1UGVA

Solution structure of the sh3 domain of human olygophrein-1 like protein (kiaa0621)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
72
structure length
72
Chain Sequence
GSSGSSGTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of human olygophrein-1 like protein (KIAA0621)
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Olygophrenin-1 like protein
total genus 9
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2003-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ugvA00
2E5KA 2L2PA 2C0TA 4IIOA 4WCIA 2OAWA 3VS7A 2EPDA 1K0XA 2DF6A 1NEGA 1GCPA 1K0SA 2JT4A 4K11A 1T3LA 2D0NA 1B3QA 2GQIA 2EYZA 4CC3A 4RUGA 1UG1A 4HXJA 2EW3A 1GFCA 2CT3A 2DBMA 2PNIA 1K9AA 4E6RA 1VYUA 1ZBJA 2KRSA 3NHNA 4JZ4A 1WDXA 1YN8A 4LN2A 1NG2A 3UA6A 2GBQA 4J9CA 2DLPA 1TUDA 1OEBA 2P4RA 2KE9A 1HJDA 2L3SA 4J9HA 2DVJA 2EBPA 1M27C 1E6GA 1T0JA 1Y57A 1AWOA 2CUBA 2DBKA 1QWEA 4LUEA 4LUDA 1X6BA 2KNBB 2FO0A 1NM7A 1X2KA 1WI7A 4RTWA 1UUEA 4GBQA 4OMOA 3UA7A 1M3CA 1ZUUA 2ENMA 1G83A 3VRZA 2BZ8A 4CC2A 3EG1A 1BU1A 1XOVA 1TUCA 2KYBA 2W10A 2BZXA 3PE0A 2BTTA 1SHFA 1M3BA 2KR3A 1X27A 4OMNA 2AZVA 5IHIA 4HVVA 4DEXA 1FMKA 2DX1A 1TG0A 2FEIA 2EYYA 4LE9A 1J3TA 2KRNA 3EHQA 1RI9A 1UJYA 1AEYA 2LZ6B 3M0RA 1OPKA 1B07A 1JXMA 1E7OA 1GCQA 1ARKA 1PRLC 4ESRA 2OJ2A 1U06A 2ED0A 2M0YA 1YP5A 3U23A 3C0CA 4J9IA 3VS6A 4J9BA 2K7AA 2AKKA 3I5SA 5I11A 1RLPC 4JZ3A 1X43A 2KXCA 2NWMA 1WIEA 2QDLA 3TVTA 2MIOA 1JQQA 2DM1A 2ABLA 2A08A 5L23A 3GBQA 1Y0MA 2LJ1A 1JU5C 3TSWA 3REAB 4CC4B 2JMCA 1QKWA 2J05A 1AOJA 2JTEA 1OPLA 5FWCA 5GJVB 3THKA 1FYNA 1PRMC 3NMZC 3PVQA 1KJWA 2F2VA 2CUDA 1PNJA 4OMPA 1SSHA 2LJ3A 2KROA 4RTYA 1SEMA 2JS2A 3PVLA 1GL5A 2HCKA 2YDLA 4ZNXA 2C0IA 1QWFA 3QWYA 4CC7A 2RQRA 4JJBA 2EYXA 4JPBW 1OOTA 2DL8A 2KT1A 2YSQA 5EC7A 4AG2C 2A36A 3LH5A 2KEAA 1I07A 2FRYA 2MOXA 3A98A 1S1NA 1ABOA 1KIKA 3TSZA 2RF0A 1NLOC 2F2XA 2VWFA 4F17A 2L0AA 1M3AA 2YUQA 1MV3A 2RN8A 2AKLA 2DL7A 1JXOA 1H8KA 2JM8A 2GNCA 2IIMA 2SRCA 4DEYA 2YUNA 1UGVA 4D8KA 4ORZA 3H0IA 4J9GA 5FW9A 1YNZA 2K9GA 2AK5A 2DA9A 1V1CA 4FSSA 1MUZA 2YT6A 2CREA 3M0QA 4M4ZA 2RMOA 2O88A 2O31A 2C0OA 2L3PA 3SEMA 1SRMA 4J9FA 2D8HA 1GFDA 1WXBA 1Z9ZA 2DL3A 1MV0B 2K79A 1M30A 1YWPA 2X3WD 2YUOA 4EIKA 2GTOA 2EVRA 1CKBA 3O5ZA 1UECA 1PWTA 2EGCA 2MCNA 2ED1A 1AWJA 4LNPA 2O9SA 2HDAA 1G2BA 1ZUYA 4J9EA 1X69A 1VYTA 2F2WA 2X3XD 4JJDA 1LCKA 1UJ0A 5IXBA 1I1JA 1GBRA 2V1RA 1H3HA 2NUZA 2KXDA 1NYGA 2KT8A 2W0ZA 1CKAA 3M0PA 3EG2A 2ROTA 2LQNA 1UDLA 1RUWA 1WLPB 4X1VA 2RQWA 1K76A 1VA7A 3M0TA 2FPFA 5FWBA 3RNJA 3ULRB 1KSWA 2L3QA 2LX7A 3NGPA 1JO8A 2KYMA 2EGEA 1KFZA 3EGUA 2KBTA 3JV3A 1W6XA 4OMMA 1UTIA 4KRTA 3R6NA 2D1XA 1K1ZA 2DJQA 4OMLA 1QLYA 2FPEA 1UHCA 1JEGA 2DRKA 2LNHB 1AZEA 1AD5A 2GGRA 3VS5A 3VS1A 1BB9A 3I9QA 4AG1C 1H92A 1SHGA 4HCKA 1X6GA 2J6FA 2LMJA 3UATA 1SPKA 4GLMA 1ZSGA 3I35A 1UE9A 1AWWA 1T0HA 3EG3A 1PKTA 2RQTA 3SHWA 2B86A 3UF4A 1WFWA 1M8MA 1PKSA 1A0NB 1GRIA 2K2MA 1ZLMA 2EYWA 2HBWA 2I0NA 1CSKA 3EHRA 2JXBA 2CSQA 1GCQC 1N5ZA 5IXFA 2XMFA 3CQTA 2K3BA 4RTXA 2V1QA 2DYBA 2DE0X 2DRMA 1NEBA 1HSQA 2EQIA 2DL4A 3H41A 3RBBB 4JJCA 1Z9QA 1ZUKA 3IQLA 4QT7A 3NPFA 1ZX6A 1OV3A 1W70A 2RNAA 2JW4A 2PTKA 2GTJA 1EFNA 1YCSB 2J06A 5IH2A 3KFVA 3VS3A 3ZL7C 1X2QA 2EGAA 2ESWA 4AFSC 2ROLA 3VS4A 1YWOA 4HVWA 2EKHA 2LQWA 4AFUC 2J6KA 1WYXA 1HD3A 2A28A 4R0KA 1BK2A 2KRMA 2RPNA 1U5SA 3VS2A 4F16A 4Z8AA 4AFZC 1SRLA 5ECAA 1I0CA 2OI3A 4OMQA 4IIMA 2BZYA 4F14A 3H0FA 3FJ5A 1RLQC 4RTVA 3REBB 2G6FX 2CH4W 2DMOA 1QCFA 2JMAA 2SEMA 3M0UA 4HVUA 2J6OA 2DNUA 3H0HA 1UHFA 4J9DA 4A63B 2RQVA 4RTTA 2J7IA 4Z88A 3I5RA 2LCSA 3EG0A 2FRWA 4RTZA 1ABQA 5IHKA 2JS0A 2CT4A 2HSPA 2H8HA 1WXUA 1PHTA 2JM9A 4Y92A 3VS0A 1GBQA 1UFFA 1NYFA 2RQUA 3QWXX 1WA7A 2LJ0A 1AZGB 4D8DA 5GJWB 1E6HA 2VVKA 5I22A 2O2OA 2ECZA 2KGTA 1BBZA 4RTUA 2CH4A 2M51A 1WXTA 2CSIA 1VYVA 4AFQC 1T3SA 2DILA 2PZ1A 2FG0A 2A37A 1AVZC 1WX6A 1QKXA 2VKNA 4Z89A 3M0SA 2FPDA 1K4US 1IO6A 2DL5A 1AWXA 2O9VA 2K6DA 2YUPA 5HCKA 2AZSA 3VRYA 2HEQA 1NLPC 2D8JA 1W1FA 2LP5A 1U3OA 5IHNA 2CDTA
chains in the Genus database with same CATH superfamily
4JLIA 2L2PA 1NPPA 3I56T 3HRUA 3TREA 1DJ7B 2C0TA 1MNEA 4WCIA 2OAWA 2RHIA 1KC8C 1GCPA 1PD0A 2R57A 4PKCC 4LDVA 1KQ1A 1YJNQ 2EYZA 2BIVA 1VQNT 2JTMA 1I8FA 1WPYA 4HXJA 3TEEA 5LJ5j 4E6RA 3CD6A 1OULA 1ZBJA 1VQ7A 3V7SA 2HBPA 2RK2A 1Q7YC 1WDXA 3CC4Q 3UPUA 2FZCB 4KBMB 1K73U 1TUDA 1VIFA 4J9HA 2DVJA 4QVZA 2EBPA 3HTRA 3OYCA 4LUEA 2KNBB 5GAOl 1KD1C 1X2KA 4GBQA 1VQ8A 4OMOA 2OX7A 3CCQA 2CP6A 4JLGA 2DIQA 5GANf 2KY9A 2ENMA 1YI2Q 4PJOD 2H3JA 1NZ9A 2VGNA 3EG1A 3I55T 3PFSA 2Y4XA 2KYBA 2EQUA 4OGCA 3QJYA 2BZXA 2JOYA 2RA2A 1RAAB 2D6FA 4HVVA 2FEIA 2HKQB 3NTKA 1UJYA 3BW1A 3G71T 1AEYA 1MNDA 2LZ6B 5GMKl 4QQ6A 1JXMA 1E7OA 1ARKA 2DETA 2ED0A 4Y91A 3RMSA 2RHUA 4A53A 3C0CA 4J9IA 5GAN7 2YHTA 3VS6A 4J9BA 5KYWA 2K7AA 5AT1B 1XNIA 2QTVA 3E19A 4M7DG 1RLPC 1XQHA 5D6XA 1VQ6A 5L23A 3JCMg 1JRIA 2K2VA 1JU5C 1LPLA 3TSWA 1N9RA 4DBHA 5D7UA 1NE8A 3REAB 2JMCA 5GAMe 2NUTB 2LRQA 3WVDB 3CCSA 5IT9E 2JTEA 1OPLA 2LDMA 3S3OA 1Q81U 4AT1B 3RIRA 4JUVA 4BI8B 1PRMC 3CBOA 3NMZC 3EH2A 1ZSZA 3QG1A 2RI3A 2F2VA 8ATCB 4OMPA 1SSHA 2LJ3A 2KROA 2QA4A 2JS2A 2DPPB 4D6WA 1YJWT 4M7AD 1BI0A 4R55A 2BE9B 2O01E 2CP3A 1QVFP 2PVDB 1OYXA 5GANj 1WJRA 1VQLQ 3MJXA 1KHCA 2RQRA 4JJBA 3ASKA 3ZFJA 3JRZA 1IRXA 2YSQA 2HNIA 4DBRA 1VQNQ 1BI2A 2R5MA 1MMNA 1IHVA 2MK5A 5CVIA 5GAN8 2YUQA 2KSSA 2QDYB 3HL8A 3PMIA 1M2VA 2AKLA 1JXOA 2JM8A 4FL6A 2KVQG 1UGVA 1YJNA 2BE7D 2R58A 1TTHB 3VYHB 1WQ7A 5KYUA 1V1CA 2YT6A 2YRCA 2RMOA 1VQKA 1UGPB 2O31A 3SEMA 5KYXB 2RH2A 4C8QF 1WXBA 1D0YA 3QYGB 4M7AB 2ZZDA 3URGA 4BY6B 3P8HA 2M02A 7AT1B 1X6OA 3L2VA 2EGCA 1RAEB 3MP1A 4LNPA 3CCQT 3EFRA 1QVFS 4J9EA 1VIEA 3S3MA 2X3XD 1H641 5KCHA 2MF2A 3CCQQ 2LVMA 3G7ZA 3GIBA 1UJ0A 4B9XA 4BE2A 2P4TA 2NUZA 5D6WA 3CCRA 2XK0A 4NL3A 4M7DD 1CKAA 2RI2A 5LJ3j 4E7ZA 1BI1A 2CKKA 3QDRB 2CP2A 4PJLA 1RUWA 4X1VA 2QQ9A 1VA7A 5AYFA 2V8JA 2HKNA 4J83A 5GMKh 2EGEA 1UGQB 3EGUA 2KBTA 1QVPA 4M77F 4KRTA 4C5GA 4XU1A 1FX7A 1QLYA 2FPEA 1UHCA 1UGSB 3PTAA 1KD1U 1VQ6Q 3VS1A 3I9QA 4XTWA 3G4ST 3E9GA 1N8RR 3CBMA 1G5VA 3X25B 3I56A 4PFOA 1SPKA 2RJEA 2X4XA 1UE9A 1OU9A 5FU6C 1G3SA 5DLQE 3SHWA 3M9QA 3X24B 4IURA 