1UGSB

Crystal structure of ay114t mutant of co-type nitrile hydratase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
228
structure length
228
Chain Sequence
b'MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile Hydratase alpha subunit
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 66
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugsB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugsB02
3A8LB 2D0QB 2O01E 2ZPFB 3X28B 4RKUE 2AHJB 2WSFE 4OB1B 5L8RE 2ZZDB 3QXEB 2DD5A 2CZ7B 1QP2A 2PVOB 1UGQB 3QZ5B 3X25B 2ZPIB 2WSEE 2ZZDA 2ZPGB 2ZCFB 3HHTB 3A8OB 4KT0E 2PU9B 1UGSB 4Y28E 2DXCB 3WVDB 2CZ6B 4OB3B 2CZ1B 1UGRB 1V29B 2DXCA 2ZPEB 2ZPBB 2DD4B 2ZPHB 1IREB 4ZGDB 1AHJB 2DPPB 3QYHB 4ZGEB 2DXBB 2CYZB 1UGPB 3LW5E 3VYGB 3VYHB 1JB0E 1GXIE 2PVDB 1QP3A 2DD4A 3QZ9B 4OB0B 1PSEA 3X26B 4XK8E 4OB2B 2DXBA 2PVGB 4L6V5 3A8MB 3QYGB 3VYGA 2PUKB 2QDYB 3X20B 3X24B 4ZGJB 4FM4B 1DJ7B 2CZ0B 2PUOB 3WVEB 2DD5B 2WSCE 3A8GB 1PSFA 3A8HB
chains in the Genus database with same CATH superfamily
1MV3A 5I22A 4KGVB 4FU6A 1Q86C 1CKAA 5I5ZB 4PJOG 3RMQA 5LJ3d 1JJ2S 1KJWA 2GFAA 1P92A 3K7AM 1X6OA 3CC7A 2RMOA 2CGHA 2RHIA 2C5VB 1KSWA 4JS4A 2F2CA 1W2BS 2E12A 1VINA 1D0ZA 1T3LA 2O31A 5IH2A 5DLOA 4M7DD 4BY6B 4ESRA 4HKEA 3PT9A 1M9SA 2HNIA 4C92D 3BG9A 3G33B 2WEVB 1RAEB 3L2UA 3A1PA 3A8OB 3H4CA 4KH0B 5FGKB 2ENMA 4A54A 1KD1R 4JJNK 3CC2A 2LQKA 2QYZA 1JEGA 4HLQA 1E6GA 1YJ9T 4OB3B 5CIUA 2XKOC 3QUIA 1FVVB 1UGRB 1I1JA 4MZTA 2O2OA 2BPMB 4E7ZA 2ZPBB 2KT8A 3KHIA 2CP6A 2HKQB 4LOCA 2YT6A 1T3SA 2DPPB 2EQMA 4QQGA 4NC6A 1K4US 2V1RA 3M58A 1WHLA 4JX6A 1YWPA 4A4EA 1N5ZA 3ULRB 5GMKl 4PJOF 2P4TA 1UNHD 5GAMg 1GXIE 4OF1A 4DBHA 1XNIA 2E3HA 4RTXA 3I55Q 1VQ5A 3JCMc 1BI2A 4XQ3A 1G3YA 1AOJA 1C6VX 4FX3B 1WDXA 3FJ5A 1F5QB 1S72T 2UZLB 4E2FB 2DXUA 3JB9H 2KRNA 2V8KA 3U23A 5IF1B 4PJOB 1VYWB 3E19A 1JQQA 1QVFS 4OR5B 3GOXA 3VKHA 3RBBB 5GAMf 2D0NA 1KFZA 4NS5A 5KYXA 1B7TA 1D3BB 3GF5A 1OOTA 3SB2A 2CP7A 2F2WA 2KT1A 4BBRM 4RG2A 5GANj 2CCIB 1U5SA 2LC4A 3M0RA 5GMKh 3RKYA 3CXCS 1YCYA 1NYFA 2IW8B 4BCFB 1VQ7A 4F7LB 3RESA 5LQFB 1C9BA 3I56T 4YOZA 1D1BA 5GAN6 4FYYB 1KQSS 2LZ6B 1R8OB 2X4JA 3CCMA 4M7AC 5FWCA 2ZZDA 2J6KA 4M77G 2QK0A 1VQMT 2J6FA 1UG1A 3GNGA 3DDQB 3CD6T 2SRCA 2DBKA 4BCHB 5L23A 2KDSA 3LH0A 3VS5A 4DOVA 3WVDB 4PJOE 2KROA 1H1RB 2W10A 3AT1B 1UTIA 1X2KA 5CYIB 1BYMA 4PJOD 3SFMA 5CAIA 2IW6B 4F6SB 2XI9A 3OYBA 4JZ4A 1B34A 1IO6A 5LMKB 1Y7XA 2ZPHB 1J3TA 1ZSZC 5HBEB 2COZA 2EIFA 3NPFA 4CC3A 2M9UA 2EYQA 3JCMW 1KIKA 3FRNA 1Q7YR 1G2BA 3S6WA 3CBOA 2K2MA 5GAOp 5FLXE 3TW7A 1D09B 3LX7A 2PVDB 4YC3B 4BCNB 4RMOA 4OB0B 3VS6A 1H28B 4ELYC 2FPDA 4RUGA 1YCSB 3NHNA 2QGFB 1PG5B 3M55A 4AT1B 4DBQA 1H25B 4J8OA 1OYXA 2LQWA 2QQ9A 3N5BB 2QGGA 4M77F 2DZ9A 1UGVA 1MMAA 1VQOT 2GF7A 1N9RA 2A3LA 2RQWA 3EG3A 3PVQA 5EJCA 3CMEA 4M78E 3NTIA 2QTXA 2GTJA 2AKKA 2CSQA 3QIIA 4RTZA 4BE2A 3OYDA 3BLHB 2R57A 1RAFB 5KYUB 4M6VA 1VQPQ 2ED1A 1XJWB 1ZP2A 4C8QG 3HTRA 2CJMB 4GBQA 1UNLD 1YIJT 2ZPFB 3R6OA 2MYSA 1VQ8Q 4O6JA 2WMAB 5IHNA 4OB1B 5LJ5g 1YHQQ 2DJQA 2PMIB 1NEBA 2ECZA 1Y96B 4DQ2A 1W4SA 1K8AR 4LDXA 2IVXA 1I5LA 4BE0A 3CCRQ 9ATCB 1GFDA 2ED0A 2EFIA 4Z02A 4BCND 1HJDA 2KMGA 4N4IA 3DB3A 1AWJA 1OPLA 3CCSQ 2RA2A 4E6RA 2KXCA 3BY7A 4F6UB 1RL2A 2QAZA 4PJJA 4PJLA 1VA7A 1Q81U 1TU0B 3VS3A 3E1SA 2YUOA 2X3WD 1TUGB 1IXDA 4UC4A 3I5RA 2A0FB 5LJ5f 2ESWA 4E7LA 1RAHB 2KE9A 5GAN5 4HVWA 1OX8A 2MI6A 1K1ZA 4B9WA 4IUVA 2QF7A 3HZJA 3I35A 1AWWA 2H8HA 4C8QF 3EGXB 4G6LB 4X1VA 3QYHB 1K9MU 4NOYA 3BG5A 2P4RA 2JNGA 3VYGB 4AFSC 3VYHB 2LX9A 4M7AA 4KH1B 1AZEA 3MP6A 2VKNA 4NSTB 1ZLMA 4AMCA 3NGPA 2LT1A 1RAGB 4M77D 1TXQA 2DXBA 4J6WA 2VVKA 5HBHB 1QCOA 3QHSA 2KRSA 2JTEA 4EOOB 2AKLA 2O4XA 4J7IA 3JB9G 1M3CA 4C8QB 4JJDA 1BIBA 2EQKA 3CC7T 1UFFA 3V8LA 3GIBA 1ZSZA 1IB8A 1DJ7B 2B86A 1WPYA 1FYNA 3H41A 3EFSA 4JRPA 2QQAA 4CRLB 3A8GB 3HPWA 3MI9B 1F1BB 1RLQC 1JKWA 5CK9A 2KR3A 3S3MA 3CC2T 2RF0A 2DF6A 4L59A 4C0GA 4MMKA 4XU3A 1QVFP 2FO0A 4F17A 1W1FA 3MP1A 1P5EB 5I2MA 1U1SA 1U1TA 4FT2A 4EMHA 1MNEA 3CCQQ 3I5SA 4QT7A 3HRSA 1E7PA 3OYMA 4AI6A 3CCLQ 2JZ2A 1PM3A 4BE1A 4Q5WA 2E64A 4C8QE 2XIDA 1WI7A 2YWWA 3H8ZA 2EBPA 3JB9F 3CCVQ 5GAN8 2MK5A 4MFEA 2DEUA 4BUGA 1VQ5T 1KQSP 4FIBA 4AKGA 3G6ET 2CZ1B 4C8QD 3OS2A 3OYGA 4KUDK 2WXVB 2F2XA 4CFWB 5GANg 3QDRB 1VQ4T 3C4SA 2JT4A 1NBEB 5KYNA 1R0BG 1X6GA 4TTHA 1IREB 2CSIA 1N4MA 2QGSA 1YNZA 4ZGEB 5I21A 4VUBA 2QTVA 1VQNA 1UGPB 3LW5E 1BK2A 2FRWA 4BCMB 4XTXA 5ACBA 2DVJA 3OW2A 4DOWA 1Q82C 1NJIC 4X9CA 2UZBB 4XTWA 1G3NC 1SF9A 3I56A 2DKGA 3QPHA 1LVKA 4J9HA 2MMPA 4Z89A 5D6YA 3CMAA 5GAOm 4BCGB 3H0HA 1YI2A 3QWXX 4PLIA 1YJ9Q 1M2VB 2VB6A 2NUTA 5GANf 3RKWA 1JXOA 1VQ7T 3CQTA 2CUBA 4R56A 1Y71A 3ZEHA 3FLGA 5HCKA 1VQMA 4CFUB 1JU5C 3X24B 3A5ZB 2RQTA 2EGAA 1NLPC 2G77A 3UATA 2JW4A 2EQJA 3CCMT 1X2QA 2LCLA 1K9AA 2IIMA 1GBQA 2DE0X 4AFZC 4UN0A 1BI0A 2OX7A 3JCMg 1PC0A 1XTDA 2CT3A 2RI5A 3OQ5A 2AHJB 2LNHB 2A08A 2YHTA 2HSEB 2L3RA 2W2HA 2YLBA 3BLQB 3L2VA 3QXEB 1S1NA 2K6DA 1JRIA 4HT8A 1M1GA 1WJRA 1K73R 3JB9D 3BE3A 4X34A 2JS0A 1S72Q 3VS0A 4NL3A 2DTOA 2O9SA 2FEIA 3TW6A 2X4YA 1TG0A 1R0CB 1M90U 3KBGA 3EGDA 2DERA 4Y28E 3ZL7C 4EOPB 2E1HA 1EX4A 2WFYB 1AISB 2CZ6B 1VQKQ 5HY6A 4M75C 5GJWB 1QW1A 1E7OA 1KXUA 4EONB 1VQ6T 3EG1A 1OKVB 2GQVA 4XU0A 2O9VA 4PLLA 3OW2P 4ORZA 4YOSA 2GCXA 2MWOA 3HSBA 3M0UA 2K5LA 3PMIA 4P5NA 3LWHA 5DQVA 3URGA 2JTMA 5LJ3j 2EYXA 2CP0A 3P8BB 3CD6Q 2KXDA 3JCMe 3RR6A 1PRLC 2DBMA 1SSHA 5FW9A 5D6WA 5CEIB 3C12A 3ZBDA 4BI3A 1D1AA 1VYTA 1KHIA 4KBMB 1QWFA 2QG9B 4OMOA 2BS4A 3HFNA 2WPAB 4IKFA 1Q86R 1ARKA 1G83A 4HCBA 2PUOB 3INZA 3NMZC 4R0KA 4C92B 1YJWQ 1ZUUA 4OP0A 2UUEB 2WIPB 2EJFA 4XAXB 1OIYB 4FW2A 1YN8A 4JX5A 4KRCB 3JCMV 4JDSA 2ZZDB 4C0DC 3JCMh 1OPKA 2KQWA 4HCZA 1KC8U 2YSQA 1GRIA 2KY9A 2A36A 2DL5A 1QVGP 3V7CA 1QLBA 1H1PB 4FW1A 1UECA 1VQOQ 5FU6C 2QQSA 4FYXB 2F69A 8AT1B 1OEBA 2KK4A 1VQLQ 3VS4A 1QCFA 3G4SA 4E7IA 4J5YA 2I0NA 3DKMA 1NLOC 4M7DE 2PK2A 2DIGA 4RTWA 1H27B 2IG0A 4C92E 1LOJA 1YIJQ 3LYIA 2ZAEA 1MV0B 3EAEA 3ME9A 3DTOA 2HBPA 3OBWA 4MMLA 4F7JB 1E6HA 5IHIA 2QEXA 1M2OA 2F1LA 4JZ3A 1I8FA 4O5VA 4RG8A 2DMOA 1QP3A 2DD4A 2BKZB 1IZ6A 3M4YA 4J9FA 4M7AG 4EORB 2FB7A 1N8RU 1WLPB 4OB2B 4BDZA 5AT1B 1KQ1A 4BY6C 4M75A 4V2SA 3VKGA 1RLPC 2GNCA 3PIOA 1W98B 5IHYA 1GBRA 1TS9A 5FRNA 1MUZA 2DRMA 1TSFA 3V7RA 2QA4T 2DIQA 4CC2A 3EGUA 3KFVA 2DVEA 3NTKA 1H92A 4C5EA 2OTJQ 3PIPA 2X51A 4LD9K 2DRKA 2W0ZA 3G6EA 1TWBA 5GMKe 1M1FA 2J6OA 1Q95G 4I3ZB 2KNBB 2KEAA 1X75C 3VRYA 3MHXA 1VQ4A 2OTLA 3BDUA 3CCJA 1RI9A 1Y0MA 5ECAA 1H26B 3KUFA 1M1KU 4MZPA 2DMEA 2GFUA 2YUNA 2CUDA 1OX9A 1UGQB 2IN3A 1YFNA 3QZ5B 2QASA 1Z9QA 2CT4A 3MEWA 3TEEA 4QSHA 4PFOA 4M7AF 4BXXX 4Y92A 4KGXB 3RERA 7AT1B 3PTAA 2YLCA 1H8KA 2DAQA 4PJNA 4LD6A 1VQNT 2PU9B 5I11A 1RADB 1PCXA 4PNOA 2VXFA 2C5OB 4BBSM 3OYHA 4F6WB 3TN8B 1D0YA 2J06A 3CMAT 3QKJA 3CC2Q 3V8JA 2KYMA 4M7AB 1YI2T 1UB4A 2M1HA 2NWMA 3OYFA 2FZGB 4MIMA 3EG9A 1OU9A 1YJNA 1PHTA 2QQ8A 5IAYA 3CPFA 4OVAA 2EYWA 2DXBB 2QDJA 2D8JA 4X9DA 2GQIA 4BI4A 4IUPA 5GAMe 1EIFA 2K57A 3OSSC 2Z0WA 4ZTJA 2C0IA 4ANJA 2FPFA 1VQ8A 1UHFA 2X9HA 2QI2A 