1UGVA

Solution structure of the sh3 domain of human olygophrein-1 like protein (kiaa0621)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
72
structure length
72
Chain Sequence
GSSGSSGTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olygophrenin-1 like protein
publication title Solution structure of the SH3 domain of human olygophrein-1 like protein (KIAA0621)
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2003-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ugvA00
4OMLA 2BZ8A 3I5RA 5GJVB 2DNUA 2CT4A 1T3SA 1VYUA 4QT7A 3NPFA 2C0OA 4HXJA 2DX1A 2DVJA 1QLYA 2K3BA 1E6HA 1KSWA 4ZNXA 2JMAA 2V1RA 2LJ3A 1XOVA 4CC4B 1X2KA 3H0FA 4X1VA 2RQRA 4DEYA 2HBWA 3RNJA 1CKBA 1YWPA 2DE0X 3SHWA 4AFQC 2ROTA 4ORZA 1UTIA 1K0XA 4DEXA 3U23A 1GL5A 5I11A 3THKA 2D8HA 2HCKA 1UHFA 2NWMA 1SHFA 1U06A 1UE9A 1RLPC 4E6RA 1ZUYA 1HSQA 4RTZA 2EYZA 1AZGB 1JXOA 1MUZA 5ECAA 4R0KA 2DL4A 1ABQA 2FRWA 4JJBA 1X69A 2EGAA 2KRSA 3M0UA 2FEIA 2J6FA 2A36A 2DL8A 1NEGA 1NG2A 2KNBB 2KXDA 4Z8AA 3VS2A 2L3PA 1SPKA 2LMJA 1ZUKA 4RTUA 2ED0A 4Z88A 1M8MA 1LCKA 5IXFA 2PTKA 1HD3A 2CH4A 2DJQA 4D8KA 5IH2A 2GTOA 5IHIA 1PWTA 2D1XA 3VS0A 1K4US 3JV3A 2DBKA 2RN8A 1UJYA 2GGRA 2VVKA 3LH5A 1NEBA 1K0SA 1GFDA 3KFVA 2YDLA 2JXBA 4RTTA 1GCPA 4AFSC 4F17A 2DBMA 2V1QA 1WXUA 2CT3A 4AFUC 2JM9A 2EGEA 2EGCA 4RUGA 2BTTA 4GBQA 4J9CA 4WCIA 2F2XA 1QWFA 1J3TA 1YWOA 2G6FX 3TSZA 1NLOC 2ABLA 1X6GA 4OMOA 2KGTA 2CUBA 4J9BA 4RTYA 1YNZA 1JXMA 2C0IA 1ZX6A 2RQTA 2VWFA 1GFCA 3PVQA 4EIKA 1NYGA 1OPKA 2LX7A 3SEMA 3VS6A 3GBQA 4J9IA 1VYTA 2GNCA 4A63B 1GBRA 1I1JA 3UF4A 2KRNA 2O31A 1M27C 1K1ZA 2HEQA 4J9GA 1NLPC 3EG3A 2KR3A 2RF0A 4JZ3A 4RTXA 4RTWA 2A37A 2L3QA 4M4ZA 2D0NA 3RBBB 1RLQC 2EQIA 1V1CA 2B86A 4Z89A 5L23A 1OV3A 2X3XD 4OMPA 1H8KA 1G2BA 2J05A 2LCSA 1UECA 3CQTA 3ZL7C 1PRLC 2OAWA 1UJ0A 1UUEA 1AWWA 2CH4W 2MCNA 1U5SA 1WYXA 2RQVA 1X27A 2EVRA 5HCKA 3TVTA 4OMQA 2PZ1A 3PE0A 5I22A 4JZ4A 2K7AA 4J9FA 4LUEA 1UHCA 3EG1A 2DRMA 1QWEA 2DL5A 2RQWA 1KFZA 1H3HA 3EHRA 1AD5A 1GCQA 1YP5A 2KE9A 4JJDA 3A98A 4OMMA 1H92A 1JO8A 1WXBA 1M3AA 1PKTA 1WX6A 1SSHA 2NUZA 1MV3A 2L3SA 2KRMA 1G83A 4ESRA 1UDLA 2CREA 2LJ0A 2K2MA 3I5SA 2J06A 1ARKA 1ZLMA 3I9QA 1B3QA 5IHKA 2O88A 1AZEA 1X2QA 5IXBA 1QKXA 4J9HA 1T0JA 4IIOA 1TUDA 2DRKA 4D8DA 1PKSA 1WA7A 4LE9A 2KBTA 1ABOA 4HVWA 3ULRB 3VS7A 2AKLA 1W70A 3VS5A 2FPFA 1CKAA 2OI3A 3REBB 4F14A 2YUOA 2A28A 2JW4A 1OEBA 2YUPA 1PRMC 1VYVA 3M0SA 3QWXX 2MOXA 4JJCA 1T3LA 3M0TA 2EYWA 2LNHB 1EFNA 1AWJA 2K9GA 1SRLA 1TUCA 1N5ZA 3I35A 1W1FA 3NMZC 4IIMA 2FRYA 1AOJA 2O2OA 2M51A 1PHTA 2CSIA 1RI9A 1FYNA 1JQQA 2EKHA 2L0AA 2DA9A 1X43A 2L2PA 2EYXA 3H41A 4Y92A 2DMOA 2AZVA 3M0RA 1BBZA 4LNPA 5FWBA 3M0QA 3EG2A 3UATA 1PNJA 1RUWA 2BZXA 1Z9QA 2YUNA 3H0HA 1IO6A 2ESWA 5EC7A 2F2WA 3M0PA 2D8JA 2EBPA 2ROLA 1QCFA 2MIOA 2QDLA 4K11A 4GLMA 2X3WD 2K79A 1KJWA 1UGVA 1UFFA 2BZYA 5FWCA 1SRMA 2VKNA 2DF6A 2O9VA 2XMFA 1OPLA 1AWXA 2EYYA 1E6GA 2LJ1A 2JS2A 1KIKA 2JS0A 1GBQA 2LP5A 2JTEA 1QKWA 4HCKA 1AEYA 2O9SA 1AWOA 1WI7A 1Y0MA 1GCQC 2I0NA 2FG0A 4OMNA 2LZ6B 2EW3A 2LQNA 2RPNA 1FMKA 2PNIA 1WDXA 2ECZA 2JT4A 2KT1A 2AZSA 1CSKA 2DL3A 2RQUA 2AK5A 4AFZC 4RTVA 4CC7A 2E5KA 2KEAA 2CSQA 1B07A 2OJ2A 1BK2A 3VRYA 2HSPA 3TSWA 1ZSGA 3QWYA 2CDTA 2ED1A 1S1NA 2JMCA 3REAB 2RNAA 1Y57A 2HDAA 4J9EA 1T0HA 2SRCA 4AG2C 1M30A 2H8HA 3EHQA 2AKKA 3FJ5A 2DLPA 2P4RA 1M3BA 2C0TA 2W0ZA 4F16A 1K9AA 1BB9A 2K6DA 1HJDA 5FW9A 1WLPB 1A0NB 2EPDA 1WIEA 3IQLA 2DL7A 2RMOA 4LN2A 2KXCA 1YCSB 1WXTA 2M0YA 3H0IA 1Z9ZA 1SEMA 2JM8A 2KYMA 1SHGA 3NGPA 2GQIA 4J9DA 1U3OA 4LUDA 1M3CA 1ZBJA 2YUQA 3UA7A 3EG0A 3VS3A 1I07A 3R6NA 2KROA 3C0CA 4JPBW 1E7OA 2FO0A 2A08A 2YSQA 2ENMA 4CC2A 1WFWA 2DYBA 1BU1A 4AG1C 2SEMA 1I0CA 1JU5C 2LQWA 1OOTA 2J6KA 3PVLA 5IHNA 4HVVA 4HVUA 1VA7A 3VRZA 1K76A 2GTJA 1GRIA 3VS4A 3NHNA 1UG1A 2FPEA 2J7IA 3VS1A 3O5ZA 2DM1A 1TG0A 1X6BA 2J6OA 2CUDA 2KYBA 1W6XA 2YT6A 3EGUA 1MV0B 1JEGA 1YN8A 1ZUUA 4FSSA 1NM7A 2KT8A 2FPDA 2IIMA 1AVZC 4KRTA 2DILA 3UA6A 4CC3A 2F2VA 2W10A 1NYFA 5GJWB 2GBQA
chains in the Genus database with same CATH superfamily
4PFPA 4PJJA 2A0FB 2Y90A 4L59A 3OYDA 1T3SA 2CZ7B 4M78C 2LDMA 2QQBA 3CC2A 2DVJA 2MWOA 4J6YA 1QLYA 3J7AF 2ZCFB 1Q81R 4X9CA 3MP1A 2JMAA 3CC2T 4PNOA 4FM4B 3M59A 1XOVA 3VU3C 3JCMP 4X1VA 2RQRA 1MMDA 4DEYA 3LGFA 4ELZC 3RNJA 1CKBA 4FW1A 1VQ6A 4F04B 3CC4A 2COZA 1ZSZB 3HTRA 3AT1B 1YITA 2X51A 1VQ6T 3CC4T 1GL5A 3I55A 1HXDA 1YITT 1UHFA 4OB0B 4RG8A 1KHCA 1VQKA 5CVIA 4M75A 3I55T 1UE9A 2GF7A 4E6RA 2P84A 1HSQA 2AHJB 1VQKT 2DL4A 3OYCA 3CBPA 4QVZA 1M90U 2KRSA 2E10A 3CCJA 1VQ9A 4M75F 3RR6A 1NEGA 2DFUA 3META 4OVAA 1X01A 3VS2A 3CCJT 2MI6A 3FC3A 1VQ9T 5LJ3f 2RHIA 3WVEB 3C95A 4DQ2A 3QZ9B 5CIUA 1O75A 1MGQA 3MPUB 2CZ0B 1M90R 2M02A 3JRZA 3CXCP 1PD1A 2HAXA 2RHZA 5GAN4 5IHIA 2D0QB 4DBQA 1KQ2A 3RKYA 1YJNQ 1NEBA 5KYXB 3G71Q 2MWPA 4AFSC 4F17A 2DBMA 4OGCA 5FROA 3EFSA 4LDUA 4AFUC 5LL6S 2EGEA 1NJIC 2BTTA 1YIJA 3EGXB 4C92C 4WCIA 1B7TA 1J3TA 4DOWA 1YIJT 2KMTA 3X26B 5GAMe 4IUQA 3OYJA 4N4HA 2KGTA 1TXQA 1N8RC 5CAIA 4OP0A 4J83A 4QVDA 3ER0A 2RQTA 2ZGWA 3QDRB 4N4IA 5GANh 2K57A 3H8ZA 3GBQA 2QGFB 4J9IA 5GMKh 2DYIA 1ZA1B 2GNCA 2KSSA 1VQ4A 3INZA 3CCUQ 2DEUA 5GMKj 2XDBA 1TTHB 3UF4A 3C94A 1VQ4T 4C8QD 2DK3A 4WF2A 4PLIA 2OTLQ 2DZ9A 3A5ZB 2EQKA 3G6EA 2QYZA 3RERA 4Z89A 5L23A 3OA6A 1M4ZA 3G6ET 1OV3A 2NUPB 4J8OA 2OAWA 1UJ0A 2BE7D 3N5BB 3RESA 2MK5A 2CH4W 2PU9B 3R6OA 4DBHA 1N9RA 4F7UG 1C6VX 2KI7A 4X34A 4OMQA 1IZ6A 2JTMA 5FU6B 2CP5A 2E70A 1VQNA 4JZ4A 2K7AA 1Q82U 2Y4XA 1VQNT 3CEYA 2VC8A 1QP3A 3EHRA 3M9QA 4XTZA 3URGA 3HPWA 1JO8A 5CKDA 1PKTA 1WX6A 3M54A 4PJOD 3CCEA 3VUBA 1G83A 3JB9G 2LJ0A 4M7AG 4XTUA 5GANg 1R77A 5IHKA 2VYTA 3FRNA 2CP2A 2XDPA 2JTFA 4M7DA 1PKSA 1OYXA 3OY9A 1VQMQ 1RABB 3FB9A 2WSEE 1WJSA 4CI0C 4HVWA 5GAMf 2AKLA 3VS5A 3REBB 4F14A 4OB3B 4J7FA 2QASA 4OF1A 2KY9A 1VYVA 3M0SA 3UPUA 1JJ2A 5FU7B 1T3LA 3EG9A 1Q7YU 2EYWA 1B34B 1EFNA 1AWJA 1M1KU 1N5ZA 3V7RA 4FYYB 5GAOn 1D0XA 4C5HA 2DA9A 1Q7YR 1AT1B 2QTVA 3M57A 2DMOA 1M1KR 4PJMA 1BBZA 2MAMA 2E4HA 2OAUA 3A8HB 1QVPA 4EPCA 4M77G 1LVKA 1PNJA 3UATA 2RHYA 2CP7A 1VQPA 2Z0WA 4FYXB 4J6XA 3M0PA 4BY6C 2RHUA 3G4SQ 2MIOA 1VQPT 1ZHIA 1KG1A 2K79A 1KJWA 1UGVA 4NOYA 2BZYA 4LDWA 