1WFWA 1GRIA 2EYWA 2QQBA 2HZYA 2WSFE 5GAN6 1ZHIA 1GCQC 5A0LA 1Q81R 3CQTA 3P8BB 5LJ5g 5CO7A 1BCOA 2RK1A 1NJIU 3T9NA 2DYBA 3V8LA 2RB6A 1IREB 4LD9K 3CCLT 3H41A 3CC4A 3RBBB 1X75C 5KYUB 1YIJT 2DZ9A 5A2QE 3IQLA 4QT7A 3NPFA 3VUZA 5CCAA 2RNAA 3G6EQ 2K3XA 2PTKA 3RERA 4N4IA 3VS3A 3SWNB 3ZL7C 2E4HA 2ZCFB 1VQOQ 2E3IA 2ROLA 1YWOA 2EKHA 2LQWA 4AFUC 2J6KA 1WYXA 2QEXT 2E6ZA 4HCZA 2V26A 2A7YA 2A28A 5CKDA 4KGXB 2JUFA 2RPNA 1SG5A 4ELYC 4IUTA 3OB9A 4Z8AA 2QEXQ 3QZ5B 5IAYA 1NJIC 4ZN3A 2DZCA 1R0CB 4EPCA 2BKDN 2BZYA 3OW2A 3H9NA 1YJNT 3FRNA 2OTLA 1RLQC 1TU0B 2L3RA 2DMOA 1VQKQ 2SEMA 3FDRA 4KT0E 2J6OA 2X4YA 1MMGA 4A63B 2RQVA 4RTTA 1G3YA 5DM7R 3G1JA 2DXBA 4MDWA 3I5RA 3EG0A 2PQWA 2B8AA 2PVGB 1JJ2P 4EDUA 3CC7A 2JS0A 4Y28E 2EJ9A 1PHTA 5GAN3 3VS0A 1GBQA 2LCCA 3GP8A 2HQEA 2R5AA 3S6WA 3M5AA 1W2BP 4D8DA 2CGHA 2ECZA 4RTUA 1WXTA 4NOYA 1D1AA 2XKOC 2MYSA 1VYVA 2PZ1A 2DILA 3WVEB 1KQSS 1BI3A 2FG0A 3A1PA 4KGZB 4WTOB 2DXTA 3MEWA 4J7IA 1VQMT 3QDFA 4Z89A 1IO6A 2NUTA 2MI6A 5HCKA 2AZSA 2X35A 1VQMQ 3DB4A 1RI0A 5LJ3d 1BKBA 4ZTJA 4J5YA 5CAIA 2X4WA 2RM4A 3E2UA 2EIFA 4FYXB 3G4SQ 3VUBA 1K0XA 2EPDA 2DF6A 4PLLA 1PSEA 3I56Q 3ZEHA 1WHGA 4K11A 1B3QA 2GQIA 4M75C 4PLIA 1YHQA 4PJOC 2A0FB 4E7IA 1YJ9T 1I5LA 2PNIA 3JB9H 1OQKA 1M90C 2KRSA 5GMKj 3OW2S 4M7DC 4F7UB 1LVKA 3R6OA 4BB7A 3JCMd 4FIBA 2D0QB 1R8OB 2GBQA 1ACMB 2DLPA 1O9SA 3KXTA 3CMEA 3CMET 2L3SA 2OTJT 2F69A 4ME7A 2RJCA 2ZPBB 3A5ZB 4M7DB 1NM7A 4RTWA 3KBGA 3S3NA 5FU6B 1ZQ1A 4BI4A 3JAME 5I2SA 2DIGA 2NUPA 1VQOA 4CC2A 4M7AE 1BU1A 1XOVA 2W10A 2XDPA 2COWA 2BTTA 2E65A 1SHFA 3C94A 1M3BA 2PU9B 4DEXA 1Y96B 4DQ2A 1M1FA 3INZA 2DX1A 4LE9A 5KYNA 2KRNA 3EHQA 4RG2A 1WJQA 3M4GA 2XDBA 1QCNA 2F1LA 4XU0A 3QIIA 1IB8A 1GCQA 2EJGA 1VQ5T 4ESRA 1U8RA 2M0YA 4BE1A 5GAOr 3CCJA 1Q82U 3DKMA 3OSVA 1WIEA 3TVTA 2MIOA 2DM1A 1VQ4T 3JCMP 2A08A 3LWHA 4LDUA 2QQAA 2LJ1A 1YI2A 2ZPIB 3RR6A 5KYYA 3HRSA 4CC4B 3PT9A 5C0MA 2L89A 2J05A 4M78G 1AOJA 1RAFB 1BYMA 3THKA 5GAOp 2VXEA 3V8JA 3BE3A 3EFSA 2DEUA 2CP7A 4ELZC 3RMQA 1SEMA 2DXUA 1ZBXA 4ZNXA 5GAMf 3OYFA 2C0IA 1QWFA 3QWYA 4EMKC 4M78F 4M78D 2LTOA 5CKFA 4CC7A 2VB6A 1IHWA 8AT1B 3EAEA 1TUGB 2E3HA 3JB9G 1YIJQ 1K8AC 1RAIB 3PIPA 5EC7A 4AG2C 4CRIA 4XTVA 5LJ5e 1I07A 2MOXA 1YJ9Q 3A98A 1ABOA 5C6SA 1I4K1 1KIKA 1NLOC 5GMKi 3CPWA 4IUQA 3L42A 2L0AA 4KUDK 4FM4B 3OQ5A 1MV3A 3SWNC 2D9TA 1HYOA 2RN8A 1H8KA 2IIMA 2FYKA 4C0DB 4DEYA 2MPXC 3CMEQ 2F5TX 2HQHA 1K73C 4A4GA 1Y96A 2DA9A 4JRPA 4FSSA 4PJOG 1M90R 2RHXA 3CPWS 2CREA 5CQXA 2YWWA 2QQRA 1SKUB 3P8DA 2D8HA 1GFDA 1Z9ZA 2DL3A 3CCUT 1I81A 2E6NA 2EFIA 2X3WD 2YUOA 4EIKA 2P0QA 4JRKA 4C92G 2RO0A 2GTOA 1V76A 1WZOA 2E1HA 2O9SA 1W2BS 2EKOA 3CCLQ 2DAQA 1OI1A 3JSCA 3JCMV 1N6AA 2QYZA 4JJDA 1D3BB 1GBRA 3HPWA 1H3HA 3BDUA 2KXDA 4OP0A 4E2FB 2KT8A 3EG2A 2ROTA 4C92F 2LQNA 4C92D 1YITA 3HSBA 2LT4A 4IUUA 3JB9I 2RQWA 3RNJA 1KSWA 2L3QA 4MDXA 4GY5A 2KQWA 4VUBA 4B9WA 3NGPA 1NJIR 2DO3A 4KH0B 3RKXA 2DJZA 1MGQA 3R6NA 4M77D 3CCRT 5FRNA 1K1ZA 4OMLA 2DRKA 1AZEA 1AD5A 2E64A 4ZTFA 5J3BA 4XTYA 3SWNA 4HCKA 1X6GA 1RL2A 2J6FA 2XI9A 3JCMf 1T0HA 2DEQA 5GAOq 2DTOA 2V8IA 1LJOA 1PKSA 1M8VA 3PMTA 4MMKA 3FLGA 4HA8A 2GFAA 3JB9D 2CSQA 4LD6A 1N5ZA 2XMFA 4QW2A 1XTDA 1FMWA 4EMKA 2K3BA 2CZ0B 4RTXA 2V1QA 2HQXA 3M59A 3OMGA 2DRMA 4E47A 1K9MU 2LT1A 4C8QD 1ZUKA 1U1TA 4MZTA 3OMCA 2CYZB 3M56A 1EFNA 5IH2A 2CZ1B 4M7DA 1VQPA 3KFVA 4GLKA 1X2QA 2DFUA 2ESWA 4ANJA 2HAXA 1NBEB 3CCMA 4ZN1A 4OF1A 1BIAA 4M7AF 5KE2A 4F16A 4LDWA 2QTXA 4FW1A 2QI2A 2NUPB 4C5IA 3OS0A 4XQ3A 4M78E 4IIMA 2PUOB 2O4XA 3F70A 3FJ5A 2G6FX 2CH4W 5M9OA 3M0UA 1EIFA 1D1CA 1TS9A 3AHUA 1WQWA 1VQ4A 4HVUA 3OS2A 1M90U 1TH7A 1UHFA 4M7AG 3MPUB 4Q5WA 5HY6A 1I5OB 2FRWA 4B6MA 1KK7A 4RTZA 1RAHB 4N4HA 5FLXE 3EFOA 1VQ5A 4DOVA 3L1AA 3E9FA 3OBYA 1ZSZC 3OYNA 3FJPA 3J80E 4C0ZA 9ATCB 2RQUA 1QVGP 2LJ0A 1AZGB 2XHCA 4M75B 5CKBA 2M51A 3L2RA 4HCCA 3QXEB 2LQKA 2QGFB 2JJ9A 3CCVA 3I55Q 1AVZC 1WX6A 4X9CA 4L59A 2FPDA 1K4US 2O9VA 2K6DA 2LCLA 2L8DA 2OTLQ 1UGRB 2E41A 2X9HA 3G71A 2HEQA 1W1FA 4P5NA 4E7JA 1U3OA 5GMKm 4OGEA 4A4EA 3CBPA 4N4GA 2E5KA 3CMAA 2WSCE 4QVCA 1PC0A 5HKCA 4A4FA 3MKDA 1B34B 3TCJA 4E7LA 2IVWA 3DLLA 3C12A 1M2OA 2VC8A 2JT4A 1T3LA 1VOMA 3CMAT 4JRIA 4EMGA 2VXFA 4RUGA 1LNXA 1ZA2B 1GFCA 2CT3A 4M77C 4M75A 1TOVA 1SSFA 5CKHA 1PD1A 3NHNA 1M1GA 3LW5E 4KH1B 1YJ9A 3CCVT 2JVVA 4LN2A 1YHQT 1KD1R 3UA6A 3HKSA 5GANe 2Y90A 2E10A 1OEBA 2P4RA 2KE9A 4F7UA 1M27C 3QSUA 4E7HA 1E6GA 1Y57A 2ZGWA 3G6EA 1AWOA 2CUBA 2LC4A 4IUPA 1R0BG 1RADB 3CC2T 5A0GA 1WI7A 1UUEA 1VQ7T 2A3LA 1JJ2A 2LNVA 3M53A 2KK4A 1D0XA 3UT1A 1ZUUA 3CCUQ 4FU6A 2ZAEA 4BD3A 3VRZA 3MEAA 3JB9J 2WSEE 1YBYA 2KR3A 2FZGB 1X27A 4V2SA 5CQYA 2AZVA 3GLXA 1FMKA 1TG0A 2EYYA 2LQ8A 1J3TA 2G3RA 5CKEA 3M0RA 5LJ3g 4FW2A 3PIOA 4E7SA 1B07A 2VASA 3CCUA 3CC7T 3CCMT 1PRLC 2OJ2A 4DBQA 4M7DE 3U23A 2YRDA 1K73R 2AKKA 3I5SA 2KXCA 2NWMA 2RI5A 4PJOE 4M78B 4LDYA 4OB2B 3SD4A 2ZPFB 4A4HA 4C0FA 1Y0MA 2CP0A 3OYBA 4UC4A 1Q81C 3V7CA 2K4YA 5GANd 1VQ9A 1QKWA 3OSSC 1TWBA 4L6V5 2CZ7B 2DD4A 4E7KA 1N8RU 3META 1FYNA 3PVQA 1KJWA 3A8GB 3GPLA 2QGGA 3PVLA 3OYLA 2VYTA 1M4ZA 4JDSA 3X26B 2HCKA 1GL5A 2YDLA 2AIRB 5FU7C 2NYSA 5GANh 2YLCA 2XIDA 3WXMB 5DLOA 3OS5A 1QCOA 4JPBW 1MMAA 3CMAQ 3TQ7P 2DL8A 2QXFA 3OBWA 2A36A 3LH5A 2Z0WA 4F7UE 2FRYA 3LGFA 2QAZA 3BFMA 1KC8R 1V29B 2QASA 2MAMA 3OYYA 3X20B 1PSFA 4C0DC 1KHIA 3KUFA 4D8KA 5GAMh 4J9GA 3MP8A 1VQLA 3SFMA 2K9GA 2CP5A 2AK5A 4M75F 3CC2Q 4R56A 1MUZA 2FVUA 3M0QA 4M4ZA 2O88A 3H8ZA 2C0OA 3CCJT 1QMCA 4J9FA 4M7DF 2K79A 1M30A 4A4KA 3O5ZA 1UECA 1YJWQ 2MCNA 4J8OA 1F1BB 1WHKA 2ED1A 4M75G 3LLRA 3VV0A 1D1BA 4LDXA 1K9MR 1N27A 1PM3A 1ZUYA 4MZMA 1X69A 4C8QC 3L2UA 2COZA 3SDZA 4PNOA 1LCKA 4NL2A 5IXBA 3HRTA 3CC2A 1HK9A 1NYGA 3G6ET 2W0ZA 4KGVB 1Y7XA 2X51A 1VQOT 4O5VA 3CCEA 3M0TA 5KH6A 4X9DA 5FWBA 3MEVA 2CS7A 2FB7A 3ULRB 5IN1A 4ZGEB 1K8AR 1JO8A 2YLBA 1KFZA 3QUIA 4PJNA 2GCXA 2JTFA 2DD5A 2D1XA 5FROA 2E5QA 1JEGA 2OTJA 1VQKT 4JS4A 3CCRQ 3VS5A 3ER0A 1BB9A 5GANg 2K5FA 4AG1C 1H92A 2M16A 3RKYA 3UATA 3OYDA 4GLMA 4J7FA 4MMLA 2EQKA 3I35A 1AWWA 2KAFA 2X4JA 4PK4A 5KYXA 1PKTA 1X01A 3CCEQ 2B86A 3QYHB 2DERA 3UF4A 4C5HA 4LXCA 5L8RE 5A0DA 1M8MA 1A0NB 2K2MA 5GAOn 2HBWA 3CCET 3EHRA 4MZPA 1WHLA 5LJ5h 2JZ2A 3CCSQ 