4BCKB 1ZSZB 3VJPA 4F04B 4IUTA 2FHDA 1VIFA 1VQ5Q 2L0AA 1Q81C 1OQKA 2VUBA 4JUVA 1HXDA 3JRZA 2RO0A 4AG2C 2X4XA 4OMPA 3L1AA 4M78C 2XG8D 1KG1A 3TNWB 3WVEB 2KRMA 1V76A 2WSCE 3S3NA 1VQ6A 3OA6A 5GAMh 1K9MC 3REBB 3L2RA 3OB9A 2K3YA 3EG0A 4II5B 3S3OA 4L5GA 3G71T 1KD1U 5LJ3g 2MCNA 1IRXA 5FU7C 1VQ9A 4M7AD 2XMFA 4EOJB 4WCIA 4LXCA 2QQRA 2LCCA 2L3QA 2DILA 4FSXA 2HKNA 4C0ZA 1N9SA 1QKXA 3FIFA 2XU8A 3JCMJ 1VQ7Q 1M27C 3HRTA 2RJEA 2E6ZA 3DL1A 2ZPGB 2JJ9A 4PFZA 3HHTB 4QKUA 4AFQC 1VYUA 2OAWA 2F2VA 2YDLA 5CQXA 4FSSA 3CCEA 4A4FA 3C94A 4M77B 3EJ1B 2M16A 3CCMQ 3QWYA 4IUQA 2MAMA 5LJ3f 3C0CA 1PD1A 1ZA1B 2E6NA 3L2ZA 2COYA 2R58A 2DXCA 2DA9A 3META 3PNWC 5IDNB 3J7AF 1SSFA 2K5FA 4RTUA 3OY9A 4JRKA 5C0MA 2L8DA 4RODA 3UF4A 4QQ6A 4AG1C 1FMVA 3OMGA 2RI3A 3OW2S 1M3BA 1W6XA 1AEYA 5A0DA 1I81A 4Z88A 4JLGA 3GLXA 4A4HA 3OYJA 2UZDB 2NUTB 4EC9B 5EC7A 2M0YA 2FYKA 2HL5C 4OGRB 4MZMA 2C0TA 2P0PA 3DLMA 2CP5A 4B9XA 1GUXA 1VOLA 2L89A 1H3HA 3HL8A 2BZXA 2B9RA 4BCQD 4M77E 2GBQA 3QBYA 3VS2A 4C0FA 2PJQA 2JTFA 4PJMA 3HO8A 3F70A 2X4WA 4TVRA 1VUBA 4AFUC 4KRTA 4J9CA 5ICPB 2RQUA 3EIDB 2RK1A 1I5OB 4M4ZA 4ELLA 2RJFA 1TTHB 2CH4A 1ZUKA 3A8HB 3A8LB 3CC4A 3CMEQ 1SHGA 3G4ST 4DEXA 4LE9A 5CQYA 3VUZA 3OBYA 4XTUA 4K11A 2KMTA 2V8IA 5LJ5e 3MCAB 1TH7A 1SRMA 1M4ZA 2E41A 3GPLA 3IQLA 1PKSA 1WQWA 5LJ3h 1SEMA 2E65A 2FL7A 3NDQA 2HL3A 2WSEE 3H6ZA 1SRLA 3TCJA 2QEXT 2JOYA 1Q7YU 1GCQC 2RPNA 4M78A 1QVGS 2BS2A 2NUZA 3CPWA 1G8XA 4IIMA 1BB9A 1H4LD 5DQWA 3ER0A 2QA4A 4YTLA 4C5HA 3HB9A 2EJ9A 5KYWB 2FZKB 2Y4XA 4EPCA 5LJ5h 1OZ2A 1Q82R 3TU4K 1OIUB 1NJIR 1AVZC 3MJXA 1ZQ1A 2MIOA 2L2PA 3O0GD 2HQHA 2W9ZA 3TREA 3TSZA 2XDDA 2OJ2A 3CEYA 1JBMA 3V7SA 4QVDA 3LGLA 4F7NB 2QFZA 2W99A 1AD5A 2C06A 2A28A 3VS1A 3OYNA 1M90C 2WMBB 5D7UA 2K2VA 3FJPA 5KCHA 2BKDN 3OYCA 1O75A 2OTLT 4MFDA 1RAAB 2DYIA 2LP5A 1SHFA 3CCJT 3QYGB 2A37A 2P0KA 2RD1A 2XDBA 1ZHIA 4PK4A 3JB9I 2M0OA 5IDPB 4M75G 2R7GA 1JO8A 2K3XA 1WX6A 2EYZA 1SKUB 1K8AU 2KR6A 2V8JA 5DM7R 1A0NB 3WXMB 1T0HA 1NYGA 3EHQA 2K9GA 3BHUB 4BCJB 1VQKA 1ENWA 4FT4A 2DYBA 2KAFA 3X28B 3ASKA 5KYYB 3C95A 3OYIA 3GP8A 2VYTA 2K7AA 5FWBA 3SWNC 3EH2A 2L3PA 3Q1JA 2LW4A 2RN8A 3CCUA 4DBRA 2E5QA 1K0SA 2K5IA 5CKDA 2LT4A 1X01A 2DNUA 5GAOl 1OULA 3CPWP 2BZYA 3O5ZA 3X25B 1YJNT 3VUBA 1H1QB 2ZGWA 4CI0C 2VV5A 4OMMA 2BZ8A 2COWA 3MEAA 1UGSB 2DTIA 3MY5B 4M75F 2PZ1A 2KGTA 1VQ8T 1WHKA 1YHQT 4CXAB 3EGXA 2EKOA 1PKDB 4BI8B 5GANe 1V29B 4HA8A 1MNDA 2DD4B 3CCRT 3P8DA 5FRMA 2M51A 2P84A 1KQ2A 2RH2A 4XTZA 1OKWB 1FMWA 1YJWA 3OYAA 2EJGA 2RM4A 1ZBXA 1GL5A 2EQUA 1WYXA 4D8DA 3RDVA 1KC8C 3G71A 1OZ3A 2JGZB 2XICA 3DLLA 5GAMd 4CC4B 1GCQA 4BD3A 1YITA 4XK8E 3RKXA 1K0XA 1ABQA 5J39A 1X43A 2PTKA 3G1JA 1VQ9T 1NPPA 4RTTA 1D0XA 4MDWA 4Z8AA 1FKMA 2GTOA 3I56Q 3SDZA 5GANh 8ATCB 1WFWA 2MF2A 5D6XA 2XK0A 1I07A 5KE3A 2E5KA 4EIKA 2G9XB 1YI2Q 3LGFA 2RJCA 2MWPA 5AYFA 2V1QA 4JX4A 2HZYA 4QQDA 1VQMQ 3PE0A 4LUDA 1AT1B 4LDUA 3CCET 5CKFA 3EHRA 2FRYA 2YUPA 4IURA 5GMKi 5KYXB 4EOQB 2K4YA 4EMKC 5KH6A 3POMA 2OAUA 1G5VA 2CZ7B 4HNVA 2PVOB 2RQVA 2PK9B 3QWLA 5HNBB 2HEQA 1XO2A 3EOCB 3QJ6A 2RHYA 2EYYA 4M75D 1RAIB 5C6SA 2PHGA 4F7UA 3RNJA 4KRDB 4J83A 4JRIA 3V8KA 1D3UB 2VWFA 2RK2A 5M9OA 2DEQA 4A53A 3J81E 3OS5A 4C0DB 2QQBA 3EG9B 2VC8A 2AZVA 4YOOA 4M7DC 5CKBA 5BNJB 2J05A 1T0JA 4F70B 4FYWB 1OV3A 4C92C 2RJDA 3SWNA 2YUQA 5FU6B 2BE9B 2LQ8A 5CVIA 3JCMP 2KBTA 1I0CA 3I55A 1UEBA 3CCLT 1M1KC 2Y90A 1XQHA 1B34B 1UJYA 3EH1A 5GAOq 1JB0E 2RQRA 3LLRA 3CCVT 1QVPA 2I40B 1UJ0A 2ABLA 3QJYA 4EMGA 1M2VA 5HBJB 1OGUB 3JV3A 1PKTA 3CC4T 5HK0A 1WXUA 2V26A 1OI1A 2YXYA 2PVGB 1LNXA 4L6V5 2A7YA 3A8MB 2HD0A 3D7SB 2JM9A 2RHUA 2VXEA 2D8HA 3RIRA 1AWOA 2JUFA 2EQIA 2HDAA 2XHCA 4KULA 3DB4A 3X20B 1O9KA 3QYEA 4GLMA 3TNHB 1K73U 4KGZB 4HT9A 2CZ0B 3CBPA 5HK3A 3B57A 1WHGA 1R77A 4CFVB 4HL4A 2EKHA 1JXMA 5FROA 3AHUA 2QXFA 2X35A 3OYEA 3RMSA 2DJZA 1QKWA 4RCCA 2I53A 4LUEA 2WSFE 3M4GA 4AKIA 2LRQA 3NFCA 1V1CA 3SEMA 1C0MA 4C5IA 5LJ5d 4LNPA 3OMCA 2WIHB 1BKBA 1WGSA 5GMKm 4Y91A 1NM7A 4CFXB 2HSPA 3H0FA 3FEOA 4WF2A 2D6FA 4ZN1A 2EVRA 1MMGA 4J9EA 4CFMB 1X69A 2DXCB 2EWNA 2NLUA 3NTHA 2ROLA 2LNVA 1AWXA 4M78G 2RHZA 3OS1A 4JS5A 1ACMB 3GNFB 2IW9B 2LQNA 1NG2A 1OL2B 3VS7A 3EFOA 3G4SQ 1N6AA 2ZPEB 4EMKA 4JRQA 2AZSA 1KD1C 4E7KA 5IHKA 2HMAA 4JJBA 3CC7Q 1XOVA 2BIVA 3A98A 2AIRB 2FZCB 1IHWA 4XU2A 4QVZA 4BCOB 2IVWA 5GAN4 1Q86U 1Q81R 3M0PA 1GUXB 3M0TA 3H0IA 1LCKA 4PJOC 4BCIB 1OU8A 2EW3A 1PSEA 3BHVB 3RGFB 1VQKT 1N27A 4HVUA 2XD0A 2LMJA 3J80E 2QEXQ 3MEUA 3UDCA 2K79A 3M03A 4ROEA 4M7DA 3BG3A 2DL7A 3PO3S 2NUPA 2UZEB 3CCUT 1BU2A 4C92A 5IXFA 1K9MR 1ZSGA 3L2QA 1IGUA 3TSWA 1VQPA 1WJSA 4BB7A 4BCPB 3OYKA 2G3RA 3HRUA 1RACB 4M78F 4F14A 2O4XB 4JPBW 1UNGD 4XU1A 2JN0A 2CS7A 1Z9ZA 3MY1B 4XTYA 1UE9A 5A0GA 1NPRA 1IGQA 1GY3B 1PWTA 2YRDA 1YHQA 1PSFA 2YRVA 2O01E 3GTMS 1QLYA 2KI7A 3CCRA 3G6EQ 2H3JA 4ME7A 2EPDA 1EZZB 3EG2A 4OMQA 2CKKA 2DD5A 1MGQA 2D1XA 1VQ4Q 4D8KA 4M78B 4IMYB 3I9QA 2H3EB 2OTLQ 4D6WA 3CCJQ 4LDYA 3CCSA 3UT1A 1JJ2A 1WHHA 1BI3A 3M9QA 4M7AE 1Y07A 1YJWT 1W2BA 3CPWS 4OMNA 3DOGB 1MHNA 2R5AA 2ZCFB 5FU7B 3SD4A 1M8MA 4E7SA 5IXBA 1GCPA 1LPLA 1WIEA 1E9HB 4R55A 2RI2A 1WZOA 1YITT 2FVUA 3E9GA 1RUWA 1O9SA 1RABB 2W9FA 1QCNA 5J3BA 3QDFA 4DA4A 4J9GA 2PQWA 3REAB 4FL6A 4MDXA 4BCQB 5GANd 1AHJB 3PVLA 3MKDA 1PD0A 4IUUA 5KE2A 2JXBA 1FX7A 4RTVA 1NZ9A 2WHBB 4N0AC 3VKIA 2J7IA 4LDWA 2DZCA 5A0LA 1YJNQ 2IPOB 1VQLT 3M5AA 4AKHA 1X6BA 1M8VA 5GAN2 3X26B 2G6FX 2JS2A 4A63B 1U3OA 3GBQA 2LCSA 3QSUA 1Q7YC 2RHXA 3RUXA 4M78D 1CKBA 3QG1A 4Y72B 2D9TA 3M57A 2C5XB 3EFRA 3TVTA 4GLKA 5I2SA 4M77C 2ATCB 4WTOB 3VU3C 1U8RA 1OL1B 1WHJA 4NL2A 4RTYA 1H3ZA 1JSUB 2CCHB 3SHWA 1UDLA 4J6YA 3MPUB 3MIAB 2EAYA 1QVFA 2DL4A 2BTTA 3ZFJA 5GAOr 4PJOA 2JVVA 1JJ2P 3CCQA 3DDPB 5LJ3e 3JCMd 5GAN3 1VQ6Q 3KXTA 3OSVA 1HYOA 1W2BP 3CCLA 4PFPA 3M0QA 5IN1A 1G3SA 3PGGA 4EOKB 1D3BA 2BUDA 3CXCA 3BW1A 1SG5A 2LJ0A 1VQ9Q 3O8VA 1JOWA 4J9BA 4J6XA 4DBFA 3CCVA 3QYBA 2ROTA 3I55T 3HFOA 2ZPIB 2OTJT 1KQSA 1UUEA 4F7UG 3E9FA 4DEYA 1NE8A 3JB9J 3P8HA 4ROCA 4N4HA 1HD3A 2AT1B 4KT0E 4F7SB 4A4GA 4BACA 1K8AC 1URCB 3H9NA 4B6MA 2C4GB 3EGDB 2JMCA 2V22B 2E10A 4CFNB 4BY7X 1BBZA 3CCEQ 1CSKA 4EC8B 2KYBA 2EGCA 1VYVA 3QHWB 3HKSA 3UA6A 1M90R 3OS0A 3LH5A 2W96A 2O88A 2E3IA 4C8QC 5GMKj 2CYZB 4E7HA 1FMKA 1PRMC 1QQJA 1B3QA 1YJ9A 2JM8A 1W70A 4E7JA 3BLRB 2I2LA 1FXXA 1VOMA 2RNAA 3OYLA 2VGNA 4OMLA 2WJ9A 3M54A 2PUKB 5HQ0B 5DLQE 4F7UF 4KUIA 2FPEA 3TNIB 2P0QA 2E70A 1H24B 2HCKA 3F5XB 2LVMA 1H641 2C0OA 4FM4B 1TUCA 1WNLA 2RB6A 2MOXA 1BCMA 2KVQG 2VASA 2DO3A 4N0AA 2L5QA 3T9NA 1OI9B 3G7ZA 2AK5A 2F5KA 3CXCP 3MEVA 5GJVB 2DL8A 3R6NA 4C5GA 5LL6S 1WXBA 4F7UB 5EFQB 2EUFA 2CP2A 3BHTB 2DM1A 1S72A 5L8RE 5KYUA 4ATOA 4EOIB 1QP2A 1ABOA 1UHCA 3CC4Q 3L42A 3PFSA 4PKCC 1I4K1 5GAOn 2HBWA 3MP8A 2C6TB 5GAMj 2BE7D 1AD6A 2M02A 1MMNA 4HNUA 4M77A 1KHCA 3BDLA 1Y96A 3JCMb 3FDRA 1G3TA 1YWOA 1TFBA 1YBYA 3SWNB 1IHVA 1TD6A 1EFNA 1MMDA 4GY5A 1GFCA 4XTVA 2GGRA 3M0SA 1C1AA 1M5Q1 3JSCA 2MPXC 4II1A 2LDMA 4LDVA 1QMCA 5HKCA 4RCBA 1KC8R 1FINB 1AZGB 2CP3A 2YRCA 3TQ7P 1U06A 2DXTA 4J9DA 1PNJA 4ZGDB 2QA4Q 2X3XD 4QW2A 1WHMA 4N4GA 