1UGSB

Crystal structure of ay114t mutant of co-type nitrile hydratase
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Nitrile Hydratase alpha subunit
total genus 66
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugsB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugsB02
2DD5A 2ZPBB 1UGPB 2CZ7B 2PVGB 3VYHB 2AHJB 1PSEA 2PUKB 2WSFE 2WSCE 3QYHB 2PU9B 2ZZDA 3A8HB 2PVDB 3QZ9B 1UGQB 2CZ1B 2DD4A 4KT0E 4OB0B 1JB0E 3HHTB 1AHJB 3A8LB 2ZPHB 1UGRB 2O01E 4OB3B 2ZPFB 3X25B 4OB1B 2ZPEB 5L8RE 3A8MB 4OB2B 1V29B 3A8GB 2DXBA 1UGSB 4L6V5 2DPPB 1QP3A 3QYGB 3X24B 2QDYB 2PUOB 3X26B 3X28B 4ZGEB 2CZ0B 1QP2A 1IREB 4FM4B 1GXIE 3VYGA 2DXBB 4ZGJB 2DD4B 3WVDB 3X20B 2ZZDB 2DXCA 3QXEB 2D0QB 4Y28E 1DJ7B 2CZ6B 2WSEE 3QZ5B 3A8OB 3VYGB 2DD5B 3WVEB 1PSFA 3LW5E 2ZPGB 2PVOB 4RKUE 4ZGDB 2DXCB 2ZPIB 4XK8E 2ZCFB 2CYZB
chains in the Genus database with same CATH superfamily
3DKMA 4M75F 4J6YA 2PTKA 3TEEA 4EONB 1XJWB 1M90R 4EOJB 3GNGA 2E6ZA 5J39A 1OI9B 1VQ7Q 2O31A 2EJFA 2WIHB 4M75D 4PKCC 1M2OA 4EMKC 4AFSC 3CCSA 5KE2A 2B86A 1UEBA 4C0ZA 3J7AF 3OSVA 1VIFA 1OKWB 3SHWA 4M7AA 2H3EB 1ZA2B 4KT0E 2JM9A 2OAWA 1MGQA 4AKHA 4OB0B 2XDPA 1R77A 2C0OA 3BLHB 1UNGD 2J06A 5LQFB 1H8KA 3U23A 3CCSQ 2BS3A 3A8LB 4BBRM 2RQWA 4M77D 5GAN2 1NLPC 4KGVB 1D0XA 2FZKB 1VQKT 4CC2A 2X3WD 1VYUA 4BXXX 1SEMA 5IDNB 1S72T 1IHVA 4JX4A 2YRDA 1VQ6T 1H4LD 4PJOG 3PNWC 3M4YA 2DL7A 3I56A 4D6WA 1VQ8A 3G6ET 2R58A 4PFPA 1VQOT 4C5EA 4C0GA 2IG0A 2PUOB 1PWTA 1WXBA 4E7LA 2YUPA 2MMPA 4J6XA 3OYJA 5HVYB 2QGGA 1BK2A 3FEOA 1VQ4A 2EYZA 3SFMA 1QVFA 3P8BB 4J9GA 3V7CA 3HP9A 1KG1A 1PRMC 1XOVA 4M78E 3VYGA 4C92E 4F7LB 1YNZA 2KMGA 2SEMA 3EAEA 1QVFS 1G3NC 1A0NB 1VYVA 1KXUA 1X69A 4Y28E 1FX7A 3RUXA 2HNIA 5KCHA 1JSUB 4JRPA 2EKOA 3UA7A 3EIDB 2L89A 3OBYA 1K9MU 1B34A 4GLKA 1PSFA 2M9UA 1NZ9A 3V7RA 1AZGB 2DBMA 3ME9A 2CP5A 5LJ5e 5EC7A 3CPFA 1YP5A 3H6ZA 3NFCA 4N4HA 2E5KA 1RACB 1X27A 2KR6A 2XHCA 2RM4A 2CYZB 2BKZB 2IPOB 4DBRA 1UJYA 2LTOA 2V8IA 1VQLQ 3DLLA 1VQ6Q 1SF9A 4BY7X 4EOOB 3T9NA 4M7DF 1KJWA 1RABB 2E70A 5D6XA 2NUPA 3D7SB 1SRMA 1JKWA 3M53A 3KHIA 3OSSC 2PK9B 2NYSA 3OS5A 1BI0A 4QQGA 1Q81U 5HNBB 1M9SA 2F5KA 1BI1A 2RJEA 2CUDA 2MOXA 2ROLA 1YIJA 4FT2A 2QQBA 2LRQA 1GBRA 3THKA 2ROTA 4EC8B 1QCFA 2A3LA 3RERA 4A53A 2DZCA 4HVVA 3CCVT 2QAZA 3EG2A 2NUZA 3LWIA 2LJ0A 3OYYA 1WHLA 1KHIA 2RO0A 1WHMA 2BZXA 1ZP2A 3CD6T 4BCQD 1I8FA 3TU4K 1RUWA 2X9HA 2X51A 4EOSB 2DERA 2ZPEB 4HNTA 3A8MB 1NE8A 2VB6A 2RPNA 4F7UF 3CPWA 3CCRQ 4LUEA 2I53A 1ACMB 2DK3A 2GTJA 2QQRA 1PM3A 1M3BA 1OIYB 4Z6YA 2CSQA 1X75C 3HB9A 4QVDA 1JQQA 4CRIA 1QP2A 3NTHA 3VRYA 2JTMA 3BW1A 4DA4A 4C5IA 3JB9H 5CK9A 3CXCP 1ZLMA 2G77A 4F17A 4XU2A 3MP8A 2HKNA 1OPKA 2BUDA 2F2XA 2EJGA 3URGA 1KQSS 2A08A 4CFWB 4PFZA 1GL5A 4JJDA 3QDFA 1EIFA 2EKHA 4JS4A 3QYBA 2XDBA 2X4WA 4HT8A 1VQOQ 2HSPA 3PMTA 4J9HA 2ED0A 2KYBA 2K9GA 4ZGDB 2EIFA 3OYHA 4OMQA 4VUBA 2QGFB 3META 3QIIA 2W10A 1YJNQ 2X4XA 4BCOB 4CRLB 2DXUA 4EMHA 1Q81C 4JJBA 4C8QF 3QHRB 5J3BA 4E7JA 1BU2A 3BY7A 4AG2C 2E4HA 2DVJA 1HK9A 3H0FA 4HCZA 4KH1B 2UZEB 3KFVA 4BCFB 3GTMS 5GANe 4ELJA 2YWWA 1D09B 4TTHA 2WACA 1T3SA 4Y92A 2IIMA 2E1HA 5GAMh 1OIUB 1JB0E 1IZ6A 2EGCA 8AT1B 2DO3A 4HNUA 3EFRA 2PMIB 4EMKB 3AHUA 3MY1B 3K7AM 4M77G 4R0KA 3H0HA 4C8QB 2I40B 3JCMW 1ZUYA 2DEQA 1FMVA 1M1KC 1AWOA 1SHFA 4OR5B 4AI6A 1K8AR 3JCMJ 3M0PA 2FYKA 2QEXA 2EYYA 2D8HA 1K8AU 3VU3C 1W2BS 3HFOA 1PRLC 1S72Q 3X24B 4RG8A 1SSFA 4YTLA 5LJ3h 1URCB 2JTFA 3M0UA 5GANj 2P84A 3M5AA 3MP1A 5I11A 1U1TA 2J6OA 2RI3A 4KRTA 4ELYC 5FU7B 5LJ5j 4YOSA 2BZYA 3I5SA 4J7IA 3CCJA 3S3OA 2DBKA 5DY9A 1UGVA 5FU6C 4A63B 1K76A 1OZ3A 3V8LA 2JT4A 4AFQC 1KQ1A 3OYEA 3M9QA 1WNLA 1M90C 1YJNT 2IW8B 4HVUA 2RQUA 2HQXA 3DDQB 2IVWA 3MY5B 4BUGA 4R55A 2RJFA 1MMDA 2RK2A 3RR6A 3DB3A 4PJOC 1TTHB 5CIUA 2RB6A 3PIOA 4A54A 2J6KA 3V7SA 1O9KA 2CH4W 2QG9B 9ATCB 1ARKA 2KRSA 2E5QA 4D8KA 2C5NB 3CXCA 3Q1JA 1SKUB 3TNIB 1NEBA 5GAMe 1RI0A 2DAQA 4II1A 1KFZA 1WGSA 2EYWA 5A2QE 1K4US 3QJ6A 4QVZA 4O5VA 2HBWA 1AEYA 2EWNA 1C0MA 4KBMB 1VQ5Q 3CCQQ 1NG2A 1H24B 1IB8A 2L2PA 4FYVB 1AVZC 2OTJT 2L3PA 2YSQA 5LJ3g 3KUFA 2ECZA 1BIAA 2AK5A 3BG3A 5ECAA 5GAN5 1ZBXA 3CCRA 4JX6A 2BZ8A 2DM1A 5LJ3e 4KH0B 4MZTA 1K9AA 2M1HA 4PJOA 2RMOA 1UGSB 5GAOn 1JBMA 5D6WA 3GOXA 1OGUB 5FRNA 4AFZC 1QVGA 2FRYA 4M7DE 4WTOB 3SDZA 2EFIA 1GH6B 1K0SA 1UFFA 4LXCA 4M7AG 1YIJT 2VGMA 4TVRA 4XU3A 4ANJA 1GCQA 1BYMA 4A4KA 1H1QB 4XTWA 5FW9A 3JB9I 1JXOA 1J3TA 4IUTA 3UA6A 4IUQA 4CFVB 2AZSA 1PKDB 1OPLA 1QCNA 4F7UG 5GAN6 3I55T 2LNHB 1NPPA 2RF0A 3OYCA 3UPUA 1WJSA 3NTIA 1TSFA 5CYIB 4YC3B 3L2WA 4JS5A 2MK5A 3VKIA 2QK0A 4RODA 4X9CA 2CH4A 2DL4A 5IT9E 4BCIB 2KT1A 3RIRA 2JW4A 3SWNC 1WJQA 2DD5A 3S3NA 1YBYA 1YHQQ 1XQHA 1K8AC 3OS0A 4MDWA 3OY9A 3QWXX 1ZA1B 2CKKA 5CAIA 4LDVA 5DQWA 5CKBA 1H92A 4KUIA 2K5FA 4OP0A 1X43A 2FEIA 2XDDA 1E7OA 2FG0A 2QDJA 2O2OA 1PC0A 1D0ZA 1U3OA 2O01E 1UTIA 3CMAQ 4M75G 1VQ8Q 1WA7A 2EW3A 4RTXA 2DL5A 3CC7Q 3TNHB 4N0AA 2VVKA 2WHBB 2Z0WA 2KBTA 2DETA 2C0TA 3RKYA 3CPWS 3HTRA 5GAN7 1NM7A 4JJNK 5DLQE 5L2WB 3RDVA 3LQ5B 1MMGA 2WEVB 2QTXA 1YJ9T 5EJCA 4BY6C 1VQMQ 3EG1A 2YUNA 5CEIB 1Q82R 4NL3A 2HQHA 1YJWT 1C1AA 1ENWA 1FXXA 4E7SA 4KUDK 5CKDA 1ZSGA 2W9FA 5FLXE 2E3IA 4C0DB 1VQ7A 3QXEB 3G71T 2CZ6B 1N8RC 2WSEE 2J6FA 1M27C 2RI5A 1QLBA 3VYGB 2B9RA 5ICPB 3ER0A 5KYXB 4BD3A 2NUTB 1K0XA 3JCMP 2C6TB 2KK4A 2C4GB 4C8QD 2UZLB 2VASA 1K73R 3AT1B 1W98B 5EFQB 1OEBA 4FIBA 3CCVA 3PVQA 4ELZC 2RD1A 2EQIA 5GAOm 4CFXB 1D3BB 2EYXA 3JB9F 4A4GA 4JRQA 4C0DC 4J9IA 1VQPA 4WCIA 1RADB 2ZPBB 1YJWQ 2WMAB 4F6UB 2DXTA 5LL6S 2VV5A 5CKFA 2LCCA 2CSIA 1XTDA 4LUDA 1SSHA 3BDUA 1KSWA 1LOJA 5GJVB 1RAGB 1VINA 1QW1A 2KROA 1VQ5A 2ZZDA 3RESA 2WJ9A 1UGQB 3CCUT 2KGTA 4IURA 2QA4A 1K73C 1ZHIA 3UF4A 3HRUA 3CQTA 2RHZA 1BKBA 2LNVA 4BCJB 4OMNA 4PJOD 1D1AA 1M3CA 5CO7A 1BB9A 5IH2A 1U8RA 2ZPHB 2A36A 2O9VA 4P5NA 3CCEQ 3A5ZB 5CR2A 4ZTFA 3H8ZA 1VQ9T 4JPBW 3MIAB 1MNEA 3VKHA 2JMAA 1QQJA 2JNGA 1EFNA 4IUUA 2EQKA 3JCMh 2RH2A 1WXTA 1RI9A 1KQ2A 3G4ST 4BCQB 1VQNA 2C5VB 2CP0A 3G4SA 2CCHB 1CKAA 1AWWA 1QVPA 4BCNB 3EG9B 3OQ5A 3JCMV 3X26B 2FPDA 1Y07A 3OBWA 2K3XA 3TVTA 4ROCA 2RHIA 3CC2Q 1V1CA 2LX9A 4Z89A 1ABOA 4J7FA 1YI2T 1H3HA 3JB9J 1X6BA 4R56A 1I07A 2JXBA 2HDAA 2DF6A 2D0QB 1DJ7B 3LGFA 1GUXB 2XI9A 5IXBA 5LMKB 3LH5A 3OYFA 3CXCS 1MNDA 2YRCA 3OYLA 2CP2A 2R57A 2OTLT 4MDXA 1KC8C 2K3YA 3VS2A 3CD6Q 2QYZA 3QKJA 4LDUA 2FZGB 4CC3A 4FX3B 4I3ZB 2EQUA 3CMET 2NLUA 1VQLT 3HSBA 2QQ9A 3OW2P 5AYFA 2OI3A 3MKDA 4N0AC 3SD4A 3I35A 4A4FA 1WDXA 2P4RA 5GJWB 3MPUB 2NWMA 3M55A 2MPXC 5J26A 4M7DB 2ABLA 2CUBA 2OTJQ 4OMPA 2LZ6B 3J80E 3GPLA 3JCMe 1UB4A 2WSFE 3MJXA 1Y0MA 3LWHA 3JB9G 4PLIA 1D0YA 3CEYA 1EZZB 4QQDA 4FYXB 3RMQA 1WJRA 1JO8A 3QO3A 1QVGP 2K5IA 3MCAB 4PL6A 5GAOq 1NYGA 2XKOC 2KXCA 2O88A 4HT9A 1WHGA 1HD3A 1X2KA 4C92D 3RNJA 5I21A 4C92A 5GMKl 1UGRB 4MFDA 2GTOA 2K3BA 1TS9A 1FVVB 1B34B 4C8QG 4JLIA 1YN8A 3RBBB 3MEWA 4DOWA 1IO6A 1GBQA 3MHXA 4JRKA 3PE0A 1YJNA 2AIRB 1RAAB 2DXBA 4F7JB 4XQ3A 2K79A 3M4GA 1G83A 2COZA 2W0ZA 3X28B 1W1FA 3TQ7P 5LJ3d 3EOCB 3ZEHA 2V1RA 3R6OA 4HXJA 1VQOA 4BDYA 5IN1A 2HL5C 2DTOA 