3NTHA 2E70A 3QPHA 4JS5A 1JBMA 3M4YA 1VQ9Q 5J26A 2EYQA 3LH0A 2QG9B 2DE0X 4FT4A 5LJ5f 1JB0E 1HSQA 4XU3A 4C8QG 1AT1B 2OAUA 5GAN4 2EQMA 3JCMh 2EWNA 3EFOB 1W70A 4C8QA 2GTJA 1YCSB 3HHTB 3PNWC 2P84A 2QA4T 1UEBA 1OZ3A 2EGAA 3VS4A 4FCYA 1PG5B 4EMHA 1M9SA 1HD3A 4F04B 4R0KA 5KCOA 2KRMA 3O8VA 2L5QA 2I2LA 3GOXA 2E12A 3VS2A 2XDDA 1YFNA 2XICA 3X28B 4KUIA 5ECAA 1I0CA 4OMQA 3H0FA 1Q82C 4RTVA 3REBB 3JCMe 1RAGB 3EG9B 2JMAA 3FC3A 5D6YA 3J7AF 5CR2A 3CCJQ 3H0HA 3MP6A 4J9DA 3C95A 4M77G 5J39A 2JN0A 1TXQA 5CIUA 1K9MC 3UDCA 3L2QA 1OX9A 4OVAA 2MWOA 4NS5A 2EQJA 4M77A 1ABQA 4BDZA 2CT4A 1ZSZB 2HSPA 2H8HA 4OB1B 4Y92A 1UFFA 1S72A 3OYKA 1R77A 4RKUE 3QWXX 1WNLA 3FIFA 5I2MA 2VVKA 1W2BA 4N0AC 5LJ3h 2O2OA 2KGTA 1GXIE 2CSIA 4OB3B 4AFQC 3M58A 5LL6S 3JCMb 1KQSA 4PJOA 1O75A 2P0KA 5CK9A 2VKNA 4IUVA 1VQ8Q 3M0SA 4C92B 1VUBA 3J81E 3GNFB 4BE0A 2K57A 2K5LA 3EGXA 4FYWB 3NFCA 2CDTA 3HP9A 2AHJB 4C92C 4BDYA 4IIOA 5FRMA 1U1SA 3JCMJ 3VS7A 5HK3A 1NEGA 1K0SA 2DTHA 3MCAB 2D0NA 1VQ5Q 1Q86C 2MWPA 5GAN2 1WHMA 3VU3C 4HT9A 4CC3A 1UG1A 2M9UA 4DBFA 2HL5C 4C8QB 4IKFA 2WACA 2EW3A 4PJMA 2DBMA 1K9AA 1SF9A 1YCYA 1IGUA 3A8OB 1VYUA 3OYMA 1VQMA 2HSEB 5I21A 4JZ4A 3CXCS 1FWZA 1G8XA 1YN8A 2RJDA 1NG2A 2H3EB 1KQSP 4J9CA 4BUGA 3CCVQ 1HJDA 4O6JA 1WGSA 1T0JA 1NPRA 5HK0A 3D7SB 2DBKA 1QWEA 2FL7A 3QKJA 4LUDA 1X6BA 2FO0A 4F7UG 1W4SA 2AT1B 4PL6A 1H3ZA 2DKGA 3UA7A 4RMOA 4RG8A 1M3CA 4XAXB 4EMKB 1G83A 2BZ8A 3ME9A 2FHDA 1TUCA 3ZBDA 3RKWA 1C1AA 4FYVB 4M77B 1C6VX 4ATOA 2RJFA 3QBYA 3PE0A 4F7UF 3JCMc 3QJ6A 3EGDA 4OMNA 2K3YA 3FB9A 5IHIA 4C0GA 2KDSA 2GF7A 1FMVA 3SB2A 3FEOA 1RI9A 2M1HA 1Q86U 1FXXA 2IPOB 1RABB 5KYWB 1OPKA 4PJOF 2QEXA 2MMPA 1XJWB 1U06A 2EJFA 1YP5A 1OX8A 4QQGA 1Q82R 3OYHA 3CC7Q 4QKUA 4XU2A 5I11A 4JZ3A 3V7RA 1X43A 2O4XB 2QQSA 3QO3A 2QDLA 6AT1B 1JQQA 2JNGA 2ABLA 3GBQA 1KG1A 1YIJA 1S72T 1Q7YR 3CC4T 4M78A 4BI3A 1D09B 1S72Q 4RCCA 1QVGA 3HFOA 2OTJQ 2LX9A 2ZPEB 5FWCA 5GJVB 2NLUA 2CUDA 3A8HB 1PNJA 3GNGA 3OW2P 1UB4A 4X34A 4C5EA 4RTYA 1M1KU 2KI7A 4OB0B 1YI2T 1ZA1B 4FSXA 1HXDA 4M75E 1QVGS 1Q86R 1B7TA 1IXDA 3G4SA 1D3BA 1K8AU 3M55A 1M1KR 3CXCP 2EYXA 4RCBA 1YJWA 2C06A 4XK8E 3CXCA 5GAOm 4KULA 1OOTA 2KT1A 1QP2A 2XD0A 4XTXA 3CCMQ 1OZ2A 2COYA 2KEAA 1S1NA 4PFPA 4HT8A 1M2VB 3OYAA 3TSZA 2RF0A 1M1KC 2F2XA 2VWFA 2FZKB 4II1A 4F17A 3LYIA 1M3AA 2M0OA 5GAMg 1B34A 3L2ZA 2DL7A 1VQ4Q 2GNCA 2SRCA 3JCMX 2YUNA 1N8RC 3GF5A 4ORZA 3H0IA 3L2WA 2XU8A 1Y07A 4C8QE 3OYJA 2P0PA 1MMDA 5FW9A 1P92A 2QK0A 1YNZA 3MEUA 1VQ6T 4QQDA 2VV5A 2CZ6B 1MHNA 2GQVA 2L3PA 2ZPHB 1Y71A 1SRMA 4XTUA 3VYGA 5DY9A 3MHXA 1MV0B 2BUDA 2EAYA 3UWNA 1LOJA 1VQPT 4J6WA 3EG9A 1YWPA 4CI0C 1JJ2S 2EVRA 1CKBA 1PWTA 3N5BB 4C92E 1AWJA 2DXCA 3CPWP 2HDAA 1G2BA 3A8MB 3JCMW 1VYTA 3OYIA 2F2WA 1Q95G 4QVDA 1I1JA 3HFNA 2V1RA 3G71Q 1C0MA 3M0PA 1WHHA 4M77E 1UDLA 1WLPB 1QQJA 4BY6C 3DLMA 4HCBA 1K76A 1PCXA 1QP3A 2FPFA 3EH1A 4HKEA 5KE3A 1QW1A 2LX7A 3V8KA 1VQ8T 4JRQA 2KYMA 3JV3A 3M57A 2F5KA 1W6XA 4OMMA 2XG8D 1UTIA 4PJOB 1QVFA 4M7AC 2PUKB 2PVOB 4PFZA 2DJQA 1G3WA 3JB9F 4OMFB 2LNHB 5LJ5d 1KQ2A 1N9SA 2GGRA 5LJ3f 3CPFA 1TSFA 2DYIA 4JJNK 4DOWA 1SHGA 3EGXB 1BCMA 2HL3A 2LMJA 1ZSGA 3EG3A 4Z02A 2RQTA 3E1SA 1EX4A 3OY9A 3Q1JA 2IG0A 1ZLMA 1YITQ 2I0NA 4M75D 1CSKA 5GMKe 2JXBA 2VGMA 1YITT 4XTZA 5FU7B 5IXFA 3H6ZA 1EZZB 3RUXA 3CCST 3TU4K 2RHZA 4AMCA 4J6XA 1VQLT 1NEBA 3PGGA 3AT1B 2DL4A 2EQIA 4DA4A 4JJCA 1Z9QA 1WJSA 2VUBA 1ZX6A 1OV3A 2JW4A 5GAMd 4WF2A 2J06A 3LX7A 4PJJA 3LGLA 1OU8A 4FYYB 3RDVA 3LWIA 2V8KA 4AFSC 4ZGDB 4FT2A 4HVWA 4BACA 5GAN5 1D0ZA 4M78C 1BK2A 2OTLT 1U5SA 3JCMQ 4AFZC 1SRLA 2OI3A 3RESA 4F14A 3VKIA 4TVRA 3OS1A 2DTIA 3CEYA 5GAMj 3MO8A 4M7AA 1QCFA 3OYEA 1Q7YU 3EGDB 3BY7A 2DNUA 1IZ6A 1VQPQ 5KYYB 2J7IA 3I55A 1BIBA 4Z88A 4L5GA 1YHQQ 1M5Q1 2LCSA 2ZPGB 3DB3A 2HD0A 2YRVA 1VQ9T 5IHKA 2KMTA 5EG2A 3QZ9B 2ATCB 1WXUA 3OA6A 1KC8U 2JM9A 2DVEA 3C4SA 1NYFA 4YTLA 4N0AA 3M54A 1WA7A 4A54A 2Y4YA 5GJWB 1E6HA 5I22A 3CCLA 1BBZA 1AHJB 2CH4A 1T3SA 3BDLA 2QA4Q 2DK3A 3QHSA 3CD6Q 1G3TA 2A37A 1VQ7Q 2YXYA 1QKXA 3VJPA 1WHJA 1RACB 1IGQA 2RD1A 3CD6T 2RHYA 2DL5A 1AWXA 2YUPA 5LJ3e 3VRYA 3OYGA 4ZGJB 4J6YA 2GFUA 1NLPC 2D8JA 3A8LB 2HMAA 1VQNA 2K5IA 3NTIA 2LP5A 4C92A 5IHNA
chains in the Genus database with same CATH topology
2E5KA 2L2PA 2C0TA 4IIOA 4WCIA 2OAWA 3VS7A 2EPDA 1K0XA 2DF6A 1NEGA 1GCPA 1K0SA 2JT4A 4K11A 1T3LA 2D0NA 1B3QA 2GQIA 2EYZA 4CC3A 4RUGA 1UG1A 4HXJA 2EW3A 1GFCA 2CT3A 2DBMA 2PNIA 1K9AA 4E6RA 1VYUA 1ZBJA 2KRSA 3NHNA 4JZ4A 1WDXA 1YN8A 4LN2A 1NG2A 3UA6A 2GBQA 4J9CA 2DLPA 1TUDA 1OEBA 2P4RA 2KE9A 1HJDA 2L3SA 4J9HA 2DVJA 2EBPA 1M27C 1E6GA 1T0JA 1Y57A 1AWOA 2CUBA 2DBKA 1QWEA 4LUEA 4LUDA 1X6BA 2KNBB 2FO0A 1NM7A 1X2KA 1WI7A 4RTWA 1UUEA 4GBQA 4OMOA 3UA7A 1M3CA 1ZUUA 2ENMA 1G83A 3VRZA 2BZ8A 4CC2A 3EG1A 1BU1A 1XOVA 1TUCA 2KYBA 2W10A 2BZXA 3PE0A 2BTTA 1SHFA 1M3BA 2KR3A 1X27A 4OMNA 2AZVA 5IHIA 4HVVA 4DEXA 1FMKA 2DX1A 1TG0A 2FEIA 2EYYA 4LE9A 1J3TA 2KRNA 3EHQA 1RI9A 1UJYA 1AEYA 2LZ6B 3M0RA 1OPKA 1B07A 1JXMA 1E7OA 1GCQA 1ARKA 1PRLC 4ESRA 2OJ2A 1U06A 2ED0A 2M0YA 1YP5A 3U23A 3C0CA 4J9IA 3VS6A 4J9BA 2K7AA 2AKKA 3I5SA 5I11A 1RLPC 4JZ3A 1X43A 2KXCA 2NWMA 1WIEA 2QDLA 3TVTA 2MIOA 1JQQA 2DM1A 2ABLA 2A08A 5L23A 3GBQA 1Y0MA 2LJ1A 1JU5C 3TSWA 3REAB 4CC4B 2JMCA 1QKWA 2J05A 1AOJA 2JTEA 1OPLA 5FWCA 5GJVB 3THKA 1FYNA 1PRMC 3NMZC 3PVQA 1KJWA 2F2VA 2CUDA 1PNJA 4OMPA 1SSHA 2LJ3A 2KROA 4RTYA 1SEMA 2JS2A 3PVLA 1GL5A 2HCKA 2YDLA 4ZNXA 2C0IA 1QWFA 3QWYA 4CC7A 2RQRA 4JJBA 2EYXA 4JPBW 1OOTA 2DL8A 2KT1A 2YSQA 5EC7A 4AG2C 2A36A 3LH5A 2KEAA 1I07A 2FRYA 2MOXA 3A98A 1S1NA 1ABOA 1KIKA 3TSZA 2RF0A 1NLOC 2F2XA 2VWFA 4F17A 2L0AA 1M3AA 2YUQA 1MV3A 2RN8A 2AKLA 2DL7A 1JXOA 1H8KA 2JM8A 2GNCA 2IIMA 2SRCA 4DEYA 2YUNA 1UGVA 4D8KA 4ORZA 3H0IA 4J9GA 5FW9A 1YNZA 2K9GA 2AK5A 2DA9A 1V1CA 4FSSA 1MUZA 2YT6A 2CREA 3M0QA 4M4ZA 2RMOA 2O88A 2O31A 2C0OA 2L3PA 3SEMA 1SRMA 4J9FA 2D8HA 1GFDA 1WXBA 1Z9ZA 2DL3A 1MV0B 2K79A 1M30A 1YWPA 2X3WD 2YUOA 4EIKA 2GTOA 2EVRA 1CKBA 3O5ZA 1UECA 1PWTA 2EGCA 2MCNA 2ED1A 1AWJA 4LNPA 2O9SA 2HDAA 1G2BA 1ZUYA 4J9EA 1X69A 1VYTA 2F2WA 2X3XD 4JJDA 1LCKA 1UJ0A 5IXBA 1I1JA 1GBRA 2V1RA 1H3HA 2NUZA 2KXDA 1NYGA 2KT8A 2W0ZA 1CKAA 3M0PA 3EG2A 2ROTA 2LQNA 1UDLA 