1UGVA

Solution structure of the sh3 domain of human olygophrein-1 like protein (kiaa0621)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
72
structure length
72
Chain Sequence
b'GSSGSSGTPFRKAKALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Olygophrenin-1 like protein
publication title Solution structure of the SH3 domain of human olygophrein-1 like protein (KIAA0621)
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2003-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1ugvA00
1FYNA 2JW4A 3NHNA 4EIKA 1OEBA 2JMAA 1MUZA 2CH4A 4HVVA 1U3OA 2X3XD 3VS4A 1KFZA 1PRMC 2L2PA 1B3QA 3M0RA 2ECZA 1H8KA 1GRIA 3O5ZA 1GFDA 2DJQA 5IHIA 2YUNA 3EGUA 2AZSA 5FWCA 1YP5A 4LE9A 2LP5A 4JJBA 2OI3A 4AG2C 1N5ZA 4RUGA 1W70A 1NLPC 2KRNA 4JJDA 1SRMA 4K11A 3GBQA 1ZUYA 5EC7A 2GTOA 1ABQA 1G2BA 1I0CA 2J7IA 3QWXX 2FEIA 1VYUA 2YDLA 2JM9A 4HVWA 1JU5C 1PKSA 5I22A 1K0SA 4AFQC 1AOJA 1OPLA 1A0NB 5L23A 2GNCA 2RF0A 2CT4A 2FRWA 2RQTA 3NPFA 1Z9QA 2J6OA 3JV3A 4IIMA 3R6NA 1SRLA 3UA6A 3NGPA 1GCQA 1QKXA 2RQWA 2ED1A 2PNIA 2NWMA 1HD3A 3EG0A 2CT3A 3I5RA 4M4ZA 1WXTA 1NG2A 1CKBA 2DRKA 2IIMA 1M30A 2P4RA 3VS5A 2MIOA 4RTUA 1OOTA 2EGAA 1KJWA 2KNBB 1M3BA 3VRZA 2EBPA 4AFSC 2D8HA 2O31A 3VS1A 2FPEA 1JEGA 4ZNXA 1RLQC 3LH5A 2DF6A 1SSHA 2F2XA 3PVQA 2E5KA 4HXJA 1NEBA 4OMNA 4J9BA 2J06A 2DL5A 2KR3A 4RTXA 1PKTA 2EYWA 2CSIA 1M8MA 4RTYA 4X1VA 2K79A 1ZUKA 3TSZA 2X3WD 2EVRA 4J9HA 2AK5A 2KYBA 2V1QA 1HSQA 2DBKA 3M0TA 2KT1A 3ZL7C 1JXOA 2D8JA 4F16A 3KFVA 3SEMA 1JQQA 3RNJA 1K1ZA 3H41A 2LX7A 4Z8AA 3SHWA 2V1RA 2DL7A 4JJCA 5IH2A 3M0QA 2ROLA 2VVKA 2EYYA 4ESRA 1SEMA 2RPNA 4DEXA 2KXCA 1AWJA 5I11A 1U5SA 5GJWB 5FWBA 5GJVB 2PZ1A 2DBMA 4CC4B 1FMKA 2FO0A 2NUZA 1WFWA 2LQWA 1IO6A 2KROA 2O2OA 2LQNA 2W10A 1ZBJA 2SRCA 4JPBW 1OV3A 2KE9A 2RQUA 4LNPA 1PRLC 3M0SA 3VS2A 2ROTA 1AWWA 1YNZA 4QT7A 1QWEA 1YN8A 4JZ4A 1TG0A 2D1XA 2LNHB 2JT4A 4Y92A 1M27C 2CUBA 2FRYA 2YSQA 2DMOA 3QWYA 4D8DA 3H0FA 2W0ZA 2L3QA 4J9IA 2KRSA 4GBQA 1X27A 1BB9A 1AVZC 2CDTA 2A28A 2KT8A 2XMFA 1OPKA 1UE9A 2YT6A 2MCNA 2HSPA 2EQIA 1V1CA 1I07A 2DVJA 3UA7A 1UHFA 2JS2A 4DEYA 2AKLA 3UF4A 2KBTA 2O9SA 2EYXA 1H3HA 4WCIA 1K0XA 4RTZA 2F2WA 4OMQA 3EG3A 3VS7A 2EGCA 1CSKA 4J9FA 1NEGA 1AEYA 2DL3A 1UFFA 3EG1A 3REBB 2RQRA 1Z9ZA 1QKWA 1UHCA 1RI9A 4J9GA 3FJ5A 2VKNA 2MOXA 4OMMA 1UG1A 1CKAA 3H0HA 3M0UA 3VRYA 1AWXA 1YWPA 2JXBA 1K4US 2RNAA 1SHFA 1NLOC 1W1FA 3EG2A 1TUDA 1JO8A 1WDXA 3U23A 2KGTA 1K76A 1AD5A 1VYVA 1QWFA 2KRMA 1YCSB 2RQVA 3NMZC 4F17A 3UATA 1AZGB 2JMCA 1BU1A 2ABLA 2YUOA 2A08A 4CC2A 2LZ6B 1Y57A 2BZXA 3IQLA 4LUEA 2DL4A 1ABOA 2C0IA 2LJ3A 4E6RA 1E7OA 2ED0A 3CQTA 1UGVA 1E6HA 4J9DA 1WI7A 1UJYA 3VS6A 2RMOA 3THKA 1U06A 4HCKA 1NYFA 1AZEA 2K7AA 4JZ3A 2L0AA 2PTKA 2L3SA 2LJ1A 2RN8A 3EHQA 4FSSA 1B07A 2EPDA 1YWOA 2HCKA 4IIOA 2DX1A 2BTTA 1X6BA 2GGRA 1UTIA 1WA7A 4Z89A 1HJDA 2L3PA 1ARKA 3VS3A 2D0NA 2B86A 3RBBB 1J3TA 1MV0B 1K9AA 2I0NA 1H92A 2A36A 2C0OA 2O88A 4GLMA 2M51A 2FPFA 2DILA 4HVUA 1EFNA 1KIKA 3C0CA 1UDLA 1WIEA 1ZUUA 2JM8A 3PE0A 4RTTA 1RUWA 5FW9A 2DYBA 3I5SA 1T3SA 2DM1A 1VA7A 2QDLA 2GBQA 2J6KA 5IHKA 2J05A 5IHNA 4F14A 1ZLMA 1X69A 1WXUA 2DRMA 5IXFA 1ZSGA 3VS0A 1NM7A 2EYZA 1M3CA 5HCKA 1NYGA 2BZ8A 4A63B 1BBZA 2DL8A 2CREA 2LMJA 1T0HA 4AFUC 2EW3A 2GTJA 1SHGA 2OJ2A 1M3AA 2G6FX 2GQIA 2DNUA 2YUPA 1GCQC 1RLPC 1E6GA 1WXBA 1ZX6A 2LJ0A 3H0IA 1GBRA 4OMLA 3EHRA 3M0PA 2ESWA 1S1NA 2YUQA 1LCKA 2J6FA 2JTEA 4LN2A 2LCSA 4Z88A 2AKKA 3I9QA 2OAWA 1KSWA 3REAB 1WX6A 1GBQA 1QCFA 3A98A 4J9CA 3I35A 4CC7A 4AG1C 1UUEA 4CC3A 2A37A 2K2MA 2EKHA 1BK2A 2CUDA 1W6XA 1AWOA 3PVLA 2AZVA 2JS0A 2BZYA 1X6GA 1PWTA 1VYTA 2FPDA 1GCPA 1G83A 1UJ0A 1T3LA 1MV3A 1UECA 2ENMA 1QLYA 2CSQA 1I1JA 1JXMA 1SPKA 1X43A 1WYXA 1XOVA 2EGEA 4AFZC 4LUDA 1X2KA 2C0TA 2HDAA 2O9VA 2M0YA 5IXBA 4KRTA 2HEQA 2K3BA 4D8KA 1GL5A 2DE0X 2K9GA 2F2VA 2H8HA 2KXDA 1PNJA 1PHTA 2VWFA 2DA9A 2K6DA 4OMPA 2SEMA 1WLPB 3TVTA 4RTWA 2CH4W 3ULRB 1TUCA 1X2QA 5ECAA 2HBWA 4OMOA 4J9EA 2KEAA 2FG0A 2DLPA 3TSWA 1T0JA 4ORZA 2KYMA 4RTVA 1GFCA 1Y0MA 4R0KA
chains in the Genus database with same CATH superfamily