2FG0A 1HSQA 2E4HA 1VQPT 2DETA 1TUDA 4ZN3A 1HK9A 4Z6YA 4F7UE 1WJQA 4EOSB 4ZTFA 1WXTA 2VGMA 5CCAA 2B8AA 5KCOA 1H1SB 3CD6A 1LJOA 1D1CA 2F5TX 3QZ9B 2LJ3A 2DL3A 3M59A 5CKHA 5J26A 3DJBA 3LWIA 1VIEA 1O9KB 3THKA 2L3SA 4PL6A 1ZBJA 3VYGA 4EOLB 4M7DG 2CDTA 3QO3A 3M53A 4ELJA 3FB9A 3E2UA 4OGCA 1WQ7A 4M75B 4C92G 3CCST 4E47A 1QWEA 1Y57A 2Y4YA 3VV0A 2NYSA 2C5NB 3LQ5B 1K76A 4HXJA 4C8QA 4BCMD 1N8RR 2SEMA 1VQNQ 4A4KA 4BDYA 2DX1A 2DK3A 2OI3A 4OGEA 2D0QB 1X27A 1KK7A 4RKUE 3HBLA 3UWNA 1YP5A 3M56A 1ZX6A 3JCMf 1QVGA 5A2QE 1ZA2B 1M3AA 3JCMX 3CMAQ 1VQOA 4OMFB 5EG2A 3HP9A 4CFUD 1VQLA 1Q82U 6AT1B 3CCUQ 1NJIU 1TOVA 2R5MA 1M30A 1SPKA 3VRZA 2CREA 2DFUA 2K3BA 3EFOB 5IT9E 5L2WB 4CRIA 1JSTB 5KYWA 4EMKB 3CMET 1YIJA 1K73C 4M7DF 2XDPA 4M75E 2EGEA 4JJCA 1G3WA 1M1KR 1N8RC 3FC3A 4C92F 2LTOA 4EDUA 1ZUYA 4ZNXA 4QVCA 4IIOA 2X1NB 2LX7A 2DLPA 5GAN7 4CC7A 1WA7A 4HNTA 2BS3A 3MO8A 5DY9A 3L2WA 4FCYA 5CR2A 2KSSA 4M7DB 4EOMB 1GH6B 3UA7A 3JAME 4HCCA 2PNIA 4J9IA 2NUPB 1BI1A 4JLIA 4HCKA 1B07A 2WACA 1RI0A 1BU1A 5LJ5j 3CBMA 1BCOA 2HQEA 2HAXA 3G71Q 2HQXA 3CCQT 4LN2A 5CO7A 2DTHA 2JMAA 3UPUA 3JCMQ 5CKEA 1YITQ 2OTJA 2QDYB 4J7FA 4ELZC 1FWZA 2CH4W 3BFMA 2LJ1A 4F16A 4ZGJB 4BY1X 1NEGA 5KYYA 5HVYB 1BIAA 4HVVA 3OYYA 2DD5B 3QHRB 1QMZB 2QDLA 4FYVB 3PMTA
chains in the Genus database with same CATH topology
3A8LB 1BI0A 3JCMg 3CC4A 3G4ST 2O01E 5CQYA 4FU6A 1Q86C 3VUZA 1XTDA 3OBYA 2OTJT 2RI5A 3OQ5A 3CCRA 2AHJB 4XTUA 4PJOG 3RMQA 2YHTA 2H3JA 4ME7A 2KMTA 2L3RA 2V8IA 2YLBA 5LJ5e 3MCAB 3L2VA 5LJ3d 1JJ2S 3QXEB 2GFAA 2CKKA 1TH7A 2DD5A 1P92A 1MGQA 1X6OA 1M4ZA 2E41A 3CC7A 1JRIA 4M78B 1M1GA 1WJRA 2CGHA 2RHIA 3GPLA 4JS4A 4HT8A 4D6WA 1WQWA 5LJ3h 4LDYA 3CCSA 2E12A 3UT1A 3JB9D 1W2BS 4X34A 1JJ2A 5DLOA 4M7DD 2E65A 2FL7A 4NL3A 1BI3A 3M9QA 2DTOA 4BY6B 4M7AE 4HKEA 3TW6A 1Y07A 2X4YA 3PT9A 3CPWS 1YJWT 3KBGA 1M9SA 2HNIA 2WSEE 3H6ZA 4C92D 1M90U 1MHNA 3BG9A 2ZCFB 2R5AA 5FU7B 3SD4A 3TCJA 2JOYA 3L2UA 2QEXT 3A8OB 1Q7YU 4Y28E 4M78A 3H4CA 1QVGS 2BS2A 2E1HA 4A54A 3CPWA 4JJNK 3CC2A 2LQKA 4R55A 2RI2A 2CZ6B 4HLQA 1YJ9T 5HY6A 2FVUA 1YITT 4M75C 3E9GA 4OB3B 1QW1A 3ER0A 5CIUA 1O9SA 4YTLA 2QA4A 4C5HA 1VQ6T 2XKOC 3QUIA 3HB9A 2EJ9A 5J3BA 1UGRB 2Y4XA 4EPCA 4MZTA 2GQVA 4XU0A 4DA4A 5LJ5h 1OZ2A 2PQWA 4PLLA 2ZPBB 3TU4K 3KHIA 4FL6A 4MDXA 1ZQ1A 2GCXA 4LOCA 2MWOA 5GANd 1AHJB 2EQMA 2DPPB 4QQGA 5KE2A 3G6ET 4IUUA 3HSBA 4NC6A 3M58A 1FX7A 2K5LA 3TREA 3PMIA 1NZ9A 4JX6A 4A4EA 4N0AC 2XDDA 5GMKl 4P5NA 3CEYA 2P4TA 4PJOF 3VKIA 4LDWA 1JBMA 3V7SA 2DZCA 5A0LA 5GAMg 3LWHA 1GXIE 4OF1A 4QVDA 3LGLA 1XNIA 1VQLT 3M5AA 3URGA 2JTMA 2QFZA 4AKHA 1VQ5A 5LJ3j 2C06A 1M8VA 5GAN2 3X26B 3JCMc 3OYNA 1BI2A 1M90C 2K2VA 3FJPA 3P8BB 2BKDN 4XQ3A 5KCHA 1G3YA 3QSUA 1Q7YC 2RHXA 3OYCA 1O75A 2OTLT 3RUXA 4M78D 4MFDA 3JCMe 3CCJT 3QYGB 3QG1A 2P0KA 2RD1A 2XDBA 1ZHIA 2D9TA 3M57A 3EFRA 1S72T 5D6WA 3JB9I 3C12A 2M0OA 4M75G 3ZBDA 2DXUA 4GLKA 4BI3A 4KBMB 1KHIA 3JB9H 2BS4A 3HFNA 4IKFA 2V8KA 2K3XA 5I2SA 4M77C 4PJOB 1K8AU 2KR6A 3E19A 4HCBA 3VU3C 1U8RA 1QVFS 2V8JA 2PUOB 4NL2A 5DM7R 1H3ZA 3INZA 3GOXA 4C92B 3WXMB 3VKHA 4J6YA 5GAMf 2EAYA 1QVFA 4OP0A 4NS5A 3ZFJA 2EJFA 1D3BB 3GF5A 1VQKA 4M7DG 5GAOr 4FT4A 4XAXB 2KAFA 4PJOA 3SB2A 2JVVA 4BBRM 4RG2A 3X28B 3CCQA 3ASKA 5GANj 3C95A 5LJ3e 4JX5A 3JCMd 2LC4A 2VYTA 3OYIA 3GP8A 3JCMV 5GMKh 4JDSA 3RKYA 3SWNC 5GAN3 1YCYA 3OSVA 3Q1JA 3KXTA 3CXCS 3CCUA 3CCLA 1VQ7A 2ZZDB 2E5QA 5IN1A 3RESA 4C0DC 1G3SA 3JCMh 3I56T 1K73C 2K5IA 3PGGA 2LT4A 1D3BA 2BUDA 5CKDA 1X01A 2KQWA 3CXCA 4M7DF 5GAOl 3BW1A 4HCZA 5GAN6 1KC8U 3O8VA 1KQSS 1R8OB 2KY9A 4J6XA 3X25B 3CCVA 1YJNT 3QYBA 2X4JA 3V7CA 3VUBA 1QLBA 2ZPIB 3HFOA 2ZGWA 3I55T 3CCMA 4CI0C 1KQSA 4M7AC 2VV5A 5FU6C 2ZZDA 4F7UG 3E9FA 3JB9J 1NE8A 3P8HA 4M77G 2QQSA 1VQMT 4N4HA 3MEAA 2F69A 4KT0E 3GNGA 1UGSB 4A4GA 4BACA 1K8AC 2DTIA 2KK4A 3CD6T 3G4SA 4M75F 4E7IA 2KDSA 3LH0A 4DOVA 4J5YA 3WVDB 3DKMA 4PJOE 4M7DE 1VQ8T 2DIGA 1YHQT 2IG0A 2EKOA 2E10A 4C92E 4BI8B 1LOJA 1BYMA 3LYIA 5GANe 4PJOD 1V29B 4HA8A 3SFMA 5CAIA 2XI9A 3OYBA 3EAEA 2DD4B 1B34A 3ME9A 1Y7XA 3P8DA 3CCRT 2ZPHB 5FRMA 2HBPA 3HKSA 3OBWA 2EIFA 2M9UA 1KQ2A 2RH2A 4XTZA 4MMLA 2EYQA 3OS0A 3JCMW 1YJWA 3FRNA 3OYAA 2EJGA 2RM4A 1ZBXA 3S6WA 2EQUA 2CYZB 3CBOA 4C8QC 5GMKj 4E7HA 2QEXA 5GAOp 5FLXE 3TW7A 3G71A 1KC8C 3LX7A 1OZ3A 1I8FA 4O5VA 2PVDB 4RG8A 1QP3A 2DD4A 1IZ6A 2XICA 3M4YA 4RMOA 3DLLA 5GAMd 4OB0B 4M7AG 4BD3A 1YITA 2FB7A 1YJ9A 1N8RU 4E7JA 4XK8E 3RKXA 4OB2B 4ELYC 4BDZA 1KQ1A 2I2LA 4BY6C 5J39A 1FXXA 3M55A 4M75A 3OYLA 3VKGA 1VQ9T 2VGNA 4V2SA 2WJ9A 1NPPA 3M54A 4MDWA 2PUKB 3PIOA 4J8OA 1FKMA 1OYXA 5DLQE 4F7UF 5FRNA 2QQ9A 3N5BB 4KUIA 4M77F 3V7RA 2DZ9A 3SDZA 2QA4T 2P0QA 2GF7A 5GANh 2DIQA 1VQOT 2MF2A 1N9RA 5D6XA 2E70A 2XK0A 2A3LA 2LVMA 1H641 5KE3A 4FM4B 1WNLA 2DVEA 2RB6A 3NTKA 5EJCA 3LGFA 2KVQG 2RJCA 3NTIA 2MWPA 2QTXA 4M78E 5AYFA 4C5EA 3CMEA 2DO3A 4JX4A 3PIPA 3QIIA 4BE2A 4LD9K 4QQDA 2R57A 3OYDA 4N0AA 2L5QA 3T9NA 3G6EA 4M6VA 3G7ZA 5GMKe 1M1FA 2F5KA 4C8QG 3MEVA 1X75C 1VQNA 4C5GA 4LDUA 3CCET 3MHXA 1VQ4A 1YIJT 2ZPFB 3R6OA 5CKFA 2OTLA 3BDUA 3CCJA 5LL6S 4O6JA 4F7UB 4OB1B 5LJ5g 4IURA 5GMKi 1S72A 5L8RE 2K4YA 4EMKC 5KH6A 3KUFA 1Y96B 1M1KU 4MZPA 4DQ2A 2OAUA 2GFUA 4ATOA 1G5VA 2CZ7B 1QP2A 4HNVA 1W4SA 2PVOB 1UGQB 3L42A 3QZ5B 4LDXA 3PFSA 3QWLA 4PKCC 1I4K1 3MEWA 5GAOn 1I5LA 4BE0A 3QJ6A 3TEEA 4QSHA 2RHYA 4M75D 4M7AF 3MP8A 5C6SA 5GAMj 4F7UA 3RERA 4HNUA 2EFIA 4M77A 4Z02A 3PTAA 1KHCA 2YLCA 2KMGA 3BDLA 1Y96A 3JCMb 3FDRA 2DAQA 1G3TA 4N4IA 3DB3A 4J83A 4JRIA 4LD6A 1VQNT 3V8KA 2RA2A 2PU9B 1YBYA 3BY7A 3SWNB 2RK2A 1RL2A 5M9OA 2DEQA 4A53A 3J81E 3OS5A 4GY5A 4C0DB 1Q81U 2QQBA 4XTVA 2VC8A 1M5Q1 3E1SA 4M7DC 4PNOA 2VXFA 4BBSM 3JSCA 5CKBA 3OYHA 4UC4A 4II1A 2LDMA 4LDVA 5LJ5f 4E7LA 3CMAT 4C92C 4RCBA 5HKCA 2RJDA 3QKJA 5GAN5 3SWNA 3V8JA 4M7AB 1YI2T 1UB4A 2MI6A 4B9WA 5FU6B 2M1HA 4IUVA 3OYFA 3HZJA 2QF7A 2DXTA 4MIMA 4ZGDB 2LQ8A 1YJNA 5CVIA 3JCMP 4QW2A 2QQ8A 4C8QF 5IAYA 4N4GA 3I55A 1UEBA 3CCLT 1VQPT 3QYHB 3CPFA 4ZN3A 1HK9A 1M1KC 2Y90A 1K9MU 4Z6YA 4OVAA 4F7UE 2DXBB 4NOYA 2QDJA 1WJQA 4X9DA 1XQHA 4ZTFA 2VGMA 3BG5A 1B34B 1W2BA 5CCAA 2JNGA 3VYGB 4BI4A 4IUPA 5GAMe 3VYHB 1JB0E 1EIFA 2B8AA 2LX9A 5KCOA 5GAOq 1LJOA 2K57A 3CD6A 4M7AA 3LLRA 3MP6A 3CCVT 2F5TX 1QVPA 3OSSC 3QZ9B 4ZTJA 3M59A 5CKHA 5J26A 3QJYA 2LT1A 4EMGA 1VQ8A 4M77D 3LWIA 3CC4T 1VIEA 5HK0A 2DXBA 4J6WA 2QI2A 1OI1A 4PL6A 2PVGB 1LNXA 3VJPA 4IUTA 2FHDA 4L6V5 2HD0A 2A7YA 3A8MB 1VIFA 3QHSA 3VYGA 2O4XA 4J7IA 3JB9G 1Q81C 2VUBA 4C8QB 4JUVA 1HXDA 2RHUA 2VXEA 3QO3A 3JRZA 1BIBA 2EQKA 3M53A 4ELJA 3FB9A 3RIRA 2JUFA 2RO0A 4OGCA 2XHCA 1WQ7A 3CC7T 4KULA 3DB4A 3X20B 4M75B 3V8LA 4C92G 3CCST 4E47A 3GIBA 3VV0A 3QYEA 2Y4YA 1K73U 1DJ7B 4HT9A 2X4XA 2CZ0B 3CBPA 5HK3A 3L1AA 1WPYA 4M78C 2XG8D 1KG1A 4C8QA 3WVEB 3EFSA 4JRPA 2QQAA 2WSCE 3S3NA 1VQ6A 4A4KA 3A8GB 3OA6A 4HL4A 3HPWA 5GAMh 4BDYA 1K9MC 3L2RA 3OB9A 2K3YA 2DK3A 4OGEA 5CK9A 5FROA 2D0QB 2QXFA 2X35A 3OYEA 3S3MA 3AHUA 3RMSA 3CC2T 2DJZA 4L59A 4L5GA 3G71T 3S3OA 1KD1U 4RCCA 5LJ3g 4RKUE 5FU7C 3HBLA 4C0GA 1VQ9A 4M7AD 2WSFE 4MMKA 3UWNA 4XU3A 3M56A 3M4GA 4AKIA 3JCMf 2LRQA 