1UGSB

Crystal structure of ay114t mutant of co-type nitrile hydratase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Nitrile Hydratase alpha subunit
total genus 66
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugsB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugsB02
2CZ7B 2DXBB 2CZ0B 2PU9B 2PUKB 4KT0E 4Y28E 2CZ1B 2WSFE 3X26B 2DD5B 2ZPBB 2PVGB 2DPPB 2CYZB 3A8LB 2PVOB 2ZZDA 4ZGEB 3A8MB 3A8OB 2D0QB 4OB2B 2QDYB 2WSCE 1AHJB 3WVEB 1UGPB 2AHJB 4OB3B 3VYGA 1PSEA 2ZCFB 1JB0E 4ZGJB 2DD4B 2DD5A 2ZPIB 3WVDB 2ZZDB 1UGRB 3X20B 3LW5E 1QP3A 3VYGB 3A8HB 2O01E 1UGQB 2CZ6B 3X28B 1GXIE 5L8RE 2DXBA 4XK8E 2DD4A 1V29B 2DXCB 2WSEE 1QP2A 3X24B 1DJ7B 2DXCA 2ZPFB 4OB1B 4ZGDB 4RKUE 3QYGB 1PSFA 4L6V5 2PUOB 3X25B 3QZ9B 2ZPEB 3QZ5B 2PVDB 2ZPGB 3QXEB 1IREB 2ZPHB 4FM4B 3QYHB 3A8GB 4OB0B 1UGSB 3VYHB 3HHTB
chains in the Genus database with same CATH superfamily
2EQJA 4A63B 5GANd 4CFUB 4BACA 1ZBXA 3OSSC 2COZA 4J5YA 2DZCA 2E65A 1BCOA 4RTWA 1QVGP 3DKMA 3V8KA 4EOPB 2PNIA 2MOXA 5A2QE 1C9BA 4HNUA 5GANg 2E10A 3A8LB 2KRSA 5CO7A 1QKWA 1E6HA 4HCZA 3J81E 3JCMc 1NPRA 1OPKA 1RACB 2MYSA 2FL7A 1FINB 2F2CA 2KQWA 3Q1JA 3CBMA 2AIRB 4OGEA 4FT2A 2DM1A 1GCPA 2PJQA 3S3MA 3CCUA 1OX8A 4MDWA 2Y4YA 2GBQA 6AT1B 4G6LB 5HK0A 3VKIA 2VC8A 2MMPA 2CCIB 1BI0A 3POMA 3GBQA 2OTLA 5GAN6 3CCRT 3RUXA 2E3IA 1BI2A 3HSBA 4M7DB 1YITA 2HL3A 2XDPA 2NUPA 1ZP2A 3OA6A 1YIJQ 3B57A 1MMGA 1BIBA 4M4ZA 3OW2S 1Q7YC 2XDBA 1WXUA 2DD4A 4MMKA 2HSEB 1FVVB 4AMCA 3CCEQ 4C92F 3VS5A 3UWNA 4GLKA 2AT1B 1H24B 3GP8A 1K9MC 4A4GA 1OL1B 4LDVA 1VQPQ 5GAMf 2EQKA 1M1GA 3RMSA 4DOVA 4M7AB 4DEXA 1RL2A 5GAMj 2NYSA 4O6JA 1UNGD 4BCQB 1RAIB 3OYBA 1VQNT 3JB9F 2Y4XA 1OQKA 4GLMA 3G7ZA 1K0XA 2A36A 4EOSB 5GAOn 2O2OA 1Y57A 1KJWA 3FIFA 1M4ZA 5A0LA 2CZ0B 1MNDA 2QF7A 3TCJA 3QJ6A 4WF2A 5LJ5e 1M8VA 3H0IA 3OQ5A 4FYVB 3M57A 5GMKj 1S72T 4RTUA 4JJDA 4JRQA 2IW8B 1BI1A 1ABOA 1URCB 1M30A 3I55A 1FMWA 3M53A 4M75B 3HB9A 2HCKA 2QQSA 4AKIA 1Y0MA 1OZ3A 4PFZA 1AOJA 4CFXB 1TTHB 1VQOA 3P8HA 2WSCE 4PLIA 2YUOA 1VQMT 2WIHB 3AT1B 3GLXA 3CCEA 2RHZA 2QQRA 1SSFA 4HCCA 4EOIB 4ZGJB 4KGXB 1OI1A 4ELLA 1RUWA 1YJ9Q 4MMLA 2QQBA 2QA4A 1U06A 2GFAA 4A4HA 4X34A 4F70B 1OYXA 4FYYB 4BBRM 1YI2T 3PIOA 4RUGA 2L5QA 2LT4A 2KAFA 2KY9A 4EPCA 2BKZB 1XTDA 1SHGA 2C0IA 2AZVA 3NGPA 1ZHIA 1HJDA 2K5LA 3EGXB 4FT4A 3J7AF 3CCJT 1QP2A 1YWPA 1SSHA 1F5QB 4ELZC 1KD1R 1XOVA 3EG9A 1VOLA 1I5LA 1WXBA 2VXEA 3RBBB 2WXVB 1WI7A 4OGCA 3RR6A 4L6V5 1XO2A 5LJ5g 4M7AA 3HPWA 2F5TX 2COYA 4EIKA 3QXEB 2HEQA 2QEXT 2QEXA 1RLPC 4F7UG 1K8AR 2X35A 2UZEB 1FXXA 5CKFA 2J6FA 4LD9K 4Y72B 3QJYA 2R58A 1ACMB 2RD1A 4RTZA 2YXYA 1SRMA 3S3OA 1VQ7A 4BCFB 2LNVA 3CPWS 1EIFA 2VUBA 1PG5B 1C0MA 3V7CA 5HVYB 4JDSA 4Y91A 2WHBB 2QAZA 2M0YA 4EOQB 3M0RA 5EG2A 2CZ1B 3CD6Q 3CCLQ 4B9XA 1G3SA 1QVFS 2LMJA 4CFNB 2PMIB 5LJ3d 1AD5A 3WXMB 3TEEA 2HDAA 4E7SA 2VGMA 4JS4A 3PVLA 1U1TA 1ZBJA 4BI8B 4JLIA 3G33B 4Z8AA 4N4GA 2AHJB 3ZEHA 1YCYA 1N9SA 4BCGB 2E1HA 3CPFA 1NE8A 1D3UB 5HK3A 3BHTB 4XU0A 2D8HA 1M1FA 1P92A 2QTXA 3EFOA 2DYBA 3EHRA 1GCQC 1IZ6A 4C8QG 3OYJA 5HQ0B 1BYMA 3LW5E 1IHVA 4PJOE 2C5VB 3OYFA 2JZ2A 3CD6T 4J9EA 1NEGA 5ACBA 2I40B 3NTHA 4C8QE 5LJ3f 2CZ6B 4X1VA 4MFDA 1O9KA 2YDLA 1VQ7Q 4I3ZB 2H3JA 3UT1A 4M78A 1M1KC 2JTMA 3R6OA 2RJEA 2WSEE 3LQ5B 1E7PA 1PD0A 2DXCA 3BDLA 1OX9A 3QYGB 3JCMf 1NBEB 3MO8A 3PT9A 3OYAA 1H3ZA 3MY5B 1T3LA 2HZYA 4JLGA 5GAOq 4BUGA 1OEBA 2X1NB 5L2WB 3JCMX 1ARKA 1X69A 5IH2A 4E7ZA 1IREB 4C0DB 5KYXA 2RQTA 4C0FA 1K76A 2LJ0A 4KH1B 2DERA 5BNJB 4M75A 4OMNA 2MWOA 3CMEA 4OB0B 4MFEA 1CKBA 3GNGA 4IMYB 3VYHB 2BIVA 5LL6S 1KK7A 2CH4A 4XQ3A 2EVRA 3CMET 1H641 2LQKA 4L5GA 2E4HA 4AFUC 4E47A 4HNTA 1I0CA 4J9HA 1K9AA 1WQWA 1NLPC 4PJMA 2R5MA 2C4GB 4XTWA 2PVGB 3VV0A 2LX9A 1OKVB 1AWXA 2V1RA 4J9GA 1FX7A 1SKUB 3A1PA 5GAOm 3G6EA 3PMTA 1LVKA 3QYEA 2B86A 3JSCA 3ME9A 2WJ9A 3G4ST 3DOGB 4AFQC 3FB9A 3OYMA 1YWOA 2RHIA 3MP8A 4RTTA 2ZCFB 3BLHB 1J3TA 4XTUA 1G3NC 4F7NB 4QQDA 2CCHB 4E7JA 2P0QA 1KIKA 3JB9I 5LJ3h 2DD5A 2EYQA 1GH6B 1KD1C 3WVDB 1SF9A 1QW1A 1JQQA 1PNJA 2M0OA 2DL7A 3HRUA 3CMAT 3REBB 5LJ5f 2YHTA 2OAWA 4AT1B 3RERA 3V7RA 3PVQA 2MF2A 1QVFA 5LJ3j 1VQOT 3OS0A 3O5ZA 1JEGA 3KHIA 5GAN7 5L8RE 3I56A 2G3RA 4AKHA 4JZ3A 1VQ6Q 3HFNA 3OSVA 4ESRA 1VQKQ 2DXCB 1RAGB 2DVJA 4DBRA 4XU1A 1UJYA 4EONB 2BE9B 4EOKB 5GAN5 1RAEB 2DJZA 1KFZA 2FO0A 8ATCB 5CKHA 4QSHA 3BG3A 3RKXA 2A28A 4PJLA 2F69A 3UPUA 2YRCA 2F2VA 4R0KA 3G1JA 1E9HB 2GCXA 5DQVA 3QO3A 1G5VA 2BZYA 2DETA 3PGGA 1QVGA 5I5ZB 1LCKA 2FPEA 2DTHA 3FLGA 3A8GB 5GJWB 3QDRB 5KYUB 1YJWQ 1D09B 4N4IA 4BCOB 3OYCA 1YIJT 2NLUA 4ZTFA 2X9HA 3L2WA 4EMKC 1VQ8T 4KT0E 4M77F 2JMAA 2NWMA 5CIUA 5A0DA 1JJ2S 2DRKA 2LP5A 4LDXA 3X26B 9ATCB 1KQ1A 3P8DA 3CC2Q 2DPPB 2CYZB 2EJGA 1JSTB 3GOXA 4LDUA 2LDMA 2RI2A 1KXUA 2XIDA 1ZSZB 3I55Q 2W2HA 4M7DA 1M8MA 4PKCC 1W2BS 3WVEB 3NTKA 5LQFB 2YUNA 4PNOA 4EC9B 1K8AU 4M6VA 1RAAB 1M90C 1H1SB 2EWNA 4M77E 3JCMd 4HCBA 4FIBA 4CRLB 2MIOA 1G8XA 3VU3C 4BI4A 2J7IA 3JAME 2RK2A 1G2BA 4M7DF 3A8HB 1TU0B 2DJQA 4HNVA 2DTIA 2PZ1A 3SEMA 8AT1B 2R5AA 2DXTA 3EJ1B 2RHYA 5I2SA 4HA8A 3X24B 4YOZA 3EGXA 5FU6C 5D6XA 3C12A 3I5RA 3DTOA 1PSFA 4V2SA 5FW9A 3SWNB 2YLBA 1UDLA 1ZA2B 3O0GD 3GF5A 3OB9A 1K8AC 3CCRQ 1QMCA 1WFWA 2CGHA 2NUTA 1XQHA 1HK9A 1YHQT 2E12A 2CP3A 5J26A 2R57A 3BLRB 2KR3A 3E9GA 2AZSA 2BE7D 2GTOA 2O9SA 3QHWB 2HQHA 4A4FA 4F6WB 3QWYA 4BCPB 3ER0A 2V8KA 3TVTA 1P5EB 4JJCA 1N8RC 2QYZA 5IHNA 1Q86R 2K57A 4N0AC 1WHHA 3HL8A 4OGRB 1UJ0A 3LLRA 1HD3A 3CCLA 3GIBA 2HBPA 2JS2A 4M78G 4YTLA 1K4US 1UG1A 2EBPA 2ZZDA 2QQ9A 3QSUA 3RGFB 3PO3S 2EW3A 4J83A 3JCMb 5IHIA 1TXQA 2A7YA 3CMAQ 2QDYB 3NPFA 2HSPA 1YJNQ 2M16A 1QWFA 4J9CA 2KT1A 3MEAA 4M75C 4Z89A 5EC7A 1EX4A 1ZUYA 2O4XA 2FZCB 2WMBB 4LD6A 1E6GA 2H8HA 2C0TA 3OYLA 3BFMA 1MMNA 3TW7A 4FYXB 3CCRA 2KBTA 2V22B 3KXTA 2CDTA 5FU7B 1M2OA 1KC8R 3VS1A 1X2QA 3HTRA 1YCSB 3RDVA 1WNLA 4D8KA 1RLQC 4RG2A 1GXIE 2KXCA 3JRZA 1IO6A 1N8RU 3FEOA 2AKKA 4RTXA 1M27C 1WDXA 2DXBA 3M5AA 3R6NA 3VJPA 4Z02A 1GL5A 3SHWA 3TQ7P 5IT9E 2F1LA 3NMZC 4L59A 3DJBA 3MEVA 5CKDA 2WPAB 3TSWA 2IVWA 3X25B 4CFVB 4A4KA 2A37A 2RJCA 3E1SA 2ZPGB 3CD6A 4FW2A 2JNGA 2W10A 3CBPA 4CC7A 3EOCB 2JS0A 1R0BG 3CCST 1IRXA 1NLOC 2DL3A 1MMDA 1SHFA 2D0NA 4ZN3A 1YJNA 3TNIB 1Y96A 1EFNA 3CC4A 2F2XA 3UA7A 1JXMA 1VYWB 2W9ZA 1WHLA 4PJOD 2FPDA 4M77D 4JRIA 4LXCA 1E7OA 4C5EA 2PU9B 2PUKB 4LDWA 2O9VA 5FLXE 3O8VA 4A4EA 1BI3A 2P4RA 3MEUA 4Y28E 2CH4W 2MWPA 2DYIA 3RMQA 2EKOA 2VVKA 4LN2A 3M9QA 3C95A 2QEXQ 3M58A 3EGUA 3QIIA 4KH0B 4F04B 3CPWA 4BCJB 1ZA1B 1UFFA 4ZGEB 1YHQQ 3OW2A 3BDUA 7AT1B 3G6EQ 2ED1A 1D1CA 1IB8A 5GMKl 2RJDA 2JJ9A 2EUFA 4OB3B 1NJIR 1CKAA 2RQRA 1XJWB 4XU2A 3GNFB 1VYUA 4F7UB 4ZN1A 2X4JA 2RHUA 5C6SA 3CXCA 3CC7A 1UE9A 4EOJB 2E6NA 1Q7YR 2XMFA 4CI0C 3DLLA 4KUIA 3QDFA 2I53A 2DX1A 3TREA 2ESWA 2CJMB 5CK9A 2ATCB 1QCFA 4BY7X 2X4WA 3FDRA 2RO0A 3CC7T 2QGFB 3H6ZA 1WJSA 2KR6A 1GFCA 3L2VA 1TD6A 4RKUE 2HQEA 3FJPA 4KRDB 1JJ2P 1ZSZA 4HT9A 3QG1A 1Q81U 1AEYA 1FKMA 1Y07A 1OPLA 2PVDB 3H41A 5DM7R 3JCMP 3F70A 1K9MU 4M7AG 4X9CA 4ROCA 2FEIA 2ROTA 4F7SB 2LT1A 1H8KA 1VQ4Q 1AWOA 1Q82R 