1FYNA 1V29B 2RHIA 3M9QA 3V7RA 3NHNA 1ZSZA 3EFOA 2E3IA 1OEBA 4IUUA 2JMAA 2CH4A 3EGDB 1FMWA 5D6YA 2H3JA 1Q86R 4PJJA 5KE3A 1BI0A 3A8HB 1RAEB 3QUIA 1JB0E 2DTIA 5FWCA 1QCNA 3MCAB 4F7UA 1QVPA 2OI3A 4AG2C 1D09B 1N5ZA 2E5QA 3VU3C 2KRNA 2L89A 3WXMB 5EC7A 4M7AC 5C0MA 1VQNT 1S72T 1G2BA 1I0CA 4J5YA 2DXBA 3QWXX 5GANd 1NE8A 3CC4A 4A4FA 2YDLA 1K0SA 4AFQC 2EYQA 1I5LA 4C8QG 4JRKA 5L23A 3L2QA 2RF0A 3NPFA 2RQTA 4IIMA 3R6NA 2ZPFB 4WTOB 4RG2A 1VIFA 1VQPT 2D9TA 4O6JA 3NGPA 1LNXA 1GCQA 1RI0A 2MWOA 3AT1B 1IREB 3CC2A 1QKXA 2PNIA 1HD3A 4J7FA 1ZBXA 3TREA 4NS5A 2EQMA 4X34A 3S3OA 3VS5A 2EGAA 1WHKA 2EBPA 2VB6A 4OGCA 3QZ9B 2DZCA 4C92E 4M77F 1R8OB 2COYA 3FC3A 1WHGA 1LOJA 3JAME 1XNIA 4JUVA 2JTMA 2WACA 4JRIA 4OMNA 1D0ZA 4IUVA 2DL5A 1P92A 2KR3A 4JDSA 1BIAA 2RI3A 2LQKA 4QVZA 1UEBA 2K79A 3JCMJ 3GOXA 2EVRA 3E9GA 4J9HA 4JLIA 4V2SA 3JCMe 2YRDA 3M0TA 1Q86U 4OMFB 2P4TA 3HFNA 1VQ6T 1OX8A 2CZ6B 3SEMA 3RNJA 1KD1R 1KHIA 1VQ8T 2V1RA 3J81E 3S3NA 3VKIA 2DL7A 4C92A 1B7TA 3CCUT 4KBMB 1BKBA 2O4XA 1OX9A 2DYIA 3C4SA 4DEXA 2DIGA 1U5SA 3A5ZB 2PZ1A 2B8AA 4M75G 4KT0E 1IO6A 2KROA 3QSUA 3HFOA 2RQUA 1YBYA 1YNZA 1QWEA 2K5FA 3I56A 4JZ4A 3M59A 2LNHB 2P84A 5L8RE 2M02A 4E7KA 2DMOA 1KQ1A 2D0QB 3H0FA 1SKUB 5CKDA 4C92D 3JCMV 1YJ9A 4QKUA 1X27A 3E2UA 1YI2A 3HRUA 1YJWT 2Y90A 4XQ3A 5CAIA 2XMFA 2A28A 1IHWA 3LGLA 1X75C 4MMLA 4C92G 1YJNQ 1VQ5T 5KH6A 4M78C 5KCOA 1UHFA 1RL2A 2O9SA 4BD3A 2EYXA 4A4GA 1K0XA 4RTZA 4PJNA 3QYHB 2F2WA 2LCLA 3M53A 3HL8A 4PKCC 5GANh 1Y07A 2HMAA 3JCMd 1YIJQ 4J9FA 3JB9J 5KYUA 1UB4A 1VQKA 1Z9ZA 3OYBA 1UHCA 1RI9A 4J9GA 3CD6Q 3RDVA 1WGSA 5KYXA 1Q81U 2I2LA 4M77B 1D0XA 3EH2A 3M0UA 3VRYA 3PMTA 1TOVA 2JXBA 3JCMb 2R57A 1KQSP 3EG2A 1TUDA 3UPUA 3CCVQ 1AD5A 1JRIA 1VYVA 3A8GB 4J6YA 2KRMA 1YCSB 3NMZC 2E4HA 1BU1A 2YUOA 4EMKB 3GIBA 4CC2A 3IQLA 2ZPBB 5AT1B 3OB9A 5GAN2 2F5KA 1ZQ1A 3KUFA 5GAMh 2YHTA 1IZ6A 3OYNA 3RIRA 4XAXB 3VS6A 3THKA 1XTDA 1NYFA 4N4GA 4C8QC 2QQAA 1WHJA 4FSSA 2OAUA 3CBMA 5CK9A 1Q81C 3JB9H 1SF9A 1VQ7Q 2XDBA 3TQ7P 2HCKA 2DX1A 1PM3A 4PJLA 4E7SA 3OW2A 4L5GA 4KH1B 5CO7A 3M56A 3A1PA 2CP5A 4ZGJB 4Z02A 2OTJQ 2LVMA 2F69A 5LJ5g 5KYWB 1QVFS 1EFNA 3TU4K 1UDLA 4RTTA 4ZTJA 2DYBA 3I5SA 3EGXA 2QDLA 4QVCA 2YRVA 2GBQA 2EJFA 1X01A 1IB8A 4BE0A 4OB0B 3QPHA 2DO3A 3EH1A 4FM4B 5HCKA 3LGFA 1BBZA 4JRQA 1D3BA 4GY5A 3WVEB 1QVFP 1IXDA 2CREA 3KBGA 4FW2A 2OTLA 3OYYA 2YUPA 4MZPA 2QYZA 1AHJB 1GCQC 5GAOm 1C6VX 3QKJA 2BE9B 2FZKB 4IUPA 5I2MA 2ESWA 2YUQA 3OYKA 1NJIR 1KC8U 4Z88A 2CYZB 2OAWA 1S72Q 2F5TX 3LLRA 4M75C 1K9MU 4AG1C 5LJ3f 5CKHA 1UUEA 4WF2A 3PIOA 2K2MA 2FZCB 4XTZA 1BK2A 1W6XA 1AWOA 3L1AA 2AZVA 5AYFA 1N8RR 2JS0A 3CC7Q 1QMCA 2BZYA 3DB4A 1VYTA 2R5AA 4L59A 2CZ0B 1V76A 1WJRA 1YITQ 2CP2A 2CSQA 1TXQA 3A8MB 2LQ8A 1TH7A 3RKWA 5FRNA 1U1TA 3CMAQ 1U1SA 2EGEA 3MEAA 4LUDA 2EKOA 4C92C 3RKYA 2HEQA 1HXDA 5KCHA 1YHQQ 3CCJQ 3FIFA 2K9GA 3JB9F 2H8HA 2KXDA 1K9MC 4FYWB 2QDYB 3JCMQ 1W2BA 2CKKA 1PHTA 2DA9A 1RACB 2XHCA 1K73R 5GAN4 3TVTA 5C6SA 1Q82R 2MPXC 4PLIA 2ZPIB 4ELZC 4BI3A 1TUCA 2WSCE 4OMOA 5GANj 1T0JA 2HQXA 1KHCA 2KYMA 3QJYA 1VQ4Q 1GFCA 1Y0MA 2NLUA 5GAOp 6AT1B 4EIKA 1RAIB 2HZYA 2RK2A 1MUZA 1G3YA 4HVVA 1VQ6A 1U3OA 4M78E 3CCUQ 1NJIU 2HAXA 1YJNT 1VQ8A 1H8KA 3O5ZA 5IHIA 3EG9A 2M16A 3META 2PUOB 1YIJT 3ZBDA 4BI4A 4J6XA 3MP6A 3INZA 2BKDN 4RUGA 1C1AA 1N8RU 2LNVA 2RB6A 1M90C 5GMKj 2E10A 2QEXA 4B9XA 3CD6T 4P5NA 5J26A 4BI8B 2J7IA 3RMQA 2FEIA 1VYUA 1BIBA 2HL3A 2P0PA 3EFSA 2DEUA 4M7DE 4DBRA 1G8XA 4M78A 2ZPGB 4KULA 3HRTA 5GAMj 2RJCA 4BE2A 1AOJA 2HL5C 2RI2A 1R0BG 2Z0WA 3F70A 4C0DB 4ZN3A 2J6OA 2EFIA 3G4SQ 1SRLA 2DEQA 3OQ5A 3OS2A 1IGQA 1Y96A 4IURA 2RQWA 2NWMA 3EG0A 4M4ZA 3G71Q 1YJWA 1NG2A 4ZGDB 2ZCFB 2DRKA 3M57A 1D1BA 2MIOA 3G7ZA 2XD0A 2QK0A 4KUDK 2PQWA 2KNBB 2RJFA 3URGA 4F7UF 1JBMA 3FJPA 1K73U 2EQJA 1NZ9A 2D8HA 2DXUA 4II1A 1VQ5A 4FW1A 3GF5A 1Q82U 1JEGA 4ZNXA 3HRSA 1RLQC 5GAN5 5GANe 1G5VA 1OYXA 2DF6A 3PVQA 2E5KA 2KQWA 4HXJA 1NEBA 4E47A 4J9BA 2E1HA 4M78D 5CCAA 4M7DA 1H641 2QA4A 4RTXA 3OS5A 2CSIA 3EAEA 4X1VA 4IUTA 2AK5A 2KYBA 3KXTA 2V1QA 2L8DA 1HSQA 2RHXA 2E6NA 1JXOA 2D8JA 4F16A 3VUZA 3OW2S 4E7HA 1K1ZA 3EGDA 3OYDA 2OTJT 4ELYC 4XU2A 3H41A 4Z8AA 4DQ2A 3CMEA 3HKSA 1MMGA 3SD4A 5IH2A 2PVGB 2EYYA 2VASA 1SEMA 4C8QA 2RPNA 2KXCA 2DZ9A 4FSXA 4M7DD 3OW2P 4CC4B 2O01E 2NUZA 4C0ZA 1MNEA 2LQWA 2EIFA 4FYYB 3VJPA 2LQNA 2W10A 1ZBJA 4JPBW 2X4XA 5GAMe 1B34B 4X9DA 3VS2A 1HK9A 3CCLA 2NUTA 3M55A 4XTVA 4M7DG 8AT1B 3M5AA 1YN8A 