4J9CA 2JN0A 2HBPA 1C9BA 1X01A 2ED1A 3VUBA 1Y96B 3NGPA 3L2RA 5HCKA 4EPCA 5A0GA 5GMKh 1OKVB 4QQ6A 2F2CA 3EFOA 1VQ9A 3M0TA 2BE9B 3R6NA 4M7DC 1W4SA 5GAOr 2VUBA 4Z02A 3A98A 4DBHA 2L3SA 3E9FA 3CCLT 3CD6A 4YOOA 2ZCFB 4CI0C 2BIVA 5KYWA 2JOYA 1WPYA 1JEGA 3M56A 3E19A 2C5XB 4BACA 2Y4XA 3CCRT 2CREA 5KYYB 1PCXA 2QGSA 2FO0A 2CDTA 4M78G 3L1AA 4OVAA 4CFUB 1PSEA 2X4YA 4AMCA 5KYWB 1RAIB 1VQPT 2RHXA 2PVDB 4Y72B 1PKSA 5CKHA 3QZ9B 2JZ2A 2LJ1A 4RTUA 4RTZA 4B9XA 2L3RA 3TW6A 5IDPB 4FSXA 3M57A 5BNJB 1YIJQ 3NDQA 4JZ3A 3OS2A 1H25B 2OAUA 1AHJB 1KD1C 2DX1A 1TD6A 1D1BA 3HL8A 1VQNQ 2GQIA 2XD0A 3REBB 4KGXB 3X25B 4F7SB 1BBZA 2CS7A 2X4JA 1VQLA 1VIEA 4M75E 2LQNA 1KC8U 3C94A 1LPLA 1TFBA 3A8GB 4HKEA 2MAMA 4RMOA 2VXFA 2E10A 5HBEB 1QP3A 4J9EA 1RAEB 1KHCA 2CZ0B 1G2BA 4E7IA 3QWLA 5LJ3j 2X1NB 2GF7A 2NUPB 3DTOA 4BCND 2QA4Q 4BI4A 1IHWA 2KYMA 3LX7A 3MEAA 4JUVA 1Q82U 3DB4A 4Y91A 2D8JA 4PJJA 1N5ZA 3ZL7C 1M1KR 1Q86U 3CCET 3FJ5A 2EVRA 1BI2A 3PGGA 5D6YA 1M8MA 1VQPQ 3ASKA 1YITT 1JJ2P 3EG9A 5FGKB 1R8OB 1WHKA 3EH1A 3SWNA 1WXUA 3JSCA 4IUVA 3MP6A 3BG5A 4RTYA 4BI3A 2DEUA 1B3QA 2MIOA 4M7DD 1M90U 2ESWA 4IIOA 4J83A 3G6EQ 4M7DA 2V26A 5GAOl 1JOWA 2W96A 1P92A 3SB2A 4E7ZA 2Y90A 1KQSA 4DEXA 3EFSA 5KYUA 2OX7A 3OW2S 1TUCA 4IMYB 1PNJA 2LQ8A 4JLGA 1E9HB 4C92F 2JMCA 1FMWA 1E7PA 4M7AD 2JVVA 2PNIA 4UC4A 3CBPA 4B6MA 1VQMA 2DD4A 2QI2A 4OGEA 3L42A 1H3ZA 3HHTB 4BCGB 5GANg 3CPWP 1M1FA 1NEGA 1B07A 5A0LA 1VQ7T 1M8VA 4BDZA 4OB1B 3M0QA 3VRZA 3QPHA 1K9MC 2GGRA 5LJ5g 1X6GA 3CC7T 4EOPB 3CC7A 2LJ3A 2HAXA 1Y71A 3H4CA 3G1JA 4C0FA 4C5HA 2IW6B 4L6V5 4II5B 4EORB 2C5OB 4F6WB 1RLQC 4EOIB 3ZBDA 4ORZA 2QFZA 3MEUA 2ZAEA 4C92C 1BCOA 1MHNA 5HQ0B 4MIMA 4BY6B 3CCMT 2PK2A 2P0QA 3V8KA 3CCMA 2E64A 4HA8A 3G33B 2G6FX 4OGCA 5KE3A 1VOMA 2E3HA 1D3BA 4XU0A 4F14A 2BE7D 2KSSA 2V8JA 4ZN1A 1AD5A 3HBLA 2VKNA 2PJQA 3GP8A 3OS1A 1YHQA 4PFOA 2W2HA 1AT1B 4BCMD 2M16A 1HJDA 4XTZA 1I81A 1H1SB 2K5LA 2QA4T 5FROA 1K9MR 3DLMA 4A4EA 5LJ3f 4AG1C 3EJ1B 2MCNA 5CQXA 1YWOA 2CT4A 2GFUA 2P0PA 1FINB 2ZPIB 3MO8A 5HY6A 2F1LA 3JAME 1AD6A 3G71Q 2XU8A 4XTUA 2CP7A 5GMKj 4RUGA 2DJQA 1SHGA 4PJOE 4BE0A 1AOJA 3C0CA 2W9ZA 1VQKQ 2BTTA 2QF7A 2K7AA 4M78D 4MZMA 2R5AA 2AHJB 4KRCB 2VYTA 4JX5A 7AT1B 1Q81R 2LX7A 2UZDB 4QKUA 5IF1B 2RQTA 1F5QB 1QVFP 1TUDA 4J9DA 3PIPA 2QASA 3OA6A 4RTTA 4L5GA 2F5TX 3HKSA 3CCLQ 2Y4YA 5KYXA 2YUQA 1C6VX 4F04B 3FIFA 3CC4A 2X3XD 1Q86C 2RA2A 4X34A 1BU1A 5GMKm 2KVQG 1NJIC 1TU0B 3NMZC 3GIBA 2D9TA 2LDMA 5L8RE 2GNCA 4JDSA 2FB7A 1YJ9Q 4F7NB 4FYWB 4C8QE 3F5XB 1UG1A 3INZA 1QLYA 3CCJT 3QWYA 2JTEA 2W99A 3WXMB 1IRXA 3CCQA 4EDUA 4PJMA 4DBQA 2MYSA 1JJ2S 4OGRB 4PJNA 3QJYA 1VQ9Q 1UDLA 2DYIA 3EG3A 4FM4B 1MUZA 1VQ8T 2D6FA 3WVDB 1G5VA 3LGLA 3RKWA 1G3SA 2KRNA 3QSUA 4BCPB 2ZZDB 3LYIA 4LDXA 2YUOA 2H8HA 4HCCA 2HL3A 2J05A 1SG5A 3PTAA 2C06A 3M03A 1QVGS 1TUGB 1OL2B 1Z9QA 4ME7A 1E6HA 2E41A 2HD0A 2DTHA 2EGEA 2VC8A 1W70A 1FYNA 1WIEA 4BCMB 2MI6A 4F6SB 2HKQB 2CJMB 5GAMd 2LQWA 3M59A 5GMKe 1YCYA 1R0CB 2PHGA 5LJ5h 5IHKA 3EGXB 4HCBA 1VYWB 4HLQA 2KMTA 4ZNXA 1EX4A 2CZ7B 2PVGB 3UATA 4EOQB 2P4TA 2RN8A 1N8RR 1CSKA 2FPEA 3M0SA 2B8AA 1M5Q1 2RK1A 5EG2A 2PU9B 2BPMB 3E1SA 1D3UB 2FVUA 1VOLA 2AKLA 2PQWA 2HSEB 4X1VA 3BLQB 3C12A 1X6OA 3I55Q 1NJIU 1JSTB 4EMKA 4NSTB 1IGQA 5HBHB 4MMKA 3PMIA 2KDSA 1YI2A 1TH7A 1OV3A 1G3YA 1W2BP 5CVIA 4FCYA 4M78A 2YT6A 4OB3B 1O9KB 2WIPB 5DLOA 2CP6A 3OYAA 4L59A 2R7GA 1Y7XA 3PO3S 2EPDA 2RHYA 1LJOA 3POMA 1OULA 1QMCA 2IN3A 3DL1A 3RGFB 4GLMA 4ROEA 4ATOA 1HSQA 2CGHA 1YI2Q 3EFOB 3JCMf 4ZGEB 2DL3A 3PFSA 3FLGA 4CFUD 1JRIA 1W6XA 2AKKA 4M75B 1T0JA 3I55A 5ACBA 3MI9B 1QKWA 3QG1A 1GXIE 3VS5A 4Z8AA 2RQVA 4E6RA 2DD4B 2HMAA 2M02A 1Y96A 1UE9A 2YLBA 3HRTA 2DA9A 3O0GD 2K6DA 4E47A 2DE0X 1U06A 3FC3A 3GBQA 3QHWB 1M1KU 3EG0A 2EQJA 1I4K1 1Q95G 3P8DA 4BCHB 1IGUA 1M30A 3KXTA 4DOVA 3LW5E 1OX9A 3CC2A 2F69A 3I56T 4Q5WA 2EBPA 2HQEA 2YHTA 2BS2A 2RHUA 3LLRA 4FW2A 2DIQA 1NBEB 2CCIB 3KBGA 3QYEA 4XK8E 2JS2A 4OMFB 3OYKA 2XG8D 1E6GA 3BHTB 1UHCA 1RL2A 3TREA 4HVWA 4XTVA 4C8QA 2J7IA 4OMLA 2KXDA 2CT3A 2EUFA 1OL1B 4RTWA 1AZEA 1UNHD 2RQRA 1KIKA 1N4MA 1GCQC 1HYOA 1CKBA 4C5GA 4M77E 2DL8A 3JCMc 1WZOA 1RAHB 4JZ4A 3JB9D 2K2MA 4FL6A 4DQ2A 1ZQ1A 1WHJA 1PG5B 4C8QC 2C0IA 2ZPFB 5GANd 3BHVB 1YJ9A 4GY5A 1PD0A 2KQWA 1YJWA 8ATCB 1O9SA 2QQSA 2KE9A 2QXFA 4KGZB 4XTXA 4PK4A 3EH2A 1UUEA 1G8XA 1WHHA 3CC4Q 1HXDA 3REAB 4BE1A 3CCVQ 5AT1B 4F16A 1ZSZC 3DDPB 4AKGA 2FZCB 4NS5A 2WMBB 4IIMA 4PJOF 5GAMg 1GUXA 3CBMA 5GAOp 5DQVA 1PHTA 4LE9A 5IHNA 2DIGA 5FU7C 3X20B 2QDLA 4M7AC 2VWFA 3BFMA 2QEXT 3QHSA 1N9SA 2L0AA 4LN2A 2O4XB 4MFEA 2JM8A 3FDRA 1VQKA 1QWEA 3QZ5B 5FU6B 1UNLD 1M4ZA 4M78B 2XK0A 4HL4A 4CFNB 3EHQA 3TCJA 1VQ6A 3WVEB 1W2BA 3OMCA 1MV3A 1VA7A 1KK7A 2V1QA 2LCSA 1VQMT 3BG9A 1M1GA 1H26B 4M7DG 3I9QA 3EHRA 3GF5A 2GQVA 3PVLA 1GRIA 2D1XA 4J9BA 4O6JA 3JCMb 1JXMA 3OYIA 3DOGB 3NHNA 4EOKB 2MWPA 2DLPA 1H27B 2FL7A 2DRKA 3CMAA 4BB7A 2M0YA 3HO8A 2PZ1A 2RNAA 1AISB 4FW1A 4JRIA 4N4GA 2KAFA 5CKEA 2V8KA 3DJBA 3A8HB 2G3RA 1D1CA 2WFYB 4OMMA 4LD6A 1TOVA 1RLPC 2CZ1B 2M51A 3CCMQ 4M7AF 1OU9A 2I2LA 3IQLA 5GAMf 1VQ4Q 2A7YA 1H1PB 3UWNA 2WXVB 2X35A 2XIDA 5D7UA 1BCMA 1ZSZA 5I2SA 4RCCA 2AZVA 5HK3A 4HNVA 2KEAA 3I56Q 4XTYA 1WX6A 2QTVA 4PJOB 1N27A 1YWPA 2JGZB 5LJ5f 3ZFJA 4PNOA 1OZ2A 1XNIA 1XO2A 2VGNA 1V29B 1KD1U 1WQ7A 2V22B 2OJ2A 2KNBB 1KD1R 2QDYB 1YCSB 1UJ0A 1TWBA 1N6AA 2JS0A 3F70A 2AT1B 3JRZA 2DZ9A 5FWCA 3A1PA 4AFUC 1Q86R 1MV0B 3S6WA 5GAN4 2EQMA 2DMEA 1GCPA 2KT8A 3EGUA 1M2VA 2DXCA 3E2UA 4J9FA 1GY3B 4K11A 5IAYA 3A8OB 2DKGA 4M77C 2UZBB 3G7ZA 2GCXA 3G6EA 4B9WA 1K73U 1ABQA 1ZUUA 3GNFB 3O8VA 3PT9A 5KYYA 4DBFA 5GAN8 4ZTJA 1VQ5T 1QMZB 3HZJA 2FRWA 3BE3A 3JCMQ 2DILA 4FSSA 4DEYA 3CCUA 1LVKA 3HFNA 3CC4T 1OOTA 2A37A 4M75A 4QSHA 4HCKA 3CMAT 3NTKA 1OX8A 3JV3A 1LNXA 3TW7A 1YITA 1TG0A 2SRCA 3OYGA 1N8RU 1BIBA 2YRVA 2RI2A 4BBSM 2ATCB 1PD1A 4KRDB 4AT1B 2YLCA 4EMGA 2F2WA 4AKIA 1JJ2A 1U5SA 4XU1A 5KH6A 2BS4A 3QUIA 5GAN3 4M6VA 4EIKA 4M4ZA 5KYUB 2H3JA 5HKCA 4CC4B 1I5LA 4A4HA 2UUEB 2JUFA 2L8DA 3RMSA 3SWNB 3C95A 2HEQA 4CXAB 1ZBJA 3M54A 5GANh 3UT1A 2EJ9A 3N5BB 3VV0A 4C92G 1QWFA 3BLRB 2OTLA 3L2VA 2KR3A 4F7UA 1IREB 4CFMB 4M77B 3JCMg 4ESRA 3CMEQ 4J6WA 2K2VA 2F2VA 5LJ5d 4YOZA 3VS4A 1H1RB 2HCKA 3EGDB 3CCJQ 4BY1X 2HZYA 4M77F 1UECA 3OW2A 5FRMA 3H0IA 2JJ9A 2E65A 2I0NA 3E9GA 2P0KA 4M75C 2L5QA 3MEVA 4XAXB 5GANf 3BDLA 4M7AB 2LT4A 3EGDA 1WLPB 5KCOA 1VUBA 2LVMA 4FYYB 1S72A 2LW4A 2EYQA 1V76A 2QQAA 3OMGA 4BI8B 2FHDA 3CCST 1K1ZA 4PLLA 2QEXQ 4E7HA 2COWA 3NPFA 1S1NA 5DM7R 4E7KA 1R0BG 4LDYA 2YDLA 1RAFB 4EC9B 2RJDA 3VYHB 4ZN3A 4JJCA 4M78F 4LOCA 2EGAA 5I22A 4FT4A 2DVEA 4UN0A 3TNWB 4IUPA 2LC4A 4RCBA 1JU5C 3VS3A 1NLOC 1OQKA 2QQ8A 4PJLA 2IW9B 1BI3A 1TXQA 3TN8B 5I2MA 1X2QA 4ELLA 1SRLA 3VS0A 2LCLA 2A28A 2LP5A 4OMOA 2E6NA 6AT1B 2GFAA 4WF2A 1VQNT 1SPKA 3TSWA 5C6SA 4J5YA 3VS6A 4OB2B 3O5ZA 1MMAA 3UDCA 5I5ZB 3VKGA 3QYGB 5GMKi 1I5OB 1ZX6A 2A0FB 3EGXA 2DTIA 3OB9A 1I1JA 1I0CA 3FJPA 1G3TA 2L3QA 3FB9A 2DMOA 5L23A 1YFNA 3GLXA 1H641 2RJCA 1FKMA 1NPRA 3H41A 4X9DA 1MMNA 3M58A 4OF1A 2OTJA 2XMFA 1ZUKA 2M0OA 3S3MA 