1RUWA 1WLPB 4X1VA 2RQWA 1K76A 1VA7A 3M0TA 2FPFA 5FWBA 3RNJA 3ULRB 1KSWA 2L3QA 2LX7A 3NGPA 1JO8A 2KYMA 2EGEA 1KFZA 3EGUA 2KBTA 3JV3A 1W6XA 4OMMA 1UTIA 4KRTA 3R6NA 2D1XA 1K1ZA 2DJQA 4OMLA 1QLYA 2FPEA 1UHCA 1JEGA 2DRKA 2LNHB 1AZEA 1AD5A 2GGRA 3VS5A 3VS1A 1BB9A 3I9QA 4AG1C 1H92A 1SHGA 4HCKA 1X6GA 2J6FA 2LMJA 3UATA 1SPKA 4GLMA 1ZSGA 3I35A 1UE9A 1AWWA 1T0HA 3EG3A 1PKTA 2RQTA 3SHWA 2B86A 3UF4A 1WFWA 1M8MA 1PKSA 1A0NB 1GRIA 2K2MA 1ZLMA 2EYWA 2HBWA 2I0NA 1CSKA 3EHRA 2JXBA 2CSQA 1GCQC 1N5ZA 5IXFA 2XMFA 3CQTA 2K3BA 4RTXA 2V1QA 2DYBA 2DE0X 2DRMA 1NEBA 1HSQA 2EQIA 2DL4A 3H41A 3RBBB 4JJCA 1Z9QA 1ZUKA 3IQLA 4QT7A 3NPFA 1ZX6A 1OV3A 1W70A 2RNAA 2JW4A 2PTKA 2GTJA 1EFNA 1YCSB 2J06A 5IH2A 3KFVA 3VS3A 3ZL7C 1X2QA 2EGAA 2ESWA 4AFSC 2ROLA 3VS4A 1YWOA 4HVWA 2EKHA 2LQWA 4AFUC 2J6KA 1WYXA 1HD3A 2A28A 4R0KA 1BK2A 2KRMA 2RPNA 1U5SA 3VS2A 4F16A 4Z8AA 4AFZC 1SRLA 5ECAA 1I0CA 2OI3A 4OMQA 4IIMA 2BZYA 4F14A 3H0FA 3FJ5A 1RLQC 4RTVA 3REBB 2G6FX 2CH4W 2DMOA 1QCFA 2JMAA 2SEMA 3M0UA 4HVUA 2J6OA 2DNUA 3H0HA 1UHFA 4J9DA 4A63B 2RQVA 4RTTA 2J7IA 4Z88A 3I5RA 2LCSA 3EG0A 2FRWA 4RTZA 1ABQA 5IHKA 2JS0A 2CT4A 2HSPA 2H8HA 1WXUA 1PHTA 2JM9A 4Y92A 3VS0A 1GBQA 1UFFA 1NYFA 2RQUA 3QWXX 1WA7A 2LJ0A 1AZGB 4D8DA 5GJWB 1E6HA 2VVKA 5I22A 2O2OA 2ECZA 2KGTA 1BBZA 4RTUA 2CH4A 2M51A 1WXTA 2CSIA 1VYVA 4AFQC 1T3SA 2DILA 2PZ1A 2FG0A 2A37A 1AVZC 1WX6A 1QKXA 2VKNA 4Z89A 3M0SA 2FPDA 1K4US 1IO6A 2DL5A 1AWXA 2O9VA 2K6DA 2YUPA 5HCKA 2AZSA 3VRYA 2HEQA 1NLPC 2D8JA 1W1FA 2LP5A 1U3OA 5IHNA 2CDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5K A;  2L2P A;  2C0T A;  4IIO A;  4WCI A;  2OAW A;  3VS7 A;  2EPD A;  1K0X A;  2DF6 A;  1NEG A;  1GCP A;  1K0S A;  2JT4 A;  4K11 A;  1T3L A;  2D0N A;  1B3Q A;  2GQI A;  2EYZ A;  4CC3 A;  4RUG A;  1UG1 A;  4HXJ A;  2EW3 A;  1GFC A;  2CT3 A;  2DBM A;  2PNI A;  1K9A A;  4E6R A;  1VYU A;  1ZBJ A;  2KRS A;  3NHN A;  4JZ4 A;  1WDX A;  1YN8 A;  4LN2 A;  1NG2 A;  3UA6 A;  2GBQ A;  4J9C A;  2DLP A;  1TUD A;  1OEB A;  2P4R A;  2KE9 A;  1HJD A;  2L3S A;  4J9H A;  2DVJ A;  2EBP A;  1M27 C;  1E6G A;  1T0J A;  1Y57 A;  1AWO A;  2CUB A;  2DBK A;  1QWE A;  4LUE A;  4LUD A;  1X6B A;  2KNB B;  2FO0 A;  1NM7 A;  1X2K A;  1WI7 A;  4RTW A;  1UUE A;  4GBQ A;  4OMO A;  3UA7 A;  1M3C A;  1ZUU A;  2ENM A;  1G83 A;  3VRZ A;  2BZ8 A;  4CC2 A;  3EG1 A;  1BU1 A;  1XOV A;  1TUC A;  2KYB A;  2W10 A;  2BZX A;  3PE0 A;  2BTT A;  1SHF A;  1M3B A;  2KR3 A;  1X27 A;  4OMN A;  2AZV A;  5IHI A;  4HVV A;  4DEX A;  1FMK A;  2DX1 A;  1TG0 A;  2FEI A;  2EYY A;  4LE9 A;  1J3T A;  2KRN A;  3EHQ A;  1RI9 A;  1UJY A;  1AEY A;  2LZ6 B;  3M0R A;  1OPK A;  1B07 A;  1JXM A;  1E7O A;  1GCQ A;  1ARK A;  1PRL C;  4ESR A;  2OJ2 A;  1U06 A;  2ED0 A;  2M0Y A;  1YP5 A;  3U23 A;  3C0C A;  4J9I A;  3VS6 A;  4J9B A;  2K7A A;  2AKK A;  3I5S A;  5I11 A;  1RLP C;  4JZ3 A;  1X43 A;  2KXC A;  2NWM A;  1WIE A;  2QDL A;  3TVT A;  2MIO A;  1JQQ A;  2DM1 A;  2ABL A;  2A08 A;  5L23 A;  3GBQ A;  1Y0M A;  2LJ1 A;  1JU5 C;  3TSW A;  3REA B;  4CC4 B;  2JMC A;  1QKW A;  2J05 A;  1AOJ A;  2JTE A;  1OPL A;  5FWC A;  5GJV B;  3THK A;  1FYN A;  1PRM C;  3NMZ C;  3PVQ A;  1KJW A;  2F2V A;  2CUD A;  1PNJ A;  4OMP A;  1SSH A;  2LJ3 A;  2KRO A;  4RTY A;  1SEM A;  2JS2 A;  3PVL A;  1GL5 A;  2HCK A;  2YDL A;  4ZNX A;  2C0I A;  1QWF A;  3QWY A;  4CC7 A;  2RQR A;  4JJB A;  2EYX A;  4JPB W;  1OOT A;  2DL8 A;  2KT1 A;  2YSQ A;  5EC7 A;  4AG2 C;  2A36 A;  3LH5 A;  2KEA A;  1I07 A;  2FRY A;  2MOX A;  3A98 A;  1S1N A;  1ABO A;  1KIK A;  3TSZ A;  2RF0 A;  1NLO C;  2F2X A;  2VWF A;  4F17 A;  2L0A A;  1M3A A;  2YUQ A;  1MV3 A;  2RN8 A;  2AKL A;  2DL7 A;  1JXO A;  1H8K A;  2JM8 A;  2GNC A;  2IIM A;  2SRC A;  4DEY A;  2YUN A;  1UGV A;  4D8K A;  4ORZ A;  3H0I A;  4J9G A;  5FW9 A;  1YNZ A;  2K9G A;  2AK5 A;  2DA9 A;  1V1C A;  4FSS A;  1MUZ A;  2YT6 A;  2CRE A;  3M0Q A;  4M4Z A;  2RMO A;  2O88 A;  2O31 A;  2C0O A;  2L3P A;  3SEM A;  1SRM A;  4J9F A;  2D8H A;  1GFD A;  1WXB A;  1Z9Z A;  2DL3 A;  1MV0 B;  2K79 A;  1M30 A;  1YWP A;  2X3W D;  2YUO A;  4EIK A;  2GTO A;  2EVR A;  1CKB A;  3O5Z A;  1UEC A;  1PWT A;  2EGC A;  2MCN A;  2ED1 A;  1AWJ A;  4LNP A;  2O9S A;  2HDA A;  1G2B A;  1ZUY A;  4J9E A;  1X69 A;  1VYT A;  2F2W A;  2X3X D;  4JJD A;  1LCK A;  1UJ0 A;  5IXB A;  1I1J A;  1GBR A;  2V1R A;  1H3H A;  2NUZ A;  2KXD A;  1NYG A;  2KT8 A;  2W0Z A;  1CKA A;  3M0P A;  3EG2 A;  2ROT A;  2LQN A;  1UDL A;  1RUW A;  1WLP B;  4X1V A;  2RQW A;  1K76 A;  1VA7 A;  3M0T A;  2FPF A;  5FWB A;  3RNJ A;  3ULR B;  1KSW A;  2L3Q A;  2LX7 A;  3NGP A;  1JO8 A;  2KYM A;  2EGE A;  1KFZ A;  3EGU A;  2KBT A;  3JV3 A;  1W6X A;  4OMM A;  1UTI A;  4KRT A;  3R6N A;  2D1X A;  1K1Z A;  2DJQ A;  4OML A;  1QLY A;  2FPE A;  1UHC A;  1JEG A;  2DRK A;  2LNH B;  1AZE A;  1AD5 A;  2GGR A;  3VS5 A;  3VS1 A;  1BB9 A;  3I9Q A;  4AG1 C;  1H92 A;  1SHG A;  4HCK A;  1X6G A;  2J6F A;  2LMJ A;  3UAT A;  1SPK A;  4GLM A;  1ZSG A;  3I35 A;  1UE9 A;  1AWW A;  1T0H A;  3EG3 A;  1PKT A;  2RQT A;  3SHW A;  2B86 A;  3UF4 A;  1WFW A;  1M8M A;  1PKS A;  1A0N B;  1GRI A;  2K2M A;  1ZLM A;  2EYW A;  2HBW A;  2I0N A;  1CSK A;  3EHR A;  2JXB A;  2CSQ A;  1GCQ C;  1N5Z A;  5IXF A;  2XMF A;  3CQT A;  2K3B A;  4RTX A;  2V1Q A;  2DYB A;  2DE0 X;  2DRM A;  1NEB A;  1HSQ A;  2EQI A;  2DL4 A;  3H41 A;  3RBB B;  4JJC A;  1Z9Q A;  1ZUK A;  3IQL A;  4QT7 A;  3NPF A;  1ZX6 A;  1OV3 A;  1W70 A;  2RNA A;  2JW4 A;  2PTK A;  2GTJ A;  1EFN A;  1YCS B;  2J06 A;  5IH2 A;  3KFV A;  3VS3 A;  3ZL7 C;  1X2Q A;  2EGA A;  2ESW A;  4AFS C;  2ROL A;  3VS4 A;  1YWO A;  4HVW A;  2EKH A;  2LQW A;  4AFU C;  2J6K A;  1WYX A;  1HD3 A;  2A28 A;  4R0K A;  1BK2 A;  2KRM A;  2RPN A;  1U5S A;  3VS2 A;  4F16 A;  4Z8A A;  4AFZ C;  1SRL A;  5ECA A;  1I0C A;  2OI3 A;  4OMQ A;  4IIM A;  2BZY A;  4F14 A;  3H0F A;  3FJ5 A;  1RLQ C;  4RTV A;  3REB B;  2G6F X;  2CH4 W;  2DMO A;  1QCF A;  2JMA A;  2SEM A;  3M0U A;  4HVU A;  2J6O A;  2DNU A;  3H0H A;  1UHF A;  4J9D A;  4A63 B;  2RQV A;  4RTT A;  2J7I A;  4Z88 A;  3I5R A;  2LCS A;  3EG0 A;  2FRW A;  4RTZ A;  1ABQ A;  5IHK A;  2JS0 A;  2CT4 A;  2HSP A;  2H8H A;  1WXU A;  1PHT A;  2JM9 A;  4Y92 A;  3VS0 A;  1GBQ A;  1UFF A;  1NYF A;  2RQU A;  3QWX X;  1WA7 A;  2LJ0 A;  1AZG B;  4D8D A;  5GJW B;  1E6H A;  2VVK A;  5I22 A;  2O2O A;  2ECZ A;  2KGT A;  1BBZ A;  4RTU A;  2CH4 A;  2M51 A;  1WXT A;  2CSI A;  1VYV A;  4AFQ C;  1T3S A;  2DIL A;  2PZ1 A;  2FG0 A;  2A37 A;  1AVZ C;  1WX6 A;  1QKX A;  2VKN A;  4Z89 A;  3M0S A;  2FPD A;  1K4U S;  1IO6 A;  2DL5 A;  1AWX A;  2O9V A;  2K6D A;  2YUP A;  5HCK A;  2AZS A;  3VRY A;  2HEQ A;  1NLP C;  2D8J A;  1W1F A;  2LP5 A;  1U3O A;  5IHN A;  2CDT A; 