3NFCA 3MP1A 1QVGA 5A2QE 3JCMX 2QQRA 2LCCA 1U1SA 5I2MA 4C5IA 1U1TA 1VQOA 5LJ5d 4FT2A 4EMHA 4FSXA 4OMFB 3OMCA 5EG2A 1BKBA 4C0ZA 3HP9A 1WGSA 3HRSA 5GMKm 1E7PA 3OYMA 4AI6A 4Y91A 1Q82U 1VQLA 1N9SA 3JCMJ 3FIFA 2XU8A 1NJIU 3HRTA 2JZ2A 3FEOA 2R5MA 2RJEA 2E6ZA 4WF2A 2D6FA 4ZN1A 3DL1A 2ZPGB 4BE1A 3HHTB 4Q5WA 2E64A 5IT9E 4C8QE 2XIDA 4CRIA 3H8ZA 3JB9F 2DXCB 2EWNA 2NLUA 3NTHA 5CQXA 4EMKB 5GAN8 2LNVA 3CMET 3CCEA 1YIJA 4MFEA 4A4FA 3C94A 4BUGA 2XDPA 4M77B 2M16A 4M78G 1VQ5T 4M75E 2RHZA 4FIBA 4IUQA 1G3WA 3OS1A 4AKGA 4JS5A 1N8RC 3FC3A 2CZ1B 4C8QD 3OS2A 3OYGA 4C92F 2LTOA 2MAMA 3GNFB 5LJ3f 4EDUA 4KUDK 4QVCA 2E6NA 3L2ZA 2R58A 5GANg 3QDRB 1VQ4T 3C4SA 1N6AA 2DXCA 3META 2ZPEB 3PNWC 4EMKA 4JRQA 5GAN7 3J7AF 1SSFA 2K5FA 1KD1C 3OY9A 1IREB 4E7KA 1XOVA 2BIVA 4JRKA 5C0MA 2L8DA 4HNTA 2BS3A 4XU2A 4ZGEB 4QVZA 3MO8A 4QQ6A 5I21A 5DY9A 4VUBA 3OMGA 2RI3A 3L2WA 3OW2S 2IVWA 5A0DA 1UGPB 1I81A 5CR2A 2KSSA 3LW5E 4JLGA 5GAN4 1Q86U 3GLXA 4A4HA 3OYJA 4M7DB 3JAME 4HCCA 4XTXA 3OW2A 4PJOC 1BI1A 4JLIA 4DOWA 1Q82C 2WACA 1NJIC 4X9CA 2FYKA 1RI0A 1PSEA 4XTWA 1VQKT 5LJ5j 1N27A 3CBMA 2XD0A 3J80E 3I56A 3MEUA 2DKGA 2HQEA 3QPHA 3UDCA 4MZMA 2HAXA 2HQXA 2MMPA 3CCQT 2P0PA 5D6YA 3CMAA 3DLMA 4M7DA 5GAOm 4B9XA 5CO7A 3BG3A 2DTHA 2L89A 4PLIA 3UPUA 1YI2A 3JCMQ 5CKEA 5GANf 3RKWA 3CCUT 2QDYB 1VQ7T 2OTJA 4R56A 3HL8A 4C92A 1Y71A 3ZEHA 4J7FA 4ELZC 1FWZA 4M77E 3L2QA 1VQPA 3QBYA 3BFMA 1WJSA 3FLGA 1VQMA 4C0FA 4BB7A 3OYKA 2G3RA 3X24B 2JTFA 4ZGJB 3HRUA 3HO8A 4M78F 3F70A 3A5ZB 2O4XB 2X4WA 4XU1A 4TVRA 1VUBA 2JN0A 2CS7A 2G77A 3CCMT 2EQJA 4XTYA 5A0GA 1NPRA 2RK1A 2LCLA 1BIAA 3OYYA 2DD5B 1YHQA 2RJFA 1PSFA 2YRVA 3PMTA 3A8HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8L B;  2D0Q B;  2O01 E;  2ZPF B;  3X28 B;  4RKU E;  2AHJ B;  2WSF E;  4OB1 B;  5L8R E;  2ZZD B;  3QXE B;  2DD5 A;  2CZ7 B;  1QP2 A;  2PVO B;  1UGQ B;  3QZ5 B;  3X25 B;  2ZPI B;  2WSE E;  2ZZD A;  2ZPG B;  2ZCF B;  3HHT B;  3A8O B;  4KT0 E;  2PU9 B;  1UGS B;  4Y28 E;  2DXC B;  3WVD B;  2CZ6 B;  4OB3 B;  2CZ1 B;  1UGR B;  1V29 B;  2DXC A;  2ZPE B;  2ZPB B;  2DD4 B;  2ZPH B;  1IRE B;  4ZGD B;  1AHJ B;  2DPP B;  3QYH B;  4ZGE B;  2DXB B;  2CYZ B;  1UGP B;  3LW5 E;  3VYG B;  3VYH B;  1JB0 E;  1GXI E;  2PVD B;  1QP3 A;  2DD4 A;  3QZ9 B;  4OB0 B;  1PSE A;  3X26 B;  4XK8 E;  4OB2 B;  2DXB A;  2PVG B;  4L6V 5;  3A8M B;  3QYG B;  3VYG A;  2PUK B;  2QDY B;  3X20 B;  3X24 B;  4ZGJ B;  4FM4 B;  1DJ7 B;  2CZ0 B;  2PUO B;  3WVE B;  2DD5 B;  2WSC E;  3A8G B;  1PSF A;  3A8H B; 
#chains in the Genus database with same CATH topology
 1MV3 A;  5I22 A;  4KGV B;  4FU6 A;  1Q86 C;  1CKA A;  5I5Z B;  4PJO G;  3RMQ A;  5LJ3 d;  1JJ2 S;  1KJW A;  2GFA A;  1P92 A;  3K7A M;  1X6O A;  3CC7 A;  2RMO A;  2CGH A;  2RHI A;  2C5V B;  1KSW A;  4JS4 A;  2F2C A;  1W2B S;  2E12 A;  1VIN A;  1D0Z A;  1T3L A;  2O31 A;  5IH2 A;  5DLO A;  4M7D D;  4BY6 B;  4ESR A;  4HKE A;  3PT9 A;  1M9S A;  2HNI A;  4C92 D;  3BG9 A;  3G33 B;  2WEV B;  1RAE B;  3L2U A;  3A1P A;  3A8O B;  3H4C A;  4KH0 B;  5FGK B;  2ENM A;  4A54 A;  1KD1 R;  4JJN K;  3CC2 A;  2LQK A;  2QYZ A;  1JEG A;  4HLQ A;  1E6G A;  1YJ9 T;  4OB3 B;  5CIU A;  2XKO C;  3QUI A;  1FVV B;  1UGR B;  1I1J A;  4MZT A;  2O2O A;  2BPM B;  4E7Z A;  2ZPB B;  2KT8 A;  3KHI A;  2CP6 A;  2HKQ B;  4LOC A;  2YT6 A;  1T3S A;  2DPP B;  2EQM A;  4QQG A;  4NC6 A;  1K4U S;  2V1R A;  3M58 A;  1WHL A;  4JX6 A;  1YWP A;  4A4E A;  1N5Z A;  3ULR B;  5GMK l;  4PJO F;  2P4T A;  1UNH D;  5GAM g;  1GXI E;  4OF1 A;  4DBH A;  1XNI A;  2E3H A;  4RTX A;  3I55 Q;  1VQ5 A;  3JCM c;  1BI2 A;  4XQ3 A;  1G3Y A;  1AOJ A;  1C6V X;  4FX3 B;  1WDX A;  3FJ5 A;  1F5Q B;  1S72 T;  2UZL B;  4E2F B;  2DXU A;  3JB9 H;  2KRN A;  2V8K A;  3U23 A;  5IF1 B;  4PJO B;  1VYW B;  3E19 A;  1JQQ A;  1QVF S;  4OR5 B;  3GOX A;  3VKH A;  3RBB B;  5GAM f;  2D0N A;  1KFZ A;  4NS5 A;  5KYX A;  1B7T A;  1D3B B;  3GF5 A;  1OOT A;  3SB2 A;  2CP7 A;  2F2W A;  2KT1 A;  4BBR M;  4RG2 A;  5GAN j;  2CCI B;  1U5S A;  2LC4 A;  3M0R A;  5GMK h;  3RKY A;  3CXC S;  1YCY A;  1NYF A;  2IW8 B;  4BCF B;  1VQ7 A;  4F7L B;  3RES A;  5LQF B;  1C9B A;  3I56 T;  4YOZ A;  1D1B A;  5GAN 6;  4FYY B;  1KQS S;  2LZ6 B;  1R8O B;  2X4J A;  3CCM A;  4M7A C;  5FWC A;  2ZZD A;  2J6K A;  4M77 G;  2QK0 A;  1VQM T;  2J6F A;  1UG1 A;  3GNG A;  3DDQ B;  3CD6 T;  2SRC A;  2DBK A;  4BCH B;  5L23 A;  2KDS A;  3LH0 A;  3VS5 A;  4DOV A;  3WVD B;  4PJO E;  2KRO A;  1H1R B;  2W10 A;  3AT1 B;  1UTI A;  1X2K A;  5CYI B;  1BYM A;  4PJO D;  3SFM A;  5CAI A;  2IW6 B;  4F6S B;  2XI9 A;  3OYB A;  4JZ4 A;  1B34 A;  1IO6 A;  5LMK B;  1Y7X A;  2ZPH B;  1J3T A;  1ZSZ C;  5HBE B;  2COZ A;  2EIF A;  3NPF A;  4CC3 A;  2M9U A;  2EYQ A;  3JCM W;  1KIK A;  3FRN A;  1Q7Y R;  1G2B A;  3S6W A;  3CBO A;  2K2M A;  5GAO p;  5FLX E;  3TW7 A;  1D09 B;  3LX7 A;  2PVD B;  4YC3 B;  4BCN B;  4RMO A;  4OB0 B;  3VS6 A;  1H28 B;  4ELY C;  2FPD A;  4RUG A;  1YCS B;  3NHN A;  2QGF B;  1PG5 B;  3M55 A;  4AT1 B;  4DBQ A;  1H25 B;  4J8O A;  1OYX A;  2LQW A;  2QQ9 A;  3N5B B;  2QGG A;  4M77 F;  2DZ9 A;  1UGV A;  1MMA A;  1VQO T;  2GF7 A;  1N9R A;  2A3L A;  2RQW A;  3EG3 A;  3PVQ A;  5EJC A;  3CME A;  4M78 E;  3NTI A;  2QTX A;  2GTJ A;  2AKK A;  2CSQ A;  3QII A;  4RTZ A;  4BE2 A;  3OYD A;  3BLH B;  2R57 A;  1RAF B;  5KYU B;  4M6V A;  1VQP Q;  2ED1 A;  1XJW B;  1ZP2 A;  4C8Q G;  3HTR A;  2CJM B;  4GBQ A;  1UNL D;  1YIJ T;  2ZPF B;  3R6O A;  2MYS A;  1VQ8 Q;  4O6J A;  2WMA B;  5IHN A;  4OB1 B;  5LJ5 g;  1YHQ Q;  2DJQ A;  2PMI B;  1NEB A;  2ECZ A;  1Y96 B;  4DQ2 A;  1W4S A;  1K8A R;  4LDX A;  2IVX A;  1I5L A;  4BE0 A;  3CCR Q;  9ATC B;  1GFD A;  2ED0 A;  2EFI A;  4Z02 A;  4BCN D;  1HJD A;  2KMG A;  4N4I A;  3DB3 A;  1AWJ A;  1OPL A;  3CCS Q;  2RA2 A;  4E6R A;  2KXC A;  3BY7 A;  4F6U B;  1RL2 A;  2QAZ A;  4PJJ A;  4PJL A;  1VA7 A;  1Q81 U;  1TU0 B;  3VS3 A;  3E1S A;  2YUO A;  2X3W D;  1TUG B;  1IXD A;  4UC4 A;  3I5R A;  2A0F B;  5LJ5 f;  2ESW A;  4E7L A;  1RAH B;  2KE9 A;  5GAN 5;  4HVW A;  1OX8 A;  2MI6 A;  1K1Z A;  4B9W A;  4IUV A;  2QF7 A;  3HZJ A;  3I35 A;  1AWW A;  2H8H A;  4C8Q F;  3EGX B;  4G6L B;  4X1V A;  3QYH B;  1K9M U;  4NOY A;  3BG5 A;  2P4R A;  2JNG A;  3VYG B;  4AFS C;  3VYH B;  2LX9 A;  4M7A A;  4KH1 B;  1AZE A;  3MP6 A;  2VKN A;  4NST B;  1ZLM A;  4AMC A;  3NGP A;  2LT1 A;  1RAG B;  4M77 D;  1TXQ A;  2DXB A;  4J6W A;  2VVK A;  5HBH B;  1QCO A;  3QHS A;  2KRS A;  2JTE A;  4EOO B;  2AKL A;  2O4X A;  4J7I A;  3JB9 G;  1M3C A;  4C8Q B;  4JJD A;  1BIB A;  2EQK A;  3CC7 T;  1UFF A;  3V8L A;  3GIB A;  1ZSZ A;  1IB8 A;  1DJ7 B;  2B86 A;  1WPY A;  1FYN A;  3H41 A;  3EFS A;  4JRP A;  2QQA A;  4CRL B;  3A8G B;  3HPW A;  3MI9 B;  1F1B B;  1RLQ C;  1JKW A;  5CK9 A;  2KR3 A;  3S3M A;  3CC2 T;  2RF0 A;  2DF6 A;  4L59 A;  4C0G A;  4MMK A;  4XU3 A;  1QVF P;  2FO0 A;  4F17 A;  1W1F A;  3MP1 A;  1P5E B;  5I2M A;  1U1S A;  1U1T A;  4FT2 A;  4EMH A;  1MNE A;  3CCQ Q;  3I5S