P;  1HJD A;  2ZAE A;  1K8A U;  4NL3 A;  1WHJ A;  3X25 B;  3OYE A;  2RJF A;  2RPN A;  5EG2 A;  1D1B A;  4BDY A;  5FU6 C;  3FB9 A;  5CQY A;  1BKB A;  2CP5 A;  2DTH A;  2DBM A;  4HXJ A;  2NLU A;  1SHG A;  1H28 B;  4QSH A;  3TN8 B;  5A0D A;  4KRC B;  4JZ4 A;  1TH7 A;  4MFD A;  1WDX A;  4OMM A;  1XO2 A;  2CCI B;  2GNC A;  2QA4 A;  1PD0 A;  2PVO B;  4PLI A;  5LJ5 h;  4EOK B;  1ACM B;  1W98 B;  2QQB A;  5GJW B;  1LOJ A;  3SDZ A;  3QDR B;  2KRO A;  1LJO A;  5CKF A;  1N8R U;  3VS7 A;  1TUG B;  1GRI A;  2RHI A;  4EOI B;  1IHV A;  1AOJ A;  1BU1 A;  1JBM A;  4M78 F;  2MCN A;  3E9F A;  4M77 C;  4M7D C;  1M3C A;  2E5Q A;  3CC2 A;  3G71 Q;  4C8Q G;  1MGQ A;  1M2V B;  4J9B A;  3UA6 A;  2J6K A;  3A98 A;  3CCJ A;  2YRC A;  5LJ5 j;  2DIL A;  4JRI A;  1YJ9 Q;  2BS4 A;  2OI3 A;  1K8A C;  3JSC A;  3A5Z B;  2QAS A;  5ECA A;  1WHL A;  1VQ9 Q;  3DLL A;  1E9H B;  2D0Q B;  3M58 A;  2BE7 D;  4E7I A;  3CPW A;  4BCI B;  3M56 A;  1RL2 A;  2HL5 C;  4HT8 A;  3JB9 G;  1ARK A;  4BCP B;  1TU0 B;  2E12 A;  4FW2 A;  1OL1 B;  3M0U A;  4BB7 A;  3GBQ A;  1WFW A;  5GAN 5;  3OW2 A;  4PJO F;  1VQ9 A;  1QLB A;  1WXT A;  1ENW A;  4EIK A;  3VUZ A;  1VQ5 Q;  3AT1 B;  2CJM B;  1GCQ C;  2LJ1 A;  4E7S A;  3SB2 A;  4II1 A;  1AZG B;  1HXD A;  2OTL T;  1VUB A;  2PQW A;  4J9C A;  3LLR A;  3ULR B;  3VYG B;  2DXB A;  2C5O B;  2E5K A;  1HD3 A;  4PJO D;  1M1F A;  4JDS A;  2VV5 A;  3CCM Q;  2L3Q A;  4ATO A;  3OYC A;  1KD1 C;  3JCM J;  4BI4 A;  3SWN B;  2O2O A;  1OX8 A;  2G77 A;  1Q86 U;  2ZPB B;  4CFV B;  4M75 B;  4V2S A;  1KQ1 A;  3M59 A;  1PG5 B;  2LQW A;  2YUO A;  4QVC A;  2EYQ A;  4DA4 A;  4J8O A;  4C92 B;  5DY9 A;  1JST B;  3Q1J A;  2L8D A;  1VOM A;  2RJD A;  3CCU A;  1ZSG A;  4MZM A;  2M1H A;  4IUP A;  4XU2 A;  2B9R A;  2FL7 A;  1NG2 A;  2MWO A;  2WMB B;  4EON B;  2KT1 A;  1NYG A;  3NTK A;  3I56 A;  2K3X A;  2QYZ A;  1AZE A;  2A0F B;  2DET A;  5ICP B;  3MI9 B;  1QVF S;  4K11 A;  3CC4 A;  1VYV A;  3CCV Q;  2QQ8 