#chains in the Genus database with same CATH topology
 4JLI A;  2L2P A;  1NPP A;  3I56 T;  3HRU A;  3TRE A;  1DJ7 B;  2C0T A;  1MNE A;  4WCI A;  2OAW A;  2RHI A;  1KC8 C;  1GCP A;  1PD0 A;  2R57 A;  4PKC C;  4LDV A;  1KQ1 A;  1YJN Q;  2EYZ A;  2BIV A;  1VQN T;  2JTM A;  1I8F A;  1WPY A;  4HXJ A;  3TEE A;  5LJ5 j;  4E6R A;  3CD6 A;  1OUL A;  1ZBJ A;  1VQ7 A;  3V7S A;  2HBP A;  2RK2 A;  1Q7Y C;  1WDX A;  3CC4 Q;  3UPU A;  2FZC B;  4KBM B;  1K73 U;  1TUD A;  1VIF A;  4J9H A;  2DVJ A;  4QVZ A;  2EBP A;  3HTR A;  3OYC A;  4LUE A;  2KNB B;  5GAO l;  1KD1 C;  1X2K A;  4GBQ A;  1VQ8 A;  4OMO A;  2OX7 A;  3CCQ A;  2CP6 A;  4JLG A;  2DIQ A;  5GAN f;  2KY9 A;  2ENM A;  1YI2 Q;  4PJO D;  2H3J A;  1NZ9 A;  2VGN A;  3EG1 A;  3I55 T;  3PFS A;  2Y4X A;  2KYB A;  2EQU A;  4OGC A;  3QJY A;  2BZX A;  2JOY A;  2RA2 A;  1RAA B;  2D6F A;  4HVV A;  2FEI A;  2HKQ B;  3NTK A;  1UJY A;  3BW1 A;  3G71 T;  1AEY A;  1MND A;  2LZ6 B;  5GMK l;  4QQ6 A;  1JXM A;  1E7O A;  1ARK A;  2DET A;  2ED0 A;  4Y91 A;  3RMS A;  2RHU A;  4A53 A;  3C0C A;  4J9I A;  5GAN 7;  2YHT A;  3VS6 A;  4J9B A;  5KYW A;  2K7A A;  5AT1 B;  1XNI A;  2QTV A;  3E19 A;  4M7D G;  1RLP C;  1XQH A;  5D6X A;  1VQ6 A;  5L23 A;  3JCM g;  1JRI A;  2K2V A;  1JU5 C;  1LPL A;  3TSW A;  1N9R A;  4DBH A;  5D7U A;  1NE8 A;  3REA B;  2JMC A;  5GAM e;  2NUT B;  2LRQ A;  3WVD B;  3CCS A;  5IT9 E;  2JTE A;  1OPL A;  2LDM A;  3S3O A;  1Q81 U;  4AT1 B;  3RIR A;  4JUV A;  4BI8 B;  1PRM C;  3CBO A;  3NMZ C;  3EH2 A;  1ZSZ A;  3QG1 A;  2RI3 A;  2F2V A;  8ATC B;  4OMP A;  1SSH A;  2LJ3 A;  2KRO A;  2QA4 A;  2JS2 A;  2DPP B;  4D6W A;  1YJW T;  4M7A D;  1BI0 A;  4R55 A;  2BE9 B;  2O01 E;  2CP3 A;  1QVF P;  2PVD B;  1OYX A;  5GAN j;  1WJR A;  1VQL Q;  3MJX A;  1KHC A;  2RQR A;  4JJB A;  3ASK A;  3ZFJ A;  3JRZ A;  1IRX A;  2YSQ A;  2HNI A;  4DBR A;  1VQN Q;  1BI2 A;  2R5M A;  1MMN A;  1IHV A;  2MK5 A;  5CVI A;  5GAN 8;  2YUQ A;  2KSS A;  2QDY B;  3HL8 A;  3PMI A;  1M2V A;  2AKL A;  1JXO A;  2JM8 A;  4FL6 A;  2KVQ G;  1UGV A;  1YJN A;  2BE7 D;  2R58 A;  1TTH B;  3VYH B;  1WQ7 A;  5KYU A;  1V1C A;  2YT6 A;  2YRC A;  2RMO A;  1VQK A;  1UGP B;  2O31 A;  3SEM A;  5KYX B;  2RH2 A;  4C8Q F;  1WXB A;  1D0Y A;  3QYG B;  4M7A B;  2ZZD A;  3URG A;  4BY6 B;  3P8H A;  2M02 A;  7AT1 B;  1X6O A;  3L2V A;  2EGC A;  1RAE B;  3MP1 A;  4LNP A;  3CCQ T;  3EFR A;  1QVF S;  4J9E A;  1VIE A;  3S3M A;  2X3X D;  1H64 1;  5KCH A;  2MF2 A;  3CCQ Q;  2LVM A;  3G7Z A;  3GIB A;  1UJ0 A;  4B9X A;  4BE2 A;  2P4T A;  2NUZ A;  5D6W A;  3CCR A;  2XK0 A;  4NL3 A;  4M7D D;  1CKA A;  2RI2 A;  5LJ3 j;  4E7Z A;  1BI1 A;  2CKK A;  3QDR B;  2CP2 A;  4PJL A;  1RUW A;  4X1V A;  2QQ9 A;  1VA7 A;  5AYF A;  2V8J A;  2HKN A;  4J83 A;  5GMK h;  2EGE A;  1UGQ B;  3EGU A;  2KBT A;  1QVP A;  4M77 F;  4KRT A;  4C5G A;  4XU1 A;  1FX7 A;  1QLY A;  2FPE A;  1UHC A;  1UGS B;  3PTA A;  1KD1 U;  1VQ6 Q;  3VS1 A;  3I9Q A;  4XTW A;  3G4S T;  3E9G A;  1N8R R;  3CBM A;  1G5V A;  3X25 B;  3I56 A;  4PFO A;  1SPK A;  2RJE A;  2X4X A;  1UE9 A;  1OU9 A;  5FU6 C;  1G3S A;  5DLQ E;  3SHW A;  3M9Q A;  3X24 B;  4IUR A;  1WFW A;  1GRI A;  2EYW A;  2QQB A;  2HZY A;  2WSF E;  5GAN 6;  1ZHI A;  1GCQ C;  5A0L A;  1Q81 R;  3CQT A;  3P8B B;  5LJ5 g;  5CO7 A;  1BCO A;  2RK1 A;  1NJI U;  3T9N A;  2DYB A;  3V8L A;  2RB6 A;  1IRE B;  4LD9 K;  3CCL T;  3H41 A;  3CC4 A;  3RBB B;  1X75 C;  5KYU B;  1YIJ T;  2DZ9 A;  5A2Q E;  3IQL A;  4QT7 A;  3NPF A;  3VUZ A;  5CCA A;  2RNA A;  3G6E Q;  2K3X A;  2PTK A;  3RER A;  4N4I A;  3VS3 A;  3SWN B;  3ZL7 C;  2E4H A;  2ZCF B;  1VQO Q;  2E3I A;  2ROL A;  1YWO A;  2EKH A;  2LQW A;  4AFU C;  2J6K A;  1WYX A;  2QEX T;  2E6Z A;  4HCZ A;  2V26 A;  2A7Y A;  2A28 A;  5CKD A;  4KGX B;  2JUF A;  2RPN A;  1SG5 A;  4ELY C;  4IUT A;  3OB9 A;  4Z8A A;  2QEX Q;  3QZ5 B;  5IAY A;  1NJI C;  4ZN3 A;  2DZC A;  1R0C B;  4EPC A;  2BKD N;  2BZY A;  3OW2 A;  3H9N A;  1YJN T;  3FRN A;  2OTL A;  1RLQ C;  1TU0 B;  2L3R A;  2DMO A;  1VQK Q;  2SEM A;  3FDR A;  4KT0 E;  2J6O A;  2X4Y A;  1MMG A;  4A63 B;  2RQV A;  4RTT A;  1G3Y A;  5DM7 R;  3G1J A;  2DXB A;  4MDW A;  3I5R A;  3EG0 A;  2PQW A;  2B8A A;  2PVG B;  1JJ2 P;  4EDU A;  3CC7 A;  2JS0 A;  4Y28 E;  2EJ9 A;  1PHT A;  5GAN 3;  3VS0 A;  1GBQ A;  2LCC A;  3GP8 A;  2HQE A;  2R5A A;  3S6W A;  3M5A A;  1W2B P;  4D8D A;  2CGH A;  2ECZ A;  4RTU A;  1WXT A;  4NOY A;  1D1A A;  2XKO C;  2MYS A;  1VYV A;  2PZ1 A;  2DIL A;  3WVE B;  1KQS S;  1BI3 A;  2FG0 A;  3A1P A;  4KGZ B;  4WTO B;  2DXT A;  3MEW A;  4J7I A;  1VQM T;  3QDF A;  4Z89 A;  1IO6 A;  2NUT A;  2MI6 A;  5HCK A;  2AZS A;  2X35 A;  1VQM Q;  3DB4 A;  1RI0 A;  5LJ3 d;  1BKB A;  4ZTJ A;  4J5Y A;  5CAI A;  2X4W A;  2RM4 A;  3E2U A;  2EIF A;  4FYX B;  3G4S Q;  3VUB A;  1K0X A;  2EPD A;  2DF6 A;  4PLL A;  1PSE A;  3I56 Q;  3ZEH A;  1WHG A;  4K11 A;  1B3Q A;  2GQI A;  4M75 C;  4PLI A;  1YHQ A;  4PJO C;  2A0F B;  4E7I A;  1YJ9 T;  1I5L A;  2PNI A;  3JB9 H;  1OQK A;  1M90 C;  2KRS A;  5GMK j;  3OW2 S;  4M7D C;  4F7U B;  1LVK A;  3R6O A;  4BB7 A;  3JCM d;  4FIB A;  2D0Q B;  1R8O B;  2GBQ A;  1ACM B;  2DLP A;  1O9S A;  3KXT A;  3CME A;  3CME T;  2L3S A;  2OTJ T;  2F69 A;  4ME7 A;  2RJC A;  2ZPB B;  3A5Z B;  4M7D B;  1NM7 A;  4RTW A;  3KBG A;  3S3N A;  5FU6 B;  1ZQ1 A;  4BI4 A;  3JAM E;  5I2S A;  2DIG A;  2NUP A;  1VQO A;  4CC2 A;  4M7A E;  1BU1 A;  1XOV A;  2W10 A;  2XDP A;  2COW