1TG0A 1QVGS 4MZMA 2CUBA 2FRYA 2YSQA 3LWHA 2XI9A 3QWYA 4D8DA 2RI5A 2CGHA 2W0ZA 2KRSA 3JCMf 2DD4A 4C8QD 4M75E 1AVZC 1QVFA 2KT8A 3MEWA 3OYEA 3MPUB 3RR6A 3SWNB 3X25B 4ATOA 3CPWS 4B9WA 3MKDA 5FU6B 7AT1B 3PFSA 2FHDA 2KK4A 3CCSA 2MCNA 2DXCA 1QVGP 3EFOB 1I07A 2DVJA 2JS2A 3CC7T 4C0GA 4E7ZA 3CC4Q 4WCIA 1H3HA 4R55A 5FRMA 2LT1A 4BDYA 4PJOB 4N4HA 1MGQA 1QP3A 1YITT 4E7JA 2D6FA 1F1BB 1AEYA 4LD6A 2RQRA 1QKWA 3JRZA 5FU7C 3ZEHA 5DM7R 2DPPB 4VUBA 4F7UB 4A53A 3FDRA 3CMAT 2G3RA 2MOXA 1WHMA 3E19A 4M75A 2DTHA 1RAAB 1YHQT 3CCJT 3OS1A 2K57A 2YLBA 3NTKA 2RNAA 2KI7A 1NLOC 4PJOG 1UGSB 2LDMA 2KGTA 1K76A 3FEOA 1W2BS 4RMOA 2XICA 2RQVA 3OS0A 4F17A 5GAMd 2JMCA 1KK7A 4C0FA 2ABLA 3HP9A 3PTAA 2A08A 2LZ6B 4LDYA 1Q95G 3J80E 4XU0A 4XU3A 4LUEA 1VQ4T 3LYIA 2DL4A 1BI1A 1E7OA 1PC0A 1K8AU 3L2RA 1UGVA 1Q81R 4M75D 1UJYA 1W2BP 2RMOA 1U06A 1D1AA 2VXFA 1Q7YU 1MMDA 2L0AA 2PTKA 3OYHA 2L3SA 4OF1A 2DD5A 2COWA 4A4EA 1PSEA 3OY9A 1B07A 3RKXA 1BI3A 2EAYA 3CCET 2EPDA 4EDUA 4IIOA 2MYSA 9ATCB 2GGRA 1UTIA 3I55A 4Z89A 5GAOq 3SFMA 2RD1A 3PMIA 4M77E 4B6MA 4J83A 2LT4A 2L3PA 2HQEA 5FLXE 3M4GA 4E2FB 1ARKA 2D0NA 1H92A 1M5Q1 4XK8E 2O88A 3MHXA 2JVVA 2CP7A 2FPFA 4Y28E 4HCBA 1ZUUA 1K8AC 5CVIA 2YWWA 5GAN3 2J05A 2O4XB 4F14A 4HCZA 3E1SA 3MP8A 3G4ST 1Q7YC 3QDRB 5LJ5h 1YJ9Q 5J39A 4LXCA 1VQLQ 1M3CA 3V8KA 2E3HA 1YI2Q 3G71T 2RK1A 2F1LA 2E41A 3BW1A 4NL2A 3WVDB 1VQ9Q 2EW3A 2IG0A 1SHGA 2G6FX 2DNUA 4M77A 2KAFA 3CBOA 1M2OA 4RKUE 1IRXA 4JJNK 4C5IA 3M0PA 1OI1A 1LCKA 2JN0A 2JTEA 4LN2A 4ZN1A 4BY6B 4KGVB 1WX6A 1QCFA 3PNWC 4J9CA 2M9UA 4EMKA 3CCRA 2M1HA 3CCMA 3I35A 4CC7A 3BY7A 5GMKi 3CD6A 1N9RA 2A37A 3JSCA 4M7DC 5GAN6 5A0DA 4M77D 4XTYA 3O8VA 2ENMA 2E6ZA 4M7AF 1SSFA 2LC4A 2HKQB 1N27A 3CCVA 4PJMA 2PU9B 1KC8R 5LJ3g 4OVAA 1WYXA 1R77A 3D7SB 1XOVA 2R5MA 4AFZC 4M77G 3DB3A 4XTXA 1K9MR 2QQSA 1TSFA 2QTXA 3G6EA 5IXBA 4KRTA 1GL5A 3PGGA 1OU8A 1OZ3A 5GMKl 2K6DA 5KYWA 4OMPA 2SEMA 3M54A 4RTWA 5D6WA 2VGMA 5ECAA 1VQ7A 2KEAA 3TSWA 4ORZA 5FU6C 3OBYA 4NL3A 2QI2A 2JW4A 3H6ZA 2DK3A 3PIPA 3VS4A 1KFZA 1PRMC 5IAYA 2L2PA 3M0RA 4PJOC 3L2ZA 3CC4T 2DJQA 4A4KA 3Q1JA 1M90R 4BDZA 3EGUA 2AZSA 2MAMA 1YP5A 4LE9A 3C94A 2LP5A 4OP0A 2QASA 1M1GA 1NLPC 1JJ2A 3ER0A 1X6OA 4JJDA 3CC2T 3GBQA 1ZUYA 1QVGA 1XJWB 2JNGA 2GTOA 4HCCA 3LW5E 2LTOA 1I4K1 1M8VA 3HPWA 3CPWA 1OPLA 2GNCA 1MHNA 3N5BB 1PG5B 2CT4A 2FRWA 1Z9QA 1I5OB 3JV3A 4QW2A 3UA6A 4RCBA 2LRQA 2ED1A 2QAZA 4QQDA 3QIIA 1VQNA 3A8OB 3OYFA 1S72A 2P4RA 2V8JA 2IPOB 4RTUA 1OOTA 1M3BA 4PFZA 4AFSC 3VS1A 3H8ZA 2FPEA 3S6WA 2ZAEA 1VQMQ 1G3WA 3LH5A 4M7AB 3VYGA 1VQPA 1VQOQ 5D6XA 2JJ9A 5FROA 4D6WA 5EG2A 2HBPA 2LCCA 1YITA 2J06A 4AT1B 3OMGA 1FWZA 4M78F 4E7IA 4JS4A 5IT9E 1M8MA 4RTYA 3TSZA 2X3WD 1I8FA 3JCMW 4DOWA 3HTRA 5LJ5j 3ZL7C 3BDUA 2FZGB 3QO3A 4CRIA 2QGGA 2JTFA 1JQQA 5KE2A 1M90U 1M2VB 1ZHIA 2ATCB 3SHWA 2ZPHB 4BB7A 4JJCA 1WHHA 2QQ9A 2Y4XA 2ROLA 3M0QA 4ESRA 1QCOA 3CBPA 2JOYA 4PLLA 3BE3A 3P8HA 1RABB 1TUGB 2ZZDA 5FWBA 5GJVB 1FMKA 2FO0A 1YJ9T 1VQLT 1YI2T 2O2OA 2NUPB 1OV3A 4IKFA 1VQ9T 2KSSA 5GANf 5KYYA 4LNPA 1PRLC 3LWIA 3M0SA 4AMCA 4QT7A 3CCUA 2DVEA 8ATCB 3CCEQ 2ZPEB 3X26B 1MMNA 2COZA 2JT4A 2WSFE 3MJXA 5HKCA 1M27C 4OB3B 2RHYA 2L3QA 4J9IA 3L2WA 3PT9A 1BB9A 4M77C 3CPFA 4TVRA 4C8QF 3X20B 1OQKA 2HSEB 1D0YA 1UGPB 1OPKA 2AIRB 1DJ7B 5M9OA 1UE9A 5DLOA 2HSPA 1V1CA 4J7IA 2VYTA 3OYGA 1BYMA 4DEYA 3UF4A 2CP0A 4OB1B 3M4YA 4OMQA 4FYVB 4EMKC 3GLXA 3JCMg 3EG3A 3GP8A 2EGCA 5HK3A 4N4IA 1WJSA 3G4SA 5LJ5e 2PVDB 1M1KC 5GAMf 3OYIA 3FJ5A 3L2UA 2VKNA 3BFMA 2EWNA 4OMMA 2DERA 1W4SA 1Y71A 2P0KA 1UG1A 4BE1A 2M0OA 1AWXA 1MMAA 3JCMX 1YWPA 2E65A 3OSSC 3HSBA 4MZTA 1VIEA 1SHFA 2X4YA 1W1FA 3AHUA 2E64A 1OU9A 4PFPA 2OX7A 2VGNA 3H9NA 3UATA 3UDCA 2P0QA 4ZGEB 2QA4Q 1Y57A 2RH2A 5LJ3d 4MMKA 4E6RA 1KQ2A 2ED0A 3CQTA 1E6HA 3CCQQ 2DJZA 1WI7A 2QQBA 4PJOE 3J7AF 1B34A 4PNOA 2K3XA 3OYCA 4M75F 1AZEA 2K7AA 3DLMA 4J6WA 2K5LA 2LJ1A 2RN8A 2X4JA 3V8JA 3CMEQ 1NBEB 2RHUA 3JB9I 1KG1A 2AHJB 4F7UE 1OULA 5J3BA 1YWOA 3FLGA 3QYGB 2BTTA 1WA7A 1WNLA 3JB9G 2YRCA 3RMSA 1VUBA 3VS3A 1J3TA 4HT8A 4DBFA 1JJ2S 1K8AR 1K9AA 2I0NA 3QXEB 2X9HA 2A36A 2C0OA 2DFUA 1TS9A 5LJ5d 3CCLQ 2DILA 3QDFA 4HVUA 3QHSA 2OTLT 3C0CA 1KIKA 1Q7YR 2QG9B 3OA6A 3PE0A 2JM8A 5CQYA 1UGRB 1RUWA 5FW9A 4PJOA 1NPPA 4C92F 2FL7A 2J6KA 1X69A 