2DZCA 3QZ5B 2YRCA 4LDVA 5FWCA 4NL3A 4JRKA 1OPLA 4F7UB 5LJ5j 1M2OA 2I2LA 1K73U 1KIKA 4M78B 1WI7A 2DIQA 2I0NA 3DB4A 1R8OB 3JCMQ 5KYWB 2DXTA 3MEVA 1WGSA 2ECZA 3MO8A 1IHVA 1DJ7B 3ZFJA 2EKOA 3E9GA 1K73R 2RQUA 1VQ5A 2AK5A 3JB9J 1BIAA 4RTVA 3HRTA 1JJ2P 1VQ5T 3E1SA 1UGRB 1ZSGA 1QVFA 2CGHA 2ED1A 2QK0A 1QP2A 1S1NA 4RG2A 3REAB 3CCLA 4M7DC 2RNAA 4M75G 4MMLA 3LWIA 5IT9E 3M55A 3JCMJ 2SRCA 1M30A 4VUBA 2XK0A 1D0YA 4C0GA 3OYKA 1UB4A 3CCLT 2AKKA 4C0ZA 3KXTA 4JS4A 2K6DA 3VUZA 1KK7A 5FW9A 3FDRA 1WIEA 4FL6A 1PCXA 1WHLA 4RCBA 2MPXC 3V7SA 5KYUB 3OW2S 1Z9ZA 3RIRA 1U3OA 2BE9B 1M3CA 3EG0A 4PJLA 1NJIR 3VS3A 2CP3A 4JPBW 5CK9A 5D7UA 3H6ZA 1E7OA 3VJPA 5GANf 5GAOl 5GAOp 3CMEA 3HKSA 2LQWA 4QW2A 5AYFA 4HCBA 2VXFA 4HVVA 3L42A 3CMET 4HVUA 4A4EA 1VA7A 5KE3A 2GTJA 2FL7A 3OB9A 1GRIA 1SSFA 2XDDA 4MMKA 1BI0A 2DM1A 2HL5C 4OB1B 4NS5A 2CUDA 3OYAA 3SDZA 5GAN8 1JEGA 2EJ9A 5L8RE 3CC4Q 2RI3A 2KT8A 4C92B 4M7AE 2VGMA 1GXIE 2IIMA 1YITQ 2DILA 4CC3A 3QPHA 2W10A 3QUIA 2WSFE 2BZ8A 3I5RA 4QT7A 1QVGS 3A8LB 3E19A 4ZNXA 2MMPA 3FJPA 4CC4B 3RKXA 1I5LA 3S6WA 3A1PA 2HBWA 2HKQB 2DTHA 1U8RA 1YHQA 3JSCA 4FYVB 5J3BA 1XTDA 5GAN2 3TEEA 3QSUA 3QYGB 4A54A 1M2VA 4FT2A 1YHQT 2GFUA 3LWHA 2XHCA 1VQLA 1K0XA 3CBOA 2K5LA 5DLQE 3U23A 2Y4YA 3CMAA 1VQLT 4BE0A 2E6ZA 4C8QA 2PQWA 2RHXA 3CMAT 1MMAA 4IKFA 3V7CA 5ECAA 1K8AC 2FYKA 2HKNA 4ZTFA 2FRWA 3LW5E 4ZGEB 4M77E 4JJBA 1X69A 1WHGA 3E2UA 4C8QF 1YIJQ 3JCMV 1YI2Q 1YJ9A 2DL8A 2PUOB 2ATCB 1W2BP 1BCMA 4LD9K 4ZN1A 4Z8AA 1IREB 1IXDA 5DY9A 1YJ9T 1KQSP 4FW2A 3CCQA 4Z88A 1M8MA 3KBGA 1O9SA 1VQ8A 3CCQT 1QCNA 4C5EA 1LNXA 1XJWB 2D1XA 1VQ8T 3JV3A 3EGDA 1UGSB 1GFDA 3KFVA 4J7IA 2V1QA 9ATCB 3HSBA 1VQ4Q 4A4FA 4E7KA 2FVUA 2AIRB 4BI3A 3HL8A 4GBQA 5J39A 2F2XA 3ASKA 4JDSA 2G3RA 2GFAA 1K9MC 4PJOA 3QKJA 8AT1B 1NLOC 2FHDA 1UEBA 2ABLA 2E1HA 4M75E 3S3OA 3G6EQ 4XK8E 2CZ1B 4RCCA 1JXMA 2C0IA 1M1FA 4PJOF 4JLIA 4OB2B 4C92A 2L8DA 2OTJQ 3SEMA 2RD1A 2DVEA 2C06A 4PL6A 3JB9H 1I1JA 4C92F 3SFMA 3L2WA 2R58A 2O31A 1K1ZA 2QTXA 1VQNQ 1VQ7Q 2EWNA 4JZ3A 5IAYA 4R56A 3M58A 4RTWA 4C8QC 1RLQC 2B86A 1WQ7A 3M5AA 1H8KA 3CQTA 3M4YA 5DLOA 3HP9A 4BY6B 3F70A 1I8FA 1AWWA 2E5QA 1VQOQ 2MCNA 4BDZA 3RUXA 2RQVA 1D1BA 4L5GA 2EVRA 3TVTA 2PZ1A 2RM4A 1D1AA 3T9NA 5GAN6 3FEOA 3G1JA 3NTIA 4C0DC 1QWEA 2DL5A 2RQWA 1KFZA 1FXXA 2YHTA 3JCMd 1YP5A 4OMMA 2MF2A 1M3AA 3TCJA 4C5IA 1YBYA 1SSHA 1UDLA 3JAME 5IXBA 5GANd 4PJOC 4M7DB 1T0JA 2IG0A 2LNVA 1ABOA 3ULRB 1RAGB 3GLXA 4MZPA 3CC7Q 3QIIA 4Z02A 4NL2A 2H3EB 4XU1A 1WHMA 4BACA 3EG9B 3JCMh 1VQPQ 1RADB 1BIBA 2IVWA 2R5AA 2LNHB 1IGQA 4DA4A 2O4XA 2HNIA 1ACMB 3I35A 3NMZC 4AT1B 3TQ7P 4IIMA 2FRYA 2O2OA 4E2FB 1R0CB 1PHTA 2CSIA 1RI9A 2M51A 1JQQA 2K3XA 2ZPBB 2L0AA 1X43A 1U1SA 2E12A 2E41A 4Y92A 1RAHB 2EAYA 3OYGA 1WJQA 2K4YA 2DPPB 1Y96A 2L89A 3FLGA 5FWBA 4KGZB 2VASA 3EG2A 4BE1A 1RUWA 3V8LA 2XICA 1Z9QA 2YUNA 3H0HA 3GIBA 3G7ZA 2R57A 2D8JA 4FSXA 1QCFA 2RK2A 2QDLA 3FIFA 4K11A 3CCLQ 1UFFA 2EIFA 1SRMA 2VKNA 3TU4K 5KYNA 3VYHB 2QQSA 2O9VA 2XMFA 5A0DA 2X4JA 2LJ1A 2JS2A 3JB9D 1GBQA 1K8AU 4M7AD 5I2MA 1AWOA 2KK4A 4QVCA 2FG0A 3L2QA 5FRNA 2LZ6B 2EW3A 2VGNA 4JUVA 3BFMA 4M78G 3OW2A 1QW1A 4XQ3A 2EQUA 2AZSA 2V8KA 4PKCC 4BE2A 4AFZC 1D09B 4BI4A 3CXCS 4C0FA 1K8AR 2CSQA 2K5FA 3JCMg 1FMVA 2HSPA 3QWYA 4AMCA 2JMCA 2DD5A 4A4KA 4C8QG 1Y57A 2RJCA 2D9TA 4II1A 2H8HA 2QA4Q 2HMAA 2JOYA 3FJ5A 2DLPA 1S72A 2LX9A 1M3BA 3QBYA 3CMEQ 4FIBA 5D6YA 4XTVA 1K9AA 3CCMQ 3CCET 1S72T 4JS5A 3QJ6A 1A0NB 5GAN7 2DL7A 2KXCA 1RL2A 4E7HA 3PIOA 2LC4A 3MEUA 2JM8A 2KYMA 3RMSA 2P0KA 2GQIA 3E9FA 1ZBJA 2YUQA 1QCOA 2DKGA 2QGGA 1PSFA 4M7DF 4IUUA 3C0CA 2YXYA 4BD3A 4M77D 4CC2A 2ENMA 1TSFA 1QVGA 1WFWA 2DYBA 1BU1A 3LYIA 1I0CA 2NYSA 1JU5C 3PVLA 5IHNA 3OS0A 5C6SA 2YRDA 2BIVA 1F1BB 5GANe 1KHIA 3VRZA 4J5YA 1RAIB 5GMKe 6AT1B 4XU3A 4KH0B 1YHQQ 2X4WA 2YT6A 1W6XA 3JB9I 4D6WA 5KYYA 3J81E 2YRVA 3L2UA 2RA2A 1YJNA 1VQLQ 4PJNA 3I56A 2LVMA 4C92G 3OYIA 3CMAQ 5GJVB 2DNUA 4MDWA 2HD0A 1VYUA 3RKWA 1TU0B 2X4XA 1YJNT 2EFIA 2JN0A 2C0OA 4R55A 3I56T 2XIDA 5LJ5h 4E7LA 3Q1JA 4M75D 1YJWQ 2LJ3A 1KC8C 2RK1A 3D7SB 2P4TA 4KULA 4FU6A 4KBMB 5GAN5 3MHXA 1I81A 1YJ9Q 1YWPA 3OYYA 2FZCB 4ME7A 1M2VB 1R0BG 3JCMW 1OU9A 4AFQC 1X75C 3CCQQ 4ORZA 4KUIA 4DEXA 3GF5A 3S3MA 2D8HA 4C8QB 1G5VA 4HT9A 1SHFA 1U06A 1QVGP 4ZGDB 1RLPC 1XQHA 2QDYB 2V8JA 1V29B 1TWBA 1MUZA 4R0KA 3GP8A 3GPLA 2XI9A 3CPFA 2EGAA 3M0UA 2YLBA 4KGVB 3QDFA 5CQYA 2A36A 1BKBA 1NG2A 4A4HA 4E7ZA 2HQEA 3BE3A 1NJIU 2CP6A 2L3PA 1LOJA 2F1LA 3QHSA 2QEXA 1SPKA 5KCHA 2ZPIB 1G3YA 4QQDA 3JCMf 4OMFB 5IXFA 2QEXT 4X9DA 2CH4A 2DJQA 4C0DB 2XKOC 5HY6A 4D8KA 5IH2A 3M56A 3EH1A 1M9SA 1N8RU 1N27A 3EGDB 3VS0A 3OYHA 1K4US 2RN8A 1UJYA 4F7UE 2YDLA 4RTTA 1GCPA 4M78E 2GCXA 1WXUA 1AHJB 3H9NA 5LJ5g 2CT3A 3M4GA 3CC2Q 4RUGA 1FMWA 4PFOA 1N8RR 3ZEHA 4PJOB 3CCSA 1QWFA 5LJ3h 1YWOA 2G6FX 1ZBXA 5LJ3j 3CCST 4DBFA 4CRIA 4C8QE 2CUBA 3EFOA 1YNZA 1VQ6Q 4HKEA 5CR2A 2LT1A 3OYEA 2VWFA 1GFCA 4FT4A 2JJ9A 3PVQA 4EIKA 1QVFP 1MNDA 3I55Q 2L5QA 1VYTA 1VQMA 3RDVA 1VQKQ 4A63B 1GBRA 1VQMT 2NUTA 1WQWA 2NLUA 2WSCE 2L3RA 5GAOr 2KRNA 1M27C 4J9GA 4EDUA 1M5Q1 1NLPC 1Y71A 3EG3A 1VIEA 2JNGA 2KR3A 1OQKA 5KE2A 5CKEA 3CCJQ 1VQ9Q 2A37A 3MP6A 5HK0A 1UGQB 2EQIA 1V1CA 3L2VA 3X28B 1NBEB 3BDLA 3PMIA 2X3XD 3SB2A 1BCOA 2LCSA 1G2BA 4BUGA 3VV0A 8ATCB 3ZL7C 1BYMA 3X25B 3HHTB 3UWNA 1WYXA 1X27A 2M1HA 3CPWS 1Q95G 1JBMA 4PLLA 4DOVA 2VV5A 1KD1C 1ZQ1A 2CKKA 2PVDB 5I22A 1M8VA 1IRXA 4J9FA 4LUEA 1WZOA 1UHCA 4FYWB 3EG1A 5LJ3g 2DRMA 5C0MA 1U1TA 4XTWA 4C92E 1AD5A 2BUDA 1GCQA 3A98A 3UT1A 2LT4A 3GOXA 4Y28E 1SKUB 4M7AA 1MV3A 2L3SA 4HA8A 4ESRA 2WACA 2FB7A 2J06A 1TS9A 3ZBDA 2KDSA 1ARKA 1B3QA 3JCMc 2O88A 1AZEA 1WHHA 3EH2A 3DLMA 1QKXA 1C0MA 3UDCA 2DRKA 3PFSA 4EMKA 4M7AF 1Q82C 2KBTA 4JLGA 4EMHA 4FCYA 4QQ6A 5GMKm 4JJNK 4M7DG 2P0PA 3VS7A 5I21A 1W70A 2OI3A 1CKAA 2FZGB 2YUOA 5CO7A 5D6WA 1OX8A 4LDYA 1OEBA 2VB6A 4A53A 3QWXX 2MOXA 4RMOA 4JJCA 4E7SA 1OZ2A 2DXBA 1Y07A 3M0TA 2O4XB 2K5IA 1P92A 1N6AA 2K9GA 4OGEA 3OYFA 1SRLA 1TUCA 1OI1A 1W1FA 4KGXB 4RKUE 4YTLA 1FYNA 2RJFA 2EKHA 3PTAA 2GQVA 2L2PA 2EYXA 4ELYC 4MZTA 5GAMh 3MEWA 2B8AA 2K3YA 4WTOB 1Y96B 5J26A 1KC8U 5GAMj 3P8DA 2RB6A 4LNPA 4M77A 4XU2A 1X6OA 3A8OB 4N0AA 3CXCA 1IO6A 2ESWA 2RJDA 