1JU5C 3VKGA 5LJ3e 2XICA 4UN0A 3RNJA 1TUCA 4VUBA 5FWCA 2QQ8A 4TTHA 3EG1A 3CC7Q 2FRYA 5IF1B 2I0NA 1PM3A 2RI3A 1K73R 3PE0A 1PD1A 2EQUA 1PKSA 3EH1A 1AZGB 4BBSM 2CP2A 5CVIA 2VV5A 2J05A 3P8BB 2RHXA 2MPXC 4J6XA 3UA6A 2L3QA 5KE3A 1H27B 1WYXA 2LCLA 4C0GA 1X27A 3CCQQ 2X4XA 2FB7A 5ECAA 1JJ2A 3OBWA 1VQ5A 1GFDA 1PSEA 3QBYA 5C0MA 3DDQB 3QKJA 2CT4A 2DNUA 1C1AA 4C8QF 2WIPB 4JX6A 2KYBA 2RQUA 1YJWT 2RNAA 4BY1X 1VQ7T 1H1QB 2GQIA 2RK1A 1U1SA 2QTVA 2XDDA 5FGKB 3PNWC 2JTFA 1W2BA 3CC2T 4X9DA 2P0KA 5IAYA 2QGSA 2V1QA 1U8RA 3OYHA 1UGQB 3LWHA 3EHQA 5D6WA 2K2MA 2DEUA 1S1NA 3LGFA 1VUBA 3V8LA 3OYYA 4OB1B 1X2KA 3EGDB 2QFZA 1AISB 4RCBA 1YJNT 3E19A 3EAEA 3M0TA 4RTYA 2KMGA 1Q82C 4BCKB 1W4SA 3CC4Q 2C5NB 2ZGWA 4CFMB 5IDPB 5KYWB 1ZX6A 4FSSA 4ATOA 1QLBA 4M78D 4IIOA 5D6YA 3BHUB 1VQLT 3KBGA 3JB9D 3CCUT 1FWZA 2PK2A 4EOLB 3K7AM 2KI7A 2JXBA 3LYIA 4N0AA 4R55A 3L42A 5FROA 4F7LB 5J3BA 4BB7A 2QQAA 2BKDN 2EKHA 3VKHA 4CXAB 1H25B 1M3CA 3M59A 5A0GA 1OKWB 3QWXX 2QDLA 3CCJQ 2M9UA 1W6XA 2Y90A 3G4SQ 3CBOA 3JCMe 4II5B 4J9DA 1I5OB 1F1BB 3BY7A 3HFOA 4IUTA 3QHRB 5LJ5j 2DMEA 4P5NA 1JKWA 3UF4A 3CCVT 3S3NA 4HVVA 3HKSA 5D7UA 4C92B 4II1A 3TSZA 2YRDA 3TW6A 2IVXA 1H26B 3VYGA 2DBMA 2W0ZA 2LTOA 3FRNA 2QXFA 4DOWA 3A5ZB 4EMKA 4QQ6A 3NDQA 3X20B 2K5FA 4M7DG 2EAYA 2LCSA 2CT3A 3DLMA 1M3AA 1PKDB 4HKEA 2PK9B 2YUPA 3I9QA 2ED0A 4LNPA 4YOOA 4C92E 2FRWA 4OMLA 4PJOG 1UUEA 1UB4A 3H0FA 1D0ZA 4XK8E 2M51A 4BCMD 2EYYA 4IKFA 4YC3B 2EGCA 3G4SA 2QG9B 2EQIA 1D3BA 2MCNA 3D7SB 1NJIU 2MAMA 1KC8C 1WHJA 3HZJA 2HAXA 4JJNK 4M7DC 3UATA 4F7UE 3QZ9B 1OIUB 2BUDA 2HD0A 2QGGA 2A3LA 1D0XA 2FZKB 2HMAA 2CREA 1NYFA 2GTJA 1H1PB 1KHCA 4ME7A 3TN8B 4F17A 1VQ8A 3QYHB 3OMGA 1OU9A 4J7IA 3JV3A 4JRPA 1UNHD 3OYKA 1I1JA 1UGSB 4DBHA 3HHTB 2AKLA 1GUXA 1K1ZA 4C8QB 1G3WA 3HP9A 2JUFA 2RI5A 2DXUA 5KE2A 1TOVA 5GMKm 3HO8A 2IG0A 3MPUB 3RESA 2FYKA 4PL6A 2JTEA 5FRMA 3F5XB 2EJ9A 2WACA 2QA4T 4QW2A 4BCHB 4M77C 4DEYA 2LJ1A 1Y71A 1FMVA 3CCLT 1MHNA 5FRNA 4EMHA 2O88A 3ASKA 1GBQA 1VQMA 1MV3A 4XTVA 4DQ2A 1KG1A 1OL2B 3BG5A 4F7JB 1VA7A 3NFCA 2OI3A 4M7AF 3M0UA 2NUZA 3JB9J 3TNWB 1Z9QA 5DQWA 2ZPIB 1M90U 1SEMA 1KQ2A 2ZZDB 1AWJA 1RI9A 1W1FA 2L2PA 3MJXA 3CCVA 5EJCA 1WZOA 1VQKT 1NZ9A 1WPYA 1Q81C 3A98A 1VQ6T 3TNHB 2K5IA 2E64A 5GAOr 2GGRA 3QHSA 3M4GA 5HY6A 5IXFA 3MI9B 1KQSP 3X28B 1H4LD 2VGNA 4EC8B 4C5IA 3G71A 2DFUA 2JGZB 4HVWA 3META 2JOYA 1BU2A 5I11A 4ORZA 4JPBW 2SEMA 1GBRA 1GUXB 3OY9A 1YJ9T 1KHIA 3ZBDA 2GFUA 2K9GA 3VS3A 2L8DA 5L23A 1X75C 4AFZC 1Q95G 2RM4A 3FJ5A 2RN8A 1LOJA 4EOOB 4MIMA 4XAXB 1YI2Q 5FU7C 4YOSA 4OMFB 3CCJA 2K6DA 3M0QA 5KYNA 3OYDA 1Z9ZA 1N5ZA 3I35A 1O9KB 2HBWA 3BLQB 3OMCA 1VQ4A 1T3SA 3LH5A 4LDYA 4OMOA 1PCXA 4ROEA 3CCVQ 2WEVB 1D1AA 2MK5A 1WHGA 2CP5A 4RG8A 2BZ8A 3L1AA 1GRIA 3GTMS 2DIGA 1VYTA 1A0NB 1W2BP 4M78F 1S72Q 3CC4T 2EGAA 1VIEA 2YT6A 2LQWA 2KDSA 5IXBA 1YITT 1UHFA 1W98B 1NEBA 3VS7A 2YSQA 1ENWA 3CMEQ 3QPHA 1LNXA 4JX5A 2E5QA 1QKXA 2K3BA 3HRSA 3L2QA 1AWWA 2DD4B 3LH0A 1IHWA 2RB6A 1YITQ 2RQWA 3JCMg 1HXDA 1PRLC 4A53A 3L2UA 1PRMC 1VQ9Q 2LQ8A 1D0YA 1K73C 1YI2A 2BS2A 1OZ2A 2JVVA 4B9WA 4BDZA 1G3YA 3FC3A 2RQVA 2BPMB 3SD4A 4BE0A 1YHQA 4PLLA 2LX7A 1NG2A 1D1BA 2YRVA 1WLPB 2EJFA 1VYVA 4N4HA 1BCMA 1ZUUA 4AKGA 4RTVA 3MHXA 1VQPA 3ZFJA 2ZPFB 5KYUA 2B8AA 3JCMh 1Q81R 4QQGA 3LX7A 3M0SA 1QVGS 5HBHB 4FCYA 2A08A 2RMOA 3OYGA 4FX3B 1OIYB 4AI6A 1AT1B 1TWBA 2DVEA 1VQ4T 5LJ5d 1U3OA 1S72A 2F2WA 1K0SA 1QVFP 1LJOA 3E9FA 1UNLD 4F7UA 1TS9A 1HYOA 3DL1A 1Q82U 4XU3A 2BTTA 3EGDA 3DB3A 4FYWB 4K11A 1UTIA 2CP0A 1B34B 2D6FA 2FG0A 3VUBA 3CXCP 2DTOA 1H92A 3MIAB 4NS5A 1M2VA 2KMTA 2KRNA 5GAMd 3VRZA 4BXXX 5KYYA 2XI9A 4M7DD 2ECZA 1WJQA 5I21A 1U5SA 4RCCA 2KE9A 4NC6A 1VQLA 2ZPBB 4M7AC 1FYNA 2OAUA 3PFSA 4KRTA 2K2VA 2PTKA 1M1KR 3MP6A 1X6OA 1QCOA 4NL2A 2GNCA 2G6FX 2BS4A 3A8OB 3EH2A 5KCOA 5GANe 2JW4A 2X3XD 2JM8A 1UECA 4O5VA 4C92D 3JCMW 1WXTA 1T0JA 4C0ZA 2V8JA 4PFPA 2YLCA 3PIPA 3OW2P 2X3WD 1YBYA 2DL8A 3ZL7C 1SRLA 3H4CA 1BKBA 1TSFA 1WHKA 4EOMB 4IUQA 2DZ9A 4E7KA 1VIFA 1X01A 3VS2A 1X6BA 1N6AA 4QVCA 2DILA 4AG2C 5DY9A 3SDZA 2C5XB 5HNBB 3CC2A 4BCNB 1MV0B 2DEQA 4JZ4A 2QI2A 2XK0A 4ELJA 2WMAB 3CQTA 5KH6A 2KK4A 4XTYA 3RKWA 2PHGA 5FU6B 2UZBB 1RI0A 4ZTJA 1BIAA 4OMPA 4M75G 1DJ7B 5I22A 5GAN8 1JO8A 2RJFA 1OV3A 5IDNB 1M2VB 5IN1A 2R7GA 1PHTA 4AFSC 4EMKB 1N27A 5HKCA 4PJOB 3SWNA 3OYIA 4M75E 2LNHB 2ZPEB 1R77A 3CCSQ 1UGVA 2L3SA 1R8OB 3C4SA 2E6ZA 4DBQA 3QWLA 1ZUKA 4FM4B 5GAN4 1JBMA 2D8JA 1MNEA 3BW1A 4Y92A 3CCMT 2NUPB 4F6UB 1VQ8Q 4LUDA 1I4K1 3NTIA 4E7HA 3EG0A 5EFQB 1VQNA 4EMGA 4CFWB 2V8IA 2L3RA 2LRQA 4UC4A 5GAN3 4NSTB 1WJRA 2LVMA 2K7AA 4OMQA 1C6VX 4KGZB 4M78E 1OI9B 2LCCA 2CP6A 5IHYA 1OULA 3KUFA 2YUQA 4C0DC 3MKDA 2XU8A 4JJBA 5J39A 2J6KA 4LE9A 4C8QA 4M75D 1ZLMA 3CCQA 5GMKe 2H3EB 3KFVA 1VOMA 2OTLQ 2PVOB 4DA4A 2E70A 4OMMA 1O9SA 2D0QB 3C94A 4JS5A 3H8ZA 4OB2B 2CUBA 4RODA 4J9IA 1PKTA 1WIEA 2EGEA 2FVUA 3G71T 2NUTB 1JB0E 1BB9A 5CQXA 4J8OA 4NOYA 1I07A 4CRIA 3CCET 4BCND 1PWTA 4BI3A 1AVZC 1NYGA 3CPWP 4C5GA 4QVZA 1UGRB 1YJ9A 4KRCB 4JRKA 3VUZA 2GQVA 1QP3A 2KRMA 2DF6A 2DE0X 2LZ6B 3VYGB 3VRYA 2OTLT 4M7AD 1Q7YU 1AD6A 5AT1B 2O01E 2COWA 3I56T 3URGA 1M5Q1 2EPDA 2RF0A 4QKUA 1NM7A 3M54A 1JRIA 1V29B 3SB2A 1RAHB 4M75F 1Q86U 1Y96B 3CCUQ 1R0CB 2Z0WA 2W99A 1MMAA 4ZNXA 3OBYA 2PUOB 4BCMB 4EDUA 1QCNA 5DLOA 2B9RA 2IPOB 2CUDA 3QZ5B 2EFIA 3CCMQ 1JSUB 1WX6A 2EYWA 2DAQA 1JOWA 2F5KA 4BY6C 2KT8A 5HCKA 2FHDA 2UZLB 4J9FA 1IGQA 2SRCA 4J7FA 4XTZA 2D1XA 2E3HA 2P84A 2XKOC 1H3HA 3DDPB 1Y7XA 2CKKA 3QYBA 2LJ3A 5KYWA 4HVUA 3C0CA 5CKBA 3DB4A 1TFBA 2DXBB 2DL5A 4PJOC 3BG9A 3J80E 5GAMg 3LGLA 1HSQA 2MI6A 2ROLA 2KROA 2CSQA 2AK5A 2P4TA 2RA2A 4IUPA 2DMOA 3EG2A 5LJ3g 2CP7A 2DD5B 1K73U 1YN8A 4DBFA 1N9RA 3T9NA 1B07A 2YWWA 5LMKB 2XD0A 1IGUA 2VASA 2QASA 3EIDB 4FU6A 2A0FB 2O4XB 4FSXA 2ENMA 1VQ9T 1GY3B 3JCMJ 3MY1B 4BDYA 3V7SA 4CFUD 4AG1C 4BCIB 3TU4K 3M4YA 5M9OA 2PQWA 4JUVA 4OVAA 3BHVB 2FPFA 2OTJA 3I56Q 1FMKA 3REAB 1G83A 5GAMe 3JB9G 1VQ5Q 2W9FA 2L3PA 5GANf 1ZSGA 3M56A 1VQ9A 4M78B 2IW6B 1ZSZC 1YIJA 3N5BB 2ABLA 5I2MA 3THKA 2DA9A 1WHMA 2DRMA 4IUUA 4PJJA 1KQSA 2I2LA 2DK3A 4PFOA 3BE3A 5CQYA 5CKEA 4E2FB 4ELYC 1IXDA 1QMZB 3H9NA 3E2UA 4Q5WA 2VB6A 3EFOB 2KYMA 4IIMA 1H28B 4B6MA 1YJWA 5KYYB 2KVQG 2C6TB 3UDCA 1VQ5T 3CMAA 2C06A 3G71Q 2K4YA 2J6OA 4EORB 4KGVB 3U23A 2LW4A 4FL6A 1YNZA 1V76A 4ANJA 1MUZA 1TH7A 1TUGB 4QVDA 1XNIA 1D3BB 3S6WA 5GAN2 5CR2A 3EFSA 2M02A 4IURA 2RPNA 2OJ2A 2DO3A 2K79A 2VXFA 1N8RR 1W70A 1VINA 2OTJQ 3SWNC 1V1CA 2DIQA 2DKGA 2K3YA 5GJVB 5CAIA 4C92A 2G77A 2ZAEA 4J9BA 1JXOA 1ABQA 4GBQA 5GAOp 4Z88A 3IQLA 3H0HA 2HKQB 1EZZB 2LC4A 4XTXA 1B7TA 1I81A 2E41A 1VQOQ 3ULRB 3A8MB 2VWFA 4Z6YA 4M77G 4JX4A 1MGQA 2EQMA 2EYZA 4M78C 4KULA 1WA7A 2HL5C 1UGPB 4CC4B 2QDJA 1B3QA 4WCIA 2JM9A 3OS1A 3G6ET 4E7LA 2VYTA 1K9MR 1UEBA 2IW9B 3LWIA 1OU8A 1QWEA 3OS5A 2JMCA 3RKYA 5LJ5h 3JB9H 4PK4A 4BE1A 4D8DA 1YFNA 2DBKA 4LOCA 3INZA 4WTOB 2EYXA 4E7IA 5CCAA 5GAMh 2CSIA 2GF7A 5AYFA 2M1HA 4TVRA 1H1RB 1GCQA 4HXJA 3CCMA 4F7UF 1T0HA 4BD3A 5GANj 4GY5A 4ZGDB 5ICPB 2KSSA 3MP1A 5DLQE 1NPPA 1KSWA 3MEWA 1M9SA 1LPLA 