2DRMA 1ZSGA 4KH0B 4C8QB 3VS0A 1NM7A 2EYZA 2XDPA 1JJ2P 1NYGA 4A63B 1ZSZB 3DLLA 1EIFA 2LMJA 4PL6A 1O9SA 2HNIA 2OJ2A 2GQIA 2PUKB 5GMKm 3CCSQ 1RLPC 2NUTB 1GBRA 4OMLA 1VQMT 1QQJA 1GXIE 3CPWP 3C95A 4XTWA 3MEUA 2MWPA 3V7CA 1VQOT 3CC2Q 2AKKA 3I9QA 3NTHA 3EFRA 4UC4A 4PJOD 1FX7A 2DETA 4OGEA 1QP2A 2KVQG 2VV5A 4CC3A 2GFAA 3PVLA 2V26A 4LDUA 2V8KA 1G83A 1MV3A 4EMHA 2GFUA 1UECA 3MEVA 4BUGA 2KMTA 2CP6A 4F7UG 2E12A 1SPKA 1YFNA 5CQXA 3C12A 1X2KA 2MI6A 2HDAA 2M0YA 4DA4A 3CXCS 4D8KA 1LVKA 2DE0X 3UT1A 2JUFA 4M75B 3VYHB 5LJ3h 1PNJA 4HA8A 3JCMP 1WLPB 2YXYA 1I81A 2YLCA 4KGXB 4EPCA 1M1FA 3VV0A 3ULRB 2RJEA 3GNGA 3QZ5B 2RO0A 1X2QA 2CZ7B 2K3YA 4J9EA 3CXCP 2FG0A 2DLPA 4RTVA 4FL6A 3X24B 4FIBA 3I55Q 1RADB 3S3MA 1EZZB 2X3XD 2QEXT 4C0DC 1B3QA 3I56Q 4A54A 2ECZA 1GRIA 1GFDA 4C92B 5A0LA 4L6V5 2YUNA 1Q86C 2HD0A 1QW1A 3GPLA 3FRNA 1VOMA 4JJBA 3DKMA 1W70A 2IVWA 1VQLA 2VXEA 1SRMA 4K11A 2XIDA 2CS7A 2GQVA 1ABQA 1YJNA 1VQ9A 4ME7A 4C5GA 2JM9A 1TTHB 2LX9A 1JU5C 1PKSA 4HVWA 5I22A 2HQHA 4R56A 1YIJA 4N0AC 1A0NB 2DIQA 2DTOA 1VQKQ 2L5QA 3I5RA 2CT3A 2A7YA 1WXTA 1CKBA 2QA4T 2IIMA 1M30A 4LD9K 3RERA 5CIUA 3CCRQ 3CCMQ 1KQSS 1Y7XA 1KJWA 4Q5WA 3VRZA 4XTUA 5I2SA 1KD1U 2BIVA 3SB2A 2O31A 4J8OA 5LL6S 3CCQT 3RESA 2GF7A 4JRPA 2NYSA 4RCCA 2RJDA 3NTIA 1SSHA 2F2XA 5KYUB 3CMET 1G3SA 1PKTA 2EYWA 2XDDA 3OYJA 2XKOC 5GMKh 1ZUKA 1BCMA 2RHZA 2Y4YA 5KYXB 2MK5A 4FCYA 2DBKA 2KT1A 4JLGA 5GAOr 1EX4A 5A0GA 3CEYA 3G6EQ 3KFVA 4XU1A 1FMVA 2EJGA 5A2QE 2LX7A 3CCLT 4CI0C 2K2VA 2VVKA 1KD1C 2AT1B 3SWNC 2V8IA 1AWJA 2RA2A 2K5IA 3ASKA 3T9NA 5I11A 5CKEA 5GJWB 2BUDA 1ZSZC 1PD1A 5I21A 2DBMA 4DBHA 1WFWA 3FB9A 1IHVA 2OTJA 1PCXA 2H3EB 2SRCA 2KE9A 4E7LA 3QG1A 5DLQE 4M7AE 3OMCA 2ROTA 1AWWA 4YTLA 3UWNA 1BCOA 3CCST 4PFOA 3JCMc 3E9FA 4LDVA 2D1XA 5HY6A 3ME9A 4Y92A 4DOVA 4KGZB 4FT4A 4GBQA 4LDXA 2CDTA 1AT1B 4FT2A 5GANg 2OTLQ 2YT6A 2EQIA 2EQUA 4DBQA 3UA7A 4A4HA 2X4WA 2AKLA 4HKEA 2KBTA 2XK0A 2A3LA 3A8LB 3EGXB 4M7AA 3VS7A 3L42A 1M1KR 1PD0A 5LJ3j 3L2VA 1CSKA 3GNFB 4JS5A 5DY9A 1NEGA 2A0FB 2QGFB 5GAOn 2DL3A 1UFFA 2JZ2A 1M4ZA 2X51A 3EG1A 5HK0A 3REBB 1D3BB 3JCMh 1VQNQ 2QXFA 3CC7A 4C5EA 5GAN8 1LPLA 1CKAA 3H0HA 2VC8A 2BE7D 5IN1A 1K4US 2EQKA 1M2VA 3OBWA 3NFCA 5GAN7 2MF2A 1VQMA 4MDXA 1JO8A 1WDXA 2E70A 3U23A 1ZA2B 3V8LA 1VQPQ 3OYLA 1VQOA 1QWFA 5D7UA 4M7AD 2XU8A 5GAMg 1AZGB 3CMAA 2BZXA 1XQHA 1ABOA 1NPRA 2C0IA 2LJ3A 4C5HA 5CKFA 1YHQA 3I55T 3CCJA 4O5VA 1WQWA 1RAGB 1WPYA 2NUPA 4M7AG 4J9DA 1KC8C 4MDWA 4NOYA 5FU7B 5KYNA 3LH0A 4HCKA 4FYXB 4QQGA 4QQ6A 4JZ3A 2X35A 4ANJA 3I56T 5CR2A 3P8BB 2VUBA 2C06A 3EHQA 4X9CA 5LJ5f 2CZ1B 4RG8A 3R6OA 3BDLA 3CXCA 1N9SA 1VQ4A 4M7DF 1OZ2A 2GCXA 3G1JA 1TWBA 1X6BA 1HJDA 2KY9A 1U8RA 2DKGA 1VQ6Q 1RAFB 4ZTFA 2B86A 4OB2B 3RBBB 1MV0B 2R58A 1M1KU 1VQ8Q 5LJ3e 2QTVA 4BY6C 4HT9A 4GLMA 2M51A 5CKBA 3RUXA 2KDSA 3M58A 1WIEA 3CCEA 1O75A 1TU0B 1T3SA 2DM1A 1VA7A 2DXTA 3P8DA 2CP3A 5IHKA 1LJOA 4PK4A 5IHNA 1ZLMA 1WXUA 1RAHB 5IXFA 1R0CB 1VQKT 1M9SA 4QVDA 2BZ8A 2WSEE 4Y91A 2QEXQ 1G3TA 2K4YA 1WZOA 3HHTB 1ZA1B 2DL8A 3CCRT 1T0HA 4AFUC 3CCMT 3VUBA 2QQRA 2GTJA 3OSVA 1M3AA 1C0MA 2DAQA 3QBYA 1D1CA 1E6GA 1WXBA 1ZX6A 5KYYB 1SG5A 2LJ0A 3H0IA 3SDZA 3EHRA 4EMGA 1S1NA 3EG9B 2J6FA 4KUIA 2LCSA 4N0AA 1KSWA 3REAB 2FB7A 3G71A 1YJWQ 1HYOA 4PJOF 3CCVT 1GBQA 3A98A 4GLKA 1NJIC 1WQ7A 2FYKA 1ACMB 1FXXA 2EKHA 1WJQA 1VQ5Q 2CUDA 3OYMA 3QJ6A 3G6ET 4LDWA 1X6GA 1PWTA 4M78B 2FPDA 1GCPA 1UJ0A 1T3LA 3LX7A 1N8RC 1KQSA 1QLYA 4C8QE 4BACA 1Y96B 2EJ9A 3TEEA 2HKNA 1I1JA 1YCYA 1JXMA 1X43A 1PSFA 4F04B 2RM4A 2L3RA 1WHLA 3X28B 1IGUA 1VQ7T 2ZGWA 2FVUA 2C0TA 3V7SA 2O9VA 1BI2A 2K3BA 3JB9D 2F2VA 4FU6A 3CCQA 1MNDA 2MMPA 2VWFA 4M78G 3MO8A 5GAOl 2PVOB 1H3ZA 4M7DB 2CH4W 1UGQB 3TCJA 2HBWA 1N6AA 1K73C 3MP1A 5GMKe 3OYAA 3SWNA 2XG8D 3ZFJA 4R0KA 1Q82C 4IUQA
chains in the Genus database with same CATH topology