5EC7A 1RI0A 2XG8D 1KC8R 1WJRA 1XNIA 2EBPA 3CD6A 2D6FA 3V8KA 2M16A 4M77F 2ZAEA 1PM3A 4GLMA 2X3WD 2F5KA 3CD6T 3CBMA 2RI5A 4PK4A 2DF6A 4HCCA 3C12A 4BI8B 1HYOA 3CCEQ 2XD0A 1S72Q 1AWXA 1D3BA 2EYYA 1E6GA 2JS0A 2X9HA 1W2BS 1QKWA 1C1AA 1GCQC 2F5TX 2M9UA 1OULA 2E3IA 1G8XA 2RPNA 1KQSS 2PNIA 1WDXA 2HQHA 2RI2A 5GMKi 2JT4A 2KT1A 4M7AC 1CSKA 1WHKA 2DL3A 2BKDN 4B9XA 2E5KA 1LPLA 2OJ2A 1MMGA 3LLRA 1MNEA 5EG2A 4L6V5 2VXEA 3TSWA 4XAXB 2LQ8A 2KAFA 4Y91A 2JUFA 4E7JA 4EMKC 2O01E 2LRQA 3SD4A 2KQWA 3O8VA 2HDAA 1K73C 2LCCA 4AG2C 2JZ2A 4F16A 5CKHA 2DO3A 7AT1B 4ZN3A 5GAMg 4IURA 3ME9A 1HK9A 2EPDA 3IQLA 1G3SA 4B9WA 3NFCA 1YCSB 3KUFA 2M0YA 3H0IA 1SG5A 2LQKA 1QQJA 3NGPA 4J9DA 1OU8A 1VUBA 1I07A 2KROA 3MJXA 2FO0A 1Q86C 2A08A 3I56Q 2E6NA 4LDXA 3P8BB 2YWWA 4J6WA 3CCRA 3OBWA 2SEMA 3V8JA 4M77C 5FLXE 1YI2A 3CCRT 4N0AC 1NZ9A 3BDUA 1YI2T 2A3LA 1K76A 1TH7A 3VS4A 5GAOm 1UG1A 3VS1A 4IUPA 3SWNA 5KYYB 1TG0A 2RO0A 3TREA 3EGUA 1MV0B 3HFNA 1ZUUA 1IGUA 3EAEA 1NM7A 1W4SA 3OYBA 4M78D 4KRTA 2F2VA 1VQ5Q 2GBQA 4OMLA 3OMGA 3EFRA 5GANj 2CT4A 2E3HA 3DLLA 3NPFA 4HXJA 1D0ZA 2DX1A 4XU0A 4M7DE 1BI3A 2K3BA 1E6HA 3C4SA 2E64A 1KSWA 3WVDB 1BI2A 2V1RA 3S3NA 1KD1U 2E65A 1X2KA 3H0FA 4A4GA 1EZZB 4M75C 3PIPA 2DE0X 4LXCA 3HRUA 4EMGA 2QEXQ 3SHWA 3CCVA 2CZ6B 3AHUA 2ROTA 4GLKA 2V26A 1UTIA 1ZSZA 1KD1R 1G3WA 2OTJA 4UC4A 5I11A 3THKA 3CCVT 5KH6A 2HCKA 1M1KC 5IN1A 2NWMA 4IUVA 2OTJT 3GNGA 2MYSA 1ZUYA 4RTZA 1AZGB 2EYZA 1JXOA 2ZPFB 3NTHA 2PVGB 1ABQA 1VQ7A 2FEIA 2J6FA 3BY7A 2KNBB 2KXDA 3X20B 3CCSQ 1VQ7T 4LD6A 1YCYA 2QI2A 2LMJA 1ZUKA 4BB7A 4RTUA 2ED0A 2X4YA 3DKMA 2AT1B 1K9MU 1LCKA 3VKIA 1Q82R 2PTKA 5GMKl 1HD3A 3QO3A 2GTOA 3P8HA 1PWTA 1BI1A 5A0GA 1VQOA 5GAOq 1TOVA 5CKBA 3X24B 2DBKA 2ZPGB 5CKFA 2GGRA 2VVKA 3LH5A 1K0SA 3JCMe 1VQOT 1IHWA 2F69A 2JXBA 1K9MR 3SWNC 4GY5A 2JVVA 5KYXA 2EJGA 3HFOA 4C92D 3A8GB 2JM9A 2EGCA 4Q5WA 5LJ5d 2YLCA 4QKUA 2KVQG 1WNLA 1WHJA 4J9CA 3EGXA 2QG9B 3TSZA 4JRQA 1I5OB 4BDYA 4PJOG 2EQJA 3EFOB 3OW2P 1X6GA 4OMOA 4J9BA 2QQAA 4RTYA 2K2VA 2ZPEB 2QAZA 1ZX6A 2CS7A 3QYHB 3L1AA 3HRSA 5D6XA 3MP8A 1EIFA 1RAFB 1NYGA 1OPKA 2LX7A 3VS6A 3G71A 2CP0A 2DXUA 1MHNA 1IB8A 2M0OA 2NUTB 1UGPB 3G71T 1OX9A 3CPWA 2DXCA 3CC7A 1ZSZC 3OBYA 2HEQA 3MKDA 3MCAB 1WPYA 2RH2A 1EX4A 1NPPA 5CCAA 1JRIA 1OZ3A 2RF0A 2X35A 3CC7T 4RTXA 2L3QA 4M4ZA 2D0NA 3RBBB 2QQRA 1Q81C 2EJFA 2HBPA 3OSVA 4V2SA 4OMPA 2J05A 1UECA 3PGGA 2NUPA 1PRLC 1VQ8Q 3OS1A 1UUEA 2HQXA 1U5SA 2PUKB 4KUDK 3CCUA 5HCKA 3MEAA 3A8MB 3PE0A 3CCUT 3L2ZA 2OTLA 2V8IA 1KQ1A 5FRMA 2OTLT 5LJ3d 1RAEB 4ZTJA 1H3HA 2QQ9A 3LX7A 5HK3A 2KE9A 4JJDA 1H92A 3VYGA 1WXBA 2LTOA 4M7AB 2NUZA 2KRMA 1Q86U 2CREA 2K2MA 3I5SA 1YFNA 4KH1B 1ZLMA 3I9QA 1X2QA 4TVRA 2A7YA 4EMKB 1FWZA 4J9HA 2XU8A 4IIOA 1TUDA 3PNWC 4D8DA 3CPWP 1WA7A 4LE9A 5A0LA 1M90C 2P0QA 2CYZB 1Q86R 1D1CA 2FPFA 2DETA 5DM7R 5A2QE 2A28A 2FZKB 1PC0A 2JW4A 2VUBA 2YUPA 1PRMC 2ZPHB 3PT9A 4MDXA 1H641 4E7IA 2HZYA 2QA4A 3CD6Q 4P5NA 1B34A 3OYMA 2RJEA 2QA4T 3CCMA 1AOJA 1V76A 1PSEA 4IUTA 3CCMT 3H41A 1W2BA 2AZVA 4B6MA 3M0RA 4M77B 3DB3A 3OQ5A 2DERA 1KQSA 4O5VA 3M0QA 5LJ5e 1N9SA 1VOMA 2IPOB 2BZXA 4E47A 2F2WA 5CQXA 1JJ2S 2ZZDA 1JB0E 4C5GA 2ROLA 4ANJA 1H3ZA 3NTKA 4KT0E 2DTIA 2COYA 1D3BB 5FU6C 3JCMb 2HSEB 3QJYA 5AT1B 4F7UA 2LP5A 2JTEA 4HCKA 1AEYA 2O9SA 2HL3A 4M78A 4PJOE 1Y0MA 4OMNA 1Y7XA 2LQNA 1FMKA 5KYWA 5HKCA 4XTYA 1NPRA 4F7UF 2DD4A 2EQMA 1G3TA 4CC7A 4M7DD 2QXFA 2KEAA 1B07A 4M78F 3OS5A 2R5MA 1RACB 4M75B 1BK2A 3G4SA 3VRYA 2CDTA 2PVOB 2DIGA 2H3JA 1I4K1 3J80E 1QMCA 3G4ST 5I2SA 1FX7A 4J9EA 1T0HA 1ZA2B 1VIFA 3EHQA 5GAN3 1YJWA 3CCRQ 2P4RA 2C0TA 3OYNA 2W0ZA 2DEQA 1MMNA 4ATOA 4HCZA 1YJWT 1BB9A 1HJDA 4HT8A 1M1GA 1WLPB 3M53A 3JCMX 2OX7A 3WXMB 1TUGB 3PMTA 3OYLA 3LGLA 5GAMd 3JB9F 2RMOA 1LJOA 4LN2A 4QQGA 1WXTA 5FU7C 4ZGJB 4XTXA 1SEMA 5M9OA 5KYUA 1SHGA 2EYQA 2DJZA 4LUDA 1RAAB 2DTOA 3UA7A 1PD0A 4JRIA 1NE8A 3R6NA 4N4GA 5LJ3e 1QVFS 4DBRA 2YSQA 4O6JA 4JRPA 4AG1C 3OSSC 3QXEB 3LH0A 1OOTA 2J6KA 1SF9A 2DAQA 2COWA 5LJ5f 4PFZA 3BW1A 3SWNB 3QG1A 3NHNA 3GNFB 2FPEA 2J7IA 3O5ZA 2LCLA 3OS2A 1X6BA 2J6OA 2KYBA 3OMCA 3RMQA 1YN8A 4FSSA 5KCOA 4MZMA 3CCVQ 1PG5B 1Q7YC 2FPDA 1Q81U 1AVZC 3UA6A 3L2RA 1NYFA 5GJWB
chains in the Genus database with same CATH topology
4OMLA 2BZ8A 3I5RA 5GJVB 2DNUA 2CT4A 1T3SA 1VYUA 4QT7A 3NPFA 2C0OA 4HXJA 2DX1A 2DVJA 1QLYA 2K3BA 1E6HA 1KSWA 4ZNXA 2JMAA 2V1RA 2LJ3A 1XOVA 4CC4B 1X2KA 3H0FA 4X1VA 2RQRA 4DEYA 2HBWA 3RNJA 1CKBA 1YWPA 2DE0X 3SHWA 4AFQC 2ROTA 4ORZA 1UTIA 1K0XA 4DEXA 3U23A 1GL5A 5I11A 3THKA 2D8HA 2HCKA 1UHFA 2NWMA 1SHFA 1U06A 1UE9A 1RLPC 4E6RA 1ZUYA 1HSQA 4RTZA 2EYZA 1AZGB 1JXOA 1MUZA 5ECAA 4R0KA 2DL4A 1ABQA 2FRWA 4JJBA 1X69A 2EGAA 2KRSA 3M0UA 2FEIA 2J6FA 2A36A 2DL8A 1NEGA 1NG2A 2KNBB 2KXDA 4Z8AA 3VS2A 2L3PA 1SPKA 2LMJA 1ZUKA 4RTUA 2ED0A 4Z88A 1M8MA 1LCKA 5IXFA 2PTKA 1HD3A 2CH4A 2DJQA 4D8KA 5IH2A 2GTOA 5IHIA 1PWTA 2D1XA 3VS0A 1K4US 3JV3A 2DBKA 2RN8A 1UJYA 2GGRA 2VVKA 3LH5A 1NEBA 1K0SA 1GFDA 3KFVA 2YDLA 2JXBA 4RTTA 1GCPA 4AFSC 4F17A 2DBMA 2V1QA 1WXUA 2CT3A 4AFUC 2JM9A 2EGEA 2EGCA 4RUGA 2BTTA 4GBQA 4J9CA 4WCIA 2F2XA 1QWFA 1J3TA 1YWOA 2G6FX 3TSZA 1NLOC 2ABLA 1X6GA 4OMOA 2KGTA 2CUBA 4J9BA 4RTYA 1YNZA 1JXMA 2C0IA 1ZX6A 2RQTA 2VWFA 1GFCA 3PVQA 4EIKA 1NYGA 1OPKA 2LX7A 3SEMA 3VS6A 3GBQA 4J9IA 1VYTA 2GNCA 4A63B 1GBRA 1I1JA 3UF4A 2KRNA 2O31A 1M27C 1K1ZA 2HEQA 4J9GA 1NLPC 3EG3A 2KR3A 2RF0A 4JZ3A 4RTXA 4RTWA 2A37A 2L3QA 4M4ZA 2D0NA 3RBBB 1RLQC 2EQIA 1V1CA 2B86A 4Z89A 5L23A 1OV3A 2X3XD 4OMPA 1H8KA 1G2BA 2J05A 2LCSA 1UECA 3CQTA 3ZL7C 1PRLC 2OAWA 1UJ0A 1UUEA 1AWWA 2CH4W 2MCNA 1U5SA 1WYXA 2RQVA 1X27A 2EVRA 5HCKA 3TVTA 4OMQA 2PZ1A 3PE0A 5I22A 4JZ4A 2K7AA 4J9FA 4LUEA 1UHCA 3EG1A 2DRMA 1QWEA 2DL5A 2RQWA 1KFZA 1H3HA 3EHRA 1AD5A 1GCQA 1YP5A 2KE9A 4JJDA 3A98A 4OMMA 1H92A 1JO8A 1WXBA 1M3AA 1PKTA 1WX6A 1SSHA 2NUZA 1MV3A 2L3SA 2KRMA 1G83A 4ESRA 1UDLA 2CREA 2LJ0A 2K2MA 3I5SA 2J06A 1ARKA 1ZLMA 3I9QA 1B3QA 5IHKA 2O88A 1AZEA 1X2QA 5IXBA 1QKXA 4J9HA 1T0JA 4IIOA 1TUDA 2DRKA 4D8DA 1PKSA 1WA7A 4LE9A 2KBTA 1ABOA 4HVWA 3ULRB 3VS7A 2AKLA 1W70A 3VS5A 2FPFA 1CKAA 2OI3A 3REBB 4F14A 2YUOA 2A28A 2JW4A 1OEBA 2YUPA 1PRMC 1VYVA 3M0SA 3QWXX 2MOXA 4JJCA 1T3LA 3M0TA 2EYWA 2LNHB 