2HKNA 4J6WA 2W96A 2L0AA 3EG9B 5GMKh 1RABB 1KQSS 5GANh 4E6RA 1VQLQ 2EIFA 3OYNA 1UHCA 2ZPHB 2VKNA 3HBLA 3NHNA 1I8FA 5HBJB 1RADB 3OS2A 1NJIC 3CCSA 1SPKA 3JCMQ 5KCHA 2P0PA 1PC0A 1BK2A 3GPLA 4C8QD 4F14A 2X51A 2XHCA 3I5SA 4HCKA 3L2ZA 3CEYA 1WGSA 2KNBB 2OX7A 3QUIA 2CZ7B 1SG5A 4BCQD 4J6YA 2C5OB 3M55A 4PJOF 2K3XA 4RMOA 4BE2A 1VQNQ 4PJNA 2E5KA 4LUEA 3MCAB 4A54A 2WSFE 1M1KU 2KXDA 3M0PA 4C5HA 2FZGB 2LQNA 3PMIA 3PTAA 4BY6B 5CYIB 2CS7A 2O31A 3VS0A 4F6SB 2C0OA 4HL4A 5IHKA 2G9XB 2IIMA 1BU1A 1KD1U 1G3TA 4PJOA 4M77A 1M3BA 4OP0A 1AHJB 3V8JA 4OF1A 1X43A 2HNIA 4M7DE 2KGTA 1WQ7A 3CCQT 3I55T 4M77B 3OYEA 3RIRA 4KBMB 2UZDB 1B34A 5GMKi 4IUVA 1QLYA 4MZTA 1CSKA 1KC8U 3HRTA 1VQMQ 4C92G 4KUDK 1M90R 3AHUA 2KEAA 5HBEB 2IN3A 1BBZA 2JN0A 3VS6A 3L2RA 3EFRA 4QT7A 1RAFB 1X6GA 1YP5A 1Q86C 1OOTA 2V26A 2QA4Q 1O75A 3CXCS 2JT4A 1ZQ1A 4MZPA 2OTJT 1OGUB 3M03A 2D9TA 4MZMA 2QK0A 2X4YA 2DL4A 2UUEB 4FW1A 4OR5B 4HT8A 1QVPA 2DLPA 2BS3A 2WFYB 2J06A 1QQJA 2HQXA 5FWBA 3JCMV 4HLQA 4NL3A 3VS4A 4C92C 5KYXB 1TUDA 2L89A 4F16A 3SFMA 1AZEA 1N4MA 5GAOl 1TG0A 1VQ6A 1VQPT 3EG3A 4CC3A 1VQKA 4D6WA 2XG8D 4M7AE 4R56A 5CEIB 4MDXA 4C8QC 2RH2A 2BZXA 4CC2A
chains in the Genus database with same CATH topology
2EQJA 1VQNA 4EMGA 3M59A 2NLUA 2V8IA 2L3RA 2LRQA 5A0GA 4ZTFA 1YIJT 5GANd 3L2WA 4EMKC 4UC4A 5GAN3 4BACA 1ZBXA 2M9UA 1WJRA 1VQ8T 2LVMA 2Y90A 3OSSC 4KT0E 4M77F 3CBOA 3JCMe 4J5YA 4M78E 5CIUA 2DZCA 5A0DA 2LCCA 1JJ2S 2E65A 3DKMA 4LDXA 3X26B 3V8KA 3BY7A 3HFOA 3KUFA 4IUTA 4C0DC 5LJ5j 2XU8A 1KQ1A 5A2QE 3P8DA 2DPPB 2CYZB 2EJGA 4P5NA 4C8QA 4HNUA 5J39A 5GANg 3CCVT 4M75D 2E10A 3GOXA 3CCQA 3S3NA 5GMKe 3A8LB 5CO7A 2PVOB 5CAIA 4LDUA 4DA4A 2E70A 2LDMA 2RI2A 4HCZA 3J81E 3HKSA 1O9SA 2XIDA 2D0QB 3C94A 3JCMc 4JS5A 1NPRA 3H8ZA 4C92B 4II1A 4OB2B 4PKCC 4M7DA 3TW6A 1W2BS 3WVEB 3NTKA 2FL7A 3VYGA 4PNOA 2FVUA 4M6VA 1K8AU 2KQWA 3G71T 1M90C 3Q1JA 1JB0E 5CQXA 2EWNA 3CBMA 2LTOA 4J8OA 4M77E 4NOYA 4OGEA 3FRNA 2QXFA 4FT2A 4DOWA 3JCMd 4HCBA 4CRIA 3CCET 3A5ZB 4EMKA 4BI3A 4FIBA 3S3MA 4QQ6A 3CCUA 3VU3C 4BI4A 4MDWA 4C5GA 4QVZA 1UGRB 2Y4YA 2RK2A 3JAME 3X20B 2K5FA 1YJ9A 5HK0A 3VKIA 2VC8A 2MMPA 4M7DG 4JRKA 3VUZA 2GQVA 2EAYA 1BI0A 4M7DF 1QP3A 3DLMA 2OTLA 5GAN6 3CCRT 3VYGB 2OTLT 4M7AD 3RUXA 1Q7YU 1BI2A 4HKEA 3A8HB 4HNVA 2O01E 3HSBA 1YITA 4M7DB 2DTIA 4C92E 4PJOG 2XDPA 3I56T 3URGA 1M5Q1 1UB4A 2R5AA 3OA6A 2DXTA 1BIBA 3JCMf 3OW2S 4XK8E 2RHYA 3M54A 5I2SA 1Q7YC 1JRIA 2XDBA 2DD4A 1V29B 4MMKA 3SB2A 1Q86U 4M75F 4IKFA 4HA8A 3X24B 1Y96B 3G4SA 5FU6C 5D6XA 3C12A 4C92F 1D3BA 1PSFA 3UWNA 4V2SA 4GLKA 3GP8A 3OBYA 3SWNB 1NJIU 2PUOB 2MAMA 2YLBA 4EDUA 1KC8C 1K9MC 4A4GA 3HZJA 5DLOA 2HAXA 4JJNK 4M7DC 4F7UE 3QZ9B 4LDVA 3QZ5B 3GF5A 2EFIA 3OB9A 1K8AC 2BUDA 2HD0A 5GAMf 2CGHA 2EQKA 2F5KA 2DAQA 2A3LA 4BY6C 1XQHA 1HK9A 1YHQT 1KHCA 1M1GA 2E12A 3RMSA 4ME7A 5J26A 4M7AB 2FHDA 4DOVA 1VQ8A 1RL2A 2R57A 3QYHB 3OMGA 4J7IA 5GAMj 4O6JA 3E9GA 4JRPA 4J7FA 4XTZA 3OYBA 1VQNT 3JB9F 2XKOC 2Y4XA 3OYKA 1UGSB 1Y7XA 2CKKA 3G7ZA 3HHTB 3QYBA 5GAOn 5CKBA 3DB4A 3FIFA 4A4FA 2DXBB 1M4ZA 4PJOC 4C8QB 3BG9A 5A0LA 5GAMg 3J80E 2V8KA 2CZ0B 1G3WA 2JUFA 2MI6A 3ER0A 3HP9A 2RI5A 3LGLA 2DXUA 2P4TA 2RA2A 2QF7A 3TCJA 3QJ6A 5KE2A 1N8RC 4WF2A 5LJ5e 5GMKm 3HO8A 1M8VA 4IUPA 2K57A 2IG0A 3OQ5A 3RESA 4N0AC 5LJ3g 3HL8A 3M57A 2FYKA 2DD5B 4PL6A 5GMKj 1S72T 1K73U 3LLRA 1N9RA 3T9NA 4JRQA 2EJ9A 5FRMA 2WACA 1BI1A 2QA4T 4QW2A 4M77C 3CCLA 1Y71A 3I55A 3M53A 2XD0A 2HBPA 4M75B 3HB9A 4M78G 3CCLT 4YTLA 3GIBA 2QQSA 4AKIA 1MHNA 1OZ3A 2ZZDA 4EMHA 2QQ9A 4FU6A 5FRNA 3QSUA 4J83A 3ASKA 3JCMb 1VQOA 2A7YA 2O4XB 4FSXA 3P8HA 1VQ9T 2WSCE 2QDYB 4PLIA 4XTVA 4DQ2A 1VQMA 3BG5A 1VQMT 1KG1A 3NFCA 3JCMJ 3GLXA 3CCEA 2RHZA 4M7AF 4BDYA 2M16A 3V7SA 2QQRA 1SSFA 3MEAA 4M75C 3JB9J 4HCCA 4ZGJB 3TU4K 1OI1A 2O4XA 4MMLA 2ZPIB 2QQBA 1M90U 3M4YA 2QA4A 5M9OA 2PQWA 2GFAA 4LD6A 2ZZDB 1KQ2A 4JUVA 4OVAA 2OTJA 4A4HA 3BFMA 4X34A 3OYLA 3TW7A 3CCRA 3CCVA 5EJCA 1OYXA 3KXTA 1VQKT 5GAMe 1NZ9A 3JB9G 1WPYA 5FU7B 1Q81C 4BBRM 1YI2T 1VQ6T 5GANf 3PIOA 2K5IA 2E64A 5GAOr 3M56A 2L5QA 1VQ9A 4M78B 3QHSA 3M4GA 2LT4A 1YIJA 3N5BB 5HY6A 1WNLA 2KAFA 2KY9A 4EPCA 5I2MA 4RG2A 3X28B 1GXIE 1XTDA 2VGNA 3JRZA 1N8RU 3FEOA 1ZHIA 4C5IA 3G71A 4IUUA 2DXBA 3M5AA 2K5LA 1KQSA 3VJPA 3META 2JOYA 2I2LA 4FT4A 4Z02A 3CCJT 1QP2A 3J7AF 2DK3A 4ELZC 5CQYA 1XOVA 5CKEA 4ELYC 1I5LA 5IT9E 3OY9A 1YJ9T 2VXEA 1KHIA 4Q5WA 3ZBDA 2GFUA 4L59A 4OGCA 4L6V5 3MEVA 5CKDA 5LJ5g 4M7AA 2L8DA 3HPWA 1X75C 3X25B 2F5TX 2IVWA 2RM4A 4A4KA 1YJWA 2RJCA 3E1SA 2ZPGB 3CD6A 1LOJA 3QXEB 4MIMA 4XAXB 2QEXT 2KVQG 5FU7C 2JNGA 3UDCA 2QEXA 3CBPA 3CMAA 1VQ5T 2C06A 4OMFB 3CCJA 3CCST 4F7UG 2X35A 3OYDA 2K4YA 5CKFA 1FXXA 4FL6A 4LD9K 3QJYA 1YJNA 2R58A 4ZN3A 1TH7A 2RD1A 1Y96A 4QVDA 3CC4A 3OMCA 1XNIA 1D3BB 3S6WA 1VQ4A 5GAN2 3S3OA 1VQ7A 5CR2A 3EFSA 4PJOD 4M77D 4IURA 4JRIA 2LNVA 2DO3A 2VXFA 4C5EA 4LDYA 1EIFA 3CPWS 2VUBA 3SWNC 2DIQA 3V7CA 2DKGA 2K3YA 2PU9B 2PUKB 4JDSA 4LDWA 4Y91A 4C92A 3O8VA 4A4EA 5FLXE 2G77A 1BI3A 4RG8A 5EG2A 3L1AA 5GAOp 3MEUA 4Y28E 2MWPA 2CZ1B 3RMQA 1YJWT 4B9XA 2EKOA 1G3SA 1QVFS 2LC4A 3M9QA 2DIGA 4XTXA 3C95A 5LJ3d 1I81A 3M58A 3QIIA 2E41A 4M78F 3CC4T 3WXMB 3CPWA 1VIEA 3TEEA 2KDSA 1YITT 3A8MB 4ZGEB 2VGMA 4JS4A 3OW2A 3BDUA 4M77G 4Z6YA 1U1TA 4JX4A 1MGQA 2EQMA 4JLIA 2RJDA 4M78C 4KULA 4BI8B 5GMKl 4N4GA 1UGPB 2AHJB 4OB3B 3ZEHA 1YCYA 1N9SA 2QDJA 2E1HA 3CPFA 4XU2A 1NE8A 3QPHA 1LNXA 4JX5A 5HK3A 3GNFB 4XU0A 2E5QA 3JCMh 3HRSA 3OS1A 1M1FA 4F7UB 3L2QA 3G6ET 2DD4B 2X4JA 2RHUA 1P92A 3LH0A 2QTXA 4ZN1A 5C6SA 4E7LA 2RB6A 3CXCA 3CC7A 2VYTA 3JCMg 1UEBA 1HXDA 4A53A 1IZ6A 4C8QG 3OYJA 3LWIA 3L2UA 2E6NA 2LQ8A 3OS5A 1BYMA 3LW5E 4PJOE 1K73C 1YI2A 3RKYA 2BS2A 1OZ2A 2JVVA 4B9WA 5LJ5h 3OYFA 4BDZA 4CI0C 1G3YA 3DLLA 4KUIA 2JZ2A 3FC3A 3CD6T 3JB9H 4BE1A 3TREA 3SD4A 4BE0A 1YHQA 4PLLA 4LOCA 3NTHA 3INZA 4C8QE 5LJ3f 4E7IA 2CZ6B 5CK9A 5CCAA 4MFDA 5GAMh 2X4WA 2GF7A 2YRVA 2EJFA 5AYFA 3FDRA 4N4HA 2H3JA 2M1HA 2RO0A 4M78A 4TVRA 3UT1A 1M1KC 2JTMA 3CC7T 4AKGA 3H6ZA 3MHXA 3CCMA 1WJSA 2KR6A 2RJEA 2WSEE 3R6OA 1VQPA 3ZFJA 1E7PA 4F7UF 3L2VA 2DXCA 3BDLA 2ZPFB 4BD3A 5GANj 4GY5A 4ZGDB 2B8AA 2KSSA 3MP1A 3QYGB 4RKUE 2HQEA 3LX7A 4QQGA 3MO8A 3PT9A 1NPPA 3MEWA 5DLQE 3OYAA 3FJPA 1QVGS 1H3ZA 4JLGA 3OYGA 1M9SA 4HT9A 4AI6A 3QG1A 5GAOq 1FKMA 1Q81U 1Y07A 4BUGA 2DVEA 4J6WA 1VQ4T 2PVDB 5LJ5d 1S72A 5DM7R 5GMKh 1KQSS 3JCMP 3JCMX 3F70A 5GANh 1LJOA 2EIFA 3E9FA 4F7UA 3OYNA 1K9MU 4M7AG 1IREB 2ZPHB 4X9CA 3HBLA 3OS2A 1I8FA 3DL1A 1Q82U 1NJIC 4C0DB 4XU3A 3CCSA 3JCMQ 3DB3A 5KCHA 2LT1A 2P0PA 4C0FA 3GPLA 4C8QD 1B34B 2D6FA 4M75A 2XHCA 2MWOA 3VUBA 3CMEA 4OB0B 4MFEA 3VKGA 2DTOA 3GNGA 5LJ3e 3VYHB 2XICA 3L2ZA 3CEYA 1WGSA 4NS5A 2BIVA 5LL6S 2KMTA 4VUBA 4XQ3A 5GAMd 3QUIA 2QQ8A 2CZ7B 3CMET 1H641 2LQKA 2XI9A 4M7DD 4J6YA 4L5GA 3M55A 4PJOF 2K3XA 4E47A 2RI3A 4RMOA 4HNTA 4BE2A 1WJQA 1WQWA 3MCAB 2EQUA 5I21A 4RCCA 4A54A 2WSFE 2R5MA 4BBSM 1M1KU 4NC6A 4XTWA 1VQLA 2PVGB 2ZPBB 3VV0A 2LX9A 5CVIA 2OAUA 2VV5A 4C5HA 4M7AC 3PFSA 3P8BB 2K2VA 4PJOB 3PMIA 1FX7A 2RHXA 3PTAA 4BY6B 5GAOm 4J6XA 2CS7A 3G6EA 3PMTA 3QYEA 