A;  4QT7 A;  3HRS A;  1E7P A;  3OYM A;  4AI6 A;  3CCL Q;  2JZ2 A;  1PM3 A;  4BE1 A;  4Q5W A;  2E64 A;  4C8Q E;  2XID A;  1WI7 A;  2YWW A;  3H8Z A;  2EBP A;  3JB9 F;  3CCV Q;  5GAN 8;  2MK5 A;  4MFE A;  2DEU A;  4BUG A;  1VQ5 T;  1KQS P;  4FIB A;  4AKG A;  3G6E T;  2CZ1 B;  4C8Q D;  3OS2 A;  3OYG A;  4KUD K;  2WXV B;  2F2X A;  4CFW B;  5GAN g;  3QDR B;  1VQ4 T;  3C4S A;  2JT4 A;  1NBE B;  5KYN A;  1R0B G;  1X6G A;  4TTH A;  1IRE B;  2CSI A;  1N4M A;  2QGS A;  1YNZ A;  4ZGE B;  5I21 A;  4VUB A;  2QTV A;  1VQN A;  1UGP B;  3LW5 E;  1BK2 A;  2FRW A;  4BCM B;  4XTX A;  5ACB A;  2DVJ A;  3OW2 A;  4DOW A;  1Q82 C;  1NJI C;  4X9C A;  2UZB B;  4XTW A;  1G3N C;  1SF9 A;  3I56 A;  2DKG A;  3QPH A;  1LVK A;  4J9H A;  2MMP A;  4Z89 A;  5D6Y A;  3CMA A;  5GAO m;  4BCG B;  3H0H A;  1YI2 A;  3QWX X;  4PLI A;  1YJ9 Q;  1M2V B;  2VB6 A;  2NUT A;  5GAN f;  3RKW A;  1JXO A;  1VQ7 T;  3CQT A;  2CUB A;  4R56 A;  1Y71 A;  3ZEH A;  3FLG A;  5HCK A;  1VQM A;  4CFU B;  1JU5 C;  3X24 B;  3A5Z B;  2RQT A;  2EGA A;  1NLP C;  2G77 A;  3UAT A;  2JW4 A;  2EQJ A;  3CCM T;  1X2Q A;  2LCL A;  1K9A A;  2IIM A;  1GBQ A;  2DE0 X;  4AFZ C;  4UN0 A;  1BI0 A;  2OX7 A;  3JCM g;  1PC0 A;  1XTD A;  2CT3 A;  2RI5 A;  3OQ5 A;  2AHJ B;  2LNH B;  2A08 A;  2YHT A;  2HSE B;  2L3R A;  2W2H A;  2YLB A;  3BLQ B;  3L2V A;  3QXE B;  1S1N A;  2K6D A;  1JRI A;  4HT8 A;  1M1G A;  1WJR A;  1K73 R;  3JB9 D;  3BE3 A;  4X34 A;  2JS0 A;  1S72 Q;  3VS0 A;  4NL3 A;  2DTO A;  2O9S A;  2FEI A;  3TW6 A;  2X4Y A;  1TG0 A;  1R0C B;  1M90 U;  3KBG A;  3EGD A;  2DER A;  4Y28 E;  3ZL7 C;  4EOP B;  2E1H A;  1EX4 A;  2WFY B;  1AIS B;  2CZ6 B;  1VQK Q;  5HY6 A;  4M75 C;  5GJW B;  1QW1 A;  1E7O A;  1KXU A;  4EON B;  1VQ6 T;  3EG1 A;  1OKV B;  2GQV A;  4XU0 A;  2O9V A;  4PLL A;  3OW2 P;  4ORZ A;  4YOS A;  2GCX A;  2MWO A;  3HSB A;  3M0U A;  2K5L A;  3PMI A;  4P5N A;  3LWH A;  5DQV A;  3URG A;  2JTM A;  5LJ3 j;  2EYX A;  2CP0 A;  3P8B B;  3CD6 Q;  2KXD A;  3JCM e;  3RR6 A;  1PRL C;  2DBM A;  1SSH A;  5FW9 A;  5D6W A;  5CEI B;  3C12 A;  3ZBD A;  4BI3 A;  1D1A A;  1VYT A;  1KHI A;  4KBM B;  1QWF A;  2QG9 B;  4OMO A;  2BS4 A;  3HFN A;  2WPA B;  4IKF A;  1Q86 R;  1ARK A;  1G83 A;  4HCB A;  2PUO B;  3INZ A;  3NMZ C;  4R0K A;  4C92 B;  1YJW Q;  1ZUU A;  4OP0 A;  2UUE B;  2WIP B;  2EJF A;  4XAX B;  1OIY B;  4FW2 A;  1YN8 A;  4JX5 A;  4KRC B;  3JCM V;  4JDS A;  2ZZD B;  4C0D C;  3JCM h;  1OPK A;  2KQW A;  4HCZ A;  1KC8 U;  2YSQ A;  1GRI A;  2KY9 A;  2A36 A;  2DL5 A;  1QVG P;  3V7C A;  1QLB A;  1H1P B;  4FW1 A;  1UEC A;  1VQO Q;  5FU6 C;  2QQS A;  4FYX B;  2F69 A;  8AT1 B;  1OEB A;  2KK4 A;  1VQL Q;  3VS4 A;  1QCF A;  3G4S A;  4E7I A;  4J5Y A;  2I0N A;  3DKM A;  1NLO C;  4M7D E;  2PK2 A;  2DIG A;  4RTW A;  1H27 B;  2IG0 A;  4C92 E;  1LOJ A;  1YIJ Q;  3LYI A;  2ZAE A;  1MV0 B;  3EAE A;  3ME9 A;  3DTO A;  2HBP A;  3OBW A;  4MML A;  4F7J B;  1E6H A;  5IHI A;  2QEX A;  1M2O A;  2F1L A;  4JZ3 A;  1I8F A;  4O5V A;  4RG8 A;  2DMO A;  1QP3 A;  2DD4 A;  2BKZ B;  1IZ6 A;  3M4Y A;  4J9F A;  4M7A G;  4EOR B;  2FB7 A;  1N8R U;  1WLP B;  4OB2 B;  4BDZ A;  5AT1 B;  1KQ1 A;  4BY6 C;  4M75 A;  4V2S A;  3VKG A;  1RLP C;  2GNC A;  3PIO A;  1W98 B;  5IHY A;  1GBR A;  1TS9 A;  5FRN A;  1MUZ A;  2DRM A;  1TSF A;  3V7R A;  2QA4 T;  2DIQ A;  4CC2 A;  3EGU A;  3KFV A;  2DVE A;  3NTK A;  1H92 A;  4C5E A;  2OTJ Q;  3PIP A;  2X51 A;  4LD9 K;  2DRK A;  2W0Z A;  3G6E A;  1TWB A;  5GMK e;  1M1F A;  2J6O A;  1Q95 G;  4I3Z B;  2KNB B;  2KEA A;  1X75 C;  3VRY A;  3MHX A;  1VQ4 A;  2OTL A;  3BDU A;  3CCJ A;  1RI9 A;  1Y0M A;  5ECA A;  1H26 B;  3KUF A;  1M1K U;  4MZP A;  2DME A;  2GFU A;  2YUN A;  2CUD A;  1OX9 A;  1UGQ B;  2IN3 A;  1YFN A;  3QZ5 B;  2QAS A;  1Z9Q A;  2CT4 A;  3MEW A;  3TEE A;  4QSH A;  4PFO A;  4M7A F;  4BXX X;  4Y92 A;  4KGX B;  3RER A;  7AT1 B;  3PTA A;  2YLC A;  1H8K A;  2DAQ A;  4PJN A;  4LD6 A;  1VQN T;  2PU9 B;  5I11 A;  1RAD B;  1PCX A;  4PNO A;  2VXF A;  2C5O B;  4BBS M;  3OYH A;  4F6W B;  3TN8 B;  1D0Y A;  2J06 A;  3CMA T;  3QKJ A;  3CC2 Q;  3V8J A;  2KYM A;  4M7A B;  1YI2 T;  1UB4 A;  2M1H A;  2NWM A;  3OYF A;  2FZG B;  4MIM A;  3EG9 A;  1OU9 A;  1YJN A;  1PHT A;  2QQ8 A;  5IAY A;  3CPF A;  4OVA A;  2EYW A;  2DXB B;  2QDJ A;  2D8J A;  4X9D A;  2GQI A;  4BI4 A;  4IUP A;  5GAM e;  1EIF A;  2K57 A;  3OSS C;  2Z0W A;  4ZTJ A;  2C0I A;  4ANJ A;  2FPF A;  1VQ8 A;  1UHF A;  2X9H A;  2QI2 A;  4BCK B;  1ZSZ B;  3VJP A;  4F04 B;  4IUT A;  2FHD A;  1VIF A;  1VQ5 Q;  2L0A A;  1Q81 C;  1OQK A;  2VUB A;  4JUV A;  1HXD A;  3JRZ A;  2RO0 A;  4AG2 C;  2X4X A;  4OMP A;  3L1A A;  4M78 C;  2XG8 D;  1KG1 A;  3TNW B;  3WVE B;  2KRM A;  1V76 A;  2WSC E;  3S3N A;  1VQ6 A;  3OA6 A;  5GAM h;  1K9M C;  3REB B;  3L2R A;  3OB9 A;  2K3Y A;  3EG0 A;  4II5 B;  3S3O A;  4L5G A;  3G71 T;  1KD1 U;  5LJ3 g;  2MCN A;  1IRX A;  5FU7 C;  1VQ9 A;  4M7A D;  2XMF A;  4EOJ B;  4WCI A;  4LXC A;  2QQR A;  2LCC A;  2L3Q A;  2DIL A;  4FSX A;  2HKN A;  4C0Z A;  1N9S A;  1QKX A;  3FIF A;  2XU8 A;  3JCM J;  1VQ7 Q;  1M27 C;  3HRT A;  2RJE A;  2E6Z A;  3DL1 A;  2ZPG B;  2JJ9 A;  4PFZ A;  3HHT B;  4QKU A;  4AFQ C;  1VYU A;  2OAW A;  2F2V A;  2YDL A;  5CQX A;  4FSS A;  3CCE A;  4A4F A;  3C94 A;  4M77 B;  3EJ1 B;  2M16 A;  3CCM Q;  3QWY A;  4IUQ A;  2MAM A;  5LJ3 f;  3C0C A;  1PD1 A;  1ZA1 B;  2E6N A;  3L2Z A;  2COY A;  2R58 A;  2DXC A;  2DA9 A;  3MET A;  3PNW C;  5IDN B;  3J7A F;  1SSF A;  2K5F A;  4RTU A;  3OY9 A;  4JRK A;  5C0M A;  2L8D A;  4ROD A;  3UF4 A;  4QQ6 A;  4AG1 C;  1FMV A;  3OMG A;  2RI3 A;  3OW2 S;  1M3B A;  1W6X A;  1AEY A;  5A0D A;  1I81 A;  4Z88 A;  4JLG A;  3GLX A;  4A4H A;  3OYJ A;  2UZD B;  2NUT B;  4EC9 B;  5EC7 A;  2M0Y A;  2FYK A;  2HL5 C;  4OGR B;  4MZM A;  2C0T A;  2P0P A;  3DLM A;  2CP5 A;  4B9X A;  1GUX A;  1VOL A;  2L89 A;  1H3H A;  3HL8 A;  2BZX A;  2B9R A;  4BCQ D;  4M77 E;  2GBQ A;  3QBY A;  3VS2 A;  4C0F A;  2PJQ A;  2JTF A;  4PJM A;  3HO8 A;  3F70 A;  2X4W A;  4TVR A;  1VUB A;  4AFU C;  4KRT A;  4J9C A;  5ICP B;  2RQU A;  3EID B;  2RK1 A;  1I5O B;  4M4Z A;  4ELL A;  2RJF A;  1TTH B;  2CH4 A;  1ZUK A;  3A8H B;  3A8L B;  3CC4 A;  3CME Q;  1SHG A;  3G4S T;  4DEX A;  4LE9 A;  5CQY A;  3VUZ A;  3OBY A;  4XTU A;  4K11 A;  2KMT A;  2V8I A;  5LJ5 e;  3MCA B;  1TH7 A;  1SRM A;  1M4Z A;  2E41 A;  3GPL A;  3IQL A;  1PKS A;  1WQW A;  5LJ3 h;  1SEM A;  2E65 A;  2FL7 A;  3NDQ A;  2HL3 A;  2WSE E;  3H6Z A;  1SRL A;  3TCJ A;  2QEX T;  2JOY A;  1Q7Y U;  1GCQ C;  2RPN A;  4M78 A;  1QVG S;  2BS2 A;  2NUZ A;  3CPW A;  1G8X A;  4IIM A;  1BB9 A;  1H4L D;  5DQW A;  3ER0 A;  2QA4 A;  4YTL A;  4C5H A;  3HB9 A;  2EJ9 A;  5KYW B;  2FZK B;  2Y4X A;  4EPC A;  5LJ5 h;  1OZ2 A;  1Q82 R;  3TU4 K;  1OIU B;  1NJI R;  1AVZ C;  3MJX A;  1ZQ1 A;  2MIO A;  2L2P A;  3O0G D;  2HQH A;  2W9Z A;  3TRE A;  3TSZ A;  2XDD A;  2OJ2 A;  3CEY A;  1JBM A;  3V7S A;  4QVD A;  3LGL