A;  2BTT A;  2E65 A;  1SHF A;  3C94 A;  1M3B A;  2PU9 B;  4DEX A;  1Y96 B;  4DQ2 A;  1M1F A;  3INZ A;  2DX1 A;  4LE9 A;  5KYN A;  2KRN A;  3EHQ A;  4RG2 A;  1WJQ A;  3M4G A;  2XDB A;  1QCN A;  2F1L A;  4XU0 A;  3QII A;  1IB8 A;  1GCQ A;  2EJG A;  1VQ5 T;  4ESR A;  1U8R A;  2M0Y A;  4BE1 A;  5GAO r;  3CCJ A;  1Q82 U;  3DKM A;  3OSV A;  1WIE A;  3TVT A;  2MIO A;  2DM1 A;  1VQ4 T;  3JCM P;  2A08 A;  3LWH A;  4LDU A;  2QQA A;  2LJ1 A;  1YI2 A;  2ZPI B;  3RR6 A;  5KYY A;  3HRS A;  4CC4 B;  3PT9 A;  5C0M A;  2L89 A;  2J05 A;  4M78 G;  1AOJ A;  1RAF B;  1BYM A;  3THK A;  5GAO p;  2VXE A;  3V8J A;  3BE3 A;  3EFS A;  2DEU A;  2CP7 A;  4ELZ C;  3RMQ A;  1SEM A;  2DXU A;  1ZBX A;  4ZNX A;  5GAM f;  3OYF A;  2C0I A;  1QWF A;  3QWY A;  4EMK C;  4M78 F;  4M78 D;  2LTO A;  5CKF A;  4CC7 A;  2VB6 A;  1IHW A;  8AT1 B;  3EAE A;  1TUG B;  2E3H A;  3JB9 G;  1YIJ Q;  1K8A C;  1RAI B;  3PIP A;  5EC7 A;  4AG2 C;  4CRI A;  4XTV A;  5LJ5 e;  1I07 A;  2MOX A;  1YJ9 Q;  3A98 A;  1ABO A;  5C6S A;  1I4K 1;  1KIK A;  1NLO C;  5GMK i;  3CPW A;  4IUQ A;  3L42 A;  2L0A A;  4KUD K;  4FM4 B;  3OQ5 A;  1MV3 A;  3SWN C;  2D9T A;  1HYO A;  2RN8 A;  1H8K A;  2IIM A;  2FYK A;  4C0D B;  4DEY A;  2MPX C;  3CME Q;  2F5T X;  2HQH A;  1K73 C;  4A4G A;  1Y96 A;  2DA9 A;  4JRP A;  4FSS A;  4PJO G;  1M90 R;  2RHX A;  3CPW S;  2CRE A;  5CQX A;  2YWW A;  2QQR A;  1SKU B;  3P8D A;  2D8H A;  1GFD A;  1Z9Z A;  2DL3 A;  3CCU T;  1I81 A;  2E6N A;  2EFI A;  2X3W D;  2YUO A;  4EIK A;  2P0Q A;  4JRK A;  4C92 G;  2RO0 A;  2GTO A;  1V76 A;  1WZO A;  2E1H A;  2O9S A;  1W2B S;  2EKO A;  3CCL Q;  2DAQ A;  1OI1 A;  3JSC A;  3JCM V;  1N6A A;  2QYZ A;  4JJD A;  1D3B B;  1GBR A;  3HPW A;  1H3H A;  3BDU A;  2KXD A;  4OP0 A;  4E2F B;  2KT8 A;  3EG2 A;  2ROT A;  4C92 F;  2LQN A;  4C92 D;  1YIT A;  3HSB A;  2LT4 A;  4IUU A;  3JB9 I;  2RQW A;  3RNJ A;  1KSW A;  2L3Q A;  4MDX A;  4GY5 A;  2KQW A;  4VUB A;  4B9W A;  3NGP A;  1NJI R;  2DO3 A;  4KH0 B;  3RKX A;  2DJZ A;  1MGQ A;  3R6N A;  4M77 D;  3CCR T;  5FRN A;  1K1Z A;  4OML A;  2DRK A;  1AZE A;  1AD5 A;  2E64 A;  4ZTF A;  5J3B A;  4XTY A;  3SWN A;  4HCK A;  1X6G A;  1RL2 A;  2J6F A;  2XI9 A;  3JCM f;  1T0H A;  2DEQ A;  5GAO q;  2DTO A;  2V8I A;  1LJO A;  1PKS A;  1M8V A;  3PMT A;  4MMK A;  3FLG A;  4HA8 A;  2GFA A;  3JB9 D;  2CSQ A;  4LD6 A;  1N5Z A;  2XMF A;  4QW2 A;  1XTD A;  1FMW A;  4EMK A;  2K3B A;  2CZ0 B;  4RTX A;  2V1Q A;  2HQX A;  3M59 A;  3OMG A;  2DRM A;  4E47 A;  1K9M U;  2LT1 A;  4C8Q D;  1ZUK A;  1U1T A;  4MZT A;  3OMC A;  2CYZ B;  3M56 A;  1EFN A;  5IH2 A;  2CZ1 B;  4M7D A;  1VQP A;  3KFV A;  4GLK A;  1X2Q A;  2DFU A;  2ESW A;  4ANJ A;  2HAX A;  1NBE B;  3CCM A;  4ZN1 A;  4OF1 A;  1BIA A;  4M7A F;  5KE2 A;  4F16 A;  4LDW A;  2QTX A;  4FW1 A;  2QI2 A;  2NUP B;  4C5I A;  3OS0 A;  4XQ3 A;  4M78 E;  4IIM A;  2PUO B;  2O4X A;  3F70 A;  3FJ5 A;  2G6F X;  2CH4 W;  5M9O A;  3M0U A;  1EIF A;  1D1C A;  1TS9 A;  3AHU A;  1WQW A;  1VQ4 A;  4HVU A;  3OS2 A;  1M90 U;  1TH7 A;  1UHF A;  4M7A G;  3MPU B;  4Q5W A;  5HY6 A;  1I5O B;  2FRW A;  4B6M A;  1KK7 A;  4RTZ A;  1RAH B;  4N4H A;  5FLX E;  3EFO A;  1VQ5 A;  4DOV A;  3L1A A;  3E9F A;  3OBY A;  1ZSZ C;  3OYN A;  3FJP A;  3J80 E;  4C0Z A;  9ATC B;  2RQU A;  1QVG P;  2LJ0 A;  1AZG B;  2XHC A;  4M75 B;  5CKB A;  2M51 A;  3L2R A;  4HCC A;  3QXE B;  2LQK A;  2QGF B;  2JJ9 A;  3CCV A;  3I55 Q;  1AVZ C;  1WX6 A;  4X9C A;  4L59 A;  2FPD A;  1K4U S;  2O9V A;  2K6D A;  2LCL A;  2L8D A;  2OTL Q;  1UGR B;  2E41 A;  2X9H A;  3G71 A;  2HEQ A;  1W1F A;  4P5N A;  4E7J A;  1U3O A;  5GMK m;  4OGE A;  4A4E A;  3CBP A;  4N4G A;  2E5K A;  3CMA A;  2WSC E;  4QVC A;  1PC0 A;  5HKC A;  4A4F A;  3MKD A;  1B34 B;  3TCJ A;  4E7L A;  2IVW A;  3DLL A;  3C12 A;  1M2O A;  2VC8 A;  2JT4 A;  1T3L A;  1VOM A;  3CMA T;  4JRI A;  4EMG A;  2VXF A;  4RUG A;  1LNX A;  1ZA2 B;  1GFC A;  2CT3 A;  4M77 C;  4M75 A;  1TOV A;  1SSF A;  5CKH A;  1PD1 A;  3NHN A;  1M1G A;  3LW5 E;  4KH1 B;  1YJ9 A;  3CCV T;  2JVV A;  4LN2 A;  1YHQ T;  1KD1 R;  3UA6 A;  3HKS A;  5GAN e;  2Y90 A;  2E10 A;  1OEB A;  2P4R A;  2KE9 A;  4F7U A;  1M27 C;  3QSU A;  4E7H A;  1E6G A;  1Y57 A;  2ZGW A;  3G6E A;  1AWO A;  2CUB A;  2LC4 A;  4IUP A;  1R0B G;  1RAD B;  3CC2 T;  5A0G A;  1WI7 A;  1UUE A;  1VQ7 T;  2A3L A;  1JJ2 A;  2LNV A;  3M53 A;  2KK4 A;  1D0X A;  3UT1 A;  1ZUU A;  3CCU Q;  4FU6 A;  2ZAE A;  4BD3 A;  3VRZ A;  3MEA A;  3JB9 J;  2WSE E;  1YBY A;  2KR3 A;  2FZG B;  1X27 A;  4V2S A;  5CQY A;  2AZV A;  3GLX A;  1FMK A;  1TG0 A;  2EYY A;  2LQ8 A;  1J3T A;  2G3R A;  5CKE A;  3M0R A;  5LJ3 g;  4FW2 A;  3PIO A;  4E7S A;  1B07 A;  2VAS A;  3CCU A;  3CC7 T;  3CCM T;  1PRL C;  2OJ2 A;  4DBQ A;  4M7D E;  3U23 A;  2YRD A;  1K73 R;  2AKK A;  3I5S A;  2KXC A;  2NWM A;  2RI5 A;  4PJO E;  4M78 B;  4LDY A;  4OB2 B;  3SD4 A;  2ZPF B;  4A4H A;  4C0F A;  1Y0M A;  2CP0 A;  3OYB A;  4UC4 A;  1Q81 C;  3V7C A;  2K4Y A;  5GAN d;  1VQ9 A;  1QKW A;  3OSS C;  1TWB A;  4L6V 5;  2CZ7 B;  2DD4 A;  4E7K A;  1N8R U;  3MET A;  1FYN A;  3PVQ A;  1KJW A;  3A8G B;  3GPL A;  2QGG A;  3PVL A;  3OYL A;  2VYT A;  1M4Z A;  4JDS A;  3X26 B;  2HCK A;  1GL5 A;  2YDL A;  2AIR B;  5FU7 C;  2NYS A;  5GAN h;  2YLC A;  2XID A;  3WXM B;  5DLO A;  3OS5 A;  1QCO A;  4JPB W;  1MMA A;  3CMA Q;  3TQ7 P;  2DL8 A;  2QXF A;  3OBW A;  2A36 A;  3LH5 A;  2Z0W A;  4F7U E;  2FRY A;  3LGF A;  2QAZ A;  3BFM A;  1KC8 R;  1V29 B;  2QAS A;  2MAM A;  3OYY A;  3X20 B;  1PSF A;  4C0D C;  1KHI A;  3KUF A;  4D8K A;  5GAM h;  4J9G A;  3MP8 A;  1VQL A;  3SFM A;  2K9G A;  2CP5 A;  2AK5 A;  4M75 F;  3CC2 Q;  4R56 A;  1MUZ A;  2FVU A;  3M0Q A;  4M4Z A;  2O88 A;  3H8Z A;  2C0O A;  3CCJ T;  1QMC A;  4J9F A;  4M7D F;  2K79 A;  1M30 A;  4A4K A;  3O5Z A;  1UEC A;  1YJW Q;  2MCN A;  4J8O A;  1F1B B;  1WHK A;  2ED1 A;  4M75 G;  3LLR A;  3VV0 A;  1D1B A;  4LDX A;  1K9M R;  1N27 A;  1PM3 A;  1ZUY A;  4MZM A;  1X69 A;  4C8Q C;  3L2U A;  2COZ A;  3SDZ A;  4PNO A;  1LCK A;  4NL2 A;  5IXB A;  3HRT A;  3CC2 A;  1HK9 A;  1NYG