3MP6A 1X6OA 4HL4A 3JSCA 4NL2A 5KE3A 2BS4A 3A8OB 2LCLA 4C0GA 5KCOA 3ME9A 5GANe 1KD1U 2WJ9A 1G3TA 2X4XA 2FB7A 4M77A 3G4ST 4PJOA 1JJ2A 4OP0A 1AHJB 3FB9A 3OBWA 3V8JA 3OYMA 1VQ5A 4O5VA 4C92D 3JCMW 1PSEA 2RHIA 3MP8A 3QBYA 2ZCFB 4OF1A 5C0MA 3QKJA 4XTUA 2HNIA 4M7DE 4QQDA 4C8QF 2P0QA 4E7JA 1WQ7A 3CCQT 4C0ZA 4JX6A 2V8JA 3I55T 4M77B 5LJ3h 2DD5A 3JB9I 3OYEA 2EYQA 2YLCA 4KBMB 3RIRA 3PIPA 3WVDB 1KD1C 1B34A 5GMKi 1VQ7T 1YBYA 1QW1A 4IUVA 4MZTA 2RK1A 1U1SA 2XDDA 3HRTA 1KC8U 2M0OA 3PNWC 3H4CA 1BKBA 2JTFA 3HRUA 4C92G 4KUDK 3CMAT 4IUQA 4E7KA 2DZ9A 3AHUA 5LJ5f 1W2BA 3CC2T 1VIFA 1X01A 2YHTA 4X9DA 3RERA 3V7RA 2JN0A 3L2RA 1N6AA 2MF2A 2P0KA 1QVFA 5IAYA 5LJ3j 4QVCA 3EFRA 1VQOT 5DY9A 3SDZA 1U8RA 3OS0A 3OYHA 1Q86C 3CC2A 1UGQB 2DEQA 1O75A 3LWHA 3CXCS 2QI2A 2XK0A 4ELJA 3KHIA 1ZQ1A 5L8RE 5KH6A 4MZPA 5GAN7 3I56A 2G3RA 2OTJT 5D6WA 4AKHA 2KK4A 3HFNA 4XTYA 2D9TA 3LGFA 4MZMA 3RKWA 2X4YA 3OSVA 5FU6B 1VUBA 1RI0A 4ZTJA 1BIAA 2DXCB 3V8LA 4HT8A 1QVPA 1DJ7B 4M75G 5GAN8 4XU1A 2RJFA 3OYYA 4OB1B 2BS3A 5GAN5 2DJZA 2HQXA 3JCMV 5IN1A 4HLQA 4NL3A 4EMKB 4C92C 1N27A 5CKHA 5HKCA 2L89A 2QFZA 3BG3A 4QSHA 4RCBA 3RKXA 3E19A 3EAEA 3SWNA 3OYIA 1YJNT 2KMGA 4M75E 1Q82C 3SFMA 2ZPEB 1W4SA 5GAOl 2ZGWA 2F69A 3UPUA 1R8OB 3C4SA 2E6ZA 4ATOA 2GCXA 3QWLA 1QLBA 3QO3A 4FM4B 4M78D 5GAN4 1G5VA 1JBMA 5D6YA 3PGGA 1VQLT 3KBGA 3JB9D 1QVGA 3BW1A 3CCUT 1FWZA 1VQ6A 3CCMT 1VQPT 2DTHA 3FLGA 3LYIA 4N0AA 4R55A 3L42A 3A8GB 1VQKA 4D6WA 3QDRB 2XG8D 5FROA 5J3BA 4M7AE 1I4K1 4BB7A 3NTIA 4R56A 2QQAA 4MDXA 2BKDN 4N4IA 2RH2A 4C8QC 3VKHA 4E7HA 3OYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ7 B;  2DXB B;  2CZ0 B;  2PU9 B;  2PUK B;  4KT0 E;  4Y28 E;  2CZ1 B;  2WSF E;  3X26 B;  2DD5 B;  2ZPB B;  2PVG B;  2DPP B;  2CYZ B;  3A8L B;  2PVO B;  2ZZD A;  4ZGE B;  3A8M B;  3A8O B;  2D0Q B;  4OB2 B;  2QDY B;  2WSC E;  1AHJ B;  3WVE B;  1UGP B;  2AHJ B;  4OB3 B;  3VYG A;  1PSE A;  2ZCF B;  1JB0 E;  4ZGJ B;  2DD4 B;  2DD5 A;  2ZPI B;  3WVD B;  2ZZD B;  1UGR B;  3X20 B;  3LW5 E;  1QP3 A;  3VYG B;  3A8H B;  2O01 E;  1UGQ B;  2CZ6 B;  3X28 B;  1GXI E;  5L8R E;  2DXB A;  4XK8 E;  2DD4 A;  1V29 B;  2DXC B;  2WSE E;  1QP2 A;  3X24 B;  1DJ7 B;  2DXC A;  2ZPF B;  4OB1 B;  4ZGD B;  4RKU E;  3QYG B;  1PSF A;  4L6V 5;  2PUO B;  3X25 B;  3QZ9 B;  2ZPE B;  3QZ5 B;  2PVD B;  2ZPG B;  3QXE B;  1IRE B;  2ZPH B;  4FM4 B;  3QYH B;  3A8G B;  4OB0 B;  1UGS B;  3VYH B;  3HHT B; 
#chains in the Genus database with same CATH topology
 2EQJ A;  4A63 B;  5GAN d;  4CFU B;  4BAC A;  1ZBX A;  3OSS C;  2COZ A;  4J5Y A;  2DZC A;  2E65 A;  1BCO A;  4RTW A;  1QVG P;  3DKM A;  3V8K A;  4EOP B;  2PNI A;  2MOX A;  5A2Q E;  1C9B A;  4HNU A;  5GAN g;  2E10 A;  3A8L B;  2KRS A;  5CO7 A;  1QKW A;  1E6H A;  4HCZ A;  3J81 E;  3JCM c;  1NPR A;  1OPK A;  1RAC B;  2MYS A;  2FL7 A;  1FIN B;  2F2C A;  2KQW A;  3Q1J A;  3CBM A;  2AIR B;  4OGE A;  4FT2 A;  2DM1 A;  1GCP A;  2PJQ A;  3S3M A;  3CCU A;  1OX8 A;  4MDW A;  2Y4Y A;  2GBQ A;  6AT1 B;  4G6L B;  5HK0 A;  3VKI A;  2VC8 A;  2MMP A;  2CCI B;  1BI0 A;  3POM A;  3GBQ A;  2OTL A;  5GAN 6;  3CCR T;  3RUX A;  2E3I A;  1BI2 A;  3HSB A;  4M7D B;  1YIT A;  2HL3 A;  2XDP A;  2NUP A;  1ZP2 A;  3OA6 A;  1YIJ Q;  3B57 A;  1MMG A;  1BIB A;  4M4Z A;  3OW2 S;  1Q7Y C;  2XDB A;  1WXU A;  2DD4 A;  4MMK A;  2HSE B;  1FVV B;  4AMC A;  3CCE Q;  4C92 F;  3VS5 A;  3UWN A;  4GLK A;  2AT1 B;  1H24 B;  3GP8 A;  1K9M C;  4A4G A;  1OL1 B;  4LDV A;  1VQP Q;  5GAM f;  2EQK A;  1M1G A;  3RMS A;  4DOV A;  4M7A B;  4DEX A;  1RL2 A;  5GAM j;  2NYS A;  4O6J A;  1UNG D;  4BCQ B;  1RAI B;  3OYB A;  1VQN T;  3JB9 F;  2Y4X A;  1OQK A;  4GLM A;  3G7Z A;  1K0X A;  2A36 A;  4EOS B;  5GAO n;  2O2O A;  1Y57 A;  1KJW A;  3FIF A;  1M4Z A;  5A0L A;  2CZ0 B;  1MND A;  2QF7 A;  3TCJ A;  3QJ6 A;  4WF2 A;  5LJ5 e;  1M8V A;  3H0I A;  3OQ5 A;  4FYV B;  3M57 A;  5GMK j;  1S72 T;  4RTU A;  4JJD A;  4JRQ A;  2IW8 B;  1BI1 A;  1ABO A;  1URC B;  1M30 A;  3I55 A;  1FMW A;  3M53 A;  4M75 B;  3HB9 A;  2HCK A;  2QQS A;  4AKI A;  1Y0M A;  1OZ3 A;  4PFZ A;  1AOJ A;  4CFX B;  1TTH B;  1VQO A;  3P8H A;  2WSC E;  4PLI A;  2YUO A;  1VQM T;  2WIH B;  3AT1 B;  3GLX A;  3CCE A;  2RHZ A;  2QQR A;  1SSF A;  4HCC A;  4EOI B;  4ZGJ B;  4KGX B;  1OI1 A;  4ELL A;  1RUW A;  1YJ9 Q;  4MML A;  2QQB A;  2QA4 A;  1U06 A;  2GFA A;  4A4H A;  4X34 A;  4F70 B;  1OYX A;  4FYY B;  4BBR M;  1YI2 T;  3PIO A;  4RUG A;  2L5Q A;  2LT4 A;  2KAF A;  2KY9 A;  4EPC A;  2BKZ B;  1XTD A;  1SHG A;  2C0I A;  2AZV A;  3NGP A;  1ZHI A;  1HJD A;  2K5L A;  3EGX B;  4FT4 A;  3J7A F;  3CCJ T;  1QP2 A;  1YWP A;  1SSH A;  1F5Q B;  4ELZ C;  1KD1 R;  1XOV A;  3EG9 A;  1VOL A;  1I5L A;  1WXB A;  2VXE A;  3RBB B;  2WXV B;  1WI7 A;  4OGC A;  3RR6 A;  4L6V 5;  1XO2 A;  5LJ5 g;  4M7A A;  3HPW A;  2F5T X;  2COY A;  4EIK A;  3QXE B;  2HEQ A;  2QEX T;  2QEX A;  1RLP C;  4F7U G;  1K8A R;  2X35 A;  2UZE B;  1FXX A;  5CKF A;  2J6F A;  4LD9 K;  4Y72 B;  3QJY A;  2R58 A;  1ACM B;  2RD1 A;  4RTZ A;  2YXY A;  1SRM A;  3S3O A;  1VQ7 A;  4BCF B;  2LNV A;  3CPW S;  1EIF A;  2VUB A;  1PG5 B;  1C0M A;  3V7C A;  5HVY B;  4JDS A;  4Y91 A;  2WHB B;  2QAZ A;  2M0Y A;  4EOQ B;  3M0R A;  5EG2 A;  2CZ1 B;  3CD6 Q;  3CCL Q;  4B9X A;  1G3S A;  1QVF S;  2LMJ A;  4CFN B;  2PMI B;  5LJ3 d;  1AD5 A;  3WXM B;  3TEE A;  2HDA A;  4E7S A;  2VGM A;  4JS4 A;  3PVL A;  1U1T A;  1ZBJ A;  4BI8 B;  4JLI A;  3G33 B;  4Z8A A;  4N4G A;  2AHJ B;  3ZEH A;  1YCY A;  1N9S A;  4BCG B;  2E1H A;  3CPF A;  1NE8 A;  1D3U B;  5HK3 A;  3BHT B;  4XU0 A;  2D8H A;  1M1F A;  1P92 A;  2QTX A;  3EFO A;  2DYB A;  3EHR A;  1GCQ C;  1IZ6 A;  4C8Q G;  3OYJ A;  5HQ0 B;  1BYM A;  3LW5 E;  1IHV A;  4PJO E;  2C5V B;  3OYF A;  2JZ2 A;  3CD6 T;  4J9E A;  1NEG A;  5ACB A;  2I40 B;  3NTH A;  4C8Q E;  5LJ3 f;  2CZ6 B;  4X1V A;  4MFD A;  1O9K A;  2YDL A;  1VQ7 Q;  4I3Z B;  2H3J A;  3UT1 A;  4M78 A;  1M1K C;  2JTM A;  3R6O A;  2RJE A;  2WSE E;  3LQ5 B;  1E7P A;  1PD0 A;  2DXC A;  3BDL A;  1OX9 A;  3QYG B;  3JCM f;  1NBE B;  3MO8 A;  3PT9 A;  3OYA A;  1H3Z A;  3MY5 B;  1T3L A;  2HZY A;  4JLG A;  5GAO q;  4BUG A;  1OEB A;  2X1N B;  5L2W B;  3JCM X;  1ARK A;  1X69 A;  5IH2 A;  4E7Z A;  1IRE B;  4C0D B;  5KYX A;  2RQT A;  4C0F A;  1K76 A;  2LJ0 A;  4KH1 B;  2DER A;  5BNJ B;  4M75 A;  4OMN A;  2MWO A;  3CME A;  4OB0 B;  4MFE A;  1CKB A;  3GNG A;  4IMY B;  3VYH B;  2BIV A;  5LL6 S;  1KK7 A;  2CH4 A;  4XQ3 A;  2EVR A;  3CME T;  1H64 1;  2LQK A;  4L5G A;  2E4H A;  4AFU C;  4E47 A;  4HNT A;  1I0C A;  4J9H A;  1K9A A;  1WQW A;  1NLP C;  4PJM A;  2R5M A;  2C4G B;  4XTW A;  2PVG B;  3VV0 A;  2LX9 A;  1OKV B;  1AWX A;  2V1R A;  4J9G A;  1FX7 A;  1SKU B;  3A1P A;  5GAO m;  3G6E A;  3PMT A;  1LVK A;  3QYE A;  2B86 A;  3JSC A;  3ME9 A;  2WJ9 A;  3G4S T;  3DOG B;  4AFQ C;  3FB9 A;  3OYM A;  1YWO A;  2RHI A;  3MP8 A;  4RTT A;  2ZCF B;  3BLH B;  1J3T A;  4XTU A;  1G3N C;  4F7N B;  4QQD A;  2CCH