1EFNA 1AWJA 2K9GA 1SRLA 1TUCA 1N5ZA 3I35A 1W1FA 3NMZC 4IIMA 2FRYA 1AOJA 2O2OA 2M51A 1PHTA 2CSIA 1RI9A 1FYNA 1JQQA 2EKHA 2L0AA 2DA9A 1X43A 2L2PA 2EYXA 3H41A 4Y92A 2DMOA 2AZVA 3M0RA 1BBZA 4LNPA 5FWBA 3M0QA 3EG2A 3UATA 1PNJA 1RUWA 2BZXA 1Z9QA 2YUNA 3H0HA 1IO6A 2ESWA 5EC7A 2F2WA 3M0PA 2D8JA 2EBPA 2ROLA 1QCFA 2MIOA 2QDLA 4K11A 4GLMA 2X3WD 2K79A 1KJWA 1UGVA 1UFFA 2BZYA 5FWCA 1SRMA 2VKNA 2DF6A 2O9VA 2XMFA 1OPLA 1AWXA 2EYYA 1E6GA 2LJ1A 2JS2A 1KIKA 2JS0A 1GBQA 2LP5A 2JTEA 1QKWA 4HCKA 1AEYA 2O9SA 1AWOA 1WI7A 1Y0MA 1GCQC 2I0NA 2FG0A 4OMNA 2LZ6B 2EW3A 2LQNA 2RPNA 1FMKA 2PNIA 1WDXA 2ECZA 2JT4A 2KT1A 2AZSA 1CSKA 2DL3A 2RQUA 2AK5A 4AFZC 4RTVA 4CC7A 2E5KA 2KEAA 2CSQA 1B07A 2OJ2A 1BK2A 3VRYA 2HSPA 3TSWA 1ZSGA 3QWYA 2CDTA 2ED1A 1S1NA 2JMCA 3REAB 2RNAA 1Y57A 2HDAA 4J9EA 1T0HA 2SRCA 4AG2C 1M30A 2H8HA 3EHQA 2AKKA 3FJ5A 2DLPA 2P4RA 1M3BA 2C0TA 2W0ZA 4F16A 1K9AA 1BB9A 2K6DA 1HJDA 5FW9A 1WLPB 1A0NB 2EPDA 1WIEA 3IQLA 2DL7A 2RMOA 4LN2A 2KXCA 1YCSB 1WXTA 2M0YA 3H0IA 1Z9ZA 1SEMA 2JM8A 2KYMA 1SHGA 3NGPA 2GQIA 4J9DA 1U3OA 4LUDA 1M3CA 1ZBJA 2YUQA 3UA7A 3EG0A 3VS3A 1I07A 3R6NA 2KROA 3C0CA 4JPBW 1E7OA 2FO0A 2A08A 2YSQA 2ENMA 4CC2A 1WFWA 2DYBA 1BU1A 4AG1C 2SEMA 1I0CA 1JU5C 2LQWA 1OOTA 2J6KA 3PVLA 5IHNA 4HVVA 4HVUA 1VA7A 3VRZA 1K76A 2GTJA 1GRIA 3VS4A 3NHNA 1UG1A 2FPEA 2J7IA 3VS1A 3O5ZA 2DM1A 1TG0A 1X6BA 2J6OA 2CUDA 2KYBA 1W6XA 2YT6A 3EGUA 1MV0B 1JEGA 1YN8A 1ZUUA 4FSSA 1NM7A 2KT8A 2FPDA 2IIMA 1AVZC 4KRTA 2DILA 3UA6A 4CC3A 2F2VA 2W10A 1NYFA 5GJWB 2GBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OML A;  2BZ8 A;  3I5R A;  5GJV B;  2DNU A;  2CT4 A;  1T3S A;  1VYU A;  4QT7 A;  3NPF A;  2C0O A;  4HXJ A;  2DX1 A;  2DVJ A;  1QLY A;  2K3B A;  1E6H A;  1KSW A;  4ZNX A;  2JMA A;  2V1R A;  2LJ3 A;  1XOV A;  4CC4 B;  1X2K A;  3H0F A;  4X1V A;  2RQR A;  4DEY A;  2HBW A;  3RNJ A;  1CKB A;  1YWP A;  2DE0 X;  3SHW A;  4AFQ C;  2ROT A;  4ORZ A;  1UTI A;  1K0X A;  4DEX A;  3U23 A;  1GL5 A;  5I11 A;  3THK A;  2D8H A;  2HCK A;  1UHF A;  2NWM A;  1SHF A;  1U06 A;  1UE9 A;  1RLP C;  4E6R A;  1ZUY A;  1HSQ A;  4RTZ A;  2EYZ A;  1AZG B;  1JXO A;  1MUZ A;  5ECA A;  4R0K A;  2DL4 A;  1ABQ A;  2FRW A;  4JJB A;  1X69 A;  2EGA A;  2KRS A;  3M0U A;  2FEI A;  2J6F A;  2A36 A;  2DL8 A;  1NEG A;  1NG2 A;  2KNB B;  2KXD A;  4Z8A A;  3VS2 A;  2L3P A;  1SPK A;  2LMJ A;  1ZUK A;  4RTU A;  2ED0 A;  4Z88 A;  1M8M A;  1LCK A;  5IXF A;  2PTK A;  1HD3 A;  2CH4 A;  2DJQ A;  4D8K A;  5IH2 A;  2GTO A;  5IHI A;  1PWT A;  2D1X A;  3VS0 A;  1K4U S;  3JV3 A;  2DBK A;  2RN8 A;  1UJY A;  2GGR A;  2VVK A;  3LH5 A;  1NEB A;  1K0S A;  1GFD A;  3KFV A;  2YDL A;  2JXB A;  4RTT A;  1GCP A;  4AFS C;  4F17 A;  2DBM A;  2V1Q A;  1WXU A;  2CT3 A;  4AFU C;  2JM9 A;  2EGE A;  2EGC A;  4RUG A;  2BTT A;  4GBQ A;  4J9C A;  4WCI A;  2F2X A;  1QWF A;  1J3T A;  1YWO A;  2G6F X;  3TSZ A;  1NLO C;  2ABL A;  1X6G A;  4OMO A;  2KGT A;  2CUB A;  4J9B A;  4RTY A;  1YNZ A;  1JXM A;  2C0I A;  1ZX6 A;  2RQT A;  2VWF A;  1GFC A;  3PVQ A;  4EIK A;  1NYG A;  1OPK A;  2LX7 A;  3SEM A;  3VS6 A;  3GBQ A;  4J9I A;  1VYT A;  2GNC A;  4A63 B;  1GBR A;  1I1J A;  3UF4 A;  2KRN A;  2O31 A;  1M27 C;  1K1Z A;  2HEQ A;  4J9G A;  1NLP C;  3EG3 A;  2KR3 A;  2RF0 A;  4JZ3 A;  4RTX A;  4RTW A;  2A37 A;  2L3Q A;  4M4Z A;  2D0N A;  3RBB B;  1RLQ C;  2EQI A;  1V1C A;  2B86 A;  4Z89 A;  5L23 A;  1OV3 A;  2X3X D;  4OMP A;  1H8K A;  1G2B A;  2J05 A;  2LCS A;  1UEC A;  3CQT A;  3ZL7 C;  1PRL C;  2OAW A;  1UJ0 A;  1UUE A;  1AWW A;  2CH4 W;  2MCN A;  1U5S A;  1WYX A;  2RQV A;  1X27 A;  2EVR A;  5HCK A;  3TVT A;  4OMQ A;  2PZ1 A;  3PE0 A;  5I22 A;  4JZ4 A;  2K7A A;  4J9F A;  4LUE A;  1UHC A;  3EG1 A;  2DRM A;  1QWE A;  2DL5 A;  2RQW A;  1KFZ A;  1H3H A;  3EHR A;  1AD5 A;  1GCQ A;  1YP5 A;  2KE9 A;  4JJD A;  3A98 A;  4OMM A;  1H92 A;  1JO8 A;  1WXB A;  1M3A A;  1PKT A;  1WX6 A;  1SSH A;  2NUZ A;  1MV3 A;  2L3S A;  2KRM A;  1G83 A;  4ESR A;  1UDL A;  2CRE A;  2LJ0 A;  2K2M A;  3I5S A;  2J06 A;  1ARK A;  1ZLM A;  3I9Q A;  1B3Q A;  5IHK A;  2O88 A;  1AZE A;  1X2Q A;  5IXB A;  1QKX A;  4J9H A;  1T0J A;  4IIO A;  1TUD A;  2DRK A;  4D8D A;  1PKS A;  1WA7 A;  4LE9 A;  2KBT A;  1ABO A;  4HVW A;  3ULR B;  3VS7 A;  2AKL A;  1W70 A;  3VS5 A;  2FPF A;  1CKA A;  2OI3 A;  3REB B;  4F14 A;  2YUO A;  2A28 A;  2JW4 A;  1OEB A;  2YUP A;  1PRM C;  1VYV A;  3M0S A;  3QWX X;  2MOX A;  4JJC A;  1T3L A;  3M0T A;  2EYW A;  2LNH B;  1EFN A;  1AWJ A;  2K9G A;  1SRL A;  1TUC A;  1N5Z A;  3I35 A;  1W1F A;  3NMZ C;  4IIM A;  2FRY A;  1AOJ A;  2O2O A;  2M51 A;  1PHT A;  2CSI A;  1RI9 A;  1FYN A;  1JQQ A;  2EKH A;  2L0A A;  2DA9 A;  1X43 A;  2L2P A;  2EYX A;  3H41 A;  4Y92 A;  2DMO A;  2AZV A;  3M0R A;  1BBZ A;  4LNP A;  5FWB A;  3M0Q A;  3EG2 A;  3UAT A;  1PNJ A;  1RUW A;  2BZX A;  1Z9Q A;  2YUN A;  3H0H A;  1IO6 A;  2ESW A;  5EC7 A;  2F2W A;  3M0P A;  2D8J A;  2EBP A;  2ROL A;  1QCF A;  2MIO A;  2QDL A;  4K11 A;  4GLM A;  2X3W D;  2K79 A;  1KJW A;  1UGV A;  1UFF A;  2BZY A;  5FWC A;  1SRM A;  2VKN A;  2DF6 A;  2O9V A;  2XMF A;  1OPL A;  1AWX A;  2EYY A;  1E6G A;  2LJ1 A;  2JS2 A;  1KIK A;  2JS0 A;  1GBQ A;  2LP5 A;  2JTE A;  1QKW A;  4HCK A;  1AEY A;  2O9S A;  1AWO A;  1WI7 A;  1Y0M A;  1GCQ C;  2I0N A;  2FG0 A;  4OMN A;  2LZ6 B;  2EW3 A;  2LQN A;  2RPN A;  1FMK A;  2PNI A;  1WDX A;  2ECZ A;  2JT4 A;  2KT1 A;  2AZS A;  1CSK A;  2DL3 A;  2RQU A;  2AK5 A;  4AFZ C;  4RTV A;  4CC7 A;  2E5K A;  2KEA A;  2CSQ A;  1B07 A;  2OJ2 A;  1BK2 A;  3VRY A;  2HSP A;  3TSW A;  1ZSG A;  3QWY A;  2CDT A;  2ED1 A;  1S1N A;  2JMC A;  3REA B;  2RNA A;  1Y57 A;  2HDA A;  4J9E A;  1T0H A;  2SRC A;  4AG2 C;  1M30 A;  2H8H A;  3EHQ A;  2AKK A;  3FJ5 A;  2DLP A;  2P4R A;  1M3B A;  2C0T A;  2W0Z A;  4F16 A;  1K9A A;  1BB9 A;  2K6D A;  1HJD A;  5FW9 A;  1WLP B;  1A0N B;  2EPD A;  1WIE A;  3IQL A;  2DL7 A;  2RMO A;  4LN2 A;  2KXC A;  1YCS B;  1WXT A;  2M0Y A;  3H0I A;  1Z9Z A;  1SEM A;  2JM8 A;  2KYM A;  1SHG A;  3NGP A;  2GQI A;  4J9D A;  1U3O A;  4LUD A;  1M3C A;  1ZBJ A;  2YUQ A;  3UA7 A;  3EG0 A;  3VS3 A;  1I07 A;  3R6N A;  2KRO A;  3C0C A;  4JPB W;  1E7O A;  2FO0 A;  2A08 A;  2YSQ A;  2ENM A;  4CC2 A;  1WFW A;  2DYB A;  1BU1 A;  4AG1 C;  2SEM A;  1I0C A;  1JU5 C;  2LQW A;  1OOT A;  2J6K A;  3PVL A;  5IHN A;  4HVV A;  4HVU A;  1VA7 A;  3VRZ A;  1K76 A;  2GTJ A;  1GRI A;  3VS4 A;  3NHN A;  1UG1 A;  2FPE A;  2J7I A;  3VS1 A;  3O5Z A;  2DM1 A;  1TG0 A;  1X6B A;  2J6O A;  2CUD A;  2KYB A;  1W6X A;  2YT6 A;  3EGU A;  1MV0 B;  1JEG A;  1YN8 A;  1ZUU A;  4FSS A;  1NM7 A;  2KT8 A;  2FPD A;  2IIM A;  1AVZ C;  4KRT A;  2DIL A;  3UA6 A;  4CC3 A;  2F2V A;  2W10 A;  1NYF A;  5GJW B;  2GBQ A; 