A;  4KT0 E;  4J9H A;  4KGX B;  1VQN A;  4BCH B;  2E6Z A;  4JLI A;  1K73 U;  5LJ5 d;  1E7P A;  2UZB B;  2KYB A;  1LPL A;  4IUQ A;  3F5X B;  1M2O A;  1WNL A;  2V8J A;  3EOC B;  2VYT A;  3CCR T;  3MIA B;  4AI6 A;  1OYX A;  5LJ5 e;  2XK0 A;  3HZJ A;  1D3U B;  4XAX B;  4RTW A;  4JS5 A;  2PTK A;  4JUV A;  4M7A G;  2FZG B;  3CCM A;  3BG9 A;  4IUR A;  3REB B;  5J3B A;  4BCF B;  2RK2 A;  5FRO A;  1RAI B;  1ZSZ A;  3O8V A;  3RUX A;  2QDY B;  4F16 A;  2MAM A;  1G3W A;  4BI3 A;  2PK9 B;  3CCJ Q;  1M1K C;  1H25 B;  1YCY A;  4M78 A;  2JTE A;  2HBP A;  3L1A A;  3ASK A;  2D9T A;  1N4M A;  3G4S T;  4OF1 A;  2W96 A;  1BIA A;  1OPL A;  1UTI A;  3CXC A;  3NFC A;  2O9V A;  3GOX A;  2M9U A;  1YI2 T;  3H8Z A;  4ROC A;  3POM A;  2JM9 A;  2LJ3 A;  2LCC A;  2L5Q A;  2YSQ A;  2P84 A;  3QZ9 B;  1P92 A;  2B86 A;  1YP5 A; 
#chains in the Genus database with same CATH homology
 2MF2 A;  3CCM T;  4N4I A;  4A54 A;  1EIF A;  2JN0 A;  3NTI A;  4PLL A;  3OBY A;  5GMK m;  3P8H A;  3L2V A;  1VQ6 A;  2OTJ T;  1JJ2 S;  5KE3 A;  1QVG A;  4FT4 A;  3HRU A;  3CEY A;  2E1H A;  3QPH A;  4E7K A;  2FHD A;  3GP8 A;  5AYF A;  2DD5 B;  4LDX A;  2LTO A;  4C8Q D;  4JRQ A;  3JCM Q;  2RJE A;  2KVQ G;  4JS4 A;  3S3N A;  1OZ3 A;  1NPR A;  4QVD A;  4BE0 A;  2RA2 A;  2QFZ A;  5GAN h;  3BG3 A;  1JRI A;  1OZ2 A;  1YJ9 T;  2JVV A;  5DLQ E;  4RCC A;  4XK8 E;  5LJ3 f;  2X4Y A;  1KG1 A;  3VKI A;  5D6X A;  3ZFJ A;  1I5L A;  3QHS A;  2MMP A;  5GAM f;  1B34 B;  3RES A;  1IZ6 A;  4JX5 A;  3V8L A;  4C0D C;  2DD5 A;  4M78 E;  4EMG A;  3MP8 A;  3HBL A;  1QP2 A;  4IKF A;  4PNO A;  3QYG B;  4OB1 B;  3C4S A;  4M77 A;  3BG5 A;  4O6J A;  3PFS A;  3VUB A;  5KH6 A;  3MEW A;  3G71 T;  3CCS T;  3OW2 S;  1YHQ T;  3L2U A;  4JX4 A;  3CC4 T;  1OI1 A;  3QJ6 A;  2ZPI B;  3X26 B;  3MEA A;  3JCM e;  3OS5 A;  3GLX A;  1M1G A;  4KUD K;  1W2B A;  3RKX A;  1Y07 A;  3CD6 T;  3I56 T;  5GAN e;  3LWI A;  4KBM B;  1KQS A;  4HCZ A;  3V8J A;  1S72 A;  