A;  4F7N B;  2QFZ A;  2W99 A;  1AD5 A;  2C06 A;  2A28 A;  3VS1 A;  3OYN A;  1M90 C;  2WMB B;  5D7U A;  2K2V A;  3FJP A;  5KCH A;  2BKD N;  3OYC A;  1O75 A;  2OTL T;  4MFD A;  1RAA B;  2DYI A;  2LP5 A;  1SHF A;  3CCJ T;  3QYG B;  2A37 A;  2P0K A;  2RD1 A;  2XDB A;  1ZHI A;  4PK4 A;  3JB9 I;  2M0O A;  5IDP B;  4M75 G;  2R7G A;  1JO8 A;  2K3X A;  1WX6 A;  2EYZ A;  1SKU B;  1K8A U;  2KR6 A;  2V8J A;  5DM7 R;  1A0N B;  3WXM B;  1T0H A;  1NYG A;  3EHQ A;  2K9G A;  3BHU B;  4BCJ B;  1VQK A;  1ENW A;  4FT4 A;  2DYB A;  2KAF A;  3X28 B;  3ASK A;  5KYY B;  3C95 A;  3OYI A;  3GP8 A;  2VYT A;  2K7A A;  5FWB A;  3SWN C;  3EH2 A;  2L3P A;  3Q1J A;  2LW4 A;  2RN8 A;  3CCU A;  4DBR A;  2E5Q A;  1K0S A;  2K5I A;  5CKD A;  2LT4 A;  1X01 A;  2DNU A;  5GAO l;  1OUL A;  3CPW P;  2BZY A;  3O5Z A;  3X25 B;  1YJN T;  3VUB A;  1H1Q B;  2ZGW A;  4CI0 C;  2VV5 A;  4OMM A;  2BZ8 A;  2COW A;  3MEA A;  1UGS B;  2DTI A;  3MY5 B;  4M75 F;  2PZ1 A;  2KGT A;  1VQ8 T;  1WHK A;  1YHQ T;  4CXA B;  3EGX A;  2EKO A;  1PKD B;  4BI8 B;  5GAN e;  1V29 B;  4HA8 A;  1MND A;  2DD4 B;  3CCR T;  3P8D A;  5FRM A;  2M51 A;  2P84 A;  1KQ2 A;  2RH2 A;  4XTZ A;  1OKW B;  1FMW A;  1YJW A;  3OYA A;  2EJG A;  2RM4 A;  1ZBX A;  1GL5 A;  2EQU A;  1WYX A;  4D8D A;  3RDV A;  1KC8 C;  3G71 A;  1OZ3 A;  2JGZ B;  2XIC A;  3DLL A;  5GAM d;  4CC4 B;  1GCQ A;  4BD3 A;  1YIT A;  4XK8 E;  3RKX A;  1K0X A;  1ABQ A;  5J39 A;  1X43 A;  2PTK A;  3G1J A;  1VQ9 T;  1NPP A;  4RTT A;  1D0X A;  4MDW A;  4Z8A A;  1FKM A;  2GTO A;  3I56 Q;  3SDZ A;  5GAN h;  8ATC B;  1WFW A;  2MF2 A;  5D6X A;  2XK0 A;  1I07 A;  5KE3 A;  2E5K A;  4EIK A;  2G9X B;  1YI2 Q;  3LGF A;  2RJC A;  2MWP A;  5AYF A;  2V1Q A;  4JX4 A;  2HZY A;  4QQD A;  1VQM Q;  3PE0 A;  4LUD A;  1AT1 B;  4LDU A;  3CCE T;  5CKF A;  3EHR A;  2FRY A;  2YUP A;  4IUR A;  5GMK i;  5KYX B;  4EOQ B;  2K4Y A;  4EMK C;  5KH6 A;  3POM A;  2OAU A;  1G5V A;  2CZ7 B;  4HNV A;  2PVO B;  2RQV A;  2PK9 B;  3QWL A;  5HNB B;  2HEQ A;  1XO2 A;  3EOC B;  3QJ6 A;  2RHY A;  2EYY A;  4M75 D;  1RAI B;  5C6S A;  2PHG A;  4F7U A;  3RNJ A;  4KRD B;  4J83 A;  4JRI A;  3V8K A;  1D3U B;  2VWF A;  2RK2 A;  5M9O A;  2DEQ A;  4A53 A;  3J81 E;  3OS5 A;  4C0D B;  2QQB A;  3EG9 B;  2VC8 A;  2AZV A;  4YOO A;  4M7D C;  5CKB A;  5BNJ B;  2J05 A;  1T0J A;  4F70 B;  4FYW B;  1OV3 A;  4C92 C;  2RJD A;  3SWN A;  2YUQ A;  5FU6 B;  2BE9 B;  2LQ8 A;  5CVI A;  3JCM P;  2KBT A;  1I0C A;  3I55 A;  1UEB A;  3CCL T;  1M1K C;  2Y90 A;  1XQH A;  1B34 B;  1UJY A;  3EH1 A;  5GAO q;  1JB0 E;  2RQR A;  3LLR A;  3CCV T;  1QVP A;  2I40 B;  1UJ0 A;  2ABL A;  3QJY A;  4EMG A;  1M2V A;  5HBJ B;  1OGU B;  3JV3 A;  1PKT A;  3CC4 T;  5HK0 A;  1WXU A;  2V26 A;  1OI1 A;  2YXY A;  2PVG B;  1LNX A;  4L6V 5;  2A7Y A;  3A8M B;  2HD0 A;  3D7S B;  2JM9 A;  2RHU A;  2VXE A;  2D8H A;  3RIR A;  1AWO A;  2JUF A;  2EQI A;  2HDA A;  2XHC A;  4KUL A;  3DB4 A;  3X20 B;  1O9K A;  3QYE A;  4GLM A;  3TNH B;  1K73 U;  4KGZ B;  4HT9 A;  2CZ0 B;  3CBP A;  5HK3 A;  3B57 A;  1WHG A;  1R77 A;  4CFV B;  4HL4 A;  2EKH A;  1JXM A;  5FRO A;  3AHU A;  2QXF A;  2X35 A;  3OYE A;  3RMS A;  2DJZ A;  1QKW A;  4RCC A;  2I53 A;  4LUE A;  2WSF E;  3M4G A;  4AKI A;  2LRQ A;  3NFC A;  1V1C A;  3SEM A;  1C0M A;  4C5I A;  5LJ5 d;  4LNP A;  3OMC A;  2WIH B;  1BKB A;  1WGS A;  5GMK m;  4Y91 A;  1NM7 A;  4CFX B;  2HSP A;  3H0F A;  3FEO A;  4WF2 A;  2D6F A;  4ZN1 A;  2EVR A;  1MMG A;  4J9E A;  4CFM B;  1X69 A;  2DXC B;  2EWN A;  2NLU A;  3NTH A;  2ROL A;  2LNV A;  1AWX A;  4M78 G;  2RHZ A;  3OS1 A;  4JS5 A;  1ACM B;  3GNF B;  2IW9 B;  2LQN A;  1NG2 A;  1OL2 B;  3VS7 A;  3EFO A;  3G4S Q;  1N6A A;  2ZPE B;  4EMK A;  4JRQ A;  2AZS A;  1KD1 C;  4E7K A;  5IHK A;  2HMA A;  4JJB A;  3CC7 Q;  1XOV A;  2BIV A;  3A98 A;  2AIR B;  2FZC B;  1IHW A;  4XU2 A;  4QVZ A;  4BCO B;  2IVW A;  5GAN 4;  1Q86 U;  1Q81 R;  3M0P A;  1GUX B;  3M0T A;  3H0I A;  1LCK A;  4PJO C;  4BCI B;  1OU8 A;  2EW3 A;  1PSE A;  3BHV B;  3RGF B;  1VQK T;  1N27 A;  4HVU A;  2XD0 A;  2LMJ A;  3J80 E;  2QEX Q;  3MEU A;  3UDC A;  2K79 A;  3M03 A;  4ROE A;  4M7D A;  3BG3 A;  2DL7 A;  3PO3 S;  2NUP A;  2UZE B;  3CCU T;  1BU2 A;  4C92 A;  5IXF A;  1K9M R;  1ZSG A;  3L2Q A;  1IGU A;  3TSW A;  1VQP A;  1WJS A;  4BB7 A;  4BCP B;  3OYK A;  2G3R A;  3HRU A;  1RAC B;  4M78 F;  4F14 A;  2O4X B;  4JPB W;  1UNG D;  4XU1 A;  2JN0 A;  2CS7 A;  1Z9Z A;  3MY1 B;  4XTY A;  1UE9 A;  5A0G A;  1NPR A;  1IGQ A;  1GY3 B;  1PWT A;  2YRD A;  1YHQ A;  1PSF A;  2YRV A;  2O01 E;  3GTM S;  1QLY A;  2KI7 A;  3CCR A;  3G6E Q;  2H3J A;  4ME7 A;  2EPD A;  1EZZ B;  3EG2 A;  4OMQ A;  2CKK A;  2DD5 A;  1MGQ A;  2D1X A;  1VQ4 Q;  4D8K A;  4M78 B;  4IMY B;  3I9Q A;  2H3E B;  2OTL Q;  4D6W A;  3CCJ Q;  4LDY A;  3CCS A;  3UT1 A;  1JJ2 A;  1WHH A;  1BI3 A;  3M9Q A;  4M7A E;  1Y07 A;  1YJW T;  1W2B A;  3CPW S;  4OMN A;  3DOG B;  1MHN A;  2R5A A;  2ZCF B;  5FU7 B;  3SD4 A;  1M8M A;  4E7S A;  5IXB A;  1GCP A;  1LPL A;  1WIE A;  1E9H B;  4R55 A;  2RI2 A;  1WZO A;  1YIT T;  2FVU A;  3E9G A;  1RUW A;  1O9S A;  1RAB B;  2W9F A;  1QCN A;  5J3B A;  3QDF A;  4DA4 A;  4J9G A;  2PQW A;  3REA B;  4FL6 A;  4MDX A;  4BCQ B;  5GAN d;  1AHJ B;  3PVL A;  3MKD A;  1PD0 A;  4IUU A;  5KE2 A;  2JXB A;  1FX7 A;  4RTV A;  1NZ9 A;  2WHB B;  4N0A C;  3VKI A;  2J7I A;  4LDW A;  2DZC A;  5A0L A;  1YJN Q;  2IPO B;  1VQL T;  3M5A A;  4AKH A;  1X6B A;  1M8V A;  5GAN 2;  3X26 B;  2G6F X;  2JS2 A;  4A63 B;  1U3O A;  3GBQ A;  2LCS A;  3QSU A;  1Q7Y C;  2RHX A;  3RUX A;  4M78 D;  1CKB A;  3QG1 A;  4Y72 B;  2D9T A;  3M57 A;  2C5X B;  3EFR A;  3TVT A;  4GLK A;  5I2S A;  4M77 C;  2ATC B;  4WTO B;  3VU3 C;  1U8R A;  1OL1 B;  1WHJ A;  4NL2 A;  4RTY A;  1H3Z A;  1JSU B;  2CCH B;  3SHW A;  1UDL A;  4J6Y A;  3MPU B;  3MIA B;  2EAY A;  1QVF A;  2DL4 A;  2BTT A;  3ZFJ A;  5GAO r;  4PJO A;  2JVV A;  1JJ2 P;  3CCQ A;  3DDP B;  5LJ3 e;  3JCM d;  5GAN 3;  1VQ6 Q;  3KXT A;  3OSV A;  1HYO A;  1W2B P;  3CCL A;  4PFP A;  3M0Q A;  5IN1 A;  1G3S A;  3PGG A;  4EOK B;  1D3B A;  2BUD A;  3CXC A;  3BW1 A;  1SG5 A;  2LJ0 A;  1VQ9 Q;  3O8V A;  1JOW A;  4J9B A;  4J6X A;  4DBF A;  3CCV A;  3QYB A;  2ROT A;  3I55 T;  3HFO A;  2ZPI B;  2OTJ T;  1KQS A;  1UUE A;  4F7U G;  3E9F A;  4DEY A;  1NE8 A;  3JB9 J;  3P8H A;  4ROC A;  4N4H A;  1HD3 A;  2AT1 B;  4KT0 E;  4F7S B;  4A4G A;  4BAC A;  1K8A C;  1URC B;  3H9N A;  4B6M A;  2C4G B;  3EGD B;  2JMC A;  2V22 B;  2E10 A;  4CFN B;  4BY7 X;  1BBZ A;  3CCE Q;  1CSK A;  4EC8 B;  2KYB A;  2EGC A;  1VYV A;  3QHW B;  3HKS A;  3UA6 A;  1M90 R;  3OS0 A;  3LH5 A;  2W96 A;  2O88 A;  2E3I A;  4C8Q C;  5GMK j;  2CYZ B;  4E7H A;  1FMK A;  1PRM C;  1QQJ A;  1B3Q A;  1YJ9 A;  2JM8 A;  1W70 A;  4E7J A;  3BLR B;  2I2L A;  1FXX A;  1VOM A;  2RNA A;  3OYL A;  2VGN A;  4OML A;  2WJ9 A;  3M54 A;  2PUK B;  5HQ0 B;  5DLQ E;  4F7U F;  4KUI A;  2FPE A;  3TNI B;  2P0Q A;  2E70 