B;  4E7J A;  2P0Q A;  1KIK A;  3JB9 I;  5LJ3 h;  2DD5 A;  2EYQ A;  1GH6 B;  1KD1 C;  3WVD B;  1SF9 A;  1QW1 A;  1JQQ A;  1PNJ A;  2M0O A;  2DL7 A;  3HRU A;  3CMA T;  3REB B;  5LJ5 f;  2YHT A;  2OAW A;  4AT1 B;  3RER A;  3V7R A;  3PVQ A;  2MF2 A;  1QVF A;  5LJ3 j;  1VQO T;  3OS0 A;  3O5Z A;  1JEG A;  3KHI A;  5GAN 7;  5L8R E;  3I56 A;  2G3R A;  4AKH A;  4JZ3 A;  1VQ6 Q;  3HFN A;  3OSV A;  4ESR A;  1VQK Q;  2DXC B;  1RAG B;  2DVJ A;  4DBR A;  4XU1 A;  1UJY A;  4EON B;  2BE9 B;  4EOK B;  5GAN 5;  1RAE B;  2DJZ A;  1KFZ A;  2FO0 A;  8ATC B;  5CKH A;  4QSH A;  3BG3 A;  3RKX A;  2A28 A;  4PJL A;  2F69 A;  3UPU A;  2YRC A;  2F2V A;  4R0K A;  3G1J A;  1E9H B;  2GCX A;  5DQV A;  3QO3 A;  1G5V A;  2BZY A;  2DET A;  3PGG A;  1QVG A;  5I5Z B;  1LCK A;  2FPE A;  2DTH A;  3FLG A;  3A8G B;  5GJW B;  3QDR B;  5KYU B;  1YJW Q;  1D09 B;  4N4I A;  4BCO B;  3OYC A;  1YIJ T;  2NLU A;  4ZTF A;  2X9H A;  3L2W A;  4EMK C;  1VQ8 T;  4KT0 E;  4M77 F;  2JMA A;  2NWM A;  5CIU A;  5A0D A;  1JJ2 S;  2DRK A;  2LP5 A;  4LDX A;  3X26 B;  9ATC B;  1KQ1 A;  3P8D A;  3CC2 Q;  2DPP B;  2CYZ B;  2EJG A;  1JST B;  3GOX A;  4LDU A;  2LDM A;  2RI2 A;  1KXU A;  2XID A;  1ZSZ B;  3I55 Q;  2W2H A;  4M7D A;  1M8M A;  4PKC C;  1W2B S;  3WVE B;  3NTK A;  5LQF B;  2YUN A;  4PNO A;  4EC9 B;  1K8A U;  4M6V A;  1RAA B;  1M90 C;  1H1S B;  2EWN A;  4M77 E;  3JCM d;  4HCB A;  4FIB A;  4CRL B;  2MIO A;  1G8X A;  3VU3 C;  4BI4 A;  2J7I A;  3JAM E;  2RK2 A;  1G2B A;  4M7D F;  3A8H B;  1TU0 B;  2DJQ A;  4HNV A;  2DTI A;  2PZ1 A;  3SEM A;  8AT1 B;  2R5A A;  2DXT A;  3EJ1 B;  2RHY A;  5I2S A;  4HA8 A;  3X24 B;  4YOZ A;  3EGX A;  5FU6 C;  5D6X A;  3C12 A;  3I5R A;  3DTO A;  1PSF A;  4V2S A;  5FW9 A;  3SWN B;  2YLB A;  1UDL A;  1ZA2 B;  3O0G D;  3GF5 A;  3OB9 A;  1K8A C;  3CCR Q;  1QMC A;  1WFW A;  2CGH A;  2NUT A;  1XQH A;  1HK9 A;  1YHQ T;  2E12 A;  2CP3 A;  5J26 A;  2R57 A;  3BLR B;  2KR3 A;  3E9G A;  2AZS A;  2BE7 D;  2GTO A;  2O9S A;  3QHW B;  2HQH A;  4A4F A;  4F6W B;  3QWY A;  4BCP B;  3ER0 A;  2V8K A;  3TVT A;  1P5E B;  4JJC A;  1N8R C;  2QYZ A;  5IHN A;  1Q86 R;  2K57 A;  4N0A C;  1WHH A;  3HL8 A;  4OGR B;  1UJ0 A;  3LLR A;  1HD3 A;  3CCL A;  3GIB A;  2HBP A;  2JS2 A;  4M78 G;  4YTL A;  1K4U S;  1UG1 A;  2EBP A;  2ZZD A;  2QQ9 A;  3QSU A;  3RGF B;  3PO3 S;  2EW3 A;  4J83 A;  3JCM b;  5IHI A;  1TXQ A;  2A7Y A;  3CMA Q;  2QDY B;  3NPF A;  2HSP A;  1YJN Q;  2M16 A;  1QWF A;  4J9C A;  2KT1 A;  3MEA A;  4M75 C;  4Z89 A;  5EC7 A;  1EX4 A;  1ZUY A;  2O4X A;  2FZC B;  2WMB B;  4LD6 A;  1E6G A;  2H8H A;  2C0T A;  3OYL A;  3BFM A;  1MMN A;  3TW7 A;  4FYX B;  3CCR A;  2KBT A;  2V22 B;  3KXT A;  2CDT A;  5FU7 B;  1M2O A;  1KC8 R;  3VS1 A;  1X2Q A;  3HTR A;  1YCS B;  3RDV A;  1WNL A;  4D8K A;  1RLQ C;  4RG2 A;  1GXI E;  2KXC A;  3JRZ A;  1IO6 A;  1N8R U;  3FEO A;  2AKK A;  4RTX A;  1M27 C;  1WDX A;  2DXB A;  3M5A A;  3R6N A;  3VJP A;  4Z02 A;  1GL5 A;  3SHW A;  3TQ7 P;  5IT9 E;  2F1L A;  3NMZ C;  4L59 A;  3DJB A;  3MEV A;  5CKD A;  2WPA B;  3TSW A;  2IVW A;  3X25 B;  4CFV B;  4A4K A;  2A37 A;  2RJC A;  3E1S A;  2ZPG B;  3CD6 A;  4FW2 A;  2JNG A;  2W10 A;  3CBP A;  4CC7 A;  3EOC B;  2JS0 A;  1R0B G;  3CCS T;  1IRX A;  1NLO C;  2DL3 A;  1MMD A;  1SHF A;  2D0N A;  4ZN3 A;  1YJN A;  3TNI B;  1Y96 A;  1EFN A;  3CC4 A;  2F2X A;  3UA7 A;  1JXM A;  1VYW B;  2W9Z A;  1WHL A;  4PJO D;  2FPD A;  4M77 D;  4JRI A;  4LXC A;  1E7O A;  4C5E A;  2PU9 B;  2PUK B;  4LDW A;  2O9V A;  5FLX E;  3O8V A;  4A4E A;  1BI3 A;  2P4R A;  3MEU A;  4Y28 E;  2CH4 W;  2MWP A;  2DYI A;  3RMQ A;  2EKO A;  2VVK A;  4LN2 A;  3M9Q A;  3C95 A;  2QEX Q;  3M58 A;  3EGU A;  3QII A;  4KH0 B;  4F04 B;  3CPW A;  4BCJ B;  1ZA1 B;  1UFF A;  4ZGE B;  1YHQ Q;  3OW2 A;  3BDU A;  7AT1 B;  3G6E Q;  2ED1 A;  1D1C A;  1IB8 A;  5GMK l;  2RJD A;  2JJ9 A;  2EUF A;  4OB3 B;  1NJI R;  1CKA A;  2RQR A;  1XJW B;  4XU2 A;  3GNF B;  1VYU A;  4F7U B;  4ZN1 A;  2X4J A;  2RHU A;  5C6S A;  3CXC A;  3CC7 A;  1UE9 A;  4EOJ B;  2E6N A;  1Q7Y R;  2XMF A;  4CI0 C;  3DLL A;  4KUI A;  3QDF A;  2I53 A;  2DX1 A;  3TRE A;  2ESW A;  2CJM B;  5CK9 A;  2ATC B;  1QCF A;  4BY7 X;  2X4W A;  3FDR A;  2RO0 A;  3CC7 T;  2QGF B;  3H6Z A;  1WJS A;  2KR6 A;  1GFC A;  3L2V A;  1TD6 A;  4RKU E;  2HQE A;  3FJP A;  4KRD B;  1JJ2 P;  1ZSZ A;  4HT9 A;  3QG1 A;  1Q81 U;  1AEY A;  1FKM A;  1Y07 A;  1OPL A;  2PVD B;  3H41 A;  5DM7 R;  3JCM P;  3F70 A;  1K9M U;  4M7A G;  4X9C A;  4ROC A;  2FEI A;  2ROT A;  4F7S B;  2LT1 A;  1H8K A;  1VQ4 Q;  1AWO A;  1Q82 R;  1JU5 C;  3VKG A;  5LJ3 e;  2XIC A;  4UN0 A;  3RNJ A;  1TUC A;  4VUB A;  5FWC A;  2QQ8 A;  4TTH A;  3EG1 A;  3CC7 Q;  2FRY A;  5IF1 B;  2I0N A;  1PM3 A;  2RI3 A;  1K73 R;  3PE0 A;  1PD1 A;  2EQU A;  1PKS A;  3EH1 A;  1AZG B;  4BBS M;  2CP2 A;  5CVI A;  2VV5 A;  2J05 A;  3P8B B;  2RHX A;  2MPX C;  4J6X A;  3UA6 A;  2L3Q A;  5KE3 A;  1H27 B;  1WYX A;  2LCL A;  4C0G A;  1X27 A;  3CCQ Q;  2X4X A;  2FB7 A;  5ECA A;  1JJ2 A;  3OBW A;  1VQ5 A;  1GFD A;  1PSE A;  3QBY A;  5C0M A;  3DDQ B;  3QKJ A;  2CT4 A;  2DNU A;  1C1A A;  4C8Q F;  2WIP B;  4JX6 A;  2KYB A;  2RQU A;  1YJW T;  2RNA A;  4BY1 X;  1VQ7 T;  1H1Q B;  2GQI A;  2RK1 A;  1U1S A;  2QTV A;  2XDD A;  5FGK B;  3PNW C;  2JTF A;  1W2B A;  3CC2 T;  4X9D A;  2P0K A;  5IAY A;  2QGS A;  2V1Q A;  1U8R A;  3OYH A;  1UGQ B;  3LWH A;  3EHQ A;  5D6W A;  2K2M A;  2DEU A;  1S1N A;  3LGF A;  1VUB A;  3V8L A;  3OYY A;  4OB1 B;  1X2K A;  3EGD B;  2QFZ A;  1AIS B;  4RCB A;  1YJN T;  3E19 A;  3EAE A;  3M0T A;  4RTY A;  2KMG A;  1Q82 C;  4BCK B;  1W4S A;  3CC4 Q;  2C5N B;  2ZGW A;  4CFM B;  5IDP B;  5KYW B;  1ZX6 A;  4FSS A;  4ATO A;  1QLB A;  4M78 D;  4IIO A;  5D6Y A;  3BHU B;  1VQL T;  3KBG A;  3JB9 D;  3CCU T;  1FWZ A;  2PK2 A;  4EOL B;  3K7A M;  2KI7 A;  2JXB A;  3LYI A;  4N0A A;  4R55 A;  3L42 A;  5FRO A;  4F7L B;  5J3B A;  4BB7 A;  2QQA A;  2BKD N;  2EKH A;  3VKH A;  4CXA B;  1H25 B;  1M3C A;  3M59 A;  5A0G A;  1OKW B;  3QWX X;  2QDL A;  3CCJ Q;  2M9U A;  1W6X A;  2Y90 A;  3G4S Q;  3CBO A;  3JCM e;  4II5 B;  4J9D A;  1I5O B;  1F1B B;  3BY7 A;  3HFO A;  4IUT A;  3QHR B;  5LJ5 j;  2DME A;  4P5N A;  1JKW A;  3UF4 A;  3CCV T;  3S3N A;  4HVV A;  3HKS A;  5D7U A;  4C92 B;  4II1 A;  3TSZ A;  2YRD A;  3TW6 A;  2IVX A;  1H26 B;  3VYG A;  2DBM A;  2W0Z A;  2LTO A;  3FRN A;  2QXF A;  4DOW A;  3A5Z B;  4EMK A;  4QQ6 A;  3NDQ A;  3X20 B;  2K5F A;  4M7D G;  2EAY A;  2LCS A;  2CT3 A;  3DLM A;  1M3A A;  1PKD B;  4HKE A;  2PK9 B;  2YUP A;  3I9Q A;  2ED0 A;  4LNP A;  4YOO A;  4C92 E;  2FRW A;  4OML A;  4PJO G;  1UUE A;  1UB4 A;  3H0F A;  1D0Z A;  4XK8 E;  2M51 A;  4BCM D;  2EYY A;  4IKF A;  4YC3 B;  2EGC A;  3G4S A;  2QG9 B;  2EQI A;  1D3B A;  2MCN A;  3D7S B;  1NJI U;  2MAM A;  1KC8 C;  1WHJ A;  3HZJ A;  2HAX A;  4JJN K;  4M7D C;  3UAT A;  4F7U E;  3QZ9 B;  1OIU B;  2BUD A;  2HD0 A;  2QGG