4M7AE 4LDWA 3L2QA 4KULA 3VS1A 1ZSZB 3J81E 2LMJA 1KQSP 4IKFA 1FWZA 4QW2A 4F70B 1LCKA 4F7UE 3ULRB 2DXCB 1T3LA 5IHYA 3OYDA 4LD9K 3LH0A 3V8JA 1B7TA 2NUTA 3RKXA 5HBJB 1F1BB 4N4IA 4C92B 1UGPB 1Q7YC 4M78C 4M77A 2DRMA 2MWOA 2KRMA 2D0NA 1WYXA 2PUKB 3BHUB 2WSCE 4J8OA 3QYHB 2R5MA 4V2SA 1WI7A 3QBYA 1OI1A 3HPWA 2GBQA 2ENMA 1NJIR 3CMEA 1O75A 3CCLA 2K57A 2DFUA 1QKXA 4NC6A 3L2UA 2OTLQ 3C4SA 5IHIA 5M9OA 1Q82C 1OYXA 3JCMd 1Z9ZA 4QT7A 4MZPA 3SEMA 1IXDA 2E12A 4Z88A 4CC7A 3G4SQ 3OYMA 5KYNA 2VXEA 4EOLB 5HK0A 4FU6A 1VYTA 4BE2A 1PKTA 2O4XA 4E2FB 2G9XB 1FMKA 2BKDN 3G71A 1NYFA 3CC2T 3CBOA 3CCEA 2DJZA 1U1SA 3JCMX 3HRSA 1KC8R 2DPPB 3VJPA 1YHQT 3B57A 1Y57A 2CP3A 1M3AA 5A0DA 1N9RA 1P5EB 1VQ4T 1UHFA 2O9SA 3I5RA 5CQYA 3CCQT 1AWXA 1GFDA 2DXBB 4ZGJB 2COYA 1H28B 2KY9A 3P8HA 3VS7A 4BCKB 2YXYA 4NOYA 1WQWA 2FPFA 1YITQ 2DNUA 4D8DA 5C0MA 2KI7A 4RG2A 1OU8A 2WPAB 2DYBA 3QDRB 4F7UB 2K4YA 2LT1A 2IVXA 1WFWA 3L2ZA 2EAYA 2DD5B 5IXFA 1G3WA 1GFCA 1Q7YR 3TSZA 3OYNA 2ZPGB 3OYBA 5GAMj 1M2VB 4G6LB 2PVOB 5FWBA 3CCUQ 1Q7YU 1T0HA 4RKUE 3FRNA 4LNPA 1QCOA 4GBQA 2MF2A 2LQKA 2XICA 3H9NA 2ZGWA 4NL2A 3VUZA 3M0RA 4QVCA 4RTVA 4MMLA 1AWJA 5CCAA 4EOMB
chains in the Genus database with same CATH topology
5IT9E 1M90U 3DKMA 3RIRA 4J83A 4M75F 3SWNC 4J6YA 4O6JA 4M7DA 3JCMb 3TEEA 5GAOl 1WJQA 2DD5A 3OYIA 1P92A 3SB2A 3S3NA 1YBYA 2Y90A 1XQHA 1KQSA 2MWPA 3GNGA 2E6ZA 3EFSA 2FL7A 5J39A 3OW2S 1K8AC 3OS0A 2LQ8A 4JLGA 3CMAA 2EJFA 4MDWA 4BB7A 4C92F 3HO8A 4M75D 4PKCC 3OY9A 2CKKA 4EMKC 4JRIA 5CAIA 3CCSA 4N4GA 5KE2A 2KAFA 5CKEA 1UEBA 2V8KA 4C0ZA 4LDVA 3J7AF 3A8HB 1E7PA 3OSVA 4KUIA 5CKBA 1VIFA 2G3RA 4M7AD 2JVVA 4UC4A 3CBPA 2K5FA 4M7AA 4LD6A 2CZ1B 2DD4A 2QI2A 4OP0A 1VQMA 4M7AF 2I2LA 4KT0E 5GAMf 4OGEA 1MGQA 4AKHA 2A7YA 4OB0B 2XDPA 3L42A 3UWNA 2XDDA 2X35A 1H3ZA 2XIDA 2QDJA 3HHTB 2BS3A 5GANg 3A8LB 4BBRM 4M77D 4BD3A 1M1FA 5GAN2 2O01E 5I2SA 4RCCA 5HK3A 4HNVA 5A0LA 1VQKT 4M75G 4XTYA 1VQ7T 4PJOB 1N27A 1S72T 4N0AA 4BDZA 4JX4A 1M8VA 1VQ6T 4OB1B 5LJ5f 4PJOG 3ZFJA 3QPHA 3PNWC 4PNOA 1OZ2A 3M4YA 5LJ5g 1K9MC 3CC7T 3CC7A 1XNIA 3I56A 3RKYA 4D6WA 1VQ8A 2VGNA 1Y71A 3H4CA 4C5HA 4C0FA 2HAXA 3CPWS 1V29B 3G6ET 1KD1U 4L6V5 1WQ7A 2R58A 5GAN7 1VQOT 3ZBDA 4JJNK 5DLQE 4C5EA 2QFZA 4C0GA 2QDYB 2IG0A 2PUOB 3MEUA 4E7LA 4C92C 1MHNA 2MMPA 4J6XA 2QTXA 3OYJA 1YJ9T 3FEOA 4MIMA 1VQ4A 4BY6B 3CCMT 3SFMA 1QVFA 5EJCA 3P8BB 3V7CA 2P0QA 4BY6C 3V8KA 3CCMA 1N6AA 3HP9A 3F70A 1KG1A 2E64A 1XOVA 4HA8A 4M78E 4OGCA 3VYGA 3JRZA 4C92E 5KE3A 4NL3A 2DZ9A 1YJWT 2KMGA 1D3BA 1FXXA 4XU0A 2KSSA 4KUDK 5CKDA 2V8JA 3S6WA 5GAN4 3EAEA 2EQMA 1QVFS 4ZN1A 5FLXE 2DXCA 4C0DB 1VQ7A 3QXEB 3HBLA 4Y28E 1FX7A 3RUXA 3G71T 3GP8A 2HNIA 2CZ6B 5KCHA 1N8RC 2WSEE 3OS1A 2RI5A 1YHQA 4JRPA 5IAYA 3A8OB 2EKOA 2L89A 1QLBA 3VYGB 2M16A 3OBYA 3ER0A 2DKGA 4M77C 1K9MU 1B34A 4GLKA 1PSFA 2M9UA 2GCXA 1NZ9A 3G7ZA 4XTZA 3V7RA 4B9WA 1I81A 3G6EA 3ME9A 5LJ5e 3JCMP 1K73U 2K5LA 2QA4T 5FROA 2KK4A 3DLMA 4A4EA 4C8QD 5LJ3f 3GNFB 3O8VA 3PT9A 5CQXA 5GAN8 4ZTJA 4FIBA 1VQ5T 2GFUA 3HZJA 3CPFA 2P0PA 3NFCA 3H6ZA 3JCMQ 3CCVA 2ZPIB 3MO8A 4N4HA 5HY6A 4ELZC 2RD1A 3CCUA 3JAME 2KR6A 5GAOm 2XHCA 2RM4A 2CYZB 3HFNA 3CC4T 1D3BB 3JB9F 4A4GA 4JRQA 2LTOA 2V8IA 2XU8A 4XTUA 4C0DC 1VQPA 5GMKj 3DLLA 3T9NA 2ZPBB 4M7DF 4M75A 4BE0A 1YIJT 4QSHA 4PJOE 2DXTA 3CMAT 5LL6S 2E70A 2VV5A 5CKFA 2QF7A 5D6XA 3NTKA 4M78D 2LCCA 4MZMA 2R5AA 2AHJB 1XTDA 2VYTA 4JX5A 1LNXA 3TW7A 3M53A 3KHIA 3BDUA 3OSSC 1LOJA 3OS5A 1YITA 1BI0A 3OYGA 4QQGA 1N8RU 1QW1A 1Q81U 1VQ5A 1M9SA 2ZZDA 1BIBA 1BI1A 2F5KA 3RESA 2YRVA 3PIPA 2RJEA 2WJ9A 3OA6A 1UGQB 4L5GA 4FT2A 3CCUT 2QQBA 4IURA 2F5TX 2QA4A 2LRQA 1YIJA 1Q82U 2RI2A 1K73C 1ZHIA 3HRUA 4BBSM 3HKSA 2RHZA 2A3LA 3RERA 2Y4YA 1BKBA 4A53A 2LNVA 2YLCA 4EMGA 2DZCA 3CCVT 4PJOD 4AKIA 5CO7A 1JJ2A 3FIFA 1U8RA 3LWIA 2ZPHB 4XU1A 2BS4A 5KH6A 3CC4A 3OYYA 4P5NA 1KHIA 2RO0A 1Q86C 3A5ZB 3QUIA 5CR2A 5GAN3 3CD6T 4ZTFA 4M6VA 3H8ZA 1VQ9T 1I8FA 2RA2A 4X34A 2H3JA 5HKCA 3TU4K 5GMKm 2KVQG 1I5LA 3VKHA 4A4HA 1NJIC 2ZPEB 4HNTA 2JUFA 2D9TA 2LDMA 5L8RE 3A8MB 1NE8A 2JNGA 4JDSA 2FB7A 2L8DA 3RMSA 4F7UF 3SWNB 3CPWA 3C95A 4IUUA 2EQKA 3JCMh 2RH2A 4C8QE 1KQ2A 3G4ST 1VQNA 2DK3A 3INZA 3G4SA 2QQRA 1QVPA 3CCJT 3M54A 5GANh 3UT1A 2EJ9A 3WXMB 3JCMV 3OQ5A 4EDUA 4Z6YA 3CCQA 3N5BB 3VV0A 4C92G 3X26B 1X75C 1Y07A 3OBWA 2K3XA 3HB9A 4QVDA 1JJ2S 2OTLA 4CRIA 1QP2A 3L2VA 3NTHA 2JTMA 3QJYA 2RHIA 4F7UA 1IREB 3BW1A 4M77B 3JCMg 4DA4A 4J6WA 4FM4B 2LX9A 4C5IA 2K2VA 5CK9A 3JB9H 2G77A 4J7FA 5LJ5d 1VQ8T 1YI2T 2D6FA 3WVDB 1G5VA 3LGLA 4XU2A 3RKWA 3JB9J 1G3SA 3MP8A 3QSUA 4R56A 2BUDA 2ZZDB 3LYIA 4LDXA 4HCCA 2D0QB 2EJGA 3URGA 1DJ7B 3LGFA 1KQSS 3PTAA 2C06A 2XI9A 3CXCS 4M77F 3OYFA 3OW2A 5FRMA 1EIFA 4JS4A 3QYBA 3OYLA 2XDBA 2E65A 2X4WA 2R57A 1QVGS 4HT8A 2OTLT 4MDXA 3E9GA 2P0KA 4M75C 2L5QA 3MEVA 4ME7A 3PMTA 2E41A 2K3YA 4XAXB 5GANf 1KC8C 2HD0A 2DTHA 3BDLA 4M7AB 2LT4A 2MI6A 2VC8A 4ZGDB 2EIFA 3OYHA 3QKJA 1VUBA 5KCOA 2LVMA 4LDUA 1S72A 2EYQA 4VUBA 5GAMd 3META 2EQUA 3CMET 2QQAA 2NLUA 1VQLT 3M59A 2QQ9A 3QIIA 1YCYA 3OMGA 4BI8B 2FHDA 2X4XA 5AYFA 4EMHA 5GMKe 2DXUA 3CCST 4N0AC 4PLLA 1Q81C 3SD4A 5LJ5h 4C8QF 4E7HA 5J3BA 4A4FA 4HCBA 4E7JA 5DM7R 4E7KA 4LDYA 4HLQA 2KMTA 3M55A 2CZ7B 2PVGB 3VYHB 2RJDA 3BY7A 5J26A 4ZN3A 4M7DB 4M78F 3HSBA 2P4TA 3J80E 3GPLA 4LOCA 1UB4A 3JCMe 2B8AA 2WSFE 4FT4A 1M5Q1 1HK9A 2RK1A 4HCZA 3LWHA 5EG2A 2PU9B 2DVEA 3JB9G 3E1SA 2FVUA 4IUPA 2LC4A 4PLIA 5GANe 3CEYA 4RCBA 4ELJA 2PQWA 4QQDA 3RMQA 1WJRA 3C12A 2WACA 2QQ8A 3QO3A 1X6OA 2K5IA 3MCAB 1NJIU 4PL6A 1BI3A 4EMKA 5I2MA 2E1HA 5GAOq 5GAMh 2XKOC 1JB0E 4MMKA 1IZ6A 2LCLA 3PMIA 2KDSA 4C92D 1YI2A 4HT9A 2DO3A 1TH7A 5I21A 1G3YA 4HNUA 3EFRA 5CVIA 4C92A 4EMKB 3AHUA 4M77G 1UGRB 4M78A 5GMKl 4OB3B 4MFDA 2E6NA 2GFAA 4C8QB 5DLOA 4WF2A 3JCMW 2DEQA 1B34B 4C8QG 3OYAA 1M1KC 4L59A 4JLIA 1VQNT 4AI6A 1Y7XA 3MEWA 4DOWA 2RHYA 4J5YA 1LJOA 5C6SA 3JCMJ 4OB2B 2FYKA 3MHXA 4JRKA 2QEXA 1K8AU 3UDCA 3VU3C 1YJNA 3DL1A 2DXBA 1W2BS 3HFOA 1VQ6A 4XQ3A 4ATOA 2CGHA 3VKGA 3M4GA 3QYGB 3X24B 4RG8A 1SSFA 4YTLA 5LJ3h 3JCMf 3X28B 4ZGEB 5GMKi 3PFSA 3FLGA 2JTFA 2DTIA 1JRIA 3OB9A 5LJ3d 5GANj 3ZEHA 4M75B 3FJPA 1G3TA 3M5AA 3MP1A 3I55A 3FB9A 1U1TA 3R6OA 1VQOA 3QG1A 1GXIE 4BDYA 5IN1A 3GLXA 1H641 2RI3A 2RJCA 4ELYC 2DD4B 5FU7B 1FKMA 5LJ5j 1NPRA 1Y96A 2YLBA 2DTOA 4X9DA 3HRTA 3M58A 4J7IA 3CCJA 3S3OA 4OF1A 5DY9A 2OTJA 2JN0A 2HBPA 4E47A 1X01A 2M0OA 3VUBA 3FC3A 1Y96B 3L2RA 3S3MA 5FU6C 1M1KU 4M7AE 4LDWA 3L2QA 4EPCA 2EQJA 1I4K1 1OZ3A 4KULA 3V8LA 3P8DA 1KQ1A 3OYEA 5A0GA 5GMKh 3M9QA 3J81E 3KXTA 1WNLA 4QQ6A 4DOVA 1M90C 1YJNT 3LW5E 3CC2A 2F69A 1VQ9A 4IKFA 1FWZA 3I56T 4Q5WA 4QW2A 2HQEA 4F7UE 4M7DC 1W4SA 5GAOr 2DXCB 2YHTA 2BS2A 2RHUA 3LLRA 3OYDA 2HQXA 2VUBA 4Z02A 2DIQA 2IVWA 4BUGA 4R55A 2RJFA 4LD9K 3LH0A 3KBGA 2RK2A 3V8JA 4PJOC 3DB3A 3QYEA 3E9FA 3CCLT 4XK8E 3CD6A 2ZCFB 4OMFB 3OYKA 4CI0C 2BIVA 2XG8D 2JOYA 1WPYA 5CIUA 2RB6A 1RL2A 3RKXA 4N4IA 3TREA 3M56A 4C92B 3E19A 4XTVA 4A54A 3PIOA 2Y4XA 4BACA 3CCRT 3V7SA 4C8QA 1UGPB 1Q7YC 4M78C 4M77A 4M78G 2MWOA 3L1AA 2E5QA 4OVAA 3CXCA 3Q1JA 1PSEA 2X4YA 2PUKB 5GAMe 