#chains in the Genus database with same CATH topology
 4PFP A;  4PJJ A;  2A0F B;  2Y90 A;  4L59 A;  3OYD A;  1T3S A;  2CZ7 B;  4M78 C;  2LDM A;  2QQB A;  3CC2 A;  2DVJ A;  2MWO A;  4J6Y A;  1QLY A;  3J7A F;  2ZCF B;  1Q81 R;  4X9C A;  3MP1 A;  2JMA A;  3CC2 T;  4PNO A;  4FM4 B;  3M59 A;  1XOV A;  3VU3 C;  3JCM P;  4X1V A;  2RQR A;  1MMD A;  4DEY A;  3LGF A;  4ELZ C;  3RNJ A;  1CKB A;  4FW1 A;  1VQ6 A;  4F04 B;  3CC4 A;  2COZ A;  1ZSZ B;  3HTR A;  3AT1 B;  1YIT A;  2X51 A;  1VQ6 T;  3CC4 T;  1GL5 A;  3I55 A;  1HXD A;  1YIT T;  1UHF A;  4OB0 B;  4RG8 A;  1KHC A;  1VQK A;  5CVI A;  4M75 A;  3I55 T;  1UE9 A;  2GF7 A;  4E6R A;  2P84 A;  1HSQ A;  2AHJ B;  1VQK T;  2DL4 A;  3OYC A;  3CBP A;  4QVZ A;  1M90 U;  2KRS A;  2E10 A;  3CCJ A;  1VQ9 A;  4M75 F;  3RR6 A;  1NEG A;  2DFU A;  3MET A;  4OVA A;  1X01 A;  3VS2 A;  3CCJ T;  2MI6 A;  3FC3 A;  1VQ9 T;  5LJ3 f;  2RHI A;  3WVE B;  3C95 A;  4DQ2 A;  3QZ9 B;  5CIU A;  1O75 A;  1MGQ A;  3MPU B;  2CZ0 B;  1M90 R;  2M02 A;  3JRZ A;  3CXC P;  1PD1 A;  2HAX A;  2RHZ A;  5GAN 4;  5IHI A;  2D0Q B;  4DBQ A;  1KQ2 A;  3RKY A;  1YJN Q;  1NEB A;  5KYX B;  3G71 Q;  2MWP A;  4AFS C;  4F17 A;  2DBM A;  4OGC A;  5FRO A;  3EFS A;  4LDU A;  4AFU C;  5LL6 S;  2EGE A;  1NJI C;  2BTT A;  1YIJ A;  3EGX B;  4C92 C;  4WCI A;  1B7T A;  1J3T A;  4DOW A;  1YIJ T;  2KMT A;  3X26 B;  5GAM e;  4IUQ A;  3OYJ A;  4N4H A;  2KGT A;  1TXQ A;  1N8R C;  5CAI A;  4OP0 A;  4J83 A;  4QVD A;  3ER0 A;  2RQT A;  2ZGW A;  3QDR B;  4N4I A;  5GAN h;  2K57 A;  3H8Z A;  3GBQ A;  2QGF B;  4J9I A;  5GMK h;  2DYI A;  1ZA1 B;  2GNC A;  2KSS A;  1VQ4 A;  3INZ A;  3CCU Q;  2DEU A;  5GMK j;  2XDB A;  1TTH B;  3UF4 A;  3C94 A;  1VQ4 T;  4C8Q D;  2DK3 A;  4WF2 A;  4PLI A;  2OTL Q;  2DZ9 A;  3A5Z B;  2EQK A;  3G6E A;  2QYZ A;  3RER A;  4Z89 A;  5L23 A;  3OA6 A;  1M4Z A;  3G6E T;  1OV3 A;  2NUP B;  4J8O A;  2OAW A;  1UJ0 A;  2BE7 D;  3N5B B;  3RES A;  2MK5 A;  2CH4 W;  2PU9 B;  3R6O A;  4DBH A;  1N9R A;  4F7U G;  1C6V X;  2KI7 A;  4X34 A;  4OMQ A;  1IZ6 A;  2JTM A;  5FU6 B;  2CP5 A;  2E70 A;  1VQN A;  4JZ4 A;  2K7A A;  1Q82 U;  2Y4X A;  1VQN T;  3CEY A;  2VC8 A;  1QP3 A;  3EHR A;  3M9Q A;  4XTZ A;  3URG A;  3HPW A;  1JO8 A;  5CKD A;  1PKT A;  1WX6 A;  3M54 A;  4PJO D;  3CCE A;  3VUB A;  1G83 A;  3JB9 G;  2LJ0 A;  4M7A G;  4XTU A;  5GAN g;  1R77 A;  5IHK A;  2VYT A;  3FRN A;  2CP2 A;  2XDP A;  2JTF A;  4M7D A;  1PKS A;  1OYX A;  3OY9 A;  1VQM Q;  1RAB B;  3FB9 A;  2WSE E;  1WJS A;  4CI0 C;  4HVW A;  5GAM f;  2AKL A;  3VS5 A;  3REB B;  4F14 A;  4OB3 B;  4J7F A;  2QAS A;  4OF1 A;  2KY9 A;  1VYV A;  3M0S A;  3UPU A;  1JJ2 A;  5FU7 B;  1T3L A;  3EG9 A;  1Q7Y U;  2EYW A;  1B34 B;  1EFN A;  1AWJ A;  1M1K U;  1N5Z A;  3V7R A;  4FYY B;  5GAO n;  1D0X A;  4C5H A;  2DA9 A;  1Q7Y R;  1AT1 B;  2QTV A;  3M57 A;  2DMO A;  1M1K R;  4PJM A;  1BBZ A;  2MAM A;  2E4H A;  2OAU A;  3A8H B;  1QVP A;  4EPC A;  4M77 G;  1LVK A;  1PNJ A;  3UAT A;  2RHY A;  2CP7 A;  1VQP A;  2Z0W A;  4FYX B;  4J6X A;  3M0P A;  4BY6 C;  2RHU A;  3G4S Q;  2MIO A;  1VQP T;  1ZHI A;  1KG1 A;  2K79 A;  1KJW A;  1UGV A;  4NOY A;  2BZY A;  4LDW A;  2DZC A;  3QZ5 B;  2YRC A;  4LDV A;  5FWC A;  4NL3 A;  4JRK A;  1OPL A;  4F7U B;  5LJ5 j;  1M2O A;  2I2L A;  1K73 U;  1KIK A;  4M78 B;  1WI7 A;  2DIQ A;  2I0N A;  3DB4 A;  1R8O B;  3JCM Q;  5KYW B;  2DXT A;  3MEV A;  1WGS A;  2ECZ A;  3MO8 A;  1IHV A;  1DJ7 B;  3ZFJ A;  2EKO A;  3E9G A;  1K73 R;  2RQU A;  1VQ5 A;  2AK5 A;  3JB9 J;  1BIA A;  4RTV A;  3HRT A;  1JJ2 P;  1VQ5 T;  3E1S A;  1UGR B;  1ZSG A;  1QVF A;  2CGH A;  2ED1 A;  2QK0 A;  1QP2 A;  1S1N A;  4RG2 A;  3REA B;  3CCL A;  4M7D C;  2RNA A;  4M75 G;  4MML A;  3LWI A;  5IT9 E;  3M55 A;  3JCM J;  2SRC A;  1M30 A;  4VUB A;  2XK0 A;  1D0Y A;  4C0G A;  3OYK A;  1UB4 A;  3CCL T;  2AKK A;  4C0Z A;  3KXT A;  4JS4 A;  2K6D A;  3VUZ A;  1KK7 A;  5FW9 A;  3FDR A;  1WIE A;  4FL6 A;  1PCX A;  1WHL A;  4RCB A;  2MPX C;  3V7S A;  5KYU B;  3OW2 S;  1Z9Z A;  3RIR A;  1U3O A;  2BE9 B;  1M3C A;  3EG0 A;  4PJL A;  1NJI R;  3VS3 A;  2CP3 A;  4JPB W;  5CK9 A;  5D7U A;  3H6Z A;  1E7O A;  3VJP A;  5GAN f;  5GAO l;  5GAO p;  3CME A;  3HKS A;  2LQW A;  4QW2 A;  5AYF A;  4HCB A;  2VXF A;  4HVV A;  3L42 A;  3CME T;  4HVU A;  4A4E A;  1VA7 A;  5KE3 A;  2GTJ A;  2FL7 A;  3OB9 A;  1GRI A;  1SSF A;  2XDD A;  4MMK A;  1BI0 A;  2DM1 A;  2HL5 C;  4OB1 B;  4NS5 A;  2CUD A;  3OYA A;  3SDZ A;  5GAN 8;  1JEG A;  2EJ9 A;  5L8R E;  3CC4 Q;  2RI3 A;  2KT8 A;  4C92 B;  4M7A E;  2VGM A;  1GXI E;  2IIM A;  1YIT Q;  2DIL A;  4CC3 A;  3QPH A;  2W10 A;  3QUI A;  2WSF E;  2BZ8 A;  3I5R A;  4QT7 A;  1QVG S;  3A8L B;  3E19 A;  4ZNX A;  2MMP A;  3FJP A;  4CC4 B;  3RKX A;  1I5L A;  3S6W A;  3A1P A;  2HBW A;  2HKQ B;  2DTH A;  1U8R A;  1YHQ A;  3JSC A;  4FYV B;  5J3B A;  1XTD A;  5GAN 2;  3TEE A;  3QSU A;  3QYG B;  4A54 A;  1M2V A;  4FT2 A;  1YHQ T;  2GFU A;  3LWH A;  2XHC A;  1VQL A;  1K0X A;  3CBO A;  2K5L A;  5DLQ E;  3U23 A;  2Y4Y A;  3CMA A;  1VQL T;  4BE0 A;  2E6Z A;  4C8Q A;  2PQW A;  2RHX A;  3CMA T;  1MMA A;  4IKF A;  3V7C A;  5ECA A;  1K8A C;  2FYK A;  2HKN A;  4ZTF A;  2FRW A;  3LW5 E;  4ZGE B;  4M77 E;  4JJB A;  1X69 A;  1WHG A;  3E2U A;  4C8Q F;  1YIJ Q;  3JCM V;  1YI2 Q;  1YJ9 A;  2DL8 A;  2PUO B;  2ATC B;  1W2B P;  1BCM A;  4LD9 K;  4ZN1 A;  4Z8A A;  1IRE B;  1IXD A;  5DY9 A;  1YJ9 T;  1KQS P;  4FW2 A;  3CCQ A;  4Z88 A;  