1FYNA 2JW4A 3NHNA 4EIKA 1OEBA 2JMAA 1MUZA 2CH4A 4HVVA 1U3OA 2X3XD 3VS4A 1KFZA 1PRMC 2L2PA 1B3QA 3M0RA 2ECZA 1H8KA 1GRIA 3O5ZA 1GFDA 2DJQA 5IHIA 2YUNA 3EGUA 2AZSA 5FWCA 1YP5A 4LE9A 2LP5A 4JJBA 2OI3A 4AG2C 1N5ZA 4RUGA 1W70A 1NLPC 2KRNA 4JJDA 1SRMA 4K11A 3GBQA 1ZUYA 5EC7A 2GTOA 1ABQA 1G2BA 1I0CA 2J7IA 3QWXX 2FEIA 1VYUA 2YDLA 2JM9A 4HVWA 1JU5C 1PKSA 5I22A 1K0SA 4AFQC 1AOJA 1OPLA 1A0NB 5L23A 2GNCA 2RF0A 2CT4A 2FRWA 2RQTA 3NPFA 1Z9QA 2J6OA 3JV3A 4IIMA 3R6NA 1SRLA 3UA6A 3NGPA 1GCQA 1QKXA 2RQWA 2ED1A 2PNIA 2NWMA 1HD3A 3EG0A 2CT3A 3I5RA 4M4ZA 1WXTA 1NG2A 1CKBA 2DRKA 2IIMA 1M30A 2P4RA 3VS5A 2MIOA 4RTUA 1OOTA 2EGAA 1KJWA 2KNBB 1M3BA 3VRZA 2EBPA 4AFSC 2D8HA 2O31A 3VS1A 2FPEA 1JEGA 4ZNXA 1RLQC 3LH5A 2DF6A 1SSHA 2F2XA 3PVQA 2E5KA 4HXJA 1NEBA 4OMNA 4J9BA 2J06A 2DL5A 2KR3A 4RTXA 1PKTA 2EYWA 2CSIA 1M8MA 4RTYA 4X1VA 2K79A 1ZUKA 3TSZA 2X3WD 2EVRA 4J9HA 2AK5A 2KYBA 2V1QA 1HSQA 2DBKA 3M0TA 2KT1A 3ZL7C 1JXOA 2D8JA 4F16A 3KFVA 3SEMA 1JQQA 3RNJA 1K1ZA 3H41A 2LX7A 4Z8AA 3SHWA 2V1RA 2DL7A 4JJCA 5IH2A 3M0QA 2ROLA 2VVKA 2EYYA 4ESRA 1SEMA 2RPNA 4DEXA 2KXCA 1AWJA 5I11A 1U5SA 5GJWB 5FWBA 5GJVB 2PZ1A 2DBMA 4CC4B 1FMKA 2FO0A 2NUZA 1WFWA 2LQWA 1IO6A 2KROA 2O2OA 2LQNA 2W10A 1ZBJA 2SRCA 4JPBW 1OV3A 2KE9A 2RQUA 4LNPA 1PRLC 3M0SA 3VS2A 2ROTA 1AWWA 1YNZA 4QT7A 1QWEA 1YN8A 4JZ4A 1TG0A 2D1XA 2LNHB 2JT4A 4Y92A 1M27C 2CUBA 2FRYA 2YSQA 2DMOA 3QWYA 4D8DA 3H0FA 2W0ZA 2L3QA 4J9IA 2KRSA 4GBQA 1X27A 1BB9A 1AVZC 2CDTA 2A28A 2KT8A 2XMFA 1OPKA 1UE9A 2YT6A 2MCNA 2HSPA 2EQIA 1V1CA 1I07A 2DVJA 3UA7A 1UHFA 2JS2A 4DEYA 2AKLA 3UF4A 2KBTA 2O9SA 2EYXA 1H3HA 4WCIA 1K0XA 4RTZA 2F2WA 4OMQA 3EG3A 3VS7A 2EGCA 1CSKA 4J9FA 1NEGA 1AEYA 2DL3A 1UFFA 3EG1A 3REBB 2RQRA 1Z9ZA 1QKWA 1UHCA 1RI9A 4J9GA 3FJ5A 2VKNA 2MOXA 4OMMA 1UG1A 1CKAA 3H0HA 3M0UA 3VRYA 1AWXA 1YWPA 2JXBA 1K4US 2RNAA 1SHFA 1NLOC 1W1FA 3EG2A 1TUDA 1JO8A 1WDXA 3U23A 2KGTA 1K76A 1AD5A 1VYVA 1QWFA 2KRMA 1YCSB 2RQVA 3NMZC 4F17A 3UATA 1AZGB 2JMCA 1BU1A 2ABLA 2YUOA 2A08A 4CC2A 2LZ6B 1Y57A 2BZXA 3IQLA 4LUEA 2DL4A 1ABOA 2C0IA 2LJ3A 4E6RA 1E7OA 2ED0A 3CQTA 1UGVA 1E6HA 4J9DA 1WI7A 1UJYA 3VS6A 2RMOA 3THKA 1U06A 4HCKA 1NYFA 1AZEA 2K7AA 4JZ3A 2L0AA 2PTKA 2L3SA 2LJ1A 2RN8A 3EHQA 4FSSA 1B07A 2EPDA 1YWOA 2HCKA 4IIOA 2DX1A 2BTTA 1X6BA 2GGRA 1UTIA 1WA7A 4Z89A 1HJDA 2L3PA 1ARKA 3VS3A 2D0NA 2B86A 3RBBB 1J3TA 1MV0B 1K9AA 2I0NA 1H92A 2A36A 2C0OA 2O88A 4GLMA 2M51A 2FPFA 2DILA 4HVUA 1EFNA 1KIKA 3C0CA 1UDLA 1WIEA 1ZUUA 2JM8A 3PE0A 4RTTA 1RUWA 5FW9A 2DYBA 3I5SA 1T3SA 2DM1A 1VA7A 2QDLA 2GBQA 2J6KA 5IHKA 2J05A 5IHNA 4F14A 1ZLMA 1X69A 1WXUA 2DRMA 5IXFA 1ZSGA 3VS0A 1NM7A 2EYZA 1M3CA 5HCKA 1NYGA 2BZ8A 4A63B 1BBZA 2DL8A 2CREA 2LMJA 1T0HA 4AFUC 2EW3A 2GTJA 1SHGA 2OJ2A 1M3AA 2G6FX 2GQIA 2DNUA 2YUPA 1GCQC 1RLPC 1E6GA 1WXBA 1ZX6A 2LJ0A 3H0IA 1GBRA 4OMLA 3EHRA 3M0PA 2ESWA 1S1NA 2YUQA 1LCKA 2J6FA 2JTEA 4LN2A 2LCSA 4Z88A 2AKKA 3I9QA 2OAWA 1KSWA 3REAB 1WX6A 1GBQA 1QCFA 3A98A 4J9CA 3I35A 4CC7A 4AG1C 1UUEA 4CC3A 2A37A 2K2MA 2EKHA 1BK2A 2CUDA 1W6XA 1AWOA 3PVLA 2AZVA 2JS0A 2BZYA 1X6GA 1PWTA 1VYTA 2FPDA 1GCPA 1G83A 1UJ0A 1T3LA 1MV3A 1UECA 2ENMA 1QLYA 2CSQA 1I1JA 1JXMA 1SPKA 1X43A 1WYXA 1XOVA 2EGEA 4AFZC 4LUDA 1X2KA 2C0TA 2HDAA 2O9VA 2M0YA 5IXBA 4KRTA 2HEQA 2K3BA 4D8KA 1GL5A 2DE0X 2K9GA 2F2VA 2H8HA 2KXDA 1PNJA 1PHTA 2VWFA 2DA9A 2K6DA 4OMPA 2SEMA 1WLPB 3TVTA 4RTWA 2CH4W 3ULRB 1TUCA 1X2QA 5ECAA 2HBWA 4OMOA 4J9EA 2KEAA 2FG0A 2DLPA 3TSWA 1T0JA 4ORZA 2KYMA 4RTVA 1GFCA 1Y0MA 4R0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYN A;  2JW4 A;  3NHN A;  4EIK A;  1OEB A;  2JMA A;  1MUZ A;  2CH4 A;  4HVV A;  1U3O A;  2X3X D;  3VS4 A;  1KFZ A;  1PRM C;  2L2P A;  1B3Q A;  3M0R A;  2ECZ A;  1H8K A;  1GRI A;  3O5Z A;  1GFD A;  2DJQ A;  5IHI A;  2YUN A;  3EGU A;  2AZS A;  5FWC A;  1YP5 A;  4LE9 A;  2LP5 A;  4JJB A;  2OI3 A;  4AG2 C;  1N5Z A;  4RUG A;  1W70 A;  1NLP C;  2KRN A;  4JJD A;  1SRM A;  4K11 A;  3GBQ A;  1ZUY A;  5EC7 A;  2GTO A;  1ABQ A;  1G2B A;  1I0C A;  2J7I A;  3QWX X;  2FEI A;  1VYU A;  2YDL A;  2JM9 A;  4HVW A;  1JU5 C;  1PKS A;  5I22 A;  1K0S A;  4AFQ C;  1AOJ A;  1OPL A;  1A0N B;  5L23 A;  2GNC A;  2RF0 A;  2CT4 A;  2FRW A;  2RQT A;  3NPF A;  1Z9Q A;  2J6O A;  3JV3 A;  4IIM A;  3R6N A;  1SRL A;  3UA6 A;  3NGP A;  1GCQ A;  1QKX A;  2RQW A;  2ED1 A;  2PNI A;  2NWM A;  1HD3 A;  3EG0 A;  2CT3 A;  3I5R A;  4M4Z A;  1WXT A;  1NG2 A;  1CKB A;  2DRK A;  2IIM A;  1M30 A;  2P4R A;  3VS5 A;  2MIO A;  4RTU A;  1OOT A;  2EGA A;  1KJW A;  2KNB B;  1M3B A;  3VRZ A;  2EBP A;  4AFS C;  2D8H A;  2O31 A;  3VS1 A;  2FPE A;  1JEG A;  4ZNX A;  1RLQ C;  3LH5 A;  2DF6 A;  1SSH A;  