2WSCE 1RI0A 4J8OA 3QYHB 2R5MA 2DAQA 4V2SA 4II1A 1VQPT 3QBYA 1WGSA 1OI1A 2PVDB 2RHXA 3HPWA 5A2QE 5CKHA 3QZ9B 2JZ2A 3CMEA 4B9XA 1O75A 2L3RA 3TW6A 3QJ6A 3CCLA 2K57A 4QVZA 4O5VA 4C5GA 4M77E 4FSXA 3JCMc 3M57A 4RMOA 4NC6A 3L2UA 3C4SA 2EWNA 5M9OA 3OS2A 4KBMB 3JB9D 1Q82C 1OYXA 3JCMd 4FL6A 4DQ2A 2OAUA 1AHJB 4MZPA 1ZQ1A 1KD1C 2E12A 2OTJT 3OYMA 2VXEA 5LJ3g 3HL8A 3KUFA 2XD0A 4C8QC 2ZPFB 1BIAA 5GANd 3BG3A 5HK0A 5GAN5 1ZBXA 3CCRA 4JX6A 5LJ3e 1YJ9A 4FU6A 4GY5A 2KQWA 4MZTA 3X25B 4BE2A 1YJWA 2O4XA 1O9SA 2M1HA 2QQSA 2QXFA 2CS7A 2X4JA 1VQLA 1VIEA 4M75E 4PJOA 2BKDN 3GIBA 1KC8U 3C94A 4XTXA 3G71A 3CC2T 3A8GB 3CBOA 3CCEA 1UGSB 1U1SA 2DJZA 2MAMA 2E10A 2VXFA 4HKEA 5GAOn 1JBMA 3HRSA 5D6WA 3JCMX 1HXDA 4BE1A 3GOXA 2DPPB 5FRNA 1QP3A 1QVGA 3VJPA 1YHQT 1KHCA 2CZ0B 4AKGA 4NS5A 4E7IA 3QWLA 4M7DE 5A0DA 3SDZA 4PJOF 2EFIA 1N9RA 5LJ3j 5GAMg 2GF7A 1VQ4T 3CCQT 5CQYA 3CBMA 5GAOp 4BI4A 2DXBB 4ZGJB 4M7AG 2KY9A 3LX7A 3MEAA 3P8HA 2DIGA 2VGMA 4JUVA 5FU7C 3X20B 3DB4A 1WQWA 4NOYA 4TVRA 3BFMA 4XU3A 4Y91A 3QHSA 2QEXT 4M7AC 4A4KA 1BYMA 1N9SA 5C0MA 4XTWA 3JB9I 2O4XB 4RG2A 1Q86U 3CCET 4IUTA 4MFEA 4IUQA 3FDRA 1VQKA 3QDRB 4F7UB 2K4YA 2LT1A 3QZ5B 5FU6B 1BI2A 3L2ZA 1M4ZA 3PGGA 4M78B 2XK0A 4HL4A 2EAYA 2DD5B 5D6YA 3TCJA 4F7UG 5GAN6 3I55T 3WVEB 1G3WA 1NPPA 3ASKA 3OMCA 3OYCA 1W2BA 1YITT 3OYNA 3UPUA 2ZPGB 3OYBA 1VQMT 3BG9A 1WJSA 1M1GA 1R8OB 3NTIA 5GAMj 4M7DG 2PVOB 3L2WA 1Q7YU 4JS5A 4RKUE 3SWNA 3FRNA 3JSCA 4IUVA 3VKIA 3GF5A 2MF2A 2LQKA 2XICA 2ZGWA 3MP6A 4NL2A 3BG5A 4BI3A 3VUZA 4X9CA 4QVCA 2GQVA 4MMLA 5CCAA 4M7DD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DD5 A;  2ZPB B;  1UGP B;  2CZ7 B;  2PVG B;  3VYH B;  2AHJ B;  1PSE A;  2PUK B;  2WSF E;  2WSC E;  3QYH B;  2PU9 B;  2ZZD A;  3A8H B;  2PVD B;  3QZ9 B;  1UGQ B;  2CZ1 B;  2DD4 A;  4KT0 E;  4OB0 B;  1JB0 E;  3HHT B;  1AHJ B;  3A8L B;  2ZPH B;  1UGR B;  2O01 E;  4OB3 B;  2ZPF B;  3X25 B;  4OB1 B;  2ZPE B;  5L8R E;  3A8M B;  4OB2 B;  1V29 B;  3A8G B;  2DXB A;  1UGS B;  4L6V 5;  2DPP B;  1QP3 A;  3QYG B;  3X24 B;  2QDY B;  2PUO B;  3X26 B;  3X28 B;  4ZGE B;  2CZ0 B;  1QP2 A;  1IRE B;  4FM4 B;  1GXI E;  3VYG A;  2DXB B;  4ZGJ B;  2DD4 B;  3WVD B;  3X20 B;  2ZZD B;  2DXC A;  3QXE B;  2D0Q B;  4Y28 E;  1DJ7 B;  2CZ6 B;  2WSE E;  3QZ5 B;  3A8O B;  3VYG B;  2DD5 B;  3WVE B;  1PSF A;  3LW5 E;  2ZPG B;  2PVO B;  4RKU E;  4ZGD B;  2DXC B;  2ZPI B;  4XK8 E;  2ZCF B;  2CYZ B; 
#chains in the Genus database with same CATH topology
 3DKM A;  4M75 F;  4J6Y A;  2PTK A;  3TEE A;  4EON B;  1XJW B;  1M90 R;  4EOJ B;  3GNG A;  2E6Z A;  5J39 A;  1OI9 B;  1VQ7 Q;  2O31 A;  2EJF A;  2WIH B;  4M75 D;  4PKC C;  1M2O A;  4EMK C;  4AFS C;  3CCS A;  5KE2 A;  2B86 A;  1UEB A;  4C0Z A;  3J7A F;  3OSV A;  1VIF A;  1OKW B;  3SHW A;  4M7A A;  2H3E B;  1ZA2 B;  4KT0 E;  2JM9 A;  2OAW A;  1MGQ A;  4AKH A;  4OB0 B;  2XDP A;  1R77 A;  2C0O A;  3BLH B;  1UNG D;  2J06 A;  5LQF B;  1H8K A;  3U23 A;  3CCS Q;  2BS3 A;  3A8L B;  4BBR M;  2RQW A;  4M77 D;  5GAN 2;  1NLP C;  4KGV B;  1D0X A;  2FZK B;  1VQK T;  4CC2 A;  2X3W D;  1VYU A;  4BXX X;  1SEM A;  5IDN B;  1S72 T;  1IHV A;  4JX4 A;  2YRD A;  1VQ6 T;  1H4L D;  4PJO G;  3PNW C;  3M4Y A;  2DL7 A;  3I56 A;  4D6W A;  1VQ8 A;  3G6E T;  2R58 A;  4PFP A;  1VQO T;  4C5E A;  4C0G A;  2IG0 A;  2PUO B;  1PWT A;  1WXB A;  4E7L A;  2YUP A;  2MMP A;  4J6X A;  3OYJ A;  5HVY B;  2QGG A;  1BK2 A;  3FEO A;  1VQ4 A;  2EYZ A;  3SFM A;  1QVF A;  3P8B B;  4J9G A;  3V7C A;  3HP9 A;  1KG1 A;  1PRM C;  1XOV A;  4M78 E;  3VYG A;  4C92 E;  4F7L B;  1YNZ A;  2KMG A;  2SEM A;  3EAE A;  1QVF S;  1G3N C;  1A0N B;  1VYV A;  1KXU A;  1X69 A;  4Y28 E;  1FX7 A;  3RUX A;  2HNI A;  5KCH A;  1JSU B;  4JRP A;  2EKO A;  3UA7 A;  3EID B;  2L89 A;  3OBY A;  1K9M U;  1B34 A;  4GLK A;  1PSF A;  2M9U A;  1NZ9 A;  3V7R A;  1AZG B;  2DBM A;  3ME9 A;  2CP5 A;  5LJ5 e;  5EC7 A;  3CPF A;  1YP5 A;  3H6Z A;  3NFC A;  4N4H A;  2E5K A;  1RAC B;  1X27 A;  2KR6 A;  2XHC A;  2RM4 A;  2CYZ B;  2BKZ B;  2IPO B;  4DBR A;  1UJY A;  2LTO A;  2V8I A;  1VQL Q;  3DLL A;  1VQ6 Q;  1SF9 A;  4BY7 X;  4EOO B;  3T9N A;  4M7D F;  1KJW A;  1RAB B;  2E70 A;  5D6X A;  2NUP A;  3D7S B;  1SRM A;  1JKW A;  3M53 A;  3KHI A;  3OSS C;  2PK9 B;  2NYS A;  3OS5 A;  1BI0 A;  4QQG A;  1Q81 U;  5HNB B;  1M9S A;  2F5K A;  1BI1 A;  2RJE A;  2CUD A;  2MOX A;  2ROL A;  1YIJ A;  4FT2 A;  2QQB A;  2LRQ A;  1GBR A;  3THK A;  2ROT A;  4EC8 B;  1QCF A;  2A3L A;  3RER A;  4A53 A;  2DZC A;  4HVV A;  3CCV T;  2QAZ A;  3EG2 A;  2NUZ A;  3LWI A;  2LJ0 A;  3OYY A;  1WHL A;  1KHI A;  2RO0 A;  1WHM A;  2BZX A;  1ZP2 A;  3CD6 T;  4BCQ D;  1I8F A;  3TU4 K;  1RUW A;  2X9H A;  2X51 A;  4EOS B;  2DER A;  2ZPE B;  4HNT A;  3A8M B;  1NE8 A;  2VB6 A;  2RPN A;  4F7U F;  3CPW A;  3CCR Q;  4LUE A;  2I53 A;  1ACM B;  2DK3 A;  2GTJ A;  2QQR A;  1PM3 A;  1M3B A;  1OIY B;  4Z6Y A;  2CSQ A;  1X75 C;  3HB9 A;  4QVD A;  1JQQ A;  4CRI A;  1QP2 A;  3NTH A;  3VRY A;  2JTM A;  3BW1 A;  4DA4 A;  4C5I A;  3JB9 H;  5CK9 A;  3CXC P;  1ZLM A;  2G77 A;  4F17 A;  4XU2 A;  3MP8 A;  2HKN A;  1OPK A;  2BUD A;  2F2X A;  2EJG A;  3URG A;  1KQS S;  2A08 A;  4CFW B;  4PFZ A;  1GL5 A;  4JJD A;  3QDF A;  1EIF A;  2EKH A;  4JS4 A;  3QYB A;  2XDB A;  2X4W A;  4HT8 A;  1VQO Q;  2HSP A;  3PMT A;  4J9H A;  2ED0 A;  2KYB A;  2K9G A;  4ZGD B;  2EIF A;  3OYH A;  4OMQ A;  4VUB A;  2QGF B;  3MET A;  3QII A;  2W10 A;  1YJN Q;  2X4X A;  4BCO B;  4CRL B;  2DXU A;  4EMH A;  1Q81 C;  4JJB A;  4C8Q F;  3QHR B;  5J3B A;  4E7J A;  1BU2 A;  3BY7 A;  4AG2 C;  2E4H A;  2DVJ A;  1HK9 A;  3H0F A;  4HCZ A;  4KH1 B;  2UZE B;  3KFV A;  4BCF B;  3GTM S;  5GAN e;  4ELJ A;  2YWW A;  1D09 B;  4TTH A;  2WAC A;  1T3S A;  4Y92 A;  2IIM A;  2E1H A;  5GAM h;  1OIU B;  1JB0 E;  1IZ6 A;  2EGC A;  8AT1 B;  2DO3 A;  4HNU A;  3EFR A;  2PMI B;  4EMK B;  3AHU A;  3MY1 B;  3K7A M;  4M77 G;  4R0K A;  3H0H A;  4C8Q B;  2I40 B;  3JCM W;  1ZUY A;  2DEQ A;  1FMV A;  1M1K C;  1AWO A;  1SHF A;  4OR5 B;  4AI6 A;  1K8A R;  3JCM J;  3M0P A;  2FYK A;  2QEX A;  2EYY A;  2D8H A;  1K8A U;  3VU3 C;  1W2B S;  3HFO A;  1PRL C;  1S72 Q;  3X24 B;  4RG8 A;  1SSF A;  4YTL A;  5LJ3 h;  1URC B;  2JTF A;  3M0U A;  5GAN j;  2P84 A;  3M5A A;  3MP1 A;  5I11 A;  1U1T A;  2J6O A;  2RI3 A;  4KRT A;  4ELY C;  5FU7 B;  5LJ5 j;  4YOS A;  2BZY A;  3I5S A;  4J7I A;  3CCJ A;  3S3O A;  2DBK A;  5DY9 A;  1UGV A;  5FU6 C;  4A63 B;  1K76 A;  1OZ3 A;  3V8L A;  2JT4 A;  4AFQ C;  1KQ1 A;  3OYE A;  3M9Q A;  1WNL A;  1M90 C;  1YJN T;  2IW8 B;  4HVU A;  2RQU A;  2HQX A;  3DDQ B;  2IVW A;  3MY5 B;  4BUG A;  4R55 A;  2RJF A;  1MMD A;  2RK2 A;  3RR6 A;  3DB3 A;  4PJO C;  1TTH B;  5CIU A;  2RB6 A;  3PIO A;  4A54 A;  2J6K A;  3V7S A;  1O9K A;  2CH4 W;  2QG9 B;  9ATC B;  1ARK A;  2KRS A;  2E5Q A;  4D8K A;  2C5N B;  3CXC A;  3Q1J A;  1SKU B;  3TNI B;  1NEB A;  5GAM e;  1RI0 A;  2DAQ A;  4II1 A;  1KFZ A;  1WGS A;  2EYW A;  