1M8M A;  3KBG A;  1O9S A;  1VQ8 A;  3CCQ T;  1QCN A;  4C5E A;  1LNX A;  1XJW B;  2D1X A;  1VQ8 T;  3JV3 A;  3EGD A;  1UGS B;  1GFD A;  3KFV A;  4J7I A;  2V1Q A;  9ATC B;  3HSB A;  1VQ4 Q;  4A4F A;  4E7K A;  2FVU A;  2AIR B;  4BI3 A;  3HL8 A;  4GBQ A;  5J39 A;  2F2X A;  3ASK A;  4JDS A;  2G3R A;  2GFA A;  1K9M C;  4PJO A;  3QKJ A;  8AT1 B;  1NLO C;  2FHD A;  1UEB A;  2ABL A;  2E1H A;  4M75 E;  3S3O A;  3G6E Q;  4XK8 E;  2CZ1 B;  4RCC A;  1JXM A;  2C0I A;  1M1F A;  4PJO F;  4JLI A;  4OB2 B;  4C92 A;  2L8D A;  2OTJ Q;  3SEM A;  2RD1 A;  2DVE A;  2C06 A;  4PL6 A;  3JB9 H;  1I1J A;  4C92 F;  3SFM A;  3L2W A;  2R58 A;  2O31 A;  1K1Z A;  2QTX A;  1VQN Q;  1VQ7 Q;  2EWN A;  4JZ3 A;  5IAY A;  4R56 A;  3M58 A;  4RTW A;  4C8Q C;  1RLQ C;  2B86 A;  1WQ7 A;  3M5A A;  1H8K A;  3CQT A;  3M4Y A;  5DLO A;  3HP9 A;  4BY6 B;  3F70 A;  1I8F A;  1AWW A;  2E5Q A;  1VQO Q;  2MCN A;  4BDZ A;  3RUX A;  2RQV A;  1D1B A;  4L5G A;  2EVR A;  3TVT A;  2PZ1 A;  2RM4 A;  1D1A A;  3T9N A;  5GAN 6;  3FEO A;  3G1J A;  3NTI A;  4C0D C;  1QWE A;  2DL5 A;  2RQW A;  1KFZ A;  1FXX A;  2YHT A;  3JCM d;  1YP5 A;  4OMM A;  2MF2 A;  1M3A A;  3TCJ A;  4C5I A;  1YBY A;  1SSH A;  1UDL A;  3JAM E;  5IXB A;  5GAN d;  4PJO C;  4M7D B;  1T0J A;  2IG0 A;  2LNV A;  1ABO A;  3ULR B;  1RAG B;  3GLX A;  4MZP A;  3CC7 Q;  3QII A;  4Z02 A;  4NL2 A;  2H3E B;  4XU1 A;  1WHM A;  4BAC A;  3EG9 B;  3JCM h;  1VQP Q;  1RAD B;  1BIB A;  2IVW A;  2R5A A;  2LNH B;  1IGQ A;  4DA4 A;  2O4X A;  2HNI A;  1ACM B;  3I35 A;  3NMZ C;  4AT1 B;  3TQ7 P;  4IIM A;  2FRY A;  2O2O A;  4E2F B;  1R0C B;  1PHT A;  2CSI A;  1RI9 A;  2M51 A;  1JQQ A;  2K3X A;  2ZPB B;  2L0A A;  1X43 A;  1U1S A;  2E12 A;  2E41 A;  4Y92 A;  1RAH B;  2EAY A;  3OYG A;  1WJQ A;  2K4Y A;  2DPP B;  1Y96 A;  2L89 A;  3FLG A;  5FWB A;  4KGZ B;  2VAS A;  3EG2 A;  4BE1 A;  1RUW A;  3V8L A;  2XIC A;  1Z9Q A;  2YUN A;  3H0H A;  3GIB A;  3G7Z A;  2R57 A;  2D8J A;  4FSX A;  1QCF A;  2RK2 A;  2QDL A;  3FIF A;  4K11 A;  3CCL Q;  1UFF A;  2EIF A;  1SRM A;  2VKN A;  3TU4 K;  5KYN A;  3VYH B;  2QQS A;  2O9V A;  2XMF A;  5A0D A;  2X4J A;  2LJ1 A;  2JS2 A;  3JB9 D;  1GBQ A;  1K8A U;  4M7A D;  5I2M A;  1AWO A;  2KK4 A;  4QVC A;  2FG0 A;  3L2Q A;  5FRN A;  2LZ6 B;  2EW3 A;  2VGN A;  4JUV A;  3BFM A;  4M78 G;  3OW2 A;  1QW1 A;  4XQ3 A;  2EQU A;  2AZS A;  2V8K A;  4PKC C;  4BE2 A;  4AFZ C;  1D09 B;  4BI4 A;  3CXC S;  4C0F A;  1K8A R;  2CSQ A;  2K5F A;  3JCM g;  1FMV A;  2HSP A;  3QWY A;  4AMC A;  2JMC A;  2DD5 A;  4A4K A;  4C8Q G;  1Y57 A;  2RJC A;  2D9T A;  4II1 A;  2H8H A;  2QA4 Q;  2HMA A;  2JOY A;  3FJ5 A;  2DLP A;  1S72 A;  2LX9 A;  1M3B A;  3QBY A;  3CME Q;  4FIB A;  5D6Y A;  4XTV A;  1K9A A;  3CCM Q;  3CCE T;  1S72 T;  4JS5 A;  3QJ6 A;  1A0N B;  5GAN 7;  2DL7 A;  2KXC A;  1RL2 A;  4E7H A;  3PIO A;  2LC4 A;  3MEU A;  2JM8 A;  2KYM A;  3RMS A;  2P0K A;  2GQI A;  3E9F A;  1ZBJ A;  2YUQ A;  1QCO A;  2DKG A;  2QGG A;  1PSF A;  4M7D F;  4IUU A;  3C0C A;  2YXY A;  4BD3 A;  4M77 D;  4CC2 A;  2ENM A;  1TSF A;  1QVG A;  1WFW A;  2DYB A;  1BU1 A;  3LYI A;  1I0C A;  2NYS A;  1JU5 C;  3PVL A;  5IHN A;  3OS0 A;  5C6S A;  2YRD A;  2BIV A;  1F1B B;  5GAN e;  1KHI A;  3VRZ A;  4J5Y A;  1RAI B;  5GMK e;  6AT1 B;  4XU3 A;  4KH0 B;  1YHQ Q;  2X4W A;  2YT6 A;  1W6X A;  3JB9 I;  4D6W A;  5KYY A;  3J81 E;  2YRV A;  3L2U A;  2RA2 A;  1YJN A;  1VQL Q;  4PJN A;  3I56 A;  2LVM A;  4C92 G;  3OYI A;  3CMA Q;  5GJV B;  2DNU A;  4MDW A;  2HD0 A;  1VYU A;  3RKW A;  1TU0 B;  2X4X A;  1YJN T;  2EFI A;  2JN0 A;  2C0O A;  4R55 A;  3I56 T;  2XID A;  5LJ5 h;  4E7L A;  3Q1J A;  4M75 D;  1YJW Q;  2LJ3 A;  1KC8 C;  2RK1 A;  3D7S B;  2P4T A;  4KUL A;  4FU6 A;  4KBM B;  5GAN 5;  3MHX A;  1I81 A;  1YJ9 Q;  1YWP A;  3OYY A;  2FZC B;  4ME7 A;  1M2V B;  1R0B G;  3JCM W;  1OU9 A;  4AFQ C;  1X75 C;  3CCQ Q;  4ORZ A;  4KUI A;  4DEX A;  3GF5 A;  3S3M A;  2D8H A;  4C8Q B;  1G5V A;  4HT9 A;  1SHF A;  1U06 A;  1QVG P;  4ZGD B;  1RLP C;  1XQH A;  2QDY B;  2V8J A;  1V29 B;  1TWB A;  1MUZ A;  4R0K A;  3GP8 A;  3GPL A;  2XI9 A;  3CPF A;  2EGA A;  3M0U A;  2YLB A;  4KGV B;  3QDF A;  5CQY A;  2A36 A;  1BKB A;  1NG2 A;  4A4H A;  4E7Z A;  2HQE A;  3BE3 A;  1NJI U;  2CP6 A;  2L3P A;  1LOJ A;  2F1L A;  3QHS A;  2QEX A;  1SPK A;  5KCH A;  2ZPI B;  1G3Y A;  4QQD A;  3JCM f;  4OMF B;  5IXF A;  2QEX T;  4X9D A;  2CH4 A;  2DJQ A;  4C0D B;  2XKO C;  5HY6 A;  4D8K A;  5IH2 A;  3M56 A;  3EH1 A;  1M9S A;  1N8R U;  1N27 A;  3EGD B;  3VS0 A;  3OYH A;  1K4U S;  2RN8 A;  1UJY A;  4F7U E;  2YDL A;  4RTT A;  1GCP A;  4M78 E;  2GCX A;  1WXU A;  1AHJ B;  3H9N A;  5LJ5 g;  2CT3 A;  3M4G A;  3CC2 Q;  4RUG A;  1FMW A;  4PFO A;  1N8R R;  3ZEH A;  4PJO B;  3CCS A;  1QWF A;  5LJ3 h;  1YWO A;  2G6F X;  1ZBX A;  5LJ3 j;  3CCS T;  4DBF A;  4CRI A;  4C8Q E;  2CUB A;  3EFO A;  1YNZ A;  1VQ6 Q;  4HKE A;  5CR2 A;  2LT1 A;  3OYE A;  2VWF A;  1GFC A;  4FT4 A;  2JJ9 A;  3PVQ A;  4EIK A;  1QVF P;  1MND A;  3I55 Q;  2L5Q A;  1VYT A;  1VQM A;  3RDV A;  1VQK Q;  4A63 B;  1GBR A;  1VQM T;  2NUT A;  1WQW A;  2NLU A;  2WSC E;  2L3R A;  5GAO r;  2KRN A;  1M27 C;  4J9G A;  4EDU A;  1M5Q 1;  1NLP C;  1Y71 A;  3EG3 A;  1VIE A;  2JNG A;  2KR3 A;  1OQK A;  5KE2 A;  5CKE A;  3CCJ Q;  1VQ9 Q;  2A37 A;  3MP6 A;  5HK0 A;  1UGQ B;  2EQI A;  1V1C A;  3L2V A;  3X28 B;  1NBE B;  3BDL A;  3PMI A;  2X3X D;  3SB2 A;  1BCO A;  2LCS A;  1G2B A;  4BUG A;  3VV0 A;  8ATC B;  3ZL7 C;  1BYM A;  3X25 B;  3HHT B;  3UWN A;  1WYX A;  1X27 A;  2M1H A;  3CPW S;  1Q95 G;  1JBM A;  4PLL A;  4DOV A;  2VV5 A;  1KD1 C;  1ZQ1 A;  2CKK A;  2PVD B;  5I22 A;  1M8V A;  1IRX A;  4J9F A;  4LUE A;  1WZO A;  1UHC A;  4FYW B;  3EG1 A;  5LJ3 g;  2DRM A;  5C0M A;  1U1T A;  4XTW A;  4C92 E;  1AD5 A;  2BUD A;  1GCQ A;  3A98 A;  3UT1 A;  2LT4 A;  3GOX A;  4Y28 E;  1SKU B;  4M7A A;  1MV3 A;  2L3S A;  4HA8 A;  4ESR A;  2WAC A;  2FB7 A;  2J06 A;  1TS9 A;  3ZBD A;  2KDS A;  1ARK A;  1B3Q A;  3JCM c;  2O88 A;  1AZE A;  1WHH A;  3EH2 A;  3DLM A;  1QKX A;  1C0M A;  3UDC A;  2DRK A;  