A;  1H24 B;  2HCK A;  3F5X B;  2LVM A;  1H64 1;  2C0O A;  4FM4 B;  1TUC A;  1WNL A;  2RB6 A;  2MOX A;  1BCM A;  2KVQ G;  2VAS A;  2DO3 A;  4N0A A;  2L5Q A;  3T9N A;  1OI9 B;  3G7Z A;  2AK5 A;  2F5K A;  3CXC P;  3MEV A;  5GJV B;  2DL8 A;  3R6N A;  4C5G A;  5LL6 S;  1WXB A;  4F7U B;  5EFQ B;  2EUF A;  2CP2 A;  3BHT B;  2DM1 A;  1S72 A;  5L8R E;  5KYU A;  4ATO A;  4EOI B;  1QP2 A;  1ABO A;  1UHC A;  3CC4 Q;  3L42 A;  3PFS A;  4PKC C;  1I4K 1;  5GAO n;  2HBW A;  3MP8 A;  2C6T B;  5GAM j;  2BE7 D;  1AD6 A;  2M02 A;  1MMN A;  4HNU A;  4M77 A;  1KHC A;  3BDL A;  1Y96 A;  3JCM b;  3FDR A;  1G3T A;  1YWO A;  1TFB A;  1YBY A;  3SWN B;  1IHV A;  1TD6 A;  1EFN A;  1MMD A;  4GY5 A;  1GFC A;  4XTV A;  2GGR A;  3M0S A;  1C1A A;  1M5Q 1;  3JSC A;  2MPX C;  4II1 A;  2LDM A;  4LDV A;  1QMC A;  5HKC A;  4RCB A;  1KC8 R;  1FIN B;  1AZG B;  2CP3 A;  2YRC A;  3TQ7 P;  1U06 A;  2DXT A;  4J9D A;  1PNJ A;  4ZGD B;  2QA4 Q;  2X3X D;  4QW2 A;  1WHM A;  4N4G A;  2FG0 A;  1HSQ A;  2E4H A;  1VQP T;  2DET A;  1TUD A;  4ZN3 A;  1HK9 A;  4Z6Y A;  4F7U E;  1WJQ A;  4EOS B;  4ZTF A;  1WXT A;  2VGM A;  5CCA A;  2B8A A;  5KCO A;  1H1S B;  3CD6 A;  1LJO A;  1D1C A;  2F5T X;  3QZ9 B;  2LJ3 A;  2DL3 A;  3M59 A;  5CKH A;  5J26 A;  3DJB A;  3LWI A;  1VIE A;  1O9K B;  3THK A;  2L3S A;  4PL6 A;  1ZBJ A;  3VYG A;  4EOL B;  4M7D G;  2CDT A;  3QO3 A;  3M53 A;  4ELJ A;  3FB9 A;  3E2U A;  4OGC A;  1WQ7 A;  4M75 B;  4C92 G;  3CCS T;  4E47 A;  1QWE A;  1Y57 A;  2Y4Y A;  3VV0 A;  2NYS A;  2C5N B;  3LQ5 B;  1K76 A;  4HXJ A;  4C8Q A;  4BCM D;  1N8R R;  2SEM A;  1VQN Q;  4A4K A;  4BDY A;  2DX1 A;  2DK3 A;  2OI3 A;  4OGE A;  2D0Q B;  1X27 A;  1KK7 A;  4RKU E;  3HBL A;  3UWN A;  1YP5 A;  3M56 A;  1ZX6 A;  3JCM f;  1QVG A;  5A2Q E;  1ZA2 B;  1M3A A;  3JCM X;  3CMA Q;  1VQO A;  4OMF B;  5EG2 A;  3HP9 A;  4CFU D;  1VQL A;  1Q82 U;  6AT1 B;  3CCU Q;  1NJI U;  1TOV A;  2R5M A;  1M30 A;  1SPK A;  3VRZ A;  2CRE A;  2DFU A;  2K3B A;  3EFO B;  5IT9 E;  5L2W B;  4CRI A;  1JST B;  5KYW A;  4EMK B;  3CME T;  1YIJ A;  1K73 C;  4M7D F;  2XDP A;  4M75 E;  2EGE A;  4JJC A;  1G3W A;  1M1K R;  1N8R C;  3FC3 A;  4C92 F;  2LTO A;  4EDU A;  1ZUY A;  4ZNX A;  4QVC A;  4IIO A;  2X1N B;  2LX7 A;  2DLP A;  5GAN 7;  4CC7 A;  1WA7 A;  4HNT A;  2BS3 A;  3MO8 A;  5DY9 A;  3L2W A;  4FCY A;  5CR2 A;  2KSS A;  4M7D B;  4EOM B;  1GH6 B;  3UA7 A;  3JAM E;  4HCC A;  2PNI A;  4J9I A;  2NUP B;  1BI1 A;  4JLI A;  4HCK A;  1B07 A;  2WAC A;  1RI0 A;  1BU1 A;  5LJ5 j;  3CBM A;  1BCO A;  2HQE A;  2HAX A;  3G71 Q;  2HQX A;  3CCQ T;  4LN2 A;  5CO7 A;  2DTH A;  2JMA A;  3UPU A;  3JCM Q;  5CKE A;  1YIT Q;  2OTJ A;  2QDY B;  4J7F A;  4ELZ C;  1FWZ A;  2CH4 W;  3BFM A;  2LJ1 A;  4F16 A;  4ZGJ B;  4BY1 X;  1NEG A;  5KYY A;  5HVY B;  1BIA A;  4HVV A;  3OYY A;  2DD5 B;  3QHR B;  1QMZ B;  2QDL A;  4FYV B;  3PMT A; 
#chains in the Genus database with same CATH homology
 3A8L B;  1BI0 A;  3JCM g;  3CC4 A;  3G4S T;  2O01 E;  5CQY A;  4FU6 A;  1Q86 C;  3VUZ A;  1XTD A;  3OBY A;  2OTJ T;  2RI5 A;  3OQ5 A;  3CCR A;  2AHJ B;  4XTU A;  4PJO G;  3RMQ A;  2YHT A;  2H3J A;  4ME7 A;  2KMT A;  2L3R A;  2V8I A;  2YLB A;  5LJ5 e;  3MCA B;  3L2V A;  5LJ3 d;  1JJ2 S;  3QXE B;  2GFA A;  2CKK A;  1TH7 A;  2DD5 A;  1P92 A;  1MGQ A;  1X6O A;  1M4Z A;  2E41 A;  3CC7 A;  1JRI A;  4M78 B;  1M1G A;  1WJR A;  2CGH A;  2RHI A;  3GPL A;  4JS4 A;  4HT8 A;  4D6W A;  1WQW A;  5LJ3 h;  4LDY A;  3CCS A;  2E12 A;  3UT1 A;  3JB9 D;  1W2B S;  4X34 A;  1JJ2 A;  5DLO A;  4M7D D;  2E65 A;  2FL7 A;  4NL3 A;  1BI3 A;  3M9Q A;  2DTO A;  4BY6 B;  4M7A E;  4HKE A;  3TW6 A;  1Y07 A;  2X4Y A;  3PT9 A;  3CPW S;  1YJW T;  3KBG A;  1M9S A;  2HNI A;  2WSE E;  3H6Z A;  4C92 D;  1M90 U;  1MHN A;  3BG9 A;  2ZCF B;  2R5A A;  5FU7 B;  3SD4 A;  3TCJ A;  2JOY A;  3L2U A;  2QEX T;  3A8O B;  1Q7Y U;  4Y28 E;  4M78 A;  3H4C A;  1QVG S;  2BS2 A;  2E1H A;  4A54 A;  3CPW A;  4JJN K;  3CC2 A;  2LQK A;  4R55 A;  2RI2 A;  2CZ6 B;  4HLQ A;  1YJ9 T;  5HY6 A;  2FVU A;  1YIT T;  4M75 C;  3E9G A;  4OB3 B;  1QW1 A;  3ER0 A;  5CIU A;  1O9S A;  4YTL A;  2QA4 A;  4C5H A;  1VQ6 T;  2XKO C;  3QUI A;  3HB9 A;  2EJ9 A;  5J3B A;  1UGR B;  2Y4X A;  4EPC A;  4MZT A;  2GQV A;  4XU0 A;  4DA4 A;  5LJ5 h;  1OZ2 A;  2PQW A;  4PLL A;  2ZPB B;  3TU4 K;  3KHI A;  4FL6 A;  4MDX A;  1ZQ1 A;  2GCX A;  4LOC A;  2MWO A;  5GAN d;  1AHJ B;  2EQM A;  2DPP B;  4QQG A;  5KE2 A;  3G6E T;  4IUU A;  3HSB A;  4NC6 A;  3M58 A;  1FX7 A;  2K5L A;  3TRE A;  3PMI A;  1NZ9 A;  4JX6 A;  4A4E A;  4N0A C;  2XDD A;  5GMK l;  4P5N A;  3CEY A;  2P4T A;  4PJO F;  3VKI A;  4LDW A;  1JBM A;  3V7S A;  2DZC A;  5A0L A;  5GAM g;  3LWH A;  1GXI E;  4OF1 A;  4QVD A;  3LGL A;  1XNI A;  1VQL T;  3M5A A;  3URG A;  2JTM A;  2QFZ A;  4AKH A;  1VQ5 A;  5LJ3 j;  2C06 A;  1M8V A;  5GAN 2;  3X26 B;  3JCM c;  3OYN A;  1BI2 A;  1M90 C;  2K2V A;  3FJP A;  3P8B B;  2BKD N;  4XQ3 A;  5KCH A;  1G3Y A;  3QSU A;  1Q7Y C;  2RHX A;  3OYC A;  1O75 A;  2OTL T;  3RUX A;  4M78 D;  4MFD A;  3JCM e;  3CCJ T;  3QYG B;  3QG1 A;  2P0K A;  2RD1 A;  2XDB A;  1ZHI A;  2D9T A;  3M57 A;  3EFR A;  1S72 T;  5D6W A;  3JB9 I;  3C12 A;  2M0O A;  4M75 G;  3ZBD A;  2DXU A;  4GLK A;  4BI3 A;  4KBM B;  1KHI A;  3JB9 H;  2BS4 A;  3HFN A;  4IKF A;  2V8K A;  2K3X A;  5I2S A;  4M77 C;  4PJO B;  1K8A U;  2KR6 A;  3E19 A;  4HCB A;  3VU3 C;  1U8R A;  1QVF S;  2V8J A;  2PUO B;  4NL2 A;  5DM7 R;  1H3Z A;  3INZ A;  3GOX A;  4C92 B;  3WXM B;  3VKH A;  4J6Y A;  5GAM f;  2EAY A;  1QVF A;  4OP0 A;  4NS5 A;  3ZFJ A;  2EJF A;  1D3B B;  3GF5 A;  1VQK A;  4M7D G;  5GAO r;  4FT4 A;  4XAX B;  2KAF A;  4PJO A;  3SB2 A;  2JVV A;  4BBR M;  4RG2 A;  3X28 B;  3CCQ A;  3ASK A;  5GAN j;  3C95 A;  5LJ3 e;  4JX5 A;  3JCM d;  2LC4 A;  2VYT A;  3OYI A;  3GP8 A;  3JCM V;  5GMK h;  4JDS A;  3RKY A;  3SWN C;  5GAN 3;  1YCY A;  3OSV A;  3Q1J A;  3KXT A;  3CXC S;  3CCU A;  3CCL A;  1VQ7 A;  2ZZD B;  2E5Q A;  5IN1 A;  3RES A;  4C0D C;  1G3S A;  3JCM h;  3I56 T;  1K73 C;  2K5I A;  3PGG A;  2LT4 A;  1D3B A;  2BUD A;  5CKD A;  1X01 A;  2KQW A;  3CXC A;  4M7D F;  5GAO l;  3BW1 A;  4HCZ A;  5GAN 6;  1KC8 U;  3O8V A;  1KQS S;  1R8O B;  2KY9 A;  4J6X A;  3X25 B;  3CCV A;  1YJN T;  3QYB A;  2X4J A;  3V7C A;  3VUB A;  1QLB A;  2ZPI B;  3HFO A;  2ZGW A;  3I55 T;  3CCM A;  4CI0 C;  1KQS A;  4M7A C;  2VV5 A;  5FU6 C;  2ZZD A;  4F7U G;  3E9F A;  3JB9 J;  1NE8 A;  3P8H A;  4M77 G;  2QQS A;  1VQM T;  4N4H A;  3MEA A;  2F69 A;  4KT0 E;  3GNG A;  1UGS B;  4A4G A;  4BAC A;  1K8A C;  2DTI A;  2KK4 A;  3CD6 T;  3G4S A;  4M75 F;  4E7I A;  2KDS A;  3LH0 A;  4DOV A;  4J5Y A;  3WVD B;  3DKM A;  4PJO E;  4M7D E;  1VQ8 T;  2DIG A;  1YHQ T;  2IG0 A;  2EKO A;  2E10 A;  4C92 E;  4BI8 B;  1LOJ A;  1BYM A;  3LYI A;  5GAN e;  4PJO D;  1V29 B;  4HA8 A;  3SFM A;  5CAI A;  2XI9 A;  3OYB A;  3EAE A;  2DD4 B;  1B34 A;  3ME9 A;  1Y7X A;  3P8D A;  3CCR T;  2ZPH