1M5Q 1;  1X01 A;  2KQW A;  3HRS A;  3CBM A;  3MEU A;  4M77 B;  3ZBD A;  3CC2 T;  4M7D B;  2VXF A;  4C92 F;  4JX6 A;  1WJQ A;  2FB7 A;  2QQA A;  5A0L A;  1S72 T;  4PJO A;  3GNF B;  4R56 A;  4C8Q E;  3GPL A;  2QEX A;  2EJF A;  1Q7Y U;  3E1S A;  3QZ5 B;  2WSE E;  2I2L A;  3OMG A;  4XU3 A;  1KHI A;  3AHU A;  2E70 A;  3BFM A;  4LD9 K;  3V8K A;  5GAO p;  5GAN j;  2X4J A;  3NTH A;  3OYH A;  2DIG A;  5LL6 S;  4C92 G;  3SFM A;  5FRM A;  4J83 A;  5GAO q;  1YJW T;  1W4S A;  1V29 B;  2PVD B;  3X20 B;  3CBO A;  2F5K A;  2RB6 A;  3H6Z A;  3QG1 A;  2RHX A;  4OMF B;  3VV0 A;  4LDY A;  1YJN A;  1KQ2 A;  2QQR A;  3QYH B;  1ZBX A;  2CGH A;  3CCJ T;  3P8B B;  3G7Z A;  4BY6 B;  3LGF A;  1K9M U;  4M78 C;  3PT9 A;  2O4X B;  3MO8 A;  4EPC A;  1VQK T;  2WJ9 A;  3S3O A;  3R6O A;  4D6W A;  1O9S A;  5HK0 A;  3RMS A;  3G4S A;  4PJO C;  2E10 A;  4LD6 A;  2LNV A;  2QQS A;  4J6Y A;  3CCR A;  2EQU A;  5DLO A;  1VQ7 A;  4HLQ A;  2E64 A;  5KCO A;  2EFI A;  2RK1 A;  2E6N A;  3JB9 J;  1Q82 U;  2RHZ A;  2LQK A;  2PU9 B;  5I2S A;  4C92 C;  3CMA T;  4A4E A;  4F7U G;  4F7U E;  1K73 C;  2OTJ A;  3VYH B;  1UB4 A;  2JUF A;  5GMK i;  3SWN A;  5GMK e;  3LGL A;  5FU7 B;  4PL6 A;  2RHY A;  3PIP A;  5C0M A;  5KE2 A;  5C6S A;  2XID A;  4HCB A;  4FSX A;  2V8K A;  1NJI U;  1M90 U;  2HQE A;  5I2M A;  4L5G A;  2DZ9 A;  3OSV A;  3HL8 A;  4C5H A;  3PMT A;  2V8I A;  2X4W A;  4RG2 A;  4Y91 A;  5CCA A;  3JCM X;  4E7L A;  2HQX A;  4M77 E;  3DL1 A;  4M77 G;  4M7D G;  4M7D E;  5GMK j;  3BW1 A;  1PSE A;  3M5A A;  3I55 T;  3MP1 A;  5FU6 B;  4EMK A;  4LDV A;  2R58 A;  4IUU A;  1KC8 U;  2K5L A;  1UGR B;  2VGN A;  4EMK C;  4N0A A;  3OYA A;  4M75 C;  1R8O B;  2YLC A;  3URG A;  5CK9 A;  2XDD A;  1UGQ B;  2DK3 A;  3WVD B;  3M57 A;  3QJY A;  2H3J A;  4L6V 5;  5LJ3 d;  3X24 B;  3E9G A;  4XTZ A;  5GAM h;  2EJ9 A;  3HO8 A;  2D6F A;  3CCU T;  2QDJ A;  2DIQ A;  3CCQ T;  2HAX A;  4PJO E;  5LJ3 h;  4FIB A;  3TRE A;  3J81 E;  1YJN T;  