A;  3G6E T;  2W0Z A;  4KGV B;  1Y7X A;  2X51 A;  1VQO T;  4O5V A;  3CCE A;  3M0T A;  5KH6 A;  4X9D A;  5FWB A;  3MEV A;  2CS7 A;  2FB7 A;  3ULR B;  5IN1 A;  4ZGE B;  1K8A R;  1JO8 A;  2YLB A;  1KFZ A;  3QUI A;  4PJN A;  2GCX A;  2JTF A;  2DD5 A;  2D1X A;  5FRO A;  2E5Q A;  1JEG A;  2OTJ A;  1VQK T;  4JS4 A;  3CCR Q;  3VS5 A;  3ER0 A;  1BB9 A;  5GAN g;  2K5F A;  4AG1 C;  1H92 A;  2M16 A;  3RKY A;  3UAT A;  3OYD A;  4GLM A;  4J7F A;  4MML A;  2EQK A;  3I35 A;  1AWW A;  2KAF A;  2X4J A;  4PK4 A;  5KYX A;  1PKT A;  1X01 A;  3CCE Q;  2B86 A;  3QYH B;  2DER A;  3UF4 A;  4C5H A;  4LXC A;  5L8R E;  5A0D A;  1M8M A;  1A0N B;  2K2M A;  5GAO n;  2HBW A;  3CCE T;  3EHR A;  4MZP A;  1WHL A;  5LJ5 h;  2JZ2 A;  3CCS Q;  3NTH A;  2E70 A;  3QPH A;  4JS5 A;  1JBM A;  3M4Y A;  1VQ9 Q;  5J26 A;  2EYQ A;  3LH0 A;  2QG9 B;  2DE0 X;  4FT4 A;  5LJ5 f;  1JB0 E;  1HSQ A;  4XU3 A;  4C8Q G;  1AT1 B;  2OAU A;  5GAN 4;  2EQM A;  3JCM h;  2EWN A;  3EFO B;  1W70 A;  4C8Q A;  2GTJ A;  1YCS B;  3HHT B;  3PNW C;  2P84 A;  2QA4 T;  1UEB A;  1OZ3 A;  2EGA A;  3VS4 A;  4FCY A;  1PG5 B;  4EMH A;  1M9S A;  1HD3 A;  4F04 B;  4R0K A;  5KCO A;  2KRM A;  3O8V A;  2L5Q A;  2I2L A;  3GOX A;  2E12 A;  3VS2 A;  2XDD A;  1YFN A;  2XIC A;  3X28 B;  4KUI A;  5ECA A;  1I0C A;  4OMQ A;  3H0F A;  1Q82 C;  4RTV A;  3REB B;  3JCM e;  1RAG B;  3EG9 B;  2JMA A;  3FC3 A;  5D6Y A;  3J7A F;  5CR2 A;  3CCJ Q;  3H0H A;  3MP6 A;  4J9D A;  3C95 A;  4M77 G;  5J39 A;  2JN0 A;  1TXQ A;  5CIU A;  1K9M C;  3UDC A;  3L2Q A;  1OX9 A;  4OVA A;  2MWO A;  4NS5 A;  2EQJ A;  4M77 A;  1ABQ A;  4BDZ A;  2CT4 A;  1ZSZ B;  2HSP A;  2H8H A;  4OB1 B;  4Y92 A;  1UFF A;  1S72 A;  3OYK A;  1R77 A;  4RKU E;  3QWX X;  1WNL A;  3FIF A;  5I2M A;  2VVK A;  1W2B A;  4N0A C;  5LJ3 h;  2O2O A;  2KGT A;  1GXI E;  2CSI A;  4OB3 B;  4AFQ C;  3M58 A;  5LL6 S;  3JCM b;  1KQS A;  4PJO A;  1O75 A;  2P0K A;  5CK9 A;  2VKN A;  4IUV A;  1VQ8 Q;  3M0S A;  4C92 B;  1VUB A;  3J81 E;  3GNF B;  4BE0 A;  2K57 A;  2K5L A;  3EGX A;  4FYW B;  3NFC A;  2CDT A;  3HP9 A;  2AHJ B;  4C92 C;  4BDY A;  4IIO A;  5FRM A;  1U1S A;  3JCM J;  3VS7 A;  5HK3 A;  1NEG A;  1K0S A;  2DTH A;  3MCA B;  2D0N A;  1VQ5 Q;  1Q86 C;  2MWP A;  5GAN 2;  1WHM A;  3VU3 C;  4HT9 A;  4CC3 A;  1UG1 A;  2M9U A;  4DBF A;  2HL5 C;  4C8Q B;  4IKF A;  2WAC A;  2EW3 A;  4PJM A;  2DBM A;  1K9A A;  1SF9 A;  1YCY A;  1IGU A;  3A8O B;  1VYU A;  3OYM A;  1VQM A;  2HSE B;  5I21 A;  4JZ4 A;  3CXC S;  1FWZ A;  1G8X A;  1YN8 A;  2RJD A;  1NG2 A;  2H3E B;  1KQS P;  4J9C A;  4BUG A;  3CCV Q;  1HJD A;  4O6J A;  1WGS A;  1T0J A;  1NPR A;  5HK0 A;  3D7S B;  2DBK A;  1QWE A;  2FL7 A;  3QKJ A;  4LUD A;  1X6B A;  2FO0 A;  4F7U G;  1W4S A;  2AT1 B;  4PL6 A;  1H3Z A;  2DKG A;  3UA7 A;  4RMO A;  4RG8 A;  1M3C A;  4XAX B;  4EMK B;  1G83 A;  2BZ8 A;  3ME9 A;  2FHD A;  1TUC A;  3ZBD A;  3RKW A;  1C1A A;  4FYV B;  4M77 B;  1C6V X;  4ATO A;  2RJF A;  3QBY A;  3PE0 A;  4F7U F;  3JCM c;  3QJ6 A;  3EGD A;  4OMN A;  2K3Y A;  3FB9 A;  5IHI A;  4C0G A;  2KDS A;  2GF7 A;  1FMV A;  3SB2 A;  3FEO A;  1RI9 A;  2M1H A;  1Q86 U;  1FXX A;  2IPO B;  1RAB B;  5KYW B;  1OPK A;  4PJO F;  2QEX A;  2MMP A;  1XJW B;  1U06 A;  2EJF A;  1YP5 A;  1OX8 A;  4QQG A;  1Q82 R;  3OYH A;  3CC7 Q;  4QKU A;  4XU2 A;  5I11 A;  4JZ3 A;  3V7R A;  1X43 A;  2O4X B;  2QQS A;  3QO3 A;  2QDL A;  6AT1 B;  1JQQ A;  2JNG A;  2ABL A;  3GBQ A;  1KG1 A;  1YIJ A;  1S72 T;  1Q7Y R;  3CC4 T;  4M78 A;  4BI3 A;  1D09 B;  1S72 Q;  4RCC A;  1QVG A;  3HFO A;  2OTJ Q;  2LX9 A;  2ZPE B;  5FWC A;  5GJV B;  2NLU A;  2CUD A;  3A8H B;  1PNJ A;  3GNG A;  3OW2 P;  1UB4 A;  4X34 A;  4C5E A;  4RTY A;  1M1K U;  2KI7 A;  4OB0 B;  1YI2 T;  1ZA1 B;  4FSX A;  1HXD A;  4M75 E;  1QVG S;  1Q86 R;  1B7T A;  1IXD A;  3G4S A;  1D3B A;  1K8A U;  3M55 A;  1M1K R;  3CXC P;  2EYX A;  4RCB A;  1YJW A;  2C06 A;  4XK8 E;  3CXC A;  5GAO m;  4KUL A;  1OOT A;  2KT1 A;  1QP2 A;  2XD0 A;  4XTX A;  3CCM Q;  1OZ2 A;  2COY A;  2KEA A;  1S1N A;  4PFP A;  4HT8 A;  1M2V B;  3OYA A;  3TSZ A;  2RF0 A;  1M1K C;  2F2X A;  2VWF A;  2FZK B;  4II1 A;  4F17 A;  3LYI A;  1M3A A;  2M0O A;  5GAM g;  1B34 A;  3L2Z A;  2DL7 A;  1VQ4 Q;  2GNC A;  2SRC A;  3JCM X;  2YUN A;  1N8R C;  3GF5 A;  4ORZ A;  3H0I A;  3L2W A;  2XU8 A;  1Y07 A;  4C8Q E;  3OYJ A;  2P0P A;  1MMD A;  5FW9 A;  1P92 A;  2QK0 A;  1YNZ A;  3MEU A;  1VQ6 T;  4QQD A;  2VV5 A;  2CZ6 B;  1MHN A;  2GQV A;  2L3P A;  2ZPH B;  1Y71 A;  1SRM A;  4XTU A;  3VYG A;  5DY9 A;  3MHX A;  1MV0 B;  2BUD A;  2EAY A;  3UWN A;  1LOJ A;  1VQP T;  4J6W A;  3EG9 A;  1YWP A;  4CI0 C;  1JJ2 S;  2EVR A;  1CKB A;  1PWT A;  3N5B B;  4C92 E;  1AWJ A;  2DXC A;  3CPW P;  2HDA A;  1G2B A;  3A8M B;  3JCM W;  1VYT A;  3OYI A;  2F2W A;  1Q95 G;  4QVD A;  1I1J A;  3HFN A;  2V1R A;  3G71 Q;  1C0M A;  3M0P A;  1WHH A;  4M77 E;  1UDL A;  1WLP B;  1QQJ A;  4BY6 C;  3DLM A;  4HCB A;  1K76 A;  1PCX A;  1QP3 A;  2FPF A;  3EH1 A;  4HKE A;  5KE3 A;  1QW1 A;  2LX7 A;  3V8K A;  1VQ8 T;  4JRQ A;  2KYM A;  3JV3 A;  3M57 A;  2F5K A;  1W6X A;  4OMM A;  2XG8 D;  1UTI A;  4PJO B;  1QVF A;  4M7A C;  2PUK B;  2PVO B;  4PFZ A;  2DJQ A;  1G3W A;  3JB9 F;  4OMF B;  2LNH B;  5LJ5 d;  1KQ2 A;  1N9S A;  2GGR A;  5LJ3 f;  3CPF A;  1TSF A;  2DYI A;  4JJN K;  4DOW A;  1SHG A;  3EGX B;  1BCM A;  2HL3 A;  2LMJ A;  1ZSG A;  3EG3 A;  4Z02 A;  2RQT A;  3E1S A;  1EX4 A;  3OY9 A;  3Q1J A;  2IG0 A;  1ZLM A;  1YIT Q;  2I0N A;  4M75 D;  1CSK A;  5GMK e;  2JXB A;  2VGM A;  1YIT T;  4XTZ A;  5FU7 B;  5IXF A;  3H6Z A;  1EZZ B;  3RUX A;  3CCS T;  3TU4 K;  2RHZ A;  4AMC A;  4J6X A;  1VQL T;  1NEB A;  3PGG A;  3AT1 B;  2DL4 A;  2EQI A;  4DA4 A;  4JJC A;  1Z9Q A;  1WJS A;  2VUB A;  1ZX6 A;  1OV3 A;  2JW4 A;  5GAM d;  4WF2 A;  2J06 A;  3LX7 A;  4PJJ A;  3LGL A;  1OU8 A;  4FYY B;  3RDV A;  3LWI A;  2V8K A;  4AFS C;  4ZGD B;  4FT2 A;  4HVW A;  4BAC A;  5GAN 5;  1D0Z A;  4M78 C;  1BK2 A;  2OTL T;  1U5S A;  3JCM Q;  4AFZ C;  1SRL A;  2OI3 A;  3RES A;  4F14 A;  3VKI A;  4TVR A;  3OS1 A;  2DTI A;  3CEY A;  5GAM j;  3MO8 A;  4M7A A;  1QCF A;  3OYE A;  1Q7Y U;  3EGD B;  3BY7 A;  2DNU A;  1IZ6 A;  1VQP Q;  5KYY B;  2J7I A;  3I55 A;  1BIB A;  4Z88 A;  4L5G A;  1YHQ Q;  1M5Q 1;  2LCS A;  2ZPG B;  3DB3 A;  2HD0 A;  2YRV A;  1VQ9 T;  5IHK A;  2KMT A;  5EG2 A;  3QZ9 B;  2ATC B;  1WXU A;  3OA6 A;  1KC8 U;  2JM9 A;  2DVE A;  3C4S A;  1NYF A;  4YTL A;  4N0A A;  3M54 A;  1WA7 A;  4A54 A;  2Y4Y A;  5GJW B;  1E6H A;  5I22 A;  3CCL A;  1BBZ A;  1AHJ B;  2CH4 A;  1T3S A;  3BDL A;  2QA4 Q;  2DK3 A;  3QHS A;  3CD6 Q;  1G3T A;  2A37 A;  1VQ7 Q;  2YXY A;  1QKX A;  3VJP A;  1WHJ A;  1RAC B;  1IGQ A;  2RD1 A;  3CD6 T;  2RHY A;  2DL5 A;  1AWX A;  2YUP A;  5LJ3 e;  3VRY A;  3OYG A;  4ZGJ B;  4J6Y A;  2GFU A;  1NLP C;  2D8J A;  3A8L B;  2HMA A;  1VQN A;  2K5I A;  3NTI A;  2LP5 A;  4C92 A;  5IHN A; 