2F2X A;  3PVQ A;  2E5K A;  4HXJ A;  1NEB A;  4OMN A;  4J9B A;  2J06 A;  2DL5 A;  2KR3 A;  4RTX A;  1PKT A;  2EYW A;  2CSI A;  1M8M A;  4RTY A;  4X1V A;  2K79 A;  1ZUK A;  3TSZ A;  2X3W D;  2EVR A;  4J9H A;  2AK5 A;  2KYB A;  2V1Q A;  1HSQ A;  2DBK A;  3M0T A;  2KT1 A;  3ZL7 C;  1JXO A;  2D8J A;  4F16 A;  3KFV A;  3SEM A;  1JQQ A;  3RNJ A;  1K1Z A;  3H41 A;  2LX7 A;  4Z8A A;  3SHW A;  2V1R A;  2DL7 A;  4JJC A;  5IH2 A;  3M0Q A;  2ROL A;  2VVK A;  2EYY A;  4ESR A;  1SEM A;  2RPN A;  4DEX A;  2KXC A;  1AWJ A;  5I11 A;  1U5S A;  5GJW B;  5FWB A;  5GJV B;  2PZ1 A;  2DBM A;  4CC4 B;  1FMK A;  2FO0 A;  2NUZ A;  1WFW A;  2LQW A;  1IO6 A;  2KRO A;  2O2O A;  2LQN A;  2W10 A;  1ZBJ A;  2SRC A;  4JPB W;  1OV3 A;  2KE9 A;  2RQU A;  4LNP A;  1PRL C;  3M0S A;  3VS2 A;  2ROT A;  1AWW A;  1YNZ A;  4QT7 A;  1QWE A;  1YN8 A;  4JZ4 A;  1TG0 A;  2D1X A;  2LNH B;  2JT4 A;  4Y92 A;  1M27 C;  2CUB A;  2FRY A;  2YSQ A;  2DMO A;  3QWY A;  4D8D A;  3H0F A;  2W0Z A;  2L3Q A;  4J9I A;  2KRS A;  4GBQ A;  1X27 A;  1BB9 A;  1AVZ C;  2CDT A;  2A28 A;  2KT8 A;  2XMF A;  1OPK A;  1UE9 A;  2YT6 A;  2MCN A;  2HSP A;  2EQI A;  1V1C A;  1I07 A;  2DVJ A;  3UA7 A;  1UHF A;  2JS2 A;  4DEY A;  2AKL A;  3UF4 A;  2KBT A;  2O9S A;  2EYX A;  1H3H A;  4WCI A;  1K0X A;  4RTZ A;  2F2W A;  4OMQ A;  3EG3 A;  3VS7 A;  2EGC A;  1CSK A;  4J9F A;  1NEG A;  1AEY A;  2DL3 A;  1UFF A;  3EG1 A;  3REB B;  2RQR A;  1Z9Z A;  1QKW A;  1UHC A;  1RI9 A;  4J9G A;  3FJ5 A;  2VKN A;  2MOX A;  4OMM A;  1UG1 A;  1CKA A;  3H0H A;  3M0U A;  3VRY A;  1AWX A;  1YWP A;  2JXB A;  1K4U S;  2RNA A;  1SHF A;  1NLO C;  1W1F A;  3EG2 A;  1TUD A;  1JO8 A;  1WDX A;  3U23 A;  2KGT A;  1K76 A;  1AD5 A;  1VYV A;  1QWF A;  2KRM A;  1YCS B;  2RQV A;  3NMZ C;  4F17 A;  3UAT A;  1AZG B;  2JMC A;  1BU1 A;  2ABL A;  2YUO A;  2A08 A;  4CC2 A;  2LZ6 B;  1Y57 A;  2BZX A;  3IQL A;  4LUE A;  2DL4 A;  1ABO A;  2C0I A;  2LJ3 A;  4E6R A;  1E7O A;  2ED0 A;  3CQT A;  1UGV A;  1E6H A;  4J9D A;  1WI7 A;  1UJY A;  3VS6 A;  2RMO A;  3THK A;  1U06 A;  4HCK A;  1NYF A;  1AZE A;  2K7A A;  4JZ3 A;  2L0A A;  2PTK A;  2L3S A;  2LJ1 A;  2RN8 A;  3EHQ A;  4FSS A;  1B07 A;  2EPD A;  1YWO A;  2HCK A;  4IIO A;  2DX1 A;  2BTT A;  1X6B A;  2GGR A;  1UTI A;  1WA7 A;  4Z89 A;  1HJD A;  2L3P A;  1ARK A;  3VS3 A;  2D0N A;  2B86 A;  3RBB B;  1J3T A;  1MV0 B;  1K9A A;  2I0N A;  1H92 A;  2A36 A;  2C0O A;  2O88 A;  4GLM A;  2M51 A;  2FPF A;  2DIL A;  4HVU A;  1EFN A;  1KIK A;  3C0C A;  1UDL A;  1WIE A;  1ZUU A;  2JM8 A;  3PE0 A;  4RTT A;  1RUW A;  5FW9 A;  2DYB A;  3I5S A;  1T3S A;  2DM1 A;  1VA7 A;  2QDL A;  2GBQ A;  2J6K A;  5IHK A;  2J05 A;  5IHN A;  4F14 A;  1ZLM A;  1X69 A;  1WXU A;  2DRM A;  5IXF A;  1ZSG A;  3VS0 A;  1NM7 A;  2EYZ A;  1M3C A;  5HCK A;  1NYG A;  2BZ8 A;  4A63 B;  1BBZ A;  2DL8 A;  2CRE A;  2LMJ A;  1T0H A;  4AFU C;  2EW3 A;  2GTJ A;  1SHG A;  2OJ2 A;  1M3A A;  2G6F X;  2GQI A;  2DNU A;  2YUP A;  1GCQ C;  1RLP C;  1E6G A;  1WXB A;  1ZX6 A;  2LJ0 A;  3H0I A;  1GBR A;  4OML A;  3EHR A;  3M0P A;  2ESW A;  1S1N A;  2YUQ A;  1LCK A;  2J6F A;  2JTE A;  4LN2 A;  2LCS A;  4Z88 A;  2AKK A;  3I9Q A;  2OAW A;  1KSW A;  3REA B;  1WX6 A;  1GBQ A;  1QCF A;  3A98 A;  4J9C A;  3I35 A;  4CC7 A;  4AG1 C;  1UUE A;  4CC3 A;  2A37 A;  2K2M A;  2EKH A;  1BK2 A;  2CUD A;  1W6X A;  1AWO A;  3PVL A;  2AZV A;  2JS0 A;  2BZY A;  1X6G A;  1PWT A;  1VYT A;  2FPD A;  1GCP A;  1G83 A;  1UJ0 A;  1T3L A;  1MV3 A;  1UEC A;  2ENM A;  1QLY A;  2CSQ A;  1I1J A;  1JXM A;  1SPK A;  1X43 A;  1WYX A;  1XOV A;  2EGE A;  4AFZ C;  4LUD A;  1X2K A;  2C0T A;  2HDA A;  2O9V A;  2M0Y A;  5IXB A;  4KRT A;  2HEQ A;  2K3B A;  4D8K A;  1GL5 A;  2DE0 X;  2K9G A;  2F2V A;  2H8H A;  2KXD A;  1PNJ A;  1PHT A;  2VWF A;  2DA9 A;  2K6D A;  4OMP A;  2SEM A;  1WLP B;  3TVT A;  4RTW A;  2CH4 W;  3ULR B;  1TUC A;  1X2Q A;  5ECA A;  2HBW A;  4OMO A;  4J9E A;  2KEA A;  2FG0 A;  2DLP A;  3TSW A;  1T0J A;  4ORZ A;  2KYM A;  4RTV A;  1GFC A;  1Y0M A;  4R0K A; 
#chains in the Genus database with same CATH topology