1NPP A;  2ZZD B;  2DTI A;  2RI5 A;  2XHC A;  5GAN f;  1VQL A;  4QQG A;  4E47 A;  4MFE A;  2P0P A;  4RCB A;  2DO3 A;  4OGE A;  4ZTJ A;  4HKE A;  3M53 A;  3CMA A;  1NJI C;  3MP6 A;  3VJP A;  4ZGJ B;  2GCX A;  4M75 F;  2ZPH B;  3DLM A;  1YIT T;  2EWN A;  3EAE A;  3L2Q A;  5CKE A;  2QEX T;  3OYI A;  4AKI A;  4B9W A;  3PGG A;  1N6A A;  4Q5W A;  5CVI A;  4M7A D;  1H3Z A;  3QYE A;  4IUV A;  3HSB A;  4M75 E;  3VU3 C;  1BYM A;  3MCA B;  3L2Z A;  4PKC C;  1NZ9 A;  1QP3 A;  1FWZ A;  3JCM g;  2K4Y A;  3HPW A;  2FVU A;  5J26 A;  3N5B B;  5FU7 C;  1FXX A;  3FC3 A;  1LNX A;  1Q81 U;  3OBW A;  2JZ2 A;  4XTW A;  5LJ3 e;  2O4X A;  5I21 A;  5LJ5 g;  3CC7 A;  4A4H A;  4M78 D;  4M75 G;  3OYG A;  3BDL A;  1Q82 C;  4ZGE B;  2R57 A;  2CS7 A;  3LYI A;  4OVA A;  3J7A F;  2P0K A;  3G6E T;  1PSF A;  4XTY A;  3BY7 A;  2DD4 A;  2VUB A;  3LW5 E;  4M75 D;  1VQL T;  2RM4 A;  4A4G A;  5HY6 A;  4A53 A;  3JCM b;  2DXC B;  5L8R E;  4BI8 B;  1BI1 A;  4C5E A;  5GAN 6;  3OYB A;  3G71 A;  1I4K 1;  3BDU A;  3PTA A;  3CCS A;  4DQ2 A;  2QA4 T;  1U8R A;  4M7A F;  1D3B A;  5GMK h;  1K9M C;  1BIB A;  5KCH A;  2K5I A;  3ME9 A;  4F7U A;  3CPW S;  5LJ3 j;  2XU8 A;  2XKO C;  1WJS A;  3A8G B;  5CQX A;  2XIC A;  3M9Q A;  5CKD A;  2L89 A;  2VC8 A;  5GAN 2;  3JB9 D;  2RI3 A;  4MIM A;  3QUI A;  4J6W A;  3VKH A;  2YLB A;  1YJ9 A;  4HCC A;  1WGS A;  1Y96 B;  5D6W A;  4MDW A;  3OS2 A;  4C0F A;  2QQ9 A;  1G5V A;  3CCE T;  4ME7 A;  2BS2 A;  4C0D B;  1W2B S;  3QXE B;  2CZ7 B;  1SSF A;  3DB4 A;  2LX9 A;  3M54 A;  3CCV T;  1VQ6 T;  3JRZ A;  2XI9 A;  4JRP A;  3JB9 I;  1QVP A;  5J39 A;  2R5A A;  4N4H A;  3S3M A;  2C06 A;  4C8Q A;  1VQM T;  1VQP T;  1VQN T;  3V7C A;  2CKK A;  3J80 E;  2PUO B;  5FLX E;  2KSS A;  1K8A U;  2LCL A;  2GFA A;  2LT4 A;  4NL3 A;  2OAU A;  4HNT A;  1VQP A;  3X25 B;  3OYE A;  3M4Y A;  4ELJ A;  1X75 C;  2RJF A;  5EG2 A;  3G6E A;  5CKH A;  3CCV A;  4BDY A;  2LRQ A;  2LVM A;  2IG0 A;  2YRV A;  3FB9 A;  