#chains in the Genus database with same CATH homology
 2E5K A;  2L2P A;  2C0T A;  4IIO A;  4WCI A;  2OAW A;  3VS7 A;  2EPD A;  1K0X A;  2DF6 A;  1NEG A;  1GCP A;  1K0S A;  2JT4 A;  4K11 A;  1T3L A;  2D0N A;  1B3Q A;  2GQI A;  2EYZ A;  4CC3 A;  4RUG A;  1UG1 A;  4HXJ A;  2EW3 A;  1GFC A;  2CT3 A;  2DBM A;  2PNI A;  1K9A A;  4E6R A;  1VYU A;  1ZBJ A;  2KRS A;  3NHN A;  4JZ4 A;  1WDX A;  1YN8 A;  4LN2 A;  1NG2 A;  3UA6 A;  2GBQ A;  4J9C A;  2DLP A;  1TUD A;  1OEB A;  2P4R A;  2KE9 A;  1HJD A;  2L3S A;  4J9H A;  2DVJ A;  2EBP A;  1M27 C;  1E6G A;  1T0J A;  1Y57 A;  1AWO A;  2CUB A;  2DBK A;  1QWE A;  4LUE A;  4LUD A;  1X6B A;  2KNB B;  2FO0 A;  1NM7 A;  1X2K A;  1WI7 A;  4RTW A;  1UUE A;  4GBQ A;  4OMO A;  3UA7 A;  1M3C A;  1ZUU A;  2ENM A;  1G83 A;  3VRZ A;  2BZ8 A;  4CC2 A;  3EG1 A;  1BU1 A;  1XOV A;  1TUC A;  2KYB A;  2W10 A;  2BZX A;  3PE0 A;  2BTT A;  1SHF A;  1M3B A;  2KR3 A;  1X27 A;  4OMN A;  2AZV A;  5IHI A;  4HVV A;  4DEX A;  1FMK A;  2DX1 A;  1TG0 A;  2FEI A;  2EYY A;  4LE9 A;  1J3T A;  2KRN A;  3EHQ A;  1RI9 A;  1UJY A;  1AEY A;  2LZ6 B;  3M0R A;  1OPK A;  1B07 A;  1JXM A;  1E7O A;  1GCQ A;  1ARK A;  1PRL C;  4ESR A;  2OJ2 A;  1U06 A;  2ED0 A;  2M0Y A;  1YP5 A;  3U23 A;  3C0C A;  4J9I A;  3VS6 A;  4J9B A;  2K7A A;  2AKK A;  3I5S A;  5I11 A;  1RLP C;  4JZ3 A;  1X43 A;  2KXC A;  2NWM A;  1WIE A;  2QDL A;  3TVT A;  2MIO A;  1JQQ A;  2DM1 A;  2ABL A;  2A08 A;  5L23 A;  3GBQ A;  1Y0M A;  2LJ1 A;  1JU5 C;  3TSW A;  3REA B;  4CC4 B;  2JMC A;  1QKW A;  2J05 A;  1AOJ A;  2JTE A;  1OPL A;  5FWC A;  5GJV B;  3THK A;  1FYN A;  1PRM C;  3NMZ C;  3PVQ A;  1KJW A;  2F2V A;  2CUD A;  1PNJ A;  4OMP A;  1SSH A;  2LJ3 A;  2KRO A;  4RTY A;  1SEM A;  2JS2 A;  3PVL A;  1GL5 A;  2HCK A;  2YDL A;  4ZNX A;  2C0I A;  1QWF A;  3QWY A;  4CC7 A;  2RQR A;  4JJB A;  2EYX A;  4JPB W;  1OOT A;  2DL8 A;  2KT1 A;  2YSQ A;  5EC7 A;  4AG2 C;  2A36 A;  3LH5 A;  2KEA A;  1I07 A;  2FRY A;  2MOX A;  3A98 A;  1S1N A;  1ABO A;  1KIK A;  3TSZ A;  2RF0 A;  1NLO C;  2F2X A;  2VWF A;  4F17 A;  2L0A A;  1M3A A;  2YUQ A;  1MV3 A;  2RN8 A;  2AKL A;  2DL7 A;  1JXO A;  1H8K A;  2JM8 A;  2GNC A;  2IIM A;  2SRC A;  4DEY A;  2YUN A;  1UGV A;  4D8K A;  4ORZ A;  3H0I A;  4J9G A;  5FW9 A;  1YNZ A;  2K9G A;  2AK5 A;  2DA9 A;  1V1C A;  4FSS A;  1MUZ A;  2YT6 A;  2CRE A;  3M0Q A;  4M4Z A;  2RMO A;  2O88 A;  2O31 A;  2C0O A;  2L3P A;  3SEM A;  1SRM A;  4J9F A;  2D8H A;  1GFD A;  1WXB A;  1Z9Z A;  2DL3 A;  1MV0 B;  2K79 A;  1M30 A;  1YWP A;  2X3W D;  2YUO A;  4EIK A;  2GTO A;  2EVR A;  1CKB A;  3O5Z A;  1UEC A;  1PWT A;  2EGC A;  2MCN A;  2ED1 A;  1AWJ A;  4LNP A;  2O9S A;  2HDA A;  1G2B A;  1ZUY A;  4J9E A;  1X69 A;  1VYT A;  2F2W A;  2X3X D;  4JJD A;  1LCK A;  1UJ0 A;  5IXB A;  1I1J A;  1GBR A;  2V1R A;  1H3H A;  2NUZ A;  2KXD A;  1NYG A;  2KT8 A;  2W0Z A;  1CKA A;  3M0P A;  3EG2 A;  2ROT A;  2LQN A;  1UDL A;  1RUW A;  1WLP B;  4X1V A;  2RQW A;  1K76 A;  1VA7 A;  3M0T A;  2FPF A;  5FWB A;  3RNJ A;  3ULR B;  1KSW A;  2L3Q A;  2LX7 A;  3NGP A;  1JO8 A;  2KYM A;  2EGE A;  1KFZ A;  3EGU A;  2KBT A;  3JV3 A;  1W6X A;  4OMM A;  1UTI A;  4KRT A;  3R6N A;  2D1X A;  1K1Z A;  2DJQ A;  4OML A;  1QLY A;  2FPE A;  1UHC A;  1JEG A;  2DRK A;  2LNH B;  1AZE A;  1AD5 A;  2GGR A;  3VS5 A;  3VS1 A;  1BB9 A;  3I9Q A;  4AG1 C;  1H92 A;  1SHG A;  4HCK A;  1X6G A;  2J6F A;  2LMJ A;  3UAT A;  1SPK A;  4GLM A;  1ZSG A;  3I35 A;  1UE9 A;  1AWW A;  1T0H A;  3EG3 A;  1PKT A;  2RQT A;  3SHW A;  2B86 A;  3UF4 A;  1WFW A;  1M8M A;  1PKS A;  1A0N B;  1GRI A;  2K2M A;  1ZLM A;  2EYW A;  2HBW A;  2I0N A;  1CSK A;  3EHR A;  2JXB A;  2CSQ A;  1GCQ C;  1N5Z A;  5IXF A;  2XMF A;  3CQT A;  2K3B A;  4RTX A;  2V1Q A;  2DYB A;  2DE0 X;  2DRM A;  1NEB A;  1HSQ A;  2EQI A;  2DL4 A;  3H41 A;  3RBB B;  4JJC A;  1Z9Q A;  1ZUK A;  3IQL A;  4QT7 A;  3NPF A;  1ZX6 A;  1OV3 A;  1W70 A;  2RNA A;  2JW4 A;  2PTK A;  2GTJ A;  1EFN A;  1YCS B;  2J06 A;  5IH2 A;  3KFV A;  3VS3 A;  3ZL7 C;  1X2Q A;  2EGA A;  2ESW A;  4AFS C;  2ROL A;  3VS4 A;  1YWO A;  4HVW A;  2EKH A;  2LQW A;  4AFU C;  2J6K A;  1WYX A;  1HD3 A;  2A28 A;  4R0K A;  1BK2 A;  2KRM A;  2RPN A;  1U5S A;  3VS2 A;  4F16 A;  4Z8A A;  4AFZ C;  1SRL A;  5ECA A;  1I0C A;  2OI3 A;  4OMQ A;  4IIM A;  2BZY A;  4F14 A;  3H0F A;  3FJ5 A;  1RLQ C;  4RTV A;  3REB B;  2G6F X;  2CH4 W;  2DMO A;  1QCF A;  2JMA A;  2SEM A;  3M0U A;  4HVU A;  2J6O A;  2DNU A;  3H0H A;  1UHF A;  4J9D A;  4A63 B;  2RQV A;  4RTT A;  2J7I A;  4Z88 A;  3I5R A;  2LCS A;  3EG0 A;  2FRW A;  4RTZ A;  1ABQ A;  5IHK A;  2JS0 A;  2CT4 A;  2HSP A;  2H8H A;  1WXU A;  1PHT A;  2JM9 A;  4Y92 A;  3VS0 A;  1GBQ A;  1UFF A;  1NYF A;  2RQU A;  3QWX X;  1WA7 A;  2LJ0 A;  1AZG B;  4D8D A;  5GJW B;  1E6H A;  2VVK A;  5I22 A;  2O2O A;  2ECZ A;  2KGT A;  1BBZ A;  4RTU A;  2CH4 A;  2M51 A;  1WXT A;  2CSI A;  1VYV A;  4AFQ C;  1T3S A;  2DIL A;  2PZ1 A;  2FG0 A;  2A37 A;  1AVZ C;  1WX6 A;  1QKX A;  2VKN A;  4Z89 A;  3M0S A;  2FPD A;  1K4U S;  1IO6 A;  2DL5 A;  1AWX A;  2O9V A;  2K6D A;  2YUP A;  5HCK A;  2AZS A;  3VRY A;  2HEQ A;  1NLP C;  2D8J A;  1W1F A;  2LP5 A;  1U3O A;  5IHN A;  2CDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...