A;  2A3L A;  1D0X A;  2FZK B;  2HMA A;  2CRE A;  1NYF A;  2GTJ A;  1H1P B;  1KHC A;  4ME7 A;  3TN8 B;  4F17 A;  1VQ8 A;  3QYH B;  3OMG A;  1OU9 A;  4J7I A;  3JV3 A;  4JRP A;  1UNH D;  3OYK A;  1I1J A;  1UGS B;  4DBH A;  3HHT B;  2AKL A;  1GUX A;  1K1Z A;  4C8Q B;  1G3W A;  3HP9 A;  2JUF A;  2RI5 A;  2DXU A;  5KE2 A;  1TOV A;  5GMK m;  3HO8 A;  2IG0 A;  3MPU B;  3RES A;  2FYK A;  4PL6 A;  2JTE A;  5FRM A;  3F5X B;  2EJ9 A;  2WAC A;  2QA4 T;  4QW2 A;  4BCH B;  4M77 C;  4DEY A;  2LJ1 A;  1Y71 A;  1FMV A;  3CCL T;  1MHN A;  5FRN A;  4EMH A;  2O88 A;  3ASK A;  1GBQ A;  1VQM A;  1MV3 A;  4XTV A;  4DQ2 A;  1KG1 A;  1OL2 B;  3BG5 A;  4F7J B;  1VA7 A;  3NFC A;  2OI3 A;  4M7A F;  3M0U A;  2NUZ A;  3JB9 J;  3TNW B;  1Z9Q A;  5DQW A;  2ZPI B;  1M90 U;  1SEM A;  1KQ2 A;  2ZZD B;  1AWJ A;  1RI9 A;  1W1F A;  2L2P A;  3MJX A;  3CCV A;  5EJC A;  1WZO A;  1VQK T;  1NZ9 A;  1WPY A;  1Q81 C;  3A98 A;  1VQ6 T;  3TNH B;  2K5I A;  2E64 A;  5GAO r;  2GGR A;  3QHS A;  3M4G A;  5HY6 A;  5IXF A;  3MI9 B;  1KQS P;  3X28 B;  1H4L D;  2VGN A;  4EC8 B;  4C5I A;  3G71 A;  2DFU A;  2JGZ B;  4HVW A;  3MET A;  2JOY A;  1BU2 A;  5I11 A;  4ORZ A;  4JPB W;  2SEM A;  1GBR A;  1GUX B;  3OY9 A;  1YJ9 T;  1KHI A;  3ZBD A;  2GFU A;  2K9G A;  3VS3 A;  2L8D A;  5L23 A;  1X75 C;  4AFZ C;  1Q95 G;  2RM4 A;  3FJ5 A;  2RN8 A;  1LOJ A;  4EOO B;  4MIM A;  4XAX B;  1YI2 Q;  5FU7 C;  4YOS A;  4OMF B;  3CCJ A;  2K6D A;  3M0Q A;  5KYN A;  3OYD A;  1Z9Z A;  1N5Z A;  3I35 A;  1O9K B;  2HBW A;  3BLQ B;  3OMC A;  1VQ4 A;  1T3S A;  3LH5 A;  4LDY A;  4OMO A;  1PCX A;  4ROE A;  3CCV Q;  2WEV B;  1D1A A;  2MK5 A;  1WHG A;  2CP5 A;  4RG8 A;  2BZ8 A;  3L1A A;  1GRI A;  3GTM S;  2DIG A;  1VYT A;  1A0N B;  1W2B P;  4M78 F;  1S72 Q;  3CC4 T;  2EGA A;  1VIE A;  2YT6 A;  2LQW A;  2KDS A;  5IXB A;  1YIT T;  1UHF A;  1W98 B;  1NEB A;  3VS7 A;  2YSQ A;  1ENW A;  3CME Q;  3QPH A;  1LNX A;  4JX5 A;  2E5Q A;  1QKX A;  2K3B A;  3HRS A;  3L2Q A;  1AWW A;  2DD4 B;  3LH0 A;  1IHW A;  2RB6 A;  1YIT Q;  2RQW A;  3JCM g;  1HXD A;  1PRL C;  4A53 A;  3L2U A;  1PRM C;  1VQ9 Q;  2LQ8 A;  1D0Y A;  1K73 C;  1YI2 A;  2BS2 A;  1OZ2 A;  2JVV A;  4B9W A;  4BDZ A;  1G3Y A;  3FC3 A;  2RQV A;  2BPM B;  3SD4 A;  4BE0 A;  1YHQ A;  4PLL A;  2LX7 A;  1NG2 A;  1D1B A;  2YRV A;  1WLP B;  2EJF A;  1VYV A;  4N4H A;  1BCM A;  1ZUU A;  4AKG A;  4RTV A;  3MHX A;  1VQP A;  3ZFJ A;  2ZPF B;  5KYU A;  2B8A A;  3JCM h;  1Q81 R;  4QQG A;  3LX7 A;  3M0S A;  1QVG S;  5HBH B;  4FCY A;  2A08 A;  2RMO A;  3OYG A;  4FX3 B;  1OIY B;  4AI6 A;  1AT1 B;  1TWB A;  2DVE A;  1VQ4 T;  5LJ5 d;  1U3O A;  1S72 A;  2F2W A;  1K0S A;  1QVF P;  1LJO A;  3E9F A;  1UNL D;  4F7U A;  1TS9 A;  1HYO A;  3DL1 A;  1Q82 U;  4XU3 A;  2BTT A;  3EGD A;  3DB3 A;  4FYW B;  4K11 A;  1UTI A;  2CP0 A;  1B34 B;  2D6F A;  2FG0 A;  3VUB A;  3CXC P;  2DTO A;  1H92 A;  3MIA B;  4NS5 A;  1M2V A;  2KMT A;  2KRN A;  5GAM d;  3VRZ A;  4BXX X;  5KYY A;  2XI9 A;  4M7D D;  2ECZ A;  1WJQ A;  5I21 A;  1U5S A;  4RCC A;  2KE9 A;  4NC6 A;  1VQL A;  2ZPB B;  4M7A C;  1FYN A;  2OAU A;  3PFS A;  4KRT A;  2K2V A;  2PTK A;  1M1K R;  3MP6 A;  1X6O A;  1QCO A;  4NL2 A;  2GNC A;  2G6F X;  2BS4 A;  3A8O B;  3EH2 A;  5KCO A;  5GAN e;  2JW4 A;  2X3X D;  2JM8 A;  1UEC A;  4O5V A;  4C92 D;  3JCM W;  1WXT A;  1T0J A;  4C0Z A;  2V8J A;  4PFP A;  2YLC A;  3PIP A;  3OW2 P;  2X3W D;  1YBY A;  2DL8 A;  3ZL7 C;  1SRL A;  3H4C A;  1BKB A;  1TSF A;  1WHK A;  4EOM B;  4IUQ A;  2DZ9 A;  4E7K A;  1VIF A;  1X01 A;  3VS2 A;  1X6B A;  1N6A A;  4QVC A;  2DIL A;  4AG2 C;  5DY9 A;  3SDZ A;  2C5X B;  5HNB B;  3CC2 A;  4BCN B;  1MV0 B;  2DEQ A;  4JZ4 A;  2QI2 A;  2XK0 A;  4ELJ A;  2WMA B;  3CQT A;  5KH6 A;  2KK4 A;  4XTY A;  3RKW A;  2PHG A;  5FU6 B;  2UZB B;  1RI0 A;  4ZTJ A;  1BIA A;  4OMP A;  4M75 G;  1DJ7 B;  5I22 A;  5GAN 8;  1JO8 A;  2RJF A;  1OV3 A;  5IDN B;  1M2V B;  5IN1 A;  2R7G A;  1PHT A;  4AFS C;  4EMK B;  1N27 A;  5HKC A;  4PJO B;  3SWN A;  3OYI A;  4M75 E;  2LNH B;  2ZPE B;  1R77 A;  3CCS Q;  1UGV A;  2L3S A;  1R8O B;  3C4S A;  2E6Z A;  4DBQ A;  3QWL A;  1ZUK A;  4FM4 B;  5GAN 4;  1JBM A;  2D8J A;  1MNE A;  3BW1 A;  4Y92 A;  3CCM T;  2NUP B;  4F6U B;  1VQ8 Q;  4LUD A;  1I4K 1;  3NTI A;  4E7H A;  3EG0 A;  5EFQ B;  1VQN A;  4EMG A;  4CFW B;  2V8I A;  2L3R A;  2LRQ A;  4UC4 A;  5GAN 3;  4NST B;  1WJR A;  2LVM A;  2K7A A;  4OMQ A;  1C6V X;  4KGZ B;  4M78 E;  1OI9 B;  2LCC A;  2CP6 A;  5IHY A;  1OUL A;  3KUF A;  2YUQ A;  4C0D C;  3MKD A;  2XU8 A;  4JJB A;  5J39 A;  2J6K A;  4LE9 A;  4C8Q A;  4M75 D;  1ZLM A;  3CCQ A;  5GMK e;  2H3E B;  3KFV A;  1VOM A;  2OTL Q;  2PVO B;  4DA4 A;  2E70 A;  4OMM A;  1O9S A;  2D0Q B;  3C94 A;  4JS5 A;  3H8Z A;  4OB2 B;  2CUB A;  4ROD A;  4J9I A;  1PKT A;  1WIE A;  2EGE A;  2FVU A;  3G71 T;  2NUT B;  1JB0 E;  1BB9 A;  5CQX A;  4J8O A;  4NOY A;  1I07 A;  4CRI A;  3CCE T;  4BCN D;  1PWT A;  4BI3 A;  1AVZ C;  1NYG A;  3CPW P;  4C5G A;  4QVZ A;  1UGR B;  1YJ9 A;  4KRC B;  4JRK A;  3VUZ A;  2GQV A;  1QP3 A;  2KRM A;  2DF6 A;  2DE0 X;  2LZ6 B;  3VYG B;  3VRY A;  2OTL T;  4M7A D;  1Q7Y U;  1AD6 A;  5AT1 B;  2O01 E;  2COW A;  3I56 T;  3URG A;  1M5Q 1;  2EPD A;  2RF0 A;  4QKU A;  1NM7 A;  3M54 A;  1JRI A;  1V29 B;  3SB2 A;  1RAH B;  4M75 F;  1Q86 U;  1Y96 B;  3CCU Q;  1R0C B;  2Z0W A;  2W99 A;  1MMA A;  4ZNX A;  3OBY A;  2PUO B;  4BCM B;  4EDU A;  1QCN A;  5DLO A;  2B9R A;  2IPO B;  2CUD A;  3QZ5 B;  2EFI A;  3CCM Q;  1JSU B;  1WX6 A;  2EYW A;  2DAQ A;  1JOW A;  2F5K A;  4BY6 C;  2KT8 A;  5HCK A;  2FHD A;  2UZL B;  4J9F A;  1IGQ A;  2SRC A;  4J7F A;  4XTZ A;  2D1X A;  2E3H A;  2P84 A;  2XKO C;  1H3H A;  3DDP B;  1Y7X A;  2CKK A;  3QYB A;  2LJ3 A;  5KYW A;  4HVU A;  3C0C A;  5CKB A;  3DB4 A;  1TFB A;  2DXB B;  2DL5 A;  4PJO C;  3BG9 A;  3J80 E;  5GAM g;  3LGL A;  1HSQ A;  2MI6 A;  2ROL A;  2KRO A;  2CSQ A;  2AK5 A;  2P4T A;  2RA2 A;  4IUP A;  2DMO A;  3EG2 A;  5LJ3 g;  2CP7 A;  2DD5 B;  1K73 U;  1YN8 A;  4DBF A;  1N9R A;  3T9N A;  1B07 A;  2YWW A;  5LMK B;  2XD0 A;  1IGU A;  2VAS A;  2QAS A;  3EID B;  4FU6 A;  2A0F B;  2O4X B;  4FSX A;  2ENM A;  1VQ9 T;  1GY3 B;  3JCM J;  3MY1 B;  4BDY A;  3V7S A;  4CFU D;  4AG1 C;  4BCI B;  3TU4 K;  3M4Y A;  5M9O A;  2PQW A;  4JUV A;  4OVA A;  3BHV B;  2FPF A;  2OTJ A;  3I56 Q;  1FMK A;  3REA B;  1G83 A;  5GAM e;  3JB9 G;  1VQ5 Q;  2W9F A;  2L3P A;  5GAN f;  1ZSG A;  3M56 A;  1VQ9 A;  4M78 B;  2IW6 B;  1ZSZ C;  1YIJ A;  3N5B B;  2ABL A;  5I2M A;  3THK A;  2DA9 A;  1WHM A;  2DRM A;  4IUU A;  4PJJ A;  1KQS A;  2I2L A;  2DK3 A;  4PFO A;  3BE3 A;  5CQY A;  5CKE A;  4E2F B;  4ELY C;  1IXD A;  1QMZ B;  3H9N A;  3E2U A;  4Q5W A;  2VB6 A;  3EFO B;  2KYM A;  4IIM A;  1H28 B;  4B6M A;  1YJW A;  5KYY B;  2KVQ G;  2C6T B;  3UDC A;  1VQ5 T;  3CMA A;  2C06 A;  3G71 Q;  2K4Y A;  2J6O A;  4EOR B;  4KGV B;  3U23 A;  2LW4 A;  4FL6 A;  1YNZ A;  1V76 