5A2Q E;  1K4U S;  3QJ6 A;  4QVZ A;  4O5V A;  2HBW A;  1AEY A;  2EWN A;  1C0M A;  4KBM B;  1VQ5 Q;  3CCQ Q;  1NG2 A;  1H24 B;  1IB8 A;  2L2P A;  4FYV B;  1AVZ C;  2OTJ T;  2L3P A;  2YSQ A;  5LJ3 g;  3KUF A;  2ECZ A;  1BIA A;  2AK5 A;  3BG3 A;  5ECA A;  5GAN 5;  1ZBX A;  3CCR A;  4JX6 A;  2BZ8 A;  2DM1 A;  5LJ3 e;  4KH0 B;  4MZT A;  1K9A A;  2M1H A;  4PJO A;  2RMO A;  1UGS B;  5GAO n;  1JBM A;  5D6W A;  3GOX A;  1OGU B;  5FRN A;  4AFZ C;  1QVG A;  2FRY A;  4M7D E;  4WTO B;  3SDZ A;  2EFI A;  1GH6 B;  1K0S A;  1UFF A;  4LXC A;  4M7A G;  1YIJ T;  2VGM A;  4TVR A;  4XU3 A;  4ANJ A;  1GCQ A;  1BYM A;  4A4K A;  1H1Q B;  4XTW A;  5FW9 A;  3JB9 I;  1JXO A;  1J3T A;  4IUT A;  3UA6 A;  4IUQ A;  4CFV B;  2AZS A;  1PKD B;  1OPL A;  1QCN A;  4F7U G;  5GAN 6;  3I55 T;  2LNH B;  1NPP A;  2RF0 A;  3OYC A;  3UPU A;  1WJS A;  3NTI A;  1TSF A;  5CYI B;  4YC3 B;  3L2W A;  4JS5 A;  2MK5 A;  3VKI A;  2QK0 A;  4ROD A;  4X9C A;  2CH4 A;  2DL4 A;  5IT9 E;  4BCI B;  2KT1 A;  3RIR A;  2JW4 A;  3SWN C;  1WJQ A;  2DD5 A;  3S3N A;  1YBY A;  1YHQ Q;  1XQH A;  1K8A C;  3OS0 A;  4MDW A;  3OY9 A;  3QWX X;  1ZA1 B;  2CKK A;  5CAI A;  4LDV A;  5DQW A;  5CKB A;  1H92 A;  4KUI A;  2K5F A;  4OP0 A;  1X43 A;  2FEI A;  2XDD A;  1E7O A;  2FG0 A;  2QDJ A;  2O2O A;  1PC0 A;  1D0Z A;  1U3O A;  2O01 E;  1UTI A;  3CMA Q;  4M75 G;  1VQ8 Q;  1WA7 A;  2EW3 A;  4RTX A;  2DL5 A;  3CC7 Q;  3TNH B;  4N0A A;  2VVK A;  2WHB B;  2Z0W A;  2KBT A;  2DET A;  2C0T A;  3RKY A;  3CPW S;  3HTR A;  5GAN 7;  1NM7 A;  4JJN K;  5DLQ E;  5L2W B;  3RDV A;  3LQ5 B;  1MMG A;  2WEV B;  2QTX A;  1YJ9 T;  5EJC A;  4BY6 C;  1VQM Q;  3EG1 A;  2YUN A;  5CEI B;  1Q82 R;  4NL3 A;  2HQH A;  1YJW T;  1C1A A;  1ENW A;  1FXX A;  4E7S A;  4KUD K;  5CKD A;  1ZSG A;  2W9F A;  5FLX E;  2E3I A;  4C0D B;  1VQ7 A;  3QXE B;  3G71 T;  2CZ6 B;  1N8R C;  2WSE E;  2J6F A;  1M27 C;  2RI5 A;  1QLB A;  3VYG B;  2B9R A;  5ICP B;  3ER0 A;  5KYX B;  4BD3 A;  2NUT B;  1K0X A;  3JCM P;  2C6T B;  2KK4 A;  2C4G B;  4C8Q D;  2UZL B;  2VAS A;  1K73 R;  3AT1 B;  1W98 B;  5EFQ B;  1OEB A;  4FIB A;  3CCV A;  3PVQ A;  4ELZ C;  2RD1 A;  2EQI A;  5GAO m;  4CFX B;  1D3B B;  2EYX A;  3JB9 F;  4A4G A;  4JRQ A;  4C0D C;  4J9I A;  1VQP A;  4WCI A;  1RAD B;  2ZPB B;  1YJW Q;  2WMA B;  4F6U B;  2DXT A;  5LL6 S;  2VV5 A;  5CKF A;  2LCC A;  2CSI A;  1XTD A;  4LUD A;  1SSH A;  3BDU A;  1KSW A;  1LOJ A;  5GJV B;  1RAG B;  1VIN A;  1QW1 A;  2KRO A;  1VQ5 A;  2ZZD A;  3RES A;  2WJ9 A;  1UGQ B;  3CCU T;  2KGT A;  4IUR A;  2QA4 A;  1K73 C;  1ZHI A;  3UF4 A;  3HRU A;  3CQT A;  2RHZ A;  1BKB A;  2LNV A;  4BCJ B;  4OMN A;  4PJO D;  1D1A A;  1M3C A;  5CO7 A;  1BB9 A;  5IH2 A;  1U8R A;  2ZPH B;  2A36 A;  2O9V A;  4P5N A;  3CCE Q;  3A5Z B;  5CR2 A;  4ZTF A;  3H8Z A;  1VQ9 T;  4JPB W;  3MIA B;  1MNE A;  3VKH A;  2JMA A;  1QQJ A;  2JNG A;  1EFN A;  4IUU A;  2EQK A;  3JCM h;  2RH2 A;  1WXT A;  1RI9 A;  1KQ2 A;  3G4S T;  4BCQ B;  1VQN A;  2C5V B;  2CP0 A;  3G4S A;  2CCH B;  1CKA A;  1AWW A;  1QVP A;  4BCN B;  3EG9 B;  3OQ5 A;  3JCM V;  3X26 B;  2FPD A;  1Y07 A;  3OBW A;  2K3X A;  3TVT A;  4ROC A;  2RHI A;  3CC2 Q;  1V1C A;  2LX9 A;  4Z89 A;  1ABO A;  4J7F A;  1YI2 T;  1H3H A;  3JB9 J;  1X6B A;  4R56 A;  1I07 A;  2JXB A;  2HDA A;  2DF6 A;  2D0Q B;  1DJ7 B;  3LGF A;  1GUX B;  2XI9 A;  5IXB A;  5LMK B;  3LH5 A;  3OYF A;  3CXC S;  1MND A;  2YRC A;  3OYL A;  2CP2 A;  2R57 A;  2OTL T;  4MDX A;  1KC8 C;  2K3Y A;  3VS2 A;  3CD6 Q;  2QYZ A;  3QKJ A;  4LDU A;  2FZG B;  4CC3 A;  4FX3 B;  4I3Z B;  2EQU A;  3CME T;  2NLU A;  1VQL T;  3HSB A;  2QQ9 A;  3OW2 P;  5AYF A;  2OI3 A;  3MKD A;  4N0A C;  3SD4 A;  3I35 A;  4A4F A;  1WDX A;  2P4R A;  5GJW B;  3MPU B;  2NWM A;  3M55 A;  2MPX C;  5J26 A;  4M7D B;  2ABL A;  2CUB A;  2OTJ Q;  4OMP A;  2LZ6 B;  3J80 E;  3GPL A;  3JCM e;  1UB4 A;  2WSF E;  3MJX A;  1Y0M A;  3LWH A;  3JB9 G;  4PLI A;  1D0Y A;  3CEY A;  1EZZ B;  4QQD A;  4FYX B;  3RMQ A;  1WJR A;  1JO8 A;  3QO3 A;  1QVG P;  2K5I A;  3MCA B;  4PL6 A;  5GAO q;  1NYG A;  2XKO C;  2KXC A;  2O88 A;  4HT9 A;  1WHG A;  1HD3 A;  1X2K A;  4C92 D;  3RNJ A;  5I21 A;  4C92 A;  5GMK l;  1UGR B;  4MFD A;  2GTO A;  2K3B A;  1TS9 A;  1FVV B;  1B34 B;  4C8Q G;  4JLI A;  1YN8 A;  3RBB B;  3MEW A;  4DOW A;  1IO6 A;  1GBQ A;  3MHX A;  4JRK A;  3PE0 A;  1YJN A;  2AIR B;  1RAA B;  2DXB A;  4F7J B;  4XQ3 A;  2K79 A;  3M4G A;  1G83 A;  2COZ A;  2W0Z A;  3X28 B;  1W1F A;  3TQ7 P;  5LJ3 d;  3EOC B;  3ZEH A;  2V1R A;  3R6O A;  4HXJ A;  1VQO A;  4BDY A;  5IN1 A;  2HL5 C;  2DTO A;  4J9C A;  2JN0 A;  2HBP A;  1C9B A;  1X01 A;  2ED1 A;  3VUB A;  1Y96 B;  3NGP A;  3L2R A;  5HCK A;  4EPC A;  5A0G A;  5GMK h;  1OKV B;  4QQ6 A;  2F2C A;  3EFO A;  1VQ9 A;  3M0T A;  2BE9 B;  3R6N A;  4M7D C;  1W4S A;  5GAO r;  2VUB A;  4Z02 A;  3A98 A;  4DBH A;  2L3S A;  3E9F A;  3CCL T;  3CD6 A;  4YOO A;  2ZCF B;  4CI0 C;  2BIV A;  5KYW A;  2JOY A;  1WPY A;  1JEG A;  3M56 A;  3E19 A;  2C5X B;  4BAC A;  2Y4X A;  3CCR T;  2CRE A;  5KYY B;  1PCX A;  2QGS A;  2FO0 A;  2CDT A;  4M78 G;  3L1A A;  4OVA A;  4CFU B;  1PSE A;  2X4Y A;  4AMC A;  5KYW B;  1RAI B;  1VQP T;  2RHX A;  2PVD B;  4Y72 B;  1PKS A;  5CKH A;  3QZ9 B;  2JZ2 A;  2LJ1 A;  4RTU A;  4RTZ A;  4B9X A;  2L3R A;  3TW6 A;  5IDP B;  4FSX A;  3M57 A;  5BNJ B;  1YIJ Q;  3NDQ A;  4JZ3 A;  3OS2 A;  1H25 B;  2OAU A;  1AHJ B;  1KD1 C;  2DX1 A;  1TD6 A;  1D1B A;  3HL8 A;  1VQN Q;  2GQI A;  2XD0 A;  3REB B;  4KGX B;  3X25 B;  4F7S B;  1BBZ A;  2CS7 A;  2X4J A;  1VQL A;  1VIE A;  4M75 E;  2LQN A;  1KC8 U;  3C94 A;  1LPL A;  1TFB A;  3A8G B;  4HKE A;  2MAM A;  4RMO A;  2VXF A;  2E10 A;  5HBE B;  1QP3 A;  4J9E A;  1RAE B;  1KHC A;  2CZ0 B;  1G2B A;  4E7I A;  3QWL A;  5LJ3 j;  2X1N B;  2GF7 A;  2NUP B;  3DTO A;  4BCN D;  2QA4 Q;  4BI4 A;  1IHW A;  2KYM A;  3LX7 A;  3MEA A;  4JUV A;  1Q82 U;  3DB4 A;  4Y91 A;  2D8J A;  4PJJ A;  1N5Z A;  3ZL7 C;  1M1K R;  1Q86 U;  3CCE T;  3FJ5 A;  2EVR A;  1BI2 A;  3PGG A;  5D6Y A;  1M8M A;  1VQP Q;  3ASK A;  1YIT T;  1JJ2 P;  3EG9 A;  5FGK B;  1R8O B;  1WHK A;  3EH1 A;  3SWN A;  1WXU A;  3JSC A;  4IUV A;  3MP6 A;  3BG5 A;  4RTY A;  4BI3 A;  2DEU A;  1B3Q A;  2MIO A;  4M7D D;  1M90 U;  2ESW A;  4IIO A;  4J83 A;  3G6E Q;  4M7D A;  2V26 A;  5GAO l;  1JOW A;  2W96 A;  1P92 A;  3SB2 A;  4E7Z A;  2Y90 A;  1KQS A;  4DEX A;  3EFS A;  5KYU A;  2OX7 A;  3OW2 S;  1TUC A;  4IMY B;  1PNJ A;  2LQ8 A;  4JLG A;  1E9H B;  4C92 F;  2JMC A;  1FMW A;  1E7P A;  4M7A D;  2JVV A;  2PNI A;  4UC4 A;  3CBP A;  4B6M A;  1VQM A;  2DD4 A;  2QI2 A;  4OGE A;  3L42 A;  1H3Z A;  3HHT B;  4BCG B;  5GAN g;  3CPW P;  1M1F A;  1NEG A;  1B07 A;  5A0L A;  1VQ7 T;  1M8V A;  4BDZ A;  4OB1 B;  3M0Q A;  3VRZ A;  3QPH A;  1K9M C;  2GGR A;  5LJ5 g;  1X6G A;  3CC7 T;  4EOP B;  3CC7 A;  2LJ3 A;  2HAX A;  1Y71 A;  3H4C A;  3G1J A;  4C0F A;  4C5H A;  2IW6 B;  4L6V 5;  4II5 B;  4EOR