3PFS A;  4EMK A;  4M7A F;  1Q82 C;  2KBT A;  4JLG A;  4EMH A;  4FCY A;  4QQ6 A;  5GMK m;  4JJN K;  4M7D G;  2P0P A;  3VS7 A;  5I21 A;  1W70 A;  2OI3 A;  1CKA A;  2FZG B;  2YUO A;  5CO7 A;  5D6W A;  1OX8 A;  4LDY A;  1OEB A;  2VB6 A;  4A53 A;  3QWX X;  2MOX A;  4RMO A;  4JJC A;  4E7S A;  1OZ2 A;  2DXB A;  1Y07 A;  3M0T A;  2O4X B;  2K5I A;  1P92 A;  1N6A A;  2K9G A;  4OGE A;  3OYF A;  1SRL A;  1TUC A;  1OI1 A;  1W1F A;  4KGX B;  4RKU E;  4YTL A;  1FYN A;  2RJF A;  2EKH A;  3PTA A;  2GQV A;  2L2P A;  2EYX A;  4ELY C;  4MZT A;  5GAM h;  3MEW A;  2B8A A;  2K3Y A;  4WTO B;  1Y96 B;  5J26 A;  1KC8 U;  5GAM j;  3P8D A;  2RB6 A;  4LNP A;  4M77 A;  4XU2 A;  1X6O A;  3A8O B;  4N0A A;  3CXC A;  1IO6 A;  2ESW A;  2RJD A;  5EC7 A;  1RI0 A;  2XG8 D;  1KC8 R;  1WJR A;  1XNI A;  2EBP A;  3CD6 A;  2D6F A;  3V8K A;  2M16 A;  4M77 F;  2ZAE A;  1PM3 A;  4GLM A;  2X3W D;  2F5K A;  3CD6 T;  3CBM A;  2RI5 A;  4PK4 A;  2DF6 A;  4HCC A;  3C12 A;  4BI8 B;  1HYO A;  3CCE Q;  2XD0 A;  1S72 Q;  1AWX A;  1D3B A;  2EYY A;  1E6G A;  2JS0 A;  2X9H A;  1W2B S;  1QKW A;  1C1A A;  1GCQ C;  2F5T X;  2M9U A;  1OUL A;  2E3I A;  1G8X A;  2RPN A;  1KQS S;  2PNI A;  1WDX A;  2HQH A;  2RI2 A;  5GMK i;  2JT4 A;  2KT1 A;  4M7A C;  1CSK A;  1WHK A;  2DL3 A;  2BKD N;  4B9X A;  2E5K A;  1LPL A;  2OJ2 A;  1MMG A;  3LLR A;  1MNE A;  5EG2 A;  4L6V 5;  2VXE A;  3TSW A;  4XAX B;  2LQ8 A;  2KAF A;  4Y91 A;  2JUF A;  4E7J A;  4EMK C;  2O01 E;  2LRQ A;  3SD4 A;  2KQW A;  3O8V A;  2HDA A;  1K73 C;  2LCC A;  4AG2 C;  2JZ2 A;  4F16 A;  5CKH A;  2DO3 A;  7AT1 B;  4ZN3 A;  5GAM g;  4IUR A;  3ME9 A;  1HK9 A;  2EPD A;  3IQL A;  1G3S A;  4B9W A;  3NFC A;  1YCS B;  3KUF A;  2M0Y A;  3H0I A;  1SG5 A;  2LQK A;  1QQJ A;  3NGP A;  4J9D A;  1OU8 A;  1VUB A;  1I07 A;  2KRO A;  3MJX A;  2FO0 A;  1Q86 C;  2A08 A;  3I56 Q;  2E6N A;  4LDX A;  3P8B B;  2YWW A;  4J6W A;  3CCR A;  3OBW A;  2SEM A;  3V8J A;  4M77 C;  5FLX E;  1YI2 A;  3CCR T;  4N0A C;  1NZ9 A;  3BDU A;  1YI2 T;  2A3L A;  1K76 A;  1TH7 A;  3VS4 A;  5GAO m;  1UG1 A;  3VS1 A;  4IUP A;  3SWN A;  5KYY B;  1TG0 A;  2RO0 A;  3TRE A;  3EGU A;  1MV0 B;  3HFN A;  1ZUU A;  1IGU A;  3EAE A;  1NM7 A;  1W4S A;  3OYB A;  4M78 D;  4KRT A;  2F2V A;  1VQ5 Q;  2GBQ A;  4OML A;  3OMG A;  3EFR A;  5GAN j;  2CT4 A;  2E3H A;  3DLL A;  3NPF A;  4HXJ A;  1D0Z A;  2DX1 A;  4XU0 A;  4M7D E;  1BI3 A;  2K3B A;  1E6H A;  3C4S A;  2E64 A;  1KSW A;  3WVD B;  1BI2 A;  2V1R A;  3S3N A;  1KD1 U;  2E65 A;  1X2K A;  3H0F A;  4A4G A;  1EZZ B;  4M75 C;  3PIP A;  2DE0 X;  4LXC A;  3HRU A;  4EMG A;  2QEX Q;  3SHW A;  3CCV A;  2CZ6 B;  3AHU A;  2ROT A;  4GLK A;  2V26 A;  1UTI A;  1ZSZ A;  1KD1 R;  1G3W A;  2OTJ A;  4UC4 A;  5I11 A;  3THK A;  3CCV T;  5KH6 A;  2HCK A;  1M1K C;  5IN1 A;  2NWM A;  4IUV A;  2OTJ T;  3GNG A;  2MYS A;  1ZUY A;  4RTZ A;  1AZG B;  2EYZ A;  1JXO A;  2ZPF B;  3NTH A;  2PVG B;  1ABQ A;  1VQ7 A;  2FEI A;  2J6F A;  3BY7 A;  2KNB B;  2KXD A;  3X20 B;  3CCS Q;  1VQ7 T;  4LD6 A;  1YCY A;  2QI2 A;  2LMJ A;  1ZUK A;  4BB7 A;  4RTU A;  2ED0 A;  2X4Y A;  3DKM A;  2AT1 B;  1K9M U;  1LCK A;  3VKI A;  1Q82 R;  2PTK A;  5GMK l;  1HD3 A;  3QO3 A;  2GTO A;  3P8H A;  1PWT A;  1BI1 A;  5A0G A;  1VQO A;  5GAO q;  1TOV A;  5CKB A;  3X24 B;  2DBK A;  2ZPG B;  5CKF A;  2GGR A;  2VVK A;  3LH5 A;  1K0S A;  3JCM e;  1VQO T;  1IHW A;  2F69 A;  2JXB A;  1K9M R;  3SWN C;  4GY5 A;  2JVV A;  5KYX A;  2EJG A;  3HFO A;  4C92 D;  3A8G B;  2JM9 A;  2EGC A;  4Q5W A;  5LJ5 d;  2YLC A;  4QKU A;  2KVQ G;  1WNL A;  1WHJ A;  4J9C A;  3EGX A;  2QG9 B;  3TSZ A;  4JRQ A;  1I5O B;  4BDY A;  4PJO G;  2EQJ A;  3EFO B;  3OW2 P;  1X6G A;  4OMO A;  4J9B A;  2QQA A;  4RTY A;  2K2V A;  2ZPE B;  2QAZ A;  1ZX6 A;  2CS7 A;  3QYH B;  3L1A A;  3HRS A;  5D6X A;  3MP8 A;  1EIF A;  1RAF B;  1NYG A;  1OPK A;  2LX7 A;  3VS6 A;  3G71 A;  2CP0 A;  2DXU A;  1MHN A;  1IB8 A;  2M0O A;  2NUT B;  1UGP B;  3G71 T;  1OX9 A;  3CPW A;  2DXC A;  3CC7 A;  1ZSZ C;  3OBY A;  2HEQ A;  3MKD A;  3MCA B;  1WPY A;  2RH2 A;  1EX4 A;  1NPP A;  5CCA A;  1JRI A;  1OZ3 A;  2RF0 A;  2X35 A;  3CC7 T;  4RTX A;  2L3Q A;  4M4Z A;  2D0N A;  3RBB B;  2QQR A;  1Q81 C;  2EJF A;  2HBP A;  3OSV A;  4V2S A;  4OMP A;  2J05 A;  1UEC A;  3PGG A;  2NUP A;  1PRL C;  1VQ8 Q;  3OS1 A;  1UUE A;  2HQX A;  1U5S A;  2PUK B;  4KUD K;  3CCU A;  5HCK A;  3MEA A;  3A8M B;  3PE0 A;  3CCU T;  3L2Z A;  2OTL A;  2V8I A;  1KQ1 A;  5FRM A;  2OTL T;  5LJ3 d;  1RAE B;  4ZTJ A;  1H3H A;  2QQ9 A;  3LX7 A;  5HK3 A;  2KE9 A;  4JJD A;  1H92 A;  3VYG A;  1WXB A;  2LTO A;  4M7A B;  2NUZ A;  2KRM A;  1Q86 U;  2CRE A;  2K2M A;  3I5S A;  1YFN A;  4KH1 B;  1ZLM A;  3I9Q A;  1X2Q A;  4TVR A;  2A7Y A;  4EMK B;  1FWZ A;  4J9H A;  2XU8 A;  4IIO A;  1TUD A;  3PNW C;  4D8D A;  3CPW P;  1WA7 A;  4LE9 A;  5A0L A;  1M90 C;  2P0Q A;  2CYZ B;  1Q86 R;  1D1C A;  2FPF A;  2DET A;  5DM7 R;  5A2Q E;  2A28 A;  2FZK B;  1PC0 A;  2JW4 A;  2VUB A;  2YUP A;  1PRM C;  2ZPH B;  3PT9 A;  4MDX A;  1H64 1;  4E7I A;  2HZY A;  2QA4 A;  3CD6 Q;  4P5N A;  1B34 A;  3OYM A;  2RJE A;  2QA4 T;  3CCM A;  1AOJ A;  1V76 A;  1PSE A;  4IUT A;  3CCM T;  3H41 A;  1W2B A;  2AZV A;  4B6M A;  3M0R A;  4M77 B;  3DB3 A;  3OQ5 A;  2DER A;  1KQS A;  4O5V A;  3M0Q A;  5LJ5 e;  1N9S A;  1VOM A;  2IPO B;  2BZX A;  4E47 A;  2F2W A;  5CQX A;  1JJ2 S;  2ZZD A;  1JB0 E;  4C5G A;  2ROL A;  4ANJ A;  1H3Z A;  3NTK A;  4KT0 E;  2DTI A;  2COY A;  1D3B B;  5FU6 C;  3JCM b;  2HSE B;  3QJY A;  5AT1 B;  4F7U A;  2LP5 A;  2JTE A;  4HCK A;  1AEY A;  2O9S A;  2HL3 A;  4M78 A;  4PJO E;  1Y0M A;  4OMN A;  1Y7X A;  2LQN A;  1FMK A;  5KYW A;  5HKC A;  4XTY A;  1NPR A;  4F7U F;  2DD4 A;  2EQM A;  1G3T A;  4CC7 A;  4M7D D;  2QXF A;  2KEA A;  1B07 A;  4M78 F;  3OS5 A;  2R5M A;  1RAC B;  4M75 B;  1BK2 A;  3G4S A;  3VRY A;  2CDT A;  2PVO B;  2DIG A;  2H3J A;  1I4K 1;  3J80 E;  1QMC A;  3G4S T;  5I2S A;  1FX7 A;  4J9E A;  1T0H A;  1ZA2 B;  1VIF A;  3EHQ A;  5GAN 3;  1YJW A;  3CCR Q;  2P4R A;  2C0T A;  3OYN A;  2W0Z A;  2DEQ A;  1MMN A;  4ATO A;  4HCZ A;  1YJW T;  1BB9 A;  1HJD A;  4HT8 A;  1M1G A;  1WLP B;  3M53 A;  3JCM X;  2OX7 A;  3WXM B;  1TUG B;  3PMT A;  3OYL A;  3LGL A;  5GAM d;  3JB9 F;  2RMO A;  1LJO A;  4LN2 A;  4QQG A;  1WXT A;  5FU7 C;  4ZGJ B;  4XTX A;  1SEM A;  5M9O A;  5KYU A;  1SHG A;  2EYQ A;  2DJZ A;  4LUD A;  1RAA B;  2DTO A;  3UA7 A;  1PD0 A;  4JRI A;  1NE8 A;  3R6N A;  4N4G A;  5LJ3 e;  1QVF S;  4DBR A;  2YSQ A;  4O6J A;  4JRP A;  4AG1 C;  3OSS C;  3QXE B;  3LH0 A;  1OOT A;  2J6K A;  1SF9 A;  2DAQ A;  2COW A;  5LJ5 f;  4PFZ A;  3BW1 A;  3SWN B;  3QG1 A;  3NHN A;  3GNF B;  2FPE A;  2J7I A;  3O5Z A;  2LCL A;  3OS2 A;  1X6B A;  2J6O A;  2KYB A;  3OMC A;  3RMQ A;  1YN8 A;  4FSS A;  5KCO A;  4MZM A;  3CCV Q;  1PG5 B;  1Q7Y C;  2FPD A;  1Q81 U;  1AVZ C;  3UA6 A;  3L2R A;  1NYF A;  5GJW B; 