 1FYN A;  1V29 B;  2RHI A;  3M9Q A;  3V7R A;  3NHN A;  1ZSZ A;  3EFO A;  2E3I A;  1OEB A;  4IUU A;  2JMA A;  2CH4 A;  3EGD B;  1FMW A;  5D6Y A;  2H3J A;  1Q86 R;  4PJJ A;  5KE3 A;  1BI0 A;  3A8H B;  1RAE B;  3QUI A;  1JB0 E;  2DTI A;  5FWC A;  1QCN A;  3MCA B;  4F7U A;  1QVP A;  2OI3 A;  4AG2 C;  1D09 B;  1N5Z A;  2E5Q A;  3VU3 C;  2KRN A;  2L89 A;  3WXM B;  5EC7 A;  4M7A C;  5C0M A;  1VQN T;  1S72 T;  1G2B A;  1I0C A;  4J5Y A;  2DXB A;  3QWX X;  5GAN d;  1NE8 A;  3CC4 A;  4A4F A;  2YDL A;  1K0S A;  4AFQ C;  2EYQ A;  1I5L A;  4C8Q G;  4JRK A;  5L23 A;  3L2Q A;  2RF0 A;  3NPF A;  2RQT A;  4IIM A;  3R6N A;  2ZPF B;  4WTO B;  4RG2 A;  1VIF A;  1VQP T;  2D9T A;  4O6J A;  3NGP A;  1LNX A;  1GCQ A;  1RI0 A;  2MWO A;  3AT1 B;  1IRE B;  3CC2 A;  1QKX A;  2PNI A;  1HD3 A;  4J7F A;  1ZBX A;  3TRE A;  4NS5 A;  2EQM A;  4X34 A;  3S3O A;  3VS5 A;  2EGA A;  1WHK A;  2EBP A;  2VB6 A;  4OGC A;  3QZ9 B;  2DZC A;  4C92 E;  4M77 F;  1R8O B;  2COY A;  3FC3 A;  1WHG A;  1LOJ A;  3JAM E;  1XNI A;  4JUV A;  2JTM A;  2WAC A;  4JRI A;  4OMN A;  1D0Z A;  4IUV A;  2DL5 A;  1P92 A;  2KR3 A;  4JDS A;  1BIA A;  2RI3 A;  2LQK A;  4QVZ A;  1UEB A;  2K79 A;  3JCM J;  3GOX A;  2EVR A;  3E9G A;  4J9H A;  4JLI A;  4V2S A;  3JCM e;  2YRD A;  3M0T A;  1Q86 U;  4OMF B;  2P4T A;  3HFN A;  1VQ6 T;  1OX8 A;  2CZ6 B;  3SEM A;  3RNJ A;  1KD1 R;  1KHI A;  1VQ8 T;  2V1R A;  3J81 E;  3S3N A;  3VKI A;  2DL7 A;  4C92 A;  1B7T A;  3CCU T;  4KBM B;  1BKB A;  2O4X A;  1OX9 A;  2DYI A;  3C4S A;  4DEX A;  2DIG A;  1U5S A;  3A5Z B;  2PZ1 A;  2B8A A;  4M75 G;  4KT0 E;  1IO6 A;  2KRO A;  3QSU A;  3HFO A;  2RQU A;  1YBY A;  1YNZ A;  1QWE A;  2K5F A;  3I56 A;  4JZ4 A;  3M59 A;  2LNH B;  2P84 A;  5L8R E;  2M02 A;  4E7K A;  2DMO A;  1KQ1 A;  2D0Q B;  3H0F A;  1SKU B;  5CKD A;  4C92 D;  3JCM V;  1YJ9 A;  4QKU A;  1X27 A;  3E2U A;  1YI2 A;  3HRU A;  1YJW T;  2Y90 A;  4XQ3 A;  5CAI A;  2XMF A;  2A28 A;  1IHW A;  3LGL A;  1X75 C;  4MML A;  4C92 G;  1YJN Q;  1VQ5 T;  5KH6 A;  4M78 C;  5KCO A;  1UHF A;  1RL2 A;  2O9S A;  4BD3 A;  2EYX A;  4A4G A;  1K0X A;  4RTZ A;  4PJN A;  3QYH B;  2F2W A;  2LCL A;  3M53 A;  3HL8 A;  4PKC C;  5GAN h;  1Y07 A;  2HMA A;  3JCM d;  1YIJ Q;  4J9F A;  3JB9 J;  5KYU A;  1UB4 A;  1VQK A;  1Z9Z A;  3OYB A;  1UHC A;  1RI9 A;  4J9G A;  3CD6 Q;  3RDV A;  1WGS A;  5KYX A;  1Q81 U;  2I2L A;  4M77 B;  1D0X A;  3EH2 A;  3M0U A;  3VRY A;  3PMT A;  1TOV A;  2JXB A;  3JCM b;  2R57 A;  1KQS P;  3EG2 A;  1TUD A;  3UPU A;  3CCV Q;  1AD5 A;  1JRI A;  1VYV A;  3A8G B;  4J6Y A;  2KRM A;  1YCS B;  3NMZ C;  2E4H A;  1BU1 A;  2YUO A;  4EMK B;  3GIB A;  4CC2 A;  3IQL A;  2ZPB B;  5AT1 B;  3OB9 A;  5GAN 2;  2F5K A;  1ZQ1 A;  3KUF A;  5GAM h;  2YHT A;  1IZ6 A;  3OYN A;  3RIR A;  4XAX B;  3VS6 A;  3THK A;  1XTD A;  1NYF A;  4N4G A;  4C8Q C;  2QQA A;  1WHJ A;  4FSS A;  2OAU A;  3CBM A;  5CK9 A;  1Q81 C;  3JB9 H;  1SF9 A;  1VQ7 Q;  2XDB A;  3TQ7 P;  2HCK A;  2DX1 A;  1PM3 A;  4PJL A;  4E7S A;  3OW2 A;  4L5G A;  4KH1 B;  5CO7 A;  3M56 A;  3A1P A;  2CP5 A;  4ZGJ B;  4Z02 A;  2OTJ Q;  2LVM A;  2F69 A;  5LJ5 g;  5KYW B;  1QVF S;  1EFN A;  3TU4 K;  1UDL A;  4RTT A;  4ZTJ A;  2DYB A;  3I5S A;  3EGX A;  2QDL A;  4QVC A;  2YRV A;  2GBQ A;  2EJF A;  1X01 A;  1IB8 A;  4BE0 A;  4OB0 B;  3QPH A;  2DO3 A;  3EH1 A;  4FM4 B;  5HCK A;  3LGF A;  1BBZ A;  4JRQ A;  1D3B A;  4GY5 A;  3WVE B;  1QVF P;  1IXD A;  2CRE A;  3KBG A;  4FW2 A;  2OTL A;  3OYY A;  2YUP A;  4MZP A;  2QYZ A;  1AHJ B;  1GCQ C;  5GAO m;  1C6V X;  3QKJ A;  2BE9 B;  2FZK B;  4IUP A;  5I2M A;  2ESW A;  2YUQ A;  3OYK A;  1NJI R;  1KC8 U;  4Z88 A;  2CYZ B;  2OAW A;  1S72 Q;  2F5T X;  3LLR A;  4M75 C;  1K9M U;  4AG1 C;  5LJ3 f;  5CKH A;  1UUE A;  4WF2 A;  3PIO A;  2K2M A;  2FZC B;  4XTZ A;  1BK2 A;  1W6X A;  1AWO A;  3L1A A;  2AZV A;  5AYF A;  1N8R R;  2JS0 A;  3CC7 Q;  1QMC A;  2BZY A;  3DB4 A;  1VYT A;  2R5A A;  4L59 A;  2CZ0 B;  1V76 A;  1WJR A;  1YIT Q;  2CP2 A;  2CSQ A;  1TXQ A;  3A8M B;  2LQ8 A;  1TH7 A;  3RKW A;  5FRN A;  1U1T A;  3CMA Q;  1U1S A;  2EGE A;  3MEA A;  4LUD A;  2EKO A;  4C92 C;  3RKY A;  2HEQ A;  1HXD A;  5KCH A;  1YHQ Q;  3CCJ Q;  3FIF A;  2K9G A;  3JB9 F;  2H8H A;  2KXD A;  1K9M C;  4FYW B;  2QDY B;  3JCM