B;  2C5O B;  4F6W B;  1RLQ C;  4EOI B;  3ZBD A;  4ORZ A;  2QFZ A;  3MEU A;  2ZAE A;  4C92 C;  1BCO A;  1MHN A;  5HQ0 B;  4MIM A;  4BY6 B;  3CCM T;  2PK2 A;  2P0Q A;  3V8K A;  3CCM A;  2E64 A;  4HA8 A;  3G33 B;  2G6F X;  4OGC A;  5KE3 A;  1VOM A;  2E3H A;  1D3B A;  4XU0 A;  4F14 A;  2BE7 D;  2KSS A;  2V8J A;  4ZN1 A;  1AD5 A;  3HBL A;  2VKN A;  2PJQ A;  3GP8 A;  3OS1 A;  1YHQ A;  4PFO A;  2W2H A;  1AT1 B;  4BCM D;  2M16 A;  1HJD A;  4XTZ A;  1I81 A;  1H1S B;  2K5L A;  2QA4 T;  5FRO A;  1K9M R;  3DLM A;  4A4E A;  5LJ3 f;  4AG1 C;  3EJ1 B;  2MCN A;  5CQX A;  1YWO A;  2CT4 A;  2GFU A;  2P0P A;  1FIN B;  2ZPI B;  3MO8 A;  5HY6 A;  2F1L A;  3JAM E;  1AD6 A;  3G71 Q;  2XU8 A;  4XTU A;  2CP7 A;  5GMK j;  4RUG A;  2DJQ A;  1SHG A;  4PJO E;  4BE0 A;  1AOJ A;  3C0C A;  2W9Z A;  1VQK Q;  2BTT A;  2QF7 A;  2K7A A;  4M78 D;  4MZM A;  2R5A A;  2AHJ B;  4KRC B;  2VYT A;  4JX5 A;  7AT1 B;  1Q81 R;  2LX7 A;  2UZD B;  4QKU A;  5IF1 B;  2RQT A;  1F5Q B;  1QVF P;  1TUD A;  4J9D A;  3PIP A;  2QAS A;  3OA6 A;  4RTT A;  4L5G A;  2F5T X;  3HKS A;  3CCL Q;  2Y4Y A;  5KYX A;  2YUQ A;  1C6V X;  4F04 B;  3FIF A;  3CC4 A;  2X3X D;  1Q86 C;  2RA2 A;  4X34 A;  1BU1 A;  5GMK m;  2KVQ G;  1NJI C;  1TU0 B;  3NMZ C;  3GIB A;  2D9T A;  2LDM A;  5L8R E;  2GNC A;  4JDS A;  2FB7 A;  1YJ9 Q;  4F7N B;  4FYW B;  4C8Q E;  3F5X B;  1UG1 A;  3INZ A;  1QLY A;  3CCJ T;  3QWY A;  2JTE A;  2W99 A;  3WXM B;  1IRX A;  3CCQ A;  4EDU A;  4PJM A;  4DBQ A;  2MYS A;  1JJ2 S;  4OGR B;  4PJN A;  3QJY A;  1VQ9 Q;  1UDL A;  2DYI A;  3EG3 A;  4FM4 B;  1MUZ A;  1VQ8 T;  2D6F A;  3WVD B;  1G5V A;  3LGL A;  3RKW A;  1G3S A;  2KRN A;  3QSU A;  4BCP B;  2ZZD B;  3LYI A;  4LDX A;  2YUO A;  2H8H A;  4HCC A;  2HL3 A;  2J05 A;  1SG5 A;  3PTA A;  2C06 A;  3M03 A;  1QVG S;  1TUG B;  1OL2 B;  1Z9Q A;  4ME7 A;  1E6H A;  2E41 A;  2HD0 A;  2DTH A;  2EGE A;  2VC8 A;  1W70 A;  1FYN A;  1WIE A;  4BCM B;  2MI6 A;  4F6S B;  2HKQ B;  2CJM B;  5GAM d;  2LQW A;  3M59 A;  5GMK e;  1YCY A;  1R0C B;  2PHG A;  5LJ5 h;  5IHK A;  3EGX B;  4HCB A;  1VYW B;  4HLQ A;  2KMT A;  4ZNX A;  1EX4 A;  2CZ7 B;  2PVG B;  3UAT A;  4EOQ B;  2P4T A;  2RN8 A;  1N8R R;  1CSK A;  2FPE A;  3M0S A;  2B8A A;  1M5Q 1;  2RK1 A;  5EG2 A;  2PU9 B;  2BPM B;  3E1S A;  1D3U B;  2FVU A;  1VOL A;  2AKL A;  2PQW A;  2HSE B;  4X1V A;  3BLQ B;  3C12 A;  1X6O A;  3I55 Q;  1NJI U;  1JST B;  4EMK A;  4NST B;  1IGQ A;  5HBH B;  4MMK A;  3PMI A;  2KDS A;  1YI2 A;  1TH7 A;  1OV3 A;  1G3Y A;  1W2B P;  5CVI A;  4FCY A;  4M78 A;  2YT6 A;  4OB3 B;  1O9K B;  2WIP B;  5DLO A;  2CP6 A;  3OYA A;  4L59 A;  2R7G A;  1Y7X A;  3PO3 S;  2EPD A;  2RHY A;  1LJO A;  3POM A;  1OUL A;  1QMC A;  2IN3 A;  3DL1 A;  3RGF B;  4GLM A;  4ROE A;  4ATO A;  1HSQ A;  2CGH A;  1YI2 Q;  3EFO B;  3JCM f;  4ZGE B;  2DL3 A;  3PFS A;  3FLG A;  4CFU D;  1JRI A;  1W6X A;  2AKK A;  4M75 B;  1T0J A;  3I55 A;  5ACB A;  3MI9 B;  1QKW A;  3QG1 A;  1GXI E;  3VS5 A;  4Z8A A;  2RQV A;  4E6R A;  2DD4 B;  2HMA A;  2M02 A;  1Y96 A;  1UE9 A;  2YLB A;  3HRT A;  2DA9 A;  3O0G D;  2K6D A;  4E47 A;  2DE0 X;  1U06 A;  3FC3 A;  3GBQ A;  3QHW B;  1M1K U;  3EG0 A;  2EQJ A;  1I4K 1;  1Q95 G;  3P8D A;  4BCH B;  1IGU A;  1M30 A;  3KXT A;  4DOV A;  3LW5 E;  1OX9 A;  3CC2 A;  2F69 A;  3I56 T;  4Q5W A;  2EBP A;  2HQE A;  2YHT A;  2BS2 A;  2RHU A;  3LLR A;  4FW2 A;  2DIQ A;  1NBE B;  2CCI B;  3KBG A;  3QYE A;  4XK8 E;  2JS2 A;  4OMF B;  3OYK A;  2XG8 D;  1E6G A;  3BHT B;  1UHC A;  1RL2 A;  3TRE A;  4HVW A;  4XTV A;  4C8Q A;  2J7I A;  4OML A;  2KXD A;  2CT3 A;  2EUF A;  1OL1 B;  4RTW A;  1AZE A;  1UNH D;  2RQR A;  1KIK A;  1N4M A;  1GCQ C;  1HYO A;  1CKB A;  4C5G A;  4M77 E;  2DL8 A;  3JCM c;  1WZO A;  1RAH B;  4JZ4 A;  3JB9 D;  2K2M A;  4FL6 A;  4DQ2 A;  1ZQ1 A;  1WHJ A;  1PG5 B;  4C8Q C;  2C0I A;  2ZPF B;  5GAN d;  3BHV B;  1YJ9 A;  4GY5 A;  1PD0 A;  2KQW A;  1YJW A;  8ATC B;  1O9S A;  2QQS A;  2KE9 A;  2QXF A;  4KGZ B;  4XTX A;  4PK4 A;  3EH2 A;  1UUE A;  1G8X A;  1WHH A;  3CC4 Q;  1HXD A;  3REA B;  4BE1 A;  3CCV Q;  5AT1 B;  4F16 A;  1ZSZ C;  3DDP B;  4AKG A;  2FZC B;  4NS5 A;  2WMB B;  4IIM A;  4PJO F;  5GAM g;  1GUX A;  3CBM A;  5GAO p;  5DQV A;  1PHT A;  4LE9 A;  5IHN A;  2DIG A;  5FU7 C;  3X20 B;  2QDL A;  4M7A C;  2VWF A;  3BFM A;  2QEX T;  3QHS A;  1N9S A;  2L0A A;  4LN2 A;  2O4X B;  4MFE A;  2JM8 A;  3FDR A;  1VQK A;  1QWE A;  3QZ5 B;  5FU6 B;  1UNL D;  1M4Z A;  4M78 B;  2XK0 A;  4HL4 A;  4CFN B;  3EHQ A;  3TCJ A;  1VQ6 A;  3WVE B;  1W2B A;  3OMC A;  1MV3 A;  1VA7 A;  1KK7 A;  2V1Q A;  2LCS A;  1VQM T;  3BG9 A;  1M1G A;  1H26 B;  4M7D G;  3I9Q A;  3EHR A;  3GF5 A;  2GQV A;  3PVL A;  1GRI A;  2D1X A;  4J9B A;  4O6J A;  3JCM b;  1JXM A;  3OYI A;  3DOG B;  3NHN A;  4EOK B;  2MWP A;  2DLP A;  1H27 B;  2FL7 A;  2DRK A;  3CMA A;  4BB7 A;  2M0Y A;  3HO8 A;  2PZ1 A;  2RNA A;  1AIS B;  4FW1 A;  4JRI A;  4N4G A;  2KAF A;  5CKE A;  2V8K A;  3DJB A;  3A8H B;  2G3R A;  1D1C A;  2WFY B;  4OMM A;  4LD6 A;  1TOV A;  1RLP C;  2CZ1 B;  2M51 A;  3CCM Q;  4M7A F;  1OU9 A;  2I2L A;  3IQL A;  5GAM f;  1VQ4 Q;  2A7Y A;  1H1P B;  3UWN A;  2WXV B;  2X35 A;  2XID A;  5D7U A;  1BCM A;  1ZSZ A;  5I2S A;  4RCC A;  2AZV A;  5HK3 A;  4HNV A;  2KEA A;  3I56 Q;  4XTY A;  1WX6 A;  2QTV A;  4PJO B;  1N27 A;  1YWP A;  2JGZ B;  5LJ5 f;  3ZFJ A;  4PNO A;  1OZ2 A;  1XNI A;  1XO2 A;  2VGN A;  1V29 B;  1KD1 U;  1WQ7 A;  2V22 B;  2OJ2 A;  2KNB B;  1KD1 R;  2QDY B;  1YCS B;  1UJ0 A;  1TWB A;  1N6A A;  2JS0 A;  3F70 A;  2AT1 B;  3JRZ A;  2DZ9 A;  5FWC A;  3A1P A;  4AFU C;  1Q86 R;  1MV0 B;  3S6W A;  5GAN 4;  2EQM A;  2DME A;  1GCP A;  2KT8 A;  3EGU A;  1M2V A;  2DXC A;  3E2U A;  4J9F A;  1GY3 B;  4K11 A;  5IAY A;  3A8O B;  2DKG A;  4M77 C;  2UZB B;  3G7Z A;  2GCX A;  3G6E A;  4B9W A;  1K73 U;  1ABQ A;  1ZUU A;  3GNF B;  3O8V A;  3PT9 A;  5KYY A;  4DBF A;  5GAN 8;  4ZTJ A;  1VQ5 T;  1QMZ B;  3HZJ A;  2FRW A;  3BE3 A;  3JCM Q;  2DIL A;  4FSS A;  4DEY A;  3CCU A;  1LVK A;  3HFN A;  3CC4 T;  1OOT A;  2A37 A;  4M75 A;  4QSH A;  4HCK A;  3CMA T;  3NTK A;  1OX8 A;  3JV3 A;  1LNX A;  3TW7 A;  1YIT A;  1TG0 A;  2SRC A;  3OYG A;  1N8R U;  1BIB A;  2YRV A;  2RI2 A;  4BBS M;  2ATC B;  1PD1 A;  4KRD B;  4AT1 B;  2YLC A;  4EMG A;  2F2W A;  4AKI A;  1JJ2 A;  1U5S A;  4XU1 A;  5KH6 A;  2BS4 A;  3QUI A;  5GAN 3;  4M6V A;  4EIK A;  4M4Z A;  5KYU B;  2H3J A;  5HKC A;  4CC4 B;  1I5L A;  4A4H A;  2UUE B;  2JUF A;  2L8D A;  3RMS A;  3SWN B;  3C95 A;  2HEQ A;  4CXA B;  1ZBJ A;  3M54 A;  5GAN h;  3UT1 A;  2EJ9 A;  3N5B B;  3VV0 A;  4C92 G;  1QWF A;  3BLR B;  2OTL A;  3L2V A;  2KR3 A;  4F7U A;  1IRE B;  4CFM B;  4M77 B;  3JCM g;  4ESR A;  3CME Q;  4J6W A;  2K2V A;  2F2V A;  5LJ5 d;  4YOZ A;  3VS4 A;  1H1R B;  2HCK A;  3EGD B;  3CCJ Q;  4BY1 X;  2HZY A;  4M77 F;  1UEC A;  3OW2 A;  5FRM A;  3H0I A;  2JJ9 A;  2E65 A;  2I0N A;  3E9G A;  2P0K A;  4M75 