5CQY A;  5FU6 C;  1BKB A;  2DTH A;  5LJ5 f;  1ZHI A;  4BBR M;  2NLU A;  4JRK A;  1Y7X A;  3ZEH A;  1UEB A;  1M8V A;  3CCE A;  2WSF E;  1I8F A;  3EFS A;  4R55 A;  2JOY A;  4QSH A;  2IVW A;  1D3B B;  4QVZ A;  1Q86 C;  4HT9 A;  4B9X A;  3JB9 F;  4NOY A;  4MZP A;  5A0D A;  3JCM h;  4CRI A;  1XTD A;  1MHN A;  2BIV A;  2DTO A;  3FJP A;  1FKM A;  1N27 A;  3QO3 A;  4QQ6 A;  1TH7 A;  3SWN C;  2KR6 A;  3SD4 A;  3OYM A;  4MFD A;  4HNV A;  2XD0 A;  3A8M B;  2QA4 A;  2RI2 A;  2X4X A;  4ZTF A;  2JTM A;  4P5N A;  2G3R A;  2PVO B;  4BY6 C;  3OMC A;  4PLI A;  4O5V A;  4EMK B;  1KQS S;  1ZQ1 A;  5LJ5 h;  4E7J A;  2QQB A;  4KUL A;  2KDS A;  2RO0 A;  2XG8 D;  2YHT A;  1LOJ A;  5GAN d;  1JJ2 A;  3SDZ A;  3QDR B;  1N9R A;  3HFN A;  3OS0 A;  3TCJ A;  1LJO A;  3C12 A;  2EIF A;  5CKF A;  3JCM d;  1N8R U;  1VQO T;  1Y71 A;  2RHI A;  1FX7 A;  3GF5 A;  4XQ3 A;  3OB9 A;  1YIT A;  1JBM A;  4M78 F;  3VKG A;  2RD1 A;  2KAF A;  3E9F A;  3ER0 A;  4M77 C;  4M7D C;  5FRN A;  4KUI A;  2E5Q A;  3DB3 A;  5GAN 7;  3CC2 A;  4C8Q G;  2DXT A;  1MGQ A;  2K3Y A;  2Y4X A;  3L2W A;  3PNW C;  3JCM c;  5DM7 R;  5EJC A;  3A8H B;  1YIJ A;  3JAM E;  1BI3 A;  4C8Q B;  2DD4 B;  5CAI A;  2FYK A;  4QQD A;  3I55 A;  2RJC A;  3QII A;  4OP0 A;  3CBP A;  4VUB A;  3CCJ A;  1G3S A;  3CD6 A;  5LJ5 j;  4M6V A;  1DJ7 B;  1AHJ B;  3KBG A;  5GAM g;  1RI0 A;  1M9S A;  4BE2 A;  4EMH A;  4J5Y A;  4JRI A;  2X35 A;  4BUG A;  2BS4 A;  1YHQ A;  3HB9 A;  3TW7 A;  3PMI A;  4F7U B;  5IT9 E;  3OYK A;  4C92 E;  3JSC A;  4LDW A;  4C0Z A;  3A5Z B;  5GAM j;  3OYJ A;  1K8A C;  3CME T;  2HNI A;  3DLL A;  5CR2 A;  2D0Q B;  3M58 A;  4J7I A;  1XQH A;  4E7I A;  3QKJ A;  4EDU A;  3CPW A;  3TU4 K;  4PJO G;  3M56 A;  1VIE A;  4ZGD B;  2KMT A;  4HA8 A;  1VQ4 T;  2EKO A;  5LJ3 g;  3QWL A;  1RL2 A;  1M90 C;  2K57 A;  4HT8 A;  4OGC A;  3JB9 G;  4PJO B;  4BAC A;  3OYL A;  5GAN 4;  2E12 A;  1M4Z A;  4J6X A;  4BB7 A;  4BE1 A;  1KD1 U;  2CZ0 B;  5GAN 5;  4N4G A;  3CPF A;  4C0G A;  2LC4 A;  1H64 1;  3OW2 A;  4PJO F;  4X9C A;  4M7A C;  1VQ9 A;  1VQK A;  4M77 D;  1QLB A;  1VQ8 A;  4M7D D;  5IN1 A;  4ZN3 A;  3UT1 A;  2DJZ A;  3VUZ A;  2BS3 A;  4HNU A;  1X6O A;  3T9N A;  1Q7Y C;  2ZPF B;  2A7Y A;  2BKD N;  1VQ5 T;  2ZCF B;  1VIF A;  3SB2 A;  4M78 G;  2K2V A;  4II1 A;  4J7F A;  1HXD A;  1U1S A;  2ZGW A;  1VUB A;  2PQW A;  2MI6 A;  3MET A;  3V7S A;  2EAY A;  2OTL T;  4NS5 A;  3LLR A;  2E41 A;  3VYG B;  3CXC S;  2CYZ B;  2M0O A;  5CKB A;  4XTX A;  2DXB A;  4F7U F;  5GAM d;  3OY9 A;  1N8R C;  2GFU A;  4PJO D;  1WQ7 A;  4M75 A;  5GAN 8;  1M1F A;  3MEV A;  4JDS A;  2VV5 A;  5HK3 A;  4ZN1 A;  4C5I A;  3P8D A;  3CC7 T;  5A0G A;  1YIJ T;  4X34 A;  1N9S A;  2KY9 A;  2QF7 A;  3TW6 A;  4ATO A;  3MHX A;  4ELY C;  3OYC A;  1KD1 C;  3JCM V;  5IAY A;  3JCM J;  4FU6 A;  3M4G A;  4BI4 A;  4DOV A;  2DEQ A;  3M55 A;  3WVE B;  1KC8 C;  3SWN B;  2JTF A;  2AHJ B;  2G77 A;  4M7A E;  3HRT A;  4RG8 A;  1Q86 U;  4UC4 A;  2ZPB B;  4BBS M;  4M75 B;  4C8Q C;  2Y4Y A;  4V2S A;  3LWH A;  1KQ1 A;  3M59 A;  4CI0 C;  2XDP A;  3KUF A;  3CCL A;  4LOC A;  3RKW A;  4YTL A;  4QVC A;  2EYQ A;  4DA4 A;  2ZPE B;  3JB9 H;  4J8O A;  3FDR A;  4Y28 E;  3OYY A;  4C92 D;  2HD0 A;  5DY9 A;  4C92 B;  4GY5 A;  4M77 F;  1WJR A;  4Z02 A;  3OA6 A;  2OTL A;  4M7D F;  3OYN A;  3Q1J A;  2L8D A;  3RKY A;  3PIO A;  2RJD A;  2QI2 A;  3CCU A;  2LT1 A;  4MZM A;  3EFR A;  2M1H A;  2PUK B;  1UGP B;  1UGS B;  4IUP A;  4XU2 A;  2FL7 A;  3X28 B;  1WPY A;  1HK9 A;  3L42 A;  2MWO A;  3KXT A;  2QTX A;  1VQ8 T;  3HP9 A;  2DXC A;  2DAQ A;  3NTK A;  3E19 A;  3A8O B;  3FRN A;  3S6W A;  2K3X A;  1O75 A;  2VXE A;  3I56 A;  1BI2 A;  2WSC E;  2K5F A;  3KHI A;  4AKG A;  4XU0 A;  1GXI E;  4M7D A;  4JLG A;  1QVF S;  4L59 A;  4XTV A;  3CC4 A;  4M78 B;  3A8L B;  3OYD A;  2XDB A;  2QQ8 A;  4KT0 E;  2BUD A;  4LDU A;  4MML A;  2GQV A;  2CZ1 B;  4OB3 B;  1VQ4 A;  4MMK A;  1XNI A;  2CZ6 B;  3V7R