#chains in the Genus database with same CATH homology
 4OML A;  2BZ8 A;  3I5R A;  5GJV B;  2DNU A;  2CT4 A;  1T3S A;  1VYU A;  4QT7 A;  3NPF A;  2C0O A;  4HXJ A;  2DX1 A;  2DVJ A;  1QLY A;  2K3B A;  1E6H A;  1KSW A;  4ZNX A;  2JMA A;  2V1R A;  2LJ3 A;  1XOV A;  4CC4 B;  1X2K A;  3H0F A;  4X1V A;  2RQR A;  4DEY A;  2HBW A;  3RNJ A;  1CKB A;  1YWP A;  2DE0 X;  3SHW A;  4AFQ C;  2ROT A;  4ORZ A;  1UTI A;  1K0X A;  4DEX A;  3U23 A;  1GL5 A;  5I11 A;  3THK A;  2D8H A;  2HCK A;  1UHF A;  2NWM A;  1SHF A;  1U06 A;  1UE9 A;  1RLP C;  4E6R A;  1ZUY A;  1HSQ A;  4RTZ A;  2EYZ A;  1AZG B;  1JXO A;  1MUZ A;  5ECA A;  4R0K A;  2DL4 A;  1ABQ A;  2FRW A;  4JJB A;  1X69 A;  2EGA A;  2KRS A;  3M0U A;  2FEI A;  2J6F A;  2A36 A;  2DL8 A;  1NEG A;  1NG2 A;  2KNB B;  2KXD A;  4Z8A A;  3VS2 A;  2L3P A;  1SPK A;  2LMJ A;  1ZUK A;  4RTU A;  2ED0 A;  4Z88 A;  1M8M A;  1LCK A;  5IXF A;  2PTK A;  1HD3 A;  2CH4 A;  2DJQ A;  4D8K A;  5IH2 A;  2GTO A;  5IHI A;  1PWT A;  2D1X A;  3VS0 A;  1K4U S;  3JV3 A;  2DBK A;  2RN8 A;  1UJY A;  2GGR A;  2VVK A;  3LH5 A;  1NEB A;  1K0S A;  1GFD A;  3KFV A;  2YDL A;  2JXB A;  4RTT A;  1GCP A;  4AFS C;  4F17 A;  2DBM A;  2V1Q A;  1WXU A;  2CT3 A;  4AFU C;  2JM9 A;  2EGE A;  2EGC A;  4RUG A;  2BTT A;  4GBQ A;  4J9C A;  4WCI A;  2F2X A;  1QWF A;  1J3T A;  1YWO A;  2G6F X;  3TSZ A;  1NLO C;  2ABL A;  1X6G A;  4OMO A;  2KGT A;  2CUB A;  4J9B A;  4RTY A;  1YNZ A;  1JXM A;  2C0I A;  1ZX6 A;  2RQT A;  2VWF A;  1GFC A;  3PVQ A;  4EIK A;  1NYG A;  1OPK A;  2LX7 A;  3SEM A;  3VS6 A;  3GBQ A;  4J9I A;  1VYT A;  2GNC A;  4A63 B;  1GBR A;  1I1J A;  3UF4 A;  2KRN A;  2O31 A;  1M27 C;  1K1Z A;  2HEQ A;  4J9G A;  1NLP C;  3EG3 A;  2KR3 A;  2RF0 A;  4JZ3 A;  4RTX A;  4RTW A;  2A37 A;  2L3Q A;  4M4Z A;  2D0N A;  3RBB B;  1RLQ C;  2EQI A;  1V1C A;  2B86 A;  4Z89 A;  5L23 A;  1OV3 A;  2X3X D;  4OMP A;  1H8K A;  1G2B A;  2J05 A;  2LCS A;  1UEC A;  3CQT A;  3ZL7 C;  1PRL C;  2OAW A;  1UJ0 A;  1UUE A;  1AWW A;  2CH4 W;  2MCN A;  1U5S A;  1WYX A;  2RQV A;  1X27 A;  2EVR A;  5HCK A;  3TVT A;  4OMQ A;  2PZ1 A;  3PE0 A;  5I22 A;  4JZ4 A;  2K7A A;  4J9F A;  4LUE A;  1UHC A;  3EG1 A;  2DRM A;  1QWE A;  2DL5 A;  2RQW A;  1KFZ A;  1H3H A;  3EHR A;  1AD5 A;  1GCQ A;  1YP5 A;  2KE9 A;  4JJD A;  3A98 A;  4OMM A;  1H92 A;  1JO8 A;  1WXB A;  1M3A A;  1PKT A;  1WX6 A;  1SSH A;  2NUZ A;  1MV3 A;  2L3S A;  2KRM A;  1G83 A;  4ESR A;  1UDL A;  2CRE A;  2LJ0 A;  2K2M A;  3I5S A;  2J06 A;  1ARK A;  1ZLM A;  3I9Q A;  1B3Q A;  5IHK A;  2O88 A;  1AZE A;  1X2Q A;  5IXB A;  1QKX A;  4J9H A;  1T0J A;  4IIO A;  1TUD A;  2DRK A;  4D8D A;  1PKS A;  1WA7 A;  4LE9 A;  2KBT A;  1ABO A;  4HVW A;  3ULR B;  3VS7 A;  2AKL A;  1W70 A;  3VS5 A;  2FPF A;  1CKA A;  2OI3 A;  3REB B;  4F14 A;  2YUO A;  2A28 A;  2JW4 A;  1OEB A;  2YUP A;  1PRM C;  1VYV A;  3M0S A;  3QWX X;  2MOX A;  4JJC A;  1T3L A;  3M0T A;  2EYW A;  2LNH B;  1EFN A;  1AWJ A;  2K9G A;  1SRL A;  1TUC A;  1N5Z A;  3I35 A;  1W1F A;  3NMZ C;  4IIM A;  2FRY A;  1AOJ A;  2O2O A;  2M51 A;  1PHT A;  2CSI A;  1RI9 A;  1FYN A;  1JQQ A;  2EKH A;  2L0A A;  2DA9 A;  1X43 A;  2L2P A;  2EYX A;  3H41 A;  4Y92 A;  2DMO A;  2AZV A;  3M0R A;  1BBZ A;  4LNP A;  5FWB A;  3M0Q A;  3EG2 A;  3UAT A;  1PNJ A;  1RUW A;  2BZX A;  1Z9Q A;  2YUN A;  3H0H A;  1IO6 A;  2ESW A;  5EC7 A;  2F2W A;  3M0P A;  2D8J A;  2EBP A;  2ROL A;  1QCF A;  2MIO A;  2QDL A;  4K11 A;  4GLM A;  2X3W D;  2K79 A;  1KJW A;  1UGV A;  1UFF A;  2BZY A;  5FWC A;  1SRM A;  2VKN A;  2DF6 A;  2O9V A;  2XMF A;  1OPL A;  1AWX A;  2EYY A;  1E6G A;  2LJ1 A;  2JS2 A;  1KIK A;  2JS0 A;  1GBQ A;  2LP5 A;  2JTE A;  1QKW A;  4HCK A;  1AEY A;  2O9S A;  1AWO A;  1WI7 A;  1Y0M A;  1GCQ C;  2I0N A;  2FG0 A;  4OMN A;  2LZ6 B;  2EW3 A;  2LQN A;  2RPN A;  1FMK A;  2PNI A;  1WDX A;  2ECZ A;  2JT4 A;  2KT1 A;  2AZS A;  1CSK A;  2DL3 A;  2RQU A;  2AK5 A;  4AFZ C;  4RTV A;  4CC7 A;  2E5K A;  2KEA A;  2CSQ A;  1B07 A;  2OJ2 A;  1BK2 A;  3VRY A;  2HSP A;  3TSW A;  1ZSG A;  3QWY A;  2CDT A;  2ED1 A;  1S1N A;  2JMC A;  3REA B;  2RNA A;  1Y57 A;  2HDA A;  4J9E A;  1T0H A;  2SRC A;  4AG2 C;  1M30 A;  2H8H A;  3EHQ A;  2AKK A;  3FJ5 A;  2DLP A;  2P4R A;  1M3B A;  2C0T A;  2W0Z A;  4F16 A;  1K9A A;  1BB9 A;  2K6D A;  1HJD A;  5FW9 A;  1WLP B;  1A0N B;  2EPD A;  1WIE A;  3IQL A;  2DL7 A;  2RMO A;  4LN2 A;  2KXC A;  1YCS B;  1WXT A;  2M0Y A;  3H0I A;  1Z9Z A;  1SEM A;  2JM8 A;  2KYM A;  1SHG A;  3NGP A;  2GQI A;  4J9D A;  1U3O A;  4LUD A;  1M3C A;  1ZBJ A;  2YUQ A;  3UA7 A;  3EG0 A;  3VS3 A;  1I07 A;  3R6N A;  2KRO A;  3C0C A;  4JPB W;  1E7O A;  2FO0 A;  2A08 A;  2YSQ A;  2ENM A;  4CC2 A;  1WFW A;  2DYB A;  1BU1 A;  4AG1 C;  2SEM A;  1I0C A;  1JU5 C;  2LQW A;  1OOT A;  2J6K A;  3PVL A;  5IHN A;  4HVV A;  4HVU A;  1VA7 A;  3VRZ A;  1K76 A;  2GTJ A;  1GRI A;  3VS4 A;  3NHN A;  1UG1 A;  2FPE A;  2J7I A;  3VS1 A;  3O5Z A;  2DM1 A;  1TG0 A;  1X6B A;  2J6O A;  2CUD A;  2KYB A;  1W6X A;  2YT6 A;  3EGU A;  1MV0 B;  1JEG A;  1YN8 A;  1ZUU A;  4FSS A;  1NM7 A;  2KT8 A;  2FPD A;  2IIM A;  1AVZ C;  4KRT A;  2DIL A;  3UA6 A;  4CC3 A;  2F2V A;  2W10 A;  1NYF A;  5GJW B;  2GBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...