A;  4ANJ A;  1MUZ A;  1TH7 A;  1TUG B;  4QVD A;  1XNI A;  1D3B B;  3S6W A;  5GAN 2;  5CR2 A;  3EFS A;  2M02 A;  4IUR A;  2RPN A;  2OJ2 A;  2DO3 A;  2K79 A;  2VXF A;  1N8R R;  1W70 A;  1VIN A;  2OTJ Q;  3SWN C;  1V1C A;  2DIQ A;  2DKG A;  2K3Y A;  5GJV B;  5CAI A;  4C92 A;  2G77 A;  2ZAE A;  4J9B A;  1JXO A;  1ABQ A;  4GBQ A;  5GAO p;  4Z88 A;  3IQL A;  3H0H A;  2HKQ B;  1EZZ B;  2LC4 A;  4XTX A;  1B7T A;  1I81 A;  2E41 A;  1VQO Q;  3ULR B;  3A8M B;  2VWF A;  4Z6Y A;  4M77 G;  4JX4 A;  1MGQ A;  2EQM A;  2EYZ A;  4M78 C;  4KUL A;  1WA7 A;  2HL5 C;  1UGP B;  4CC4 B;  2QDJ A;  1B3Q A;  4WCI A;  2JM9 A;  3OS1 A;  3G6E T;  4E7L A;  2VYT A;  1K9M R;  1UEB A;  2IW9 B;  3LWI A;  1OU8 A;  1QWE A;  3OS5 A;  2JMC A;  3RKY A;  5LJ5 h;  3JB9 H;  4PK4 A;  4BE1 A;  4D8D A;  1YFN A;  2DBK A;  4LOC A;  3INZ A;  4WTO B;  2EYX A;  4E7I A;  5CCA A;  5GAM h;  2CSI A;  2GF7 A;  5AYF A;  2M1H A;  4TVR A;  1H1R B;  1GCQ A;  4HXJ A;  3CCM A;  4F7U F;  1T0H A;  4BD3 A;  5GAN j;  4GY5 A;  4ZGD B;  5ICP B;  2KSS A;  3MP1 A;  5DLQ E;  1NPP A;  1KSW A;  3MEW A;  1M9S A;  1LPL A;  2HKN A;  4J6W A;  2W96 A;  2L0A A;  3EG9 B;  5GMK h;  1RAB B;  1KQS S;  5GAN h;  4E6R A;  1VQL Q;  2EIF A;  3OYN A;  1UHC A;  2ZPH B;  2VKN A;  3HBL A;  3NHN A;  1I8F A;  5HBJ B;  1RAD B;  3OS2 A;  1NJI C;  3CCS A;  1SPK A;  3JCM Q;  5KCH A;  2P0P A;  1PC0 A;  1BK2 A;  3GPL A;  4C8Q D;  4F14 A;  2X51 A;  2XHC A;  3I5S A;  4HCK A;  3L2Z A;  3CEY A;  1WGS A;  2KNB B;  2OX7 A;  3QUI A;  2CZ7 B;  1SG5 A;  4BCQ D;  4J6Y A;  2C5O B;  3M55 A;  4PJO F;  2K3X A;  4RMO A;  4BE2 A;  1VQN Q;  4PJN A;  2E5K A;  4LUE A;  3MCA B;  4A54 A;  2WSF E;  1M1K U;  2KXD A;  3M0P A;  4C5H A;  2FZG B;  2LQN A;  3PMI A;  3PTA A;  4BY6 B;  5CYI B;  2CS7 A;  2O31 A;  3VS0 A;  4F6S B;  2C0O A;  4HL4 A;  5IHK A;  2G9X B;  2IIM A;  1BU1 A;  1KD1 U;  1G3T A;  4PJO A;  4M77 A;  1M3B A;  4OP0 A;  1AHJ B;  3V8J A;  4OF1 A;  1X43 A;  2HNI A;  4M7D E;  2KGT A;  1WQ7 A;  3CCQ T;  3I55 T;  4M77 B;  3OYE A;  3RIR A;  4KBM B;  2UZD B;  1B34 A;  5GMK i;  4IUV A;  1QLY A;  4MZT A;  1CSK A;  1KC8 U;  3HRT A;  1VQM Q;  4C92 G;  4KUD K;  1M90 R;  3AHU A;  2KEA A;  5HBE B;  2IN3 A;  1BBZ A;  2JN0 A;  3VS6 A;  3L2R A;  3EFR A;  4QT7 A;  1RAF B;  1X6G A;  1YP5 A;  1Q86 C;  1OOT A;  2V26 A;  2QA4 Q;  1O75 A;  3CXC S;  2JT4 A;  1ZQ1 A;  4MZP A;  2OTJ T;  1OGU B;  3M03 A;  2D9T A;  4MZM A;  2QK0 A;  2X4Y A;  2DL4 A;  2UUE B;  4FW1 A;  4OR5 B;  4HT8 A;  1QVP A;  2DLP A;  2BS3 A;  2WFY B;  2J06 A;  1QQJ A;  2HQX A;  5FWB A;  3JCM V;  4HLQ A;  4NL3 A;  3VS4 A;  4C92 C;  5KYX B;  1TUD A;  2L89 A;  4F16 A;  3SFM A;  1AZE A;  1N4M A;  5GAO l;  1TG0 A;  1VQ6 A;  1VQP T;  3EG3 A;  4CC3 A;  1VQK A;  4D6W A;  2XG8 D;  4M7A E;  4R56 A;  5CEI B;  4MDX A;  4C8Q C;  2RH2 A;  2BZX A;  4CC2 A; 
#chains in the Genus database with same CATH homology
 2EQJ A;  1VQN A;  4EMG A;  3M59 A;  2NLU A;  2V8I A;  2L3R A;  2LRQ A;  5A0G A;  4ZTF A;  1YIJ T;  5GAN d;  3L2W A;  4EMK C;  4UC4 A;  5GAN 3;  4BAC A;  1ZBX A;  2M9U A;  1WJR A;  1VQ8 T;  2LVM A;  2Y90 A;  3OSS C;  4KT0 E;  4M77 F;  3CBO A;  3JCM e;  4J5Y A;  4M78 E;  5CIU A;  2DZC A;  5A0D A;  2LCC A;  1JJ2 S;  2E65 A;  3DKM A;  4LDX A;  3X26 B;  3V8K A;  3BY7 A;  3HFO A;  3KUF A;  4IUT A;  4C0D C;  5LJ5 j;  2XU8 A;  1KQ1 A;  5A2Q E;  3P8D A;  2DPP B;  2CYZ B;  2EJG A;  4P5N A;  4C8Q A;  4HNU A;  5J39 A;  5GAN g;  3CCV T;  4M75 D;  2E10 A;  3GOX A;  3CCQ A;  3S3N A;  5GMK e;  3A8L B;  5CO7 A;  2PVO B;  5CAI A;  4LDU A;  4DA4 A;  2E70 A;  2LDM A;  2RI2 A;  4HCZ A;  3J81 E;  3HKS A;  1O9S A;  2XID A;  2D0Q B;  3C94 A;  3JCM c;  4JS5 A;  1NPR A;  3H8Z A;  4C92 B;  4II1 A;  4OB2 B;  4PKC C;  4M7D A;  3TW6 A;  1W2B S;  3WVE B;  3NTK A;  2FL7 A;  3VYG A;  4PNO A;  2FVU A;  4M6V A;  1K8A U;  2KQW A;  3G71 T;  1M90 C;  3Q1J A;  1JB0 E;  5CQX A;  2EWN A;  3CBM A;  2LTO A;  4J8O A;  4M77 E;  4NOY A;  4OGE A;  3FRN A;  2QXF A;  4FT2 A;  4DOW A;  3JCM d;  4HCB A;  4CRI A;  3CCE T;  3A5Z B;  4EMK A;  4BI3 A;  4FIB A;  3S3M A;  4QQ6 A;  3CCU A;  3VU3 C;  4BI4 A;  4MDW A;  4C5G A;  4QVZ A;  1UGR B;  2Y4Y A;  2RK2 A;  3JAM E;  3X20 B;  2K5F A;  1YJ9 A;  5HK0 A;  3VKI A;  2VC8 A;  2MMP A;  4M7D G;  4JRK A;  3VUZ A;  2GQV A;  2EAY A;  1BI0 A;  4M7D F;  1QP3 A;  3DLM A;  2OTL A;  5GAN 6;  3CCR T;  3VYG B;  2OTL T;  4M7A D;  3RUX A;  1Q7Y U;  1BI2 A;  4HKE A;  3A8H B;  4HNV A;  2O01 E;  3HSB A;  1YIT A;  4M7D B;  2DTI A;  4C92 E;  4PJO G;  2XDP A;  3I56 T;  3URG A;  1M5Q 1;  1UB4 A;  2R5A A;  3OA6 A;  2DXT A;  1BIB A;  3JCM f;  3OW2 S;  4XK8 E;  2RHY A;  3M54 A;  5I2S A;  1Q7Y C;  1JRI A;  2XDB A;  2DD4 A;  1V29 B;  4MMK A;  3SB2 A;  1Q86 U;  4M75 F;  4IKF A;  4HA8 A;  3X24 B;  1Y96 B;  3G4S A;  5FU6 C;  5D6X A;  3C12 A;  4C92 F;  1D3B A;  1PSF A;  3UWN A;  4V2S A;  4GLK A;  3GP8 A;  3OBY A;  3SWN B;  1NJI U;  2PUO B;  2MAM A;  2YLB A;  4EDU A;  1KC8 C;  1K9M C;  4A4G A;  3HZJ A;  5DLO A;  2HAX A;  4JJN K;  4M7D C;  4F7U E;  3QZ9 B;  4LDV A;  3QZ5 B;  3GF5 A;  2EFI A;  3OB9 A;  1K8A C;  2BUD A;  2HD0 A;  5GAM f;  2CGH A;  2EQK A;  2F5K A;  2DAQ A;  2A3L A;  4BY6 C;  1XQH A;  1HK9 A;  1YHQ T;  1KHC A;  1M1G A;  2E12 A;  3RMS A;  4ME7 A;  5J26 A;  4M7A B;  2FHD A;  4DOV A;  1VQ8 A;  1RL2 A;  2R57 A;  3QYH B;  3OMG A;  4J7I A;  5GAM j;  4O6J A;  3E9G A;  4JRP A;  4J7F A;  4XTZ A;  3OYB A;  1VQN T;  3JB9 F;  2XKO C;  2Y4X A;  3OYK A;  1UGS B;  1Y7X A;  2CKK A;  3G7Z A;  3HHT B;  3QYB A;  5GAO n;  5CKB A;  3DB4 A;  3FIF A;  4A4F A;  2DXB B;  1M4Z A;  4PJO C;  4C8Q B;  3BG9 A;  5A0L A;  5GAM g;  3J80 E;  2V8K A;  2CZ0 B;  1G3W A;  2JUF A;  2MI6 A;  3ER0 A;  3HP9 A;  2RI5 A;  3LGL A;  2DXU A;  2P4T A;  2RA2 A;  2QF7 A;  3TCJ A;  3QJ6 A;  5KE2 A;  1N8R C;  4WF2 A;  5LJ5 e;  5GMK m;  3HO8 A;  1M8V A;  4IUP A;  2K57 A;  2IG0 A;  3OQ5 A;  3RES A;  4N0A C;  5LJ3 g;  3HL8 A;  3M57 A;  2FYK A;  2DD5 B;  4PL6 A;  5GMK j;  1S72 T;  1K73 U;  3LLR A;  1N9R A;  3T9N A;  4JRQ A;  2EJ9 A;  5FRM A;  2WAC A;  1BI1 A;  2QA4 T;  4QW2 A;  4M77 C;  3CCL A;  1Y71 A;  3I55 A;  3M53 A;  2XD0 A;  2HBP A;  4M75 B;  3HB9 A;  4M78 G;  3CCL T;  4YTL A;  3GIB A;  2QQS A;  4AKI A;  1MHN A;  1OZ3 A;  2ZZD A;  4EMH A;  2QQ9 A;  4FU6 A;  5FRN A;  3QSU A;  4J83 A;  3ASK A;  3JCM b;  1VQO A;  2A7Y A;  2O4X B;  4FSX A;  3P8H A;  1VQ9 T;  2WSC E;  2QDY B;  4PLI A;  4XTV A;  4DQ2 A;  1VQM A;  3BG5 A;  1VQM T;  1KG1 A;  3NFC A;  3JCM J;  3GLX A;  3CCE A;  2RHZ A;  4M7A F;  4BDY A;  2M16 A;  3V7S A;  2QQR A;  1SSF A;  3MEA A;  4M75 C;  3JB9 J;  4HCC A;  4ZGJ B;  3TU4 K;  1OI1 A;  2O4X A;  4MML A;  2ZPI B;  2QQB A;  1M90 U;  3M4Y A;  2QA4 A;  5M9O A;  2PQW A;  2GFA A;  4LD6 A;  2ZZD B;  1KQ2 A;  4JUV A;  4OVA A;  2OTJ A;  4A4H A;  3BFM A;  4X34 A;  3OYL A;  3TW7 A;  3CCR A;  3CCV A;  5EJC A;  1OYX A;  3KXT A;  1VQK T;  5GAM e;  1NZ9 A;  3JB9 