A;  3GIB A;  3QBY A;  1Y96 A;  3JCM f;  3C94 A;  1VQM A;  1VQN A;  3CME A;  4XTU A;  2E65 A;  3INZ A;  2B8A A;  2E6Z A;  4JLI A;  1K73 U;  5LJ5 d;  1E7P A;  1B34 A;  2LDM A;  4IUT A;  3JCM W;  2Y90 A;  2VGM A;  4IUQ A;  5GAN 3;  3OS1 A;  4BDZ A;  3OSS C;  3CCL T;  1WNL A;  1WQW A;  2EQJ A;  2P4T A;  1YI2 A;  2O01 E;  2V8J A;  2WAC A;  1VQ9 T;  2DXU A;  3F70 A;  2PVG B;  3LH0 A;  3VYG A;  2VYT A;  1VQ7 T;  1QW1 A;  2R5M A;  5CIU A;  3CCR T;  2ZZD A;  3UPU A;  4AI6 A;  2RH2 A;  5GAN g;  1OYX A;  1BI0 A;  4M7A B;  5LJ5 e;  2XK0 A;  3LX7 A;  4BD3 A;  3HZJ A;  4XAX B;  4JS5 A;  2EQK A;  4JUV A;  4M7A G;  1KHC A;  2JNG A;  3CCM A;  2DVE A;  3FLG A;  4NL2 A;  5GAO m;  3BG9 A;  4IUR A;  3JCM P;  5J3B A;  2RK2 A;  5FRO A;  1VQO A;  2LQ8 A;  1U1T A;  3WXM B;  4DOW A;  4JJN K;  2DXB B;  3O8V A;  4OB0 B;  3QSU A;  3TEE A;  3RUX A;  1YJW A;  2QDY B;  2DZC A;  2F5T X;  1G3T A;  3HFO A;  3FIF A;  3C95 A;  4M7A A;  2MAM A;  4FT2 A;  2ZPG B;  1G3W A;  4FL6 A;  3OQ5 A;  1JB0 E;  4BI3 A;  4ELZ C;  4MZT A;  1YBY A;  4QW2 A;  5GMK l;  1I81 A;  2KMG A;  4WF2 A;  3CCQ A;  4A4K A;  3GNG A;  1M1K C;  5GAM e;  1YCY A;  5GAO r;  4FM4 B;  4M78 A;  3OYF A;  4NC6 A;  4GLK A;  1QVG S;  2KK4 A;  2DPP B;  3HHT B;  5A2Q E;  1M1K U;  2HBP A;  1XOV A;  2GF7 A;  2D9T A;  3ASK A;  3L1A A;  5CO7 A;  3G4S T;  4OF1 A;  1G3Y A;  1BIA A;  5GAO n;  4A4F A;  3UWN A;  4Z6Y A;  3L2R A;  3H4C A;  2M16 A;  2RHU A;  3CXC A;  4X9D A;  3NFC A;  1Q81 C;  4MDX A;  3GOX A;  5D6Y A;  4XU1 A;  4RMO A;  2M9U A;  4N0A C;  4C92 A;  2F69 A;  4HL4 A;  2DKG A;  1YI2 T;  5GAO l;  2EQM A;  1IRE B;  1NE8 A;  3QYB A;  4TVR A;  2MWP A;  3FEO A;  3RIR A;  3H8Z A;  4AKH A;  5HKC A;  3HKS A;  3UDC A;  4C8Q F;  2P0Q A;  2LCC A;  5M9O A;  2EJG A;  3RER A;  4OB2 B;  2QXF A;  3DKM A;  2L5Q A;  1QVF A;  2A3L A;  3RMQ A;  4E7H A;  2L3R A;  1VQ5 A;  3QZ9 B;  1P92 A;  4C5G A;  4RKU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...