B;  5FRM A;  2HBP A;  3HKS A;  3OBW A;  2EIF A;  2M9U A;  1KQ2 A;  2RH2 A;  4XTZ A;  4MML A;  2EYQ A;  3OS0 A;  3JCM W;  1YJW A;  3FRN A;  3OYA A;  2EJG A;  2RM4 A;  1ZBX A;  3S6W A;  2EQU A;  2CYZ B;  3CBO A;  4C8Q C;  5GMK j;  4E7H A;  2QEX A;  5GAO p;  5FLX E;  3TW7 A;  3G71 A;  1KC8 C;  3LX7 A;  1OZ3 A;  1I8F A;  4O5V A;  2PVD B;  4RG8 A;  1QP3 A;  2DD4 A;  1IZ6 A;  2XIC A;  3M4Y A;  4RMO A;  3DLL A;  5GAM d;  4OB0 B;  4M7A G;  4BD3 A;  1YIT A;  2FB7 A;  1YJ9 A;  1N8R U;  4E7J A;  4XK8 E;  3RKX A;  4OB2 B;  4ELY C;  4BDZ A;  1KQ1 A;  2I2L A;  4BY6 C;  5J39 A;  1FXX A;  3M55 A;  4M75 A;  3OYL A;  3VKG A;  1VQ9 T;  2VGN A;  4V2S A;  2WJ9 A;  1NPP A;  3M54 A;  4MDW A;  2PUK B;  3PIO A;  4J8O A;  1FKM A;  1OYX A;  5DLQ E;  4F7U F;  5FRN A;  2QQ9 A;  3N5B B;  4KUI A;  4M77 F;  3V7R A;  2DZ9 A;  3SDZ A;  2QA4 T;  2P0Q A;  2GF7 A;  5GAN h;  2DIQ A;  1VQO T;  2MF2 A;  1N9R A;  5D6X A;  2E70 A;  2XK0 A;  2A3L A;  2LVM A;  1H64 1;  5KE3 A;  4FM4 B;  1WNL A;  2DVE A;  2RB6 A;  3NTK A;  5EJC A;  3LGF A;  2KVQ G;  2RJC A;  3NTI A;  2MWP A;  2QTX A;  4M78 E;  5AYF A;  4C5E A;  3CME A;  2DO3 A;  4JX4 A;  3PIP A;  3QII A;  4BE2 A;  4LD9 K;  4QQD A;  2R57 A;  3OYD A;  4N0A A;  2L5Q A;  3T9N A;  3G6E A;  4M6V A;  3G7Z A;  5GMK e;  1M1F A;  2F5K A;  4C8Q G;  3MEV A;  1X75 C;  1VQN A;  4C5G A;  4LDU A;  3CCE T;  3MHX A;  1VQ4 A;  1YIJ T;  2ZPF B;  3R6O A;  5CKF A;  2OTL A;  3BDU A;  3CCJ A;  5LL6 S;  4O6J A;  4F7U B;  4OB1 B;  5LJ5 g;  4IUR A;  5GMK i;  1S72 A;  5L8R E;  2K4Y A;  4EMK C;  5KH6 A;  3KUF A;  1Y96 B;  1M1K U;  4MZP A;  4DQ2 A;  2OAU A;  2GFU A;  4ATO A;  1G5V A;  2CZ7 B;  1QP2 A;  4HNV A;  1W4S A;  2PVO B;  1UGQ B;  3L42 A;  3QZ5 B;  4LDX A;  3PFS A;  3QWL A;  4PKC C;  1I4K 1;  3MEW A;  5GAO n;  1I5L A;  4BE0 A;  3QJ6 A;  3TEE A;  4QSH A;  2RHY A;  4M75 D;  4M7A F;  3MP8 A;  5C6S A;  5GAM j;  4F7U A;  3RER A;  4HNU A;  2EFI A;  4M77 A;  4Z02 A;  3PTA A;  1KHC A;  2YLC A;  2KMG A;  3BDL A;  1Y96 A;  3JCM b;  3FDR A;  2DAQ A;  1G3T A;  4N4I A;  3DB3 A;  4J83 A;  4JRI A;  4LD6 A;  1VQN T;  3V8K A;  2RA2 A;  2PU9 B;  1YBY A;  3BY7 A;  3SWN B;  2RK2 A;  1RL2 A;  5M9O A;  2DEQ A;  4A53 A;  3J81 E;  3OS5 A;  4GY5 A;  4C0D B;  1Q81 U;  2QQB A;  4XTV A;  2VC8 A;  1M5Q 1;  3E1S A;  4M7D C;  4PNO A;  2VXF A;  4BBS M;  3JSC A;  5CKB A;  3OYH A;  4UC4 A;  4II1 A;  2LDM A;  4LDV A;  5LJ5 f;  4E7L A;  3CMA T;  4C92 C;  4RCB A;  5HKC A;  2RJD A;  3QKJ A;  5GAN 5;  3SWN A;  3V8J A;  4M7A B;  1YI2 T;  1UB4 A;  2MI6 A;  4B9W A;  5FU6 B;  2M1H A;  4IUV A;  3OYF A;  3HZJ A;  2QF7 A;  2DXT A;  4MIM A;  4ZGD B;  2LQ8 A;  1YJN A;  5CVI A;  3JCM P;  4QW2 A;  2QQ8 A;  4C8Q F;  5IAY A;  4N4G A;  3I55 A;  1UEB A;  3CCL T;  1VQP T;  3QYH B;  3CPF A;  4ZN3 A;  1HK9 A;  1M1K C;  2Y90 A;  1K9M U;  4Z6Y A;  4OVA A;  4F7U E;  2DXB B;  4NOY A;  2QDJ A;  1WJQ A;  4X9D A;  1XQH A;  4ZTF A;  2VGM A;  3BG5 A;  1B34 B;  1W2B A;  5CCA A;  2JNG A;  3VYG B;  4BI4 A;  4IUP A;  5GAM e;  3VYH B;  1JB0 E;  1EIF A;  2B8A A;  2LX9 A;  5KCO A;  5GAO q;  1LJO A;  2K57 A;  3CD6 A;  4M7A A;  3LLR A;  3MP6 A;  3CCV T;  2F5T X;  1QVP A;  3OSS C;  3QZ9 B;  4ZTJ A;  3M59 A;  5CKH A;  5J26 A;  3QJY A;  2LT1 A;  4EMG A;  1VQ8 A;  4M77 D;  3LWI A;  3CC4 T;  1VIE A;  5HK0 A;  2DXB A;  4J6W A;  2QI2 A;  1OI1 A;  4PL6 A;  2PVG B;  1LNX A;  3VJP A;  4IUT A;  2FHD A;  4L6V 5;  2HD0 A;  2A7Y A;  3A8M B;  1VIF A;  3QHS A;  3VYG A;  2O4X A;  4J7I A;  3JB9 G;  1Q81 C;  2VUB A;  4C8Q B;  4JUV A;  1HXD A;  2RHU A;  2VXE A;  3QO3 A;  3JRZ A;  1BIB A;  2EQK A;  3M53 A;  4ELJ A;  3FB9 A;  3RIR A;  2JUF A;  2RO0 A;  4OGC A;  2XHC A;  1WQ7 A;  3CC7 T;  4KUL A;  3DB4 A;  3X20 B;  4M75 B;  3V8L A;  4C92 G;  3CCS T;  4E47 A;  3GIB A;  3VV0 A;  3QYE A;  2Y4Y A;  1K73 U;  1DJ7 B;  4HT9 A;  2X4X A;  2CZ0 B;  3CBP A;  5HK3 A;  3L1A A;  1WPY A;  4M78 C;  2XG8 D;  1KG1 A;  4C8Q A;  3WVE B;  3EFS A;  4JRP A;  2QQA A;  2WSC E;  3S3N A;  1VQ6 A;  4A4K A;  3A8G B;  3OA6 A;  4HL4 A;  3HPW A;  5GAM h;  4BDY A;  1K9M C;  3L2R A;  3OB9 A;  2K3Y A;  2DK3 A;  4OGE A;  5CK9 A;  5FRO A;  2D0Q B;  2QXF A;  2X35 A;  3OYE A;  3S3M A;  3AHU A;  3RMS A;  3CC2 T;  2DJZ A;  4L59 A;  4L5G A;  3G71 T;  3S3O A;  1KD1 U;  4RCC A;  5LJ3 g;  4RKU E;  5FU7 C;  3HBL A;  4C0G A;  1VQ9 A;  4M7A D;  2WSF E;  4MMK A;  3UWN A;  4XU3 A;  3M56 A;  3M4G A;  4AKI A;  3JCM f;  2LRQ A;  3NFC A;  3MP1 A;  1QVG A;  5A2Q E;  3JCM X;  2QQR A;  2LCC A;  1U1S A;  5I2M A;  4C5I A;  1U1T A;  1VQO A;  5LJ5 d;  4FT2 A;  4EMH A;  4FSX A;  4OMF B;  3OMC A;  5EG2 A;  1BKB A;  4C0Z A;  3HP9 A;  1WGS A;  3HRS A;  5GMK m;  1E7P A;  3OYM A;  4AI6 A;  4Y91 A;  1Q82 U;  1VQL A;  1N9S A;  3JCM J;  3FIF A;  2XU8 A;  1NJI U;  3HRT A;  2JZ2 A;  3FEO A;  2R5M A;  2RJE A;  2E6Z A;  4WF2 A;  2D6F A;  4ZN1 A;  3DL1 A;  2ZPG B;  4BE1 A;  3HHT B;  4Q5W A;  2E64 A;  5IT9 E;  4C8Q E;  2XID A;  4CRI A;  3H8Z A;  3JB9 F;  2DXC B;  2EWN A;  2NLU A;  3NTH A;  5CQX A;  4EMK B;  5GAN 8;  2LNV A;  3CME T;  3CCE A;  1YIJ A;  4MFE A;  4A4F A;  3C94 A;  4BUG A;  2XDP A;  4M77 B;  2M16 A;  4M78 G;  1VQ5 T;  4M75 E;  2RHZ A;  4FIB A;  4IUQ A;  1G3W A;  3OS1 A;  4AKG A;  4JS5 A;  1N8R C;  3FC3 A;  2CZ1 B;  4C8Q D;  3OS2 A;  3OYG A;  4C92 F;  2LTO A;  2MAM A;  3GNF B;  5LJ3 f;  4EDU A;  4KUD K;  4QVC A;  2E6N A;  3L2Z A;  2R58 A;  5GAN g;  3QDR B;  1VQ4 T;  3C4S A;  1N6A A;  2DXC A;  3MET A;  2ZPE B;  3PNW C;  4EMK A;  4JRQ A;  5GAN 7;  3J7A F;  1SSF A;  2K5F A;  1KD1 C;  3OY9 A;  1IRE B;  4E7K A;  1XOV A;  2BIV A;  4JRK A;  5C0M A;  2L8D A;  4HNT A;  2BS3 A;  4XU2 A;  4ZGE B;  4QVZ A;  3MO8 A;  4QQ6 A;  5I21 A;  5DY9 A;  4VUB A;  3OMG A;  2RI3 A;  3L2W A;  3OW2 S;  2IVW A;  5A0D A;  1UGP B;  1I81 A;  5CR2 A;  2KSS A;  3LW5 E;  4JLG A;  5GAN 4;  1Q86 U;  3GLX A;  4A4H A;  3OYJ A;  4M7D B;  3JAM E;  4HCC A;  4XTX A;  3OW2 A;  4PJO C;  1BI1 A;  4JLI A;  4DOW A;  1Q82 C;  2WAC A;  1NJI C;  4X9C A;  2FYK A;  1RI0 A;  1PSE A;  4XTW A;  1VQK T;  5LJ5 j;  1N27 A;  3CBM A;  2XD0 A;  3J80 E;  3I56 A;  3MEU A;  2DKG A;  2HQE A;  3QPH A;  3UDC A;  4MZM A;  2HAX A;  2HQX A;  2MMP A;  3CCQ T;  2P0P A;  5D6Y A;  3CMA A;  3DLM A;  4M7D A;  5GAO m;  4B9X A;  5CO7 A;  3BG3 A;  2DTH A;  2L89 A;  4PLI A;  3UPU A;  1YI2 A;  3JCM Q;  5CKE A;  5GAN f;  3RKW A;  3CCU T;  2QDY B;  1VQ7 T;  2OTJ A;  4R56 A;  3HL8 A;  4C92 A;  1Y71 A;  3ZEH A;  4J7F A;  4ELZ C;  1FWZ A;  4M77 E;  3L2Q A;  1VQP A;  3QBY A;  3BFM A;  1WJS A;  3FLG A;  1VQM A;  4C0F A;  4BB7 A;  3OYK A;  2G3R A;  3X24 B;  2JTF A;  4ZGJ B;  3HRU A;  3HO8 A;  4M78 F;  3F70 A;  3A5Z B;  2O4X B;  2X4W A;  4XU1 A;  4TVR A;  1VUB A;  2JN0 A;  2CS7 A;  2G77 A;  3CCM T;  2EQJ A;  4XTY A;  5A0G A;  1NPR A;  2RK1 A;  2LCL A;  1BIA A;  3OYY A;  2DD5 B;  1YHQ A;  2RJF A;  1PSF A;  2YRV A;  3PMT A;  3A8H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...