C;  2L5Q A;  3MEV A;  4XAX B;  5GAN f;  3BDL A;  4M7A B;  2LT4 A;  3EGD A;  1WLP B;  5KCO A;  1VUB A;  2LVM A;  4FYY B;  1S72 A;  2LW4 A;  2EYQ A;  1V76 A;  2QQA A;  3OMG A;  4BI8 B;  2FHD A;  3CCS T;  1K1Z A;  4PLL A;  2QEX Q;  4E7H A;  2COW A;  3NPF A;  1S1N A;  5DM7 R;  4E7K A;  1R0B G;  4LDY A;  2YDL A;  1RAF B;  4EC9 B;  2RJD A;  3VYH B;  4ZN3 A;  4JJC A;  4M78 F;  4LOC A;  2EGA A;  5I22 A;  4FT4 A;  2DVE A;  4UN0 A;  3TNW B;  4IUP A;  2LC4 A;  4RCB A;  1JU5 C;  3VS3 A;  1NLO C;  1OQK A;  2QQ8 A;  4PJL A;  2IW9 B;  1BI3 A;  1TXQ A;  3TN8 B;  5I2M A;  1X2Q A;  4ELL A;  1SRL A;  3VS0 A;  2LCL A;  2A28 A;  2LP5 A;  4OMO A;  2E6N A;  6AT1 B;  2GFA A;  4WF2 A;  1VQN T;  1SPK A;  3TSW A;  5C6S A;  4J5Y A;  3VS6 A;  4OB2 B;  3O5Z A;  1MMA A;  3UDC A;  5I5Z B;  3VKG A;  3QYG B;  5GMK i;  1I5O B;  1ZX6 A;  2A0F B;  3EGX A;  2DTI A;  3OB9 A;  1I1J A;  1I0C A;  3FJP A;  1G3T A;  2L3Q A;  3FB9 A;  2DMO A;  5L23 A;  1YFN A;  3GLX A;  1H64 1;  2RJC A;  1FKM A;  1NPR A;  3H41 A;  4X9D A;  1MMN A;  3M58 A;  4OF1 A;  2OTJ A;  2XMF A;  1ZUK A;  2M0O A;  3S3M A;  4M7A E;  4LDW A;  3L2Q A;  4KUL A;  3VS1 A;  1ZSZ B;  3J81 E;  2LMJ A;  1KQS P;  4IKF A;  1FWZ A;  4QW2 A;  4F70 B;  1LCK A;  4F7U E;  3ULR B;  2DXC B;  1T3L A;  5IHY A;  3OYD A;  4LD9 K;  3LH0 A;  3V8J A;  1B7T A;  2NUT A;  3RKX A;  5HBJ B;  1F1B B;  4N4I A;  4C92 B;  1UGP B;  1Q7Y C;  4M78 C;  4M77 A;  2DRM A;  2MWO A;  2KRM A;  2D0N A;  1WYX A;  2PUK B;  3BHU B;  2WSC E;  4J8O A;  3QYH B;  2R5M A;  4V2S A;  1WI7 A;  3QBY A;  1OI1 A;  3HPW A;  2GBQ A;  2ENM A;  1NJI R;  3CME A;  1O75 A;  3CCL A;  2K57 A;  2DFU A;  1QKX A;  4NC6 A;  3L2U A;  2OTL Q;  3C4S A;  5IHI A;  5M9O A;  1Q82 C;  1OYX A;  3JCM d;  1Z9Z A;  4QT7 A;  4MZP A;  3SEM A;  1IXD A;  2E12 A;  4Z88 A;  4CC7 A;  3G4S Q;  3OYM A;  5KYN A;  2VXE A;  4EOL B;  5HK0 A;  4FU6 A;  1VYT A;  4BE2 A;  1PKT A;  2O4X A;  4E2F B;  2G9X B;  1FMK A;  2BKD N;  3G71 A;  1NYF A;  3CC2 T;  3CBO A;  3CCE A;  2DJZ A;  1U1S A;  3JCM X;  3HRS A;  1KC8 R;  2DPP B;  3VJP A;  1YHQ T;  3B57 A;  1Y57 A;  2CP3 A;  1M3A A;  5A0D A;  1N9R A;  1P5E B;  1VQ4 T;  1UHF A;  2O9S A;  3I5R A;  5CQY A;  3CCQ T;  1AWX A;  1GFD A;  2DXB B;  4ZGJ B;  2COY A;  1H28 B;  2KY9 A;  3P8H A;  3VS7 A;  4BCK B;  2YXY A;  4NOY A;  1WQW A;  2FPF A;  1YIT Q;  2DNU A;  4D8D A;  5C0M A;  2KI7 A;  4RG2 A;  1OU8 A;  2WPA B;  2DYB A;  3QDR B;  4F7U B;  2K4Y A;  2LT1 A;  2IVX A;  1WFW A;  3L2Z A;  2EAY A;  2DD5 B;  5IXF A;  1G3W A;  1GFC A;  1Q7Y R;  3TSZ A;  3OYN A;  2ZPG B;  3OYB A;  5GAM j;  1M2V B;  4G6L B;  2PVO B;  5FWB A;  3CCU Q;  1Q7Y U;  1T0H A;  4RKU E;  3FRN A;  4LNP A;  1QCO A;  4GBQ A;  2MF2 A;  2LQK A;  2XIC A;  3H9N A;  2ZGW A;  4NL2 A;  3VUZ A;  3M0R A;  4QVC A;  4RTV A;  4MML A;  1AWJ A;  5CCA A;  4EOM B; 
#chains in the Genus database with same CATH homology
 5IT9 E;  1M90 U;  3DKM A;  3RIR A;  4J83 A;  4M75 F;  3SWN C;  4J6Y A;  4O6J A;  4M7D A;  3JCM b;  3TEE A;  5GAO l;  1WJQ A;  2DD5 A;  3OYI A;  1P92 A;  3SB2 A;  3S3N A;  1YBY A;  2Y90 A;  1XQH A;  1KQS A;  2MWP A;  3GNG A;  2E6Z A;  3EFS A;  2FL7 A;  5J39 A;  3OW2 S;  1K8A C;  3OS0 A;  2LQ8 A;  4JLG A;  3CMA A;  2EJF A;  4MDW A;  4BB7 A;  4C92 F;  3HO8 A;  4M75 D;  4PKC C;  3OY9 A;  2CKK A;  4EMK C;  4JRI A;  5CAI A;  3CCS A;  4N4G A;  5KE2 A;  2KAF A;  5CKE A;  1UEB A;  2V8K A;  4C0Z A;  4LDV A;  3J7A F;  3A8H B;  1E7P A;  3OSV A;  4KUI A;  5CKB A;  1VIF A;  2G3R A;  4M7A D;  2JVV A;  4UC4 A;  3CBP A;  2K5F A;  4M7A A;  4LD6 A;  2CZ1 B;  2DD4 A;  2QI2 A;  4OP0 A;  1VQM A;  4M7A F;  2I2L A;  4KT0 E;  5GAM f;  4OGE A;  1MGQ A;  4AKH A;  2A7Y A;  4OB0 B;  2XDP A;  3L42 A;  3UWN A;  2XDD A;  2X35 A;  1H3Z A;  2XID A;  2QDJ A;  3HHT B;  2BS3 A;  5GAN g;  3A8L B;  4BBR M;  4M77 D;  4BD3 A;  1M1F A;  5GAN 2;  2O01 E;  5I2S A;  4RCC A;  5HK3 A;  4HNV A;  5A0L A;  1VQK T;  4M75 G;  4XTY A;  1VQ7 T;  4PJO B;  1N27 A;  1S72 T;  4N0A A;  4BDZ A;  4JX4 A;  1M8V A;  1VQ6 T;  4OB1 B;  5LJ5 f;  4PJO G;  3ZFJ A;  3QPH A;  3PNW C;  4PNO A;  1OZ2 A;  3M4Y A;  5LJ5 g;  1K9M C;  3CC7 T;  3CC7 A;  1XNI A;  3I56 A;  3RKY A;  4D6W A;  1VQ8 A;  2VGN A;  1Y71 A;  3H4C A;  4C5H A;  4C0F A;  2HAX A;  3CPW S;  1V29 B;  3G6E T;  1KD1 U;  4L6V 5;  1WQ7 A;  2R58 A;  5GAN 7;  1VQO T;  3ZBD A;  4JJN K;  5DLQ E;  4C5E A;  2QFZ A;  4C0G A;  2QDY B;  2IG0 A;  2PUO B;  3MEU A;  4E7L A;  4C92 C;  1MHN A;  2MMP A;  4J6X A;  2QTX A;  3OYJ A;  1YJ9 T;  3FEO A;  4MIM A;  1VQ4 A;  4BY6 B;  3CCM T;  3SFM A;  1QVF A;  5EJC A;  3P8B B;  3V7C A;  2P0Q A;  4BY6 C;  3V8K A;  3CCM A;  1N6A A;  3HP9 A;  3F70 A;  1KG1 A;  2E64 A;  1XOV A;  4HA8 A;  4M78 E;  4OGC A;  3VYG A;  3JRZ A;  4C92 E;  5KE3 A;  4NL3 A;  2DZ9 A;  1YJW T;  2KMG A;  1D3B A;  1FXX A;  4XU0 A;  2KSS A;  4KUD K;  5CKD A;  2V8J A;  3S6W A;  5GAN 4;  3EAE A;  2EQM A;  1QVF S;  4ZN1 A;  5FLX E;  2DXC A;  4C0D B;  1VQ7 A;  3QXE B;  3HBL A;  4Y28 E;  1FX7 A;  3RUX A;  3G71 T;  3GP8 A;  2HNI A;  2CZ6 B;  5KCH A;  1N8R C;  2WSE E;  3OS1 A;  2RI5 A;  1YHQ A;  4JRP A;  5IAY A;  3A8O B;  2EKO A;  2L89 A;  1QLB A;  3VYG B;  2M16 A;  3OBY A;  3ER0 A;  2DKG A;  4M77 C;  1K9M U;  1B34 A;  4GLK A;  1PSF A;  2M9U A;  2GCX A;  1NZ9 A;  3G7Z A;  4XTZ A;  3V7R A;  4B9W A;  1I81 A;  3G6E A;  3ME9 A;  5LJ5 e;  3JCM P;  1K73 U;  2K5L A;  2QA4 T;  5FRO A;  2KK4 A;  3DLM A;  4A4E A;  4C8Q D;  5LJ3 f;  3GNF B;  3O8V A;  3PT9 A;  5CQX A;  5GAN 8;  4ZTJ A;  4FIB A;  1VQ5 T;  2GFU A;  3HZJ A;  3CPF A;  2P0P A;  3NFC A;  3H6Z A;  3JCM Q;  3CCV A;  2ZPI B;  3MO8 A;  4N4H A;  5HY6 A;  4ELZ C;  2RD1 A;  3CCU A;  3JAM E;  2KR6 A;  5GAO m;  2XHC A;  2RM4 A;  2CYZ B;  3HFN A;  3CC4 T;  1D3B B;  3JB9 F;  4A4G A;  4JRQ A;  2LTO A;  2V8I A;  2XU8 A;  4XTU A;  4C0D C;  1VQP A;  5GMK j;  3DLL A;  3T9N A;  2ZPB B;  4M7D F;  4M75 A;  4BE0 A;  1YIJ T;  4QSH A;  4PJO E;  2DXT A;  3CMA T;  5LL6 S;  2E70 A;  2VV5 A;  5CKF A;  2QF7 A;  5D6X A;  3NTK A;  4M78 D;  2LCC A;  4MZM A;  2R5A A;  2AHJ B;  1XTD A;  2VYT A;  4JX5 A;  1LNX A;  3TW7 A;  3M53 A;  3KHI A;  3BDU A;  3OSS C;  1LOJ A;  3OS5 A;  1YIT A;  1BI0 A;  3OYG A;  4QQG A;  1N8R U;  1QW1 A;  1Q81 U;  1VQ5 A;  1M9S A;  2ZZD A;  1BIB A;  1BI1 A;  2F5K A;  3RES A;  2YRV A;  3PIP A;  2RJE A;  2WJ9 A;  3OA6 A;  1UGQ B;  4L5G A;  4FT2 A;  3CCU T;  2QQB A;  4IUR A;  2F5T X;  2QA4 A;  2LRQ A;  1YIJ A;  1Q82 U;  2RI2 A;  1K73 C;  1ZHI A;  3HRU A;  4BBS M;  3HKS A;  2RHZ A;  2A3L A;  3RER A;  2Y4Y A;  1BKB A;  4A53 A;  2LNV A;  2YLC A;  4EMG A;  2DZC A;  3CCV T;  4PJO D;  4AKI A;  5CO7 A;  1JJ2 A;  3FIF A;  1U8R A;  3LWI A;  2ZPH B;  4XU1 A;  2BS4 A;  5KH6 A;  3CC4 A;  3OYY A;  4P5N A;  1KHI A;  2RO0 A;  1Q86 C;  3A5Z B;  3QUI A;  5CR2 A;  5GAN 3;  3CD6 T;  4ZTF A;  4M6V A;  3H8Z A;  1VQ9 T;  1I8F A;  2RA2 A;  4X34 A;  2H3J A;  5HKC A;  3TU4 K;  5GMK m;  2KVQ G;  1I5L A;  3VKH A;  4A4H A;  1NJI C;  2ZPE B;  4HNT A;  2JUF A;  2D9T A;  2LDM A;  5L8R E;  3A8M B;  1NE8 A;  2JNG A;  4JDS A;  2FB7 A;  2L8D A;  3RMS A;  4F7U F;  3SWN B;  3CPW A;  3C95 A;  4IUU A;  2EQK A;  3JCM h;  2RH2 A;  4C8Q E;  1KQ2 A;  3G4S T;  1VQN A;  2DK3 A;  3INZ A;  3G4S A;  2QQR A;  1QVP A;  3CCJ T;  3M54 A;  5GAN h;  3UT1 A;  2EJ9 A;  3WXM B;  3JCM V;  3OQ5 A;  4EDU A;  4Z6Y A;  3CCQ A;  3N5B B;  3VV0 A;  4C92 G;  3X26 B;  1X75 C;  1Y07 A;  3OBW A;  2K3X A;  3HB9 A;  4QVD A;  1JJ2 S;  2OTL A;  4CRI A;  1QP2 A;  3L2V A;  3NTH A;  2JTM A;  3QJY A;  2RHI A;  4F7U A;  1IRE B;  3BW1 A;  4M77 B;  3JCM g;  4DA4 A;  4J6W A;  4FM4 B;  2LX9 A;  4C5I A;  2K2V A;  5CK9 A;  3JB9 H;  2G77 A;  4J7F A;  5LJ5 d;  1VQ8 T;  1YI2 T;  2D6F A;  3WVD B;  1G5V A;  3LGL A;  4XU2 A;  3RKW A;  3JB9 J;  1G3S A;  3MP8 A;  3QSU A;  4R56 A;  2BUD A;  2ZZD B;  3LYI A;  4LDX A;  4HCC A;  2D0Q B;  2EJG A;  3URG A;  1DJ7 B;  3LGF A;  1KQS S;  3PTA A;  2C06 A;  2XI9 A;  3CXC S;  4M77 F;  3OYF A;  3OW2 A;  5FRM A;  1EIF A;  4JS4 A;  3QYB A;  3OYL A;  2XDB A;  2E65 A;  2X4W A;  2R57 A;  1QVG S;  4HT8 A;  2OTL T;  4MDX A;  3E9G A;  2P0K A;  4M75 C;  2L5Q A;  3MEV A;  4ME7 A;  3PMT A;  2E41 A;  2K3Y A;  4XAX B;  5GAN f;  1KC8 C;  2HD0 A;  2DTH A;  3BDL A;  4M7A B;  2LT4 A;  2MI6 A;  2VC8 A;  4ZGD B;  2EIF A;  3OYH A;  3QKJ A;  1VUB A;  5KCO A;  2LVM A;  4LDU A;  1S72 A;  2EYQ A;  4VUB A;  5GAM d;  3MET A;  2EQU A;  3CME T;  2QQA A;  2NLU A;  1VQL T;  3M59 A;  2QQ9 A;  3QII A;  1YCY A;  3OMG A;  4BI8 B;  2FHD A;  2X4X A;  5AYF A;  4EMH A;  5GMK e;  2DXU A;  3CCS T;  4N0A C;  4PLL A;  1Q81 C;  3SD4 A;  5LJ5 h;  4C8Q F;  4E7H A;  5J3B A;  4A4F A;  4HCB A;  4E7J A;  5DM7 R;  4E7K A;  4LDY A;  4HLQ A;  2KMT A;  3M55 A;  2CZ7 B;  2PVG B;  3VYH B;  2RJD A;  3BY7 A;  5J26 A;  4ZN3 A;  4M7D B;  4M78 F;  3HSB A;  2P4T A;  3J80 E;  3GPL A;  4LOC A;  1UB4 A;  3JCM e;  2B8A A;  2WSF E;  4FT4 A;  1M5Q 1;  1HK9 A;  2RK1 A;  4HCZ A;  3LWH A;  5EG2 A;  2PU9 B;  2DVE A;  3JB9 G;  3E1S A;  2FVU A;  4IUP A;  2LC4 A;  4PLI A;  5GAN e;  3CEY A;  4RCB A;  4ELJ A;  2PQW A;  4QQD A;  3RMQ A;  1WJR A;  3C12 A;  2WAC A;  2QQ8 A;  3QO3 A;  1X6O A;  2K5I A;  3MCA B;  1NJI U;  4PL6 A;  1BI3 A;  4EMK A;  5I2M A;  2E1H A;  5GAO q;  5GAM h;  2XKO C;  1JB0 E;  4MMK A;  1IZ6 A;  2LCL A;  3PMI A;  2KDS A;  4C92 D;  1YI2 A;  4HT9 A;  2DO3 A;  1TH7 A;  5I21 A;  1G3Y A;  4HNU A;  3EFR A;  5CVI A;  4C92 A;  4EMK B;  3AHU A;  4M77 G;  1UGR B;  4M78 A;  5GMK l;  4OB3 B;  4MFD A;  2E6N A;  2GFA A;  4C8Q B;  5DLO A;  4WF2 A;  3JCM W;  2DEQ A;  1B34 B;  4C8Q G;  3OYA A;  1M1K C;  4L59 A;  4JLI A;  1VQN T;  4AI6 A;  1Y7X A;  3MEW A;  4DOW A;  2RHY A;  4J5Y A;  1LJO A;  5C6S A;  3JCM J;  4OB2 B;  2FYK A;  3MHX A;  4JRK A;  2QEX A;  1K8A U;  3UDC A;  3VU3 C;  1YJN A;  3DL1 A;  2DXB A;  1W2B S;  3HFO A;  1VQ6 A;  4XQ3 A;  4ATO A;  2CGH A;  3VKG A;  3M4G A;  3QYG B;  3X24 B;  4RG8 A;  1SSF A;  4YTL A;  5LJ3 h;  3JCM f;  3X28 B;  4ZGE B;  5GMK i;  3PFS A;  3FLG A;  2JTF A;  2DTI A;  1JRI A;  3OB9 A;  5LJ3 d;  5GAN j;  3ZEH A;  4M75 B;  3FJP A;  1G3T A;  3M5A A;  3MP1 A;  3I55 A;  3FB9 A;  1U1T A;  3R6O A;  1VQO A;  3QG1 A;  1GXI E;  4BDY A;  5IN1 A;  3GLX A;  1H64 1;  2RI3 A;  2RJC A;  4ELY C;  2DD4 B;  5FU7 B;  1FKM A;  5LJ5 j;  1NPR A;  1Y96 A;  2YLB A;  2DTO A;  4X9D A;  3HRT A;  3M58 A;  4J7I A;  3CCJ A;  3S3O A;  4OF1 A;  5DY9 A;  2OTJ A;  2JN0 A;  2HBP A;  4E47 A;  1X01 A;  2M0O A;  3VUB A;  3FC3 A;  1Y96 B;  3L2R A;  3S3M A;  5FU6 C;  1M1K U;  4M7A E;  4LDW A;  3L2Q A;  4EPC A;  2EQJ A;  1I4K 1;  1OZ3 A;  4KUL A;  3V8L A;  3P8D A;  1KQ1 A;  3OYE A;  5A0G A;  5GMK h;  3M9Q A;  3J81 E;  3KXT A;  1WNL A;  4QQ6 A;  4DOV A;  1M90 C;  1YJN T;  3LW5 E;  3CC2 A;  2F69 A;  1VQ9 A;  4IKF A;  1FWZ A;  3I56 T;  4Q5W A;  4QW2 A;  2HQE A;  4F7U E;  4M7D C;  1W4S A;  5GAO r;  2DXC B;  2YHT A;  2BS2 A;  2RHU A;  3LLR A;  3OYD A;  2HQX A;  2VUB A;  4Z02 A;  2DIQ A;  2IVW A;  4BUG A;  4R55 A;  2RJF A;  4LD9 K;  3LH0 A;  3KBG A;  2RK2 A;  3V8J A;  4PJO C;  3DB3 A;  3QYE A;  3E9F A;  3CCL T;  4XK8 E;  3CD6 A;  2ZCF B;  4OMF B;  3OYK A;  4CI0 C;  2BIV A;  2XG8 D;  2JOY A;  1WPY A;  5CIU A;  2RB6 A;  1RL2 A;  3RKX A;  4N4I A;  3TRE A;  3M56 A;  4C92 B;  3E19 A;  4XTV A;  4A54 A;  3PIO A;  2Y4X A;  4BAC A;  3CCR T;  3V7S A;  4C8Q A;  1UGP B;  1Q7Y C;  4M78 C;  4M77 A;  4M78 G;  2MWO A;  3L1A A;  2E5Q A;  4OVA A;  3CXC A;  3Q1J A;  1PSE A;  2X4Y A;  2PUK B;  5GAM e;  2WSC E;  1RI0 A;  4J8O A;  3QYH B;  2R5M A;  2DAQ A;  4V2S A;  4II1 A;  1VQP T;  3QBY A;  1WGS A;  1OI1 A;  2PVD B;  2RHX A;  3HPW A;  5A2Q E;  5CKH A;  3QZ9 B;  2JZ2 A;  3CME A;  4B9X A;  1O75 A;  2L3R A;  3TW6 A;  3QJ6 A;  3CCL A;  2K57 A;  4QVZ A;  4O5V A;  4C5G A;  4M77 E;  4FSX A;  3JCM c;  3M57 A;  4RMO A;  4NC6 A;  3L2U A;  3C4S A;  2EWN A;  5M9O A;  3OS2 A;  4KBM B;  3JB9 D;  1Q82 C;  1OYX A;  3JCM d;  4FL6 A;  4DQ2 A;  2OAU A;  1AHJ B;  4MZP A;  1ZQ1 A;  1KD1 C;  2E12 A;  2OTJ T;  3OYM A;  2VXE A;  5LJ3 g;  3HL8 A;  3KUF A;  2XD0 A;  4C8Q C;  2ZPF B;  1BIA A;  5GAN d;  3BG3 A;  5HK0 A;  5GAN 5;  1ZBX A;  3CCR A;  4JX6 A;  5LJ3 e;  1YJ9 A;  4FU6 A;  4GY5 A;  2KQW A;  4MZT A;  3X25 B;  4BE2 A;  1YJW A;  2O4X A;  1O9S A;  2M1H A;  2QQS A;  2QXF A;  2CS7 A;  2X4J A;  1VQL A;  1VIE A;  4M75 E;  4PJO A;  2BKD N;  3GIB A;  1KC8 U;  3C94 A;  4XTX A;  3G71 A;  3CC2 T;  3A8G B;  3CBO A;  3CCE A;  1UGS B;  1U1S A;  2DJZ A;  2MAM A;  2E10 A;  2VXF A;  4HKE A;  5GAO n;  1JBM A;  3HRS A;  5D6W A;  3JCM X;  1HXD A;  4BE1 A;  3GOX A;  2DPP B;  5FRN A;  1QP3 A;  1QVG A;  3VJP A;  1YHQ T;  1KHC A;  2CZ0 B;  4AKG A;  4NS5 A;  4E7I A;  3QWL A;  4M7D E;  5A0D A;  3SDZ A;  4PJO F;  2EFI A;  1N9R A;  5LJ3 j;  5GAM g;  2GF7 A;  1VQ4 T;  3CCQ T;  5CQY A;  3CBM A;  5GAO p;  4BI4 A;  2DXB B;  4ZGJ B;  4M7A G;  2KY9 A;  3LX7 A;  3MEA A;  3P8H A;  2DIG A;  2VGM A;  4JUV A;  5FU7 C;  3X20 B;  3DB4 A;  1WQW A;  4NOY A;  4TVR A;  3BFM A;  4XU3 A;  4Y91 A;  3QHS A;  2QEX T;  4M7A C;  4A4K A;  1BYM A;  1N9S A;  5C0M A;  4XTW A;  3JB9 I;  2O4X B;  4RG2 A;  1Q86 U;  3CCE T;  4IUT A;  4MFE A;  4IUQ A;  3FDR A;  1VQK A;  3QDR B;  4F7U B;  2K4Y A;  2LT1 A;  3QZ5 B;  5FU6 B;  1BI2 A;  3L2Z A;  1M4Z A;  3PGG A;  4M78 B;  2XK0 A;  4HL4 A;  2EAY A;  2DD5 B;  5D6Y A;  3TCJ A;  4F7U G;  5GAN 6;  3I55 T;  3WVE B;  1G3W A;  1NPP A;  3ASK A;  3OMC A;  3OYC A;  1W2B A;  1YIT T;  3OYN A;  3UPU A;  2ZPG B;  3OYB A;  1VQM T;  3BG9 A;  1WJS A;  1M1G A;  1R8O B;  3NTI A;  5GAM j;  4M7D G;  2PVO B;  3L2W A;  1Q7Y U;  4JS5 A;  4RKU E;  3SWN A;  3FRN A;  3JSC A;  4IUV A;  3VKI A;  3GF5 A;  2MF2 A;  2LQK A;  2XIC A;  2ZGW A;  3MP6 A;  4NL2 A;  3BG5 A;  4BI3 A;  3VUZ A;  4X9C A;  4QVC A;  2GQV A;  4MML A;  5CCA A;  4M7D D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...