G;  1WPY A;  5FU7 B;  1Q81 C;  4BBR M;  1YI2 T;  1VQ6 T;  5GAN f;  3PIO A;  2K5I A;  2E64 A;  5GAO r;  3M56 A;  2L5Q A;  1VQ9 A;  4M78 B;  3QHS A;  3M4G A;  2LT4 A;  1YIJ A;  3N5B B;  5HY6 A;  1WNL A;  2KAF A;  2KY9 A;  4EPC A;  5I2M A;  4RG2 A;  3X28 B;  1GXI E;  1XTD A;  2VGN A;  3JRZ A;  1N8R U;  3FEO A;  1ZHI A;  4C5I A;  3G71 A;  4IUU A;  2DXB A;  3M5A A;  2K5L A;  1KQS A;  3VJP A;  3MET A;  2JOY A;  2I2L A;  4FT4 A;  4Z02 A;  3CCJ T;  1QP2 A;  3J7A F;  2DK3 A;  4ELZ C;  5CQY A;  1XOV A;  5CKE A;  4ELY C;  1I5L A;  5IT9 E;  3OY9 A;  1YJ9 T;  2VXE A;  1KHI A;  4Q5W A;  3ZBD A;  2GFU A;  4L59 A;  4OGC A;  4L6V 5;  3MEV A;  5CKD A;  5LJ5 g;  4M7A A;  2L8D A;  3HPW A;  1X75 C;  3X25 B;  2F5T X;  2IVW A;  2RM4 A;  4A4K A;  1YJW A;  2RJC A;  3E1S A;  2ZPG B;  3CD6 A;  1LOJ A;  3QXE B;  4MIM A;  4XAX B;  2QEX T;  2KVQ G;  5FU7 C;  2JNG A;  3UDC A;  2QEX A;  3CBP A;  3CMA A;  1VQ5 T;  2C06 A;  4OMF B;  3CCJ A;  3CCS T;  4F7U G;  2X35 A;  3OYD A;  2K4Y A;  5CKF A;  1FXX A;  4FL6 A;  4LD9 K;  3QJY A;  1YJN A;  2R58 A;  4ZN3 A;  1TH7 A;  2RD1 A;  1Y96 A;  4QVD A;  3CC4 A;  3OMC A;  1XNI A;  1D3B B;  3S6W A;  1VQ4 A;  5GAN 2;  3S3O A;  1VQ7 A;  5CR2 A;  3EFS A;  4PJO D;  4M77 D;  4IUR A;  4JRI A;  2LNV A;  2DO3 A;  2VXF A;  4C5E A;  4LDY A;  1EIF A;  3CPW S;  2VUB A;  3SWN C;  2DIQ A;  3V7C A;  2DKG A;  2K3Y A;  2PU9 B;  2PUK B;  4JDS A;  4LDW A;  4Y91 A;  4C92 A;  3O8V A;  4A4E A;  5FLX E;  2G77 A;  1BI3 A;  4RG8 A;  5EG2 A;  3L1A A;  5GAO p;  3MEU A;  4Y28 E;  2MWP A;  2CZ1 B;  3RMQ A;  1YJW T;  4B9X A;  2EKO A;  1G3S A;  1QVF S;  2LC4 A;  3M9Q A;  2DIG A;  4XTX A;  3C95 A;  5LJ3 d;  1I81 A;  3M58 A;  3QII A;  2E41 A;  4M78 F;  3CC4 T;  3WXM B;  3CPW A;  1VIE A;  3TEE A;  2KDS A;  1YIT T;  3A8M B;  4ZGE B;  2VGM A;  4JS4 A;  3OW2 A;  3BDU A;  4M77 G;  4Z6Y A;  1U1T A;  4JX4 A;  1MGQ A;  2EQM A;  4JLI A;  2RJD A;  4M78 C;  4KUL A;  4BI8 B;  5GMK l;  4N4G A;  1UGP B;  2AHJ B;  4OB3 B;  3ZEH A;  1YCY A;  1N9S A;  2QDJ A;  2E1H A;  3CPF A;  4XU2 A;  1NE8 A;  3QPH A;  1LNX A;  4JX5 A;  5HK3 A;  3GNF B;  4XU0 A;  2E5Q A;  3JCM h;  3HRS A;  3OS1 A;  1M1F A;  4F7U B;  3L2Q A;  3G6E T;  2DD4 B;  2X4J A;  2RHU A;  1P92 A;  3LH0 A;  2QTX A;  4ZN1 A;  5C6S A;  4E7L A;  2RB6 A;  3CXC A;  3CC7 A;  2VYT A;  3JCM g;  1UEB A;  1HXD A;  4A53 A;  1IZ6 A;  4C8Q G;  3OYJ A;  3LWI A;  3L2U A;  2E6N A;  2LQ8 A;  3OS5 A;  1BYM A;  3LW5 E;  4PJO E;  1K73 C;  1YI2 A;  3RKY A;  2BS2 A;  1OZ2 A;  2JVV A;  4B9W A;  5LJ5 h;  3OYF A;  4BDZ A;  4CI0 C;  1G3Y A;  3DLL A;  4KUI A;  2JZ2 A;  3FC3 A;  3CD6 T;  3JB9 H;  4BE1 A;  3TRE A;  3SD4 A;  4BE0 A;  1YHQ A;  4PLL A;  4LOC A;  3NTH A;  3INZ A;  4C8Q E;  5LJ3 f;  4E7I A;  2CZ6 B;  5CK9 A;  5CCA A;  4MFD A;  5GAM h;  2X4W A;  2GF7 A;  2YRV A;  2EJF A;  5AYF A;  3FDR A;  4N4H A;  2H3J A;  2M1H A;  2RO0 A;  4M78 A;  4TVR A;  3UT1 A;  1M1K C;  2JTM A;  3CC7 T;  4AKG A;  3H6Z A;  3MHX A;  3CCM A;  1WJS A;  2KR6 A;  2RJE A;  2WSE E;  3R6O A;  1VQP A;  3ZFJ A;  1E7P A;  4F7U F;  3L2V A;  2DXC A;  3BDL A;  2ZPF B;  4BD3 A;  5GAN j;  4GY5 A;  4ZGD B;  2B8A A;  2KSS A;  3MP1 A;  3QYG B;  4RKU E;  2HQE A;  3LX7 A;  4QQG A;  3MO8 A;  3PT9 A;  1NPP A;  3MEW A;  5DLQ E;  3OYA A;  3FJP A;  1QVG S;  1H3Z A;  4JLG A;  3OYG A;  1M9S A;  4HT9 A;  4AI6 A;  3QG1 A;  5GAO q;  1FKM A;  1Q81 U;  1Y07 A;  4BUG A;  2DVE A;  4J6W A;  1VQ4 T;  2PVD B;  5LJ5 d;  1S72 A;  5DM7 R;  5GMK h;  1KQS S;  3JCM P;  3JCM X;  3F70 A;  5GAN h;  1LJO A;  2EIF A;  3E9F A;  4F7U A;  3OYN A;  1K9M U;  4M7A G;  1IRE B;  2ZPH B;  4X9C A;  3HBL A;  3OS2 A;  1I8F A;  3DL1 A;  1Q82 U;  1NJI C;  4C0D B;  4XU3 A;  3CCS A;  3JCM Q;  3DB3 A;  5KCH A;  2LT1 A;  2P0P A;  4C0F A;  3GPL A;  4C8Q D;  1B34 B;  2D6F A;  4M75 A;  2XHC A;  2MWO A;  3VUB A;  3CME A;  4OB0 B;  4MFE A;  3VKG A;  2DTO A;  3GNG A;  5LJ3 e;  3VYH B;  2XIC A;  3L2Z A;  3CEY A;  1WGS A;  4NS5 A;  2BIV A;  5LL6 S;  2KMT A;  4VUB A;  4XQ3 A;  5GAM d;  3QUI A;  2QQ8 A;  2CZ7 B;  3CME T;  1H64 1;  2LQK A;  2XI9 A;  4M7D D;  4J6Y A;  4L5G A;  3M55 A;  4PJO F;  2K3X A;  4E47 A;  2RI3 A;  4RMO A;  4HNT A;  4BE2 A;  1WJQ A;  1WQW A;  3MCA B;  2EQU A;  5I21 A;  4RCC A;  4A54 A;  2WSF E;  2R5M A;  4BBS M;  1M1K U;  4NC6 A;  4XTW A;  1VQL A;  2PVG B;  2ZPB B;  3VV0 A;  2LX9 A;  5CVI A;  2OAU A;  2VV5 A;  4C5H A;  4M7A C;  3PFS A;  3P8B B;  2K2V A;  4PJO B;  3PMI A;  1FX7 A;  2RHX A;  3PTA A;  4BY6 B;  5GAO m;  4J6X A;  2CS7 A;  3G6E A;  3PMT A;  3QYE A;  3MP6 A;  1X6O A;  4HL4 A;  3JSC A;  4NL2 A;  5KE3 A;  2BS4 A;  3A8O B;  2LCL A;  4C0G A;  5KCO A;  3ME9 A;  5GAN e;  1KD1 U;  2WJ9 A;  1G3T A;  2X4X A;  2FB7 A;  4M77 A;  3G4S T;  4PJO A;  1JJ2 A;  4OP0 A;  1AHJ B;  3FB9 A;  3OBW A;  3V8J A;  3OYM A;  1VQ5 A;  4O5V A;  4C92 D;  3JCM W;  1PSE A;  2RHI A;  3MP8 A;  3QBY A;  2ZCF B;  4OF1 A;  5C0M A;  3QKJ A;  4XTU A;  2HNI A;  4M7D E;  4QQD A;  4C8Q F;  2P0Q A;  4E7J A;  1WQ7 A;  3CCQ T;  4C0Z A;  4JX6 A;  2V8J A;  3I55 T;  4M77 B;  5LJ3 h;  2DD5 A;  3JB9 I;  3OYE A;  2EYQ A;  2YLC A;  4KBM B;  3RIR A;  3PIP A;  3WVD B;  1KD1 C;  1B34 A;  5GMK i;  1VQ7 T;  1YBY A;  1QW1 A;  4IUV A;  4MZT A;  2RK1 A;  1U1S A;  2XDD A;  3HRT A;  1KC8 U;  2M0O A;  3PNW C;  3H4C A;  1BKB A;  2JTF A;  3HRU A;  4C92 G;  4KUD K;  3CMA T;  4IUQ A;  4E7K A;  2DZ9 A;  3AHU A;  5LJ5 f;  1W2B A;  3CC2 T;  1VIF A;  1X01 A;  2YHT A;  4X9D A;  3RER A;  3V7R A;  2JN0 A;  3L2R A;  1N6A A;  2MF2 A;  2P0K A;  1QVF A;  5IAY A;  5LJ3 j;  4QVC A;  3EFR A;  1VQO T;  5DY9 A;  3SDZ A;  1U8R A;  3OS0 A;  3OYH A;  1Q86 C;  3CC2 A;  1UGQ B;  2DEQ A;  1O75 A;  3LWH A;  3CXC S;  2QI2 A;  2XK0 A;  4ELJ A;  3KHI A;  1ZQ1 A;  5L8R E;  5KH6 A;  4MZP A;  5GAN 7;  3I56 A;  2G3R A;  2OTJ T;  5D6W A;  4AKH A;  2KK4 A;  3HFN A;  4XTY A;  2D9T A;  3LGF A;  4MZM A;  3RKW A;  2X4Y A;  3OSV A;  5FU6 B;  1VUB A;  1RI0 A;  4ZTJ A;  1BIA A;  2DXC B;  3V8L A;  4HT8 A;  1QVP A;  1DJ7 B;  4M75 G;  5GAN 8;  4XU1 A;  2RJF A;  3OYY A;  4OB1 B;  2BS3 A;  5GAN 5;  2DJZ A;  2HQX A;  3JCM V;  5IN1 A;  4HLQ A;  4NL3 A;  4EMK B;  4C92 C;  1N27 A;  5CKH A;  5HKC A;  2L89 A;  2QFZ A;  3BG3 A;  4QSH A;  4RCB A;  3RKX A;  3E19 A;  3EAE A;  3SWN A;  3OYI A;  1YJN T;  2KMG A;  4M75 E;  1Q82 C;  3SFM A;  2ZPE B;  1W4S A;  5GAO l;  2ZGW A;  2F69 A;  3UPU A;  1R8O B;  3C4S A;  2E6Z A;  4ATO A;  2GCX A;  3QWL A;  1QLB A;  3QO3 A;  4FM4 B;  4M78 D;  5GAN 4;  1G5V A;  1JBM A;  5D6Y A;  3PGG A;  1VQL T;  3KBG A;  3JB9 D;  1QVG A;  3BW1 A;  3CCU T;  1FWZ A;  1VQ6 A;  3CCM T;  1VQP T;  2DTH A;  3FLG A;  3LYI A;  4N0A A;  4R55 A;  3L42 A;  3A8G B;  1VQK A;  4D6W A;  3QDR B;  2XG8 D;  5FRO A;  5J3B A;  4M7A E;  1I4K 1;  4BB7 A;  3NTI A;  4R56 A;  2QQA A;  4MDX A;  2BKD N;  4N4I A;  2RH2 A;  4C8Q C;  3VKH A;  4E7H A;  3OYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...