Q;  1W2B A;  2CKK A;  1PHT A;  2DA9 A;  1RAC B;  2XHC A;  1K73 R;  5GAN 4;  3TVT A;  5C6S A;  1Q82 R;  2MPX C;  4PLI A;  2ZPI B;  4ELZ C;  4BI3 A;  1TUC A;  2WSC E;  4OMO A;  5GAN j;  1T0J A;  2HQX A;  1KHC A;  2KYM A;  3QJY A;  1VQ4 Q;  1GFC A;  1Y0M A;  2NLU A;  5GAO p;  6AT1 B;  4EIK A;  1RAI B;  2HZY A;  2RK2 A;  1MUZ A;  1G3Y A;  4HVV A;  1VQ6 A;  1U3O A;  4M78 E;  3CCU Q;  1NJI U;  2HAX A;  1YJN T;  1VQ8 A;  1H8K A;  3O5Z A;  5IHI A;  3EG9 A;  2M16 A;  3MET A;  2PUO B;  1YIJ T;  3ZBD A;  4BI4 A;  4J6X A;  3MP6 A;  3INZ A;  2BKD N;  4RUG A;  1C1A A;  1N8R U;  2LNV A;  2RB6 A;  1M90 C;  5GMK j;  2E10 A;  2QEX A;  4B9X A;  3CD6 T;  4P5N A;  5J26 A;  4BI8 B;  2J7I A;  3RMQ A;  2FEI A;  1VYU A;  1BIB A;  2HL3 A;  2P0P A;  3EFS A;  2DEU A;  4M7D E;  4DBR A;  1G8X A;  4M78 A;  2ZPG B;  4KUL A;  3HRT A;  5GAM j;  2RJC A;  4BE2 A;  1AOJ A;  2HL5 C;  2RI2 A;  1R0B G;  2Z0W A;  3F70 A;  4C0D B;  4ZN3 A;  2J6O A;  2EFI A;  3G4S Q;  1SRL A;  2DEQ A;  3OQ5 A;  3OS2 A;  1IGQ A;  1Y96 A;  4IUR A;  2RQW A;  2NWM A;  3EG0 A;  4M4Z A;  3G71 Q;  1YJW A;  1NG2 A;  4ZGD B;  2ZCF B;  2DRK A;  3M57 A;  1D1B A;  2MIO A;  3G7Z A;  2XD0 A;  2QK0 A;  4KUD K;  2PQW A;  2KNB B;  2RJF A;  3URG A;  4F7U F;  1JBM A;  3FJP A;  1K73 U;  2EQJ A;  1NZ9 A;  2D8H A;  2DXU A;  4II1 A;  1VQ5 A;  4FW1 A;  3GF5 A;  1Q82 U;  1JEG A;  4ZNX A;  3HRS A;  1RLQ C;  5GAN 5;  5GAN e;  1G5V A;  1OYX A;  2DF6 A;  3PVQ A;  2E5K A;  2KQW A;  4HXJ A;  1NEB A;  4E47 A;  4J9B A;  2E1H A;  4M78 D;  5CCA A;  4M7D A;  1H64 1;  2QA4 A;  4RTX A;  3OS5 A;  2CSI A;  3EAE A;  4X1V A;  4IUT A;  2AK5 A;  2KYB A;  3KXT A;  2V1Q A;  2L8D A;  1HSQ A;  2RHX A;  2E6N A;  1JXO A;  2D8J A;  4F16 A;  3VUZ A;  3OW2 S;  4E7H A;  1K1Z A;  3EGD A;  3OYD A;  2OTJ T;  4ELY C;  4XU2 A;  3H41 A;  4Z8A A;  4DQ2 A;  3CME A;  3HKS A;  1MMG A;  3SD4 A;  5IH2 A;  2PVG B;  2EYY A;  2VAS A;  1SEM A;  4C8Q A;  2RPN A;  2KXC A;  2DZ9 A;  4FSX A;  4M7D D;  3OW2 P;  4CC4 B;  2O01 E;  2NUZ A;  4C0Z A;  1MNE A;  2LQW A;  2EIF A;  4FYY B;  3VJP A;  2LQN A;  2W10 A;  1ZBJ A;  4JPB W;  2X4X A;  5GAM e;  1B34 B;  4X9D A;  3VS2 A;  1HK9 A;  3CCL A;  2NUT A;  3M55 A;  4XTV A;  4M7D G;  8AT1 B;  3M5A A;  1YN8 A;  1TG0 A;  1QVG S;  4MZM A;  2CUB A;  2FRY A;  2YSQ A;  3LWH A;  2XI9 A;  3QWY A;  4D8D A;  2RI5 A;  2CGH A;  2W0Z A;  2KRS A;  3JCM f;  2DD4 A;  4C8Q D;  4M75 E;  1AVZ C;  1QVF A;  2KT8 A;  3MEW A;  3OYE A;  3MPU B;  3RR6 A;  3SWN B;  3X25 B;  4ATO A;  3CPW S;  4B9W A;  3MKD A;  5FU6 B;  7AT1 B;  3PFS A;  2FHD A;  2KK4 A;  3CCS A;  2MCN A;  2DXC A;  1QVG P;  3EFO B;  1I07 A;  2DVJ A;  2JS2 A;  3CC7 T;  4C0G A;  4E7Z A;  3CC4 Q;  4WCI A;  1H3H A;  4R55 A;  5FRM A;  2LT1 A;  4BDY A;  4PJO B;  4N4H A;  1MGQ A;  1QP3 A;  1YIT T;  4E7J A;  2D6F A;  1F1B B;  1AEY A;  4LD6 A;  2RQR A;  1QKW A;  3JRZ A;  5FU7 C;  3ZEH A;  5DM7 R;  2DPP B;  4VUB A;  4F7U B;  4A53 A;  3FDR A;  3CMA T;  2G3R A;  2MOX A;  1WHM A;  3E19 A;  4M75 A;  2DTH A;  1RAA B;  1YHQ T;  3CCJ T;  3OS1 A;  2K57 A;  2YLB A;  3NTK A;  2RNA A;  2KI7 A;  1NLO C;  4PJO G;  1UGS B;  2LDM A;  2KGT A;  1K76 A;  3FEO A;  1W2B S;  4RMO A;  2XIC A;  2RQV A;  3OS0 A;  4F17 A;  5GAM d;  2JMC A;  1KK7 A;  4C0F A;  2ABL A;  3HP9 A;  3PTA A;  2A08 A;  2LZ6 B;  4LDY A;  1Q95 G;  3J80 E;  4XU0 A;  4XU3 A;  4LUE A;  1VQ4 T;  3LYI A;  2DL4 A;  1BI1 A;  1E7O A;  1PC0 A;  1K8A U;  3L2R A;  1UGV A;  1Q81 R;  4M75 D;  1UJY A;  1W2B P;  2RMO A;  1U06 A;  1D1A A;  2VXF A;  1Q7Y U;  1MMD A;  2L0A A;  2PTK A;  3OYH A;  2L3S A;  4OF1 A;  2DD5 A;  2COW A;  4A4E A;  1PSE A;  3OY9 A;  1B07 A;  3RKX A;  1BI3 A;  2EAY A;  3CCE T;  2EPD A;  4EDU A;  4IIO A;  2MYS A;  9ATC B;  2GGR A;  1UTI A;  3I55 A;  4Z89 A;  5GAO q;  3SFM A;  2RD1 A;  3PMI A;  4M77 E;  4B6M A;  4J83 A;  2LT4 A;  2L3P A;  2HQE A;  5FLX E;  3M4G A;  4E2F B;  1ARK A;  2D0N A;  1H92 A;  1M5Q 1;  4XK8 E;  2O88 A;  3MHX A;  2JVV A;  2CP7 A;  2FPF A;  4Y28 E;  4HCB A;  1ZUU A;  1K8A C;  5CVI A;  2YWW A;  5GAN 3;  2J05 A;  2O4X B;  4F14 A;  4HCZ A;  3E1S A;  3MP8 A;  3G4S T;  1Q7Y C;  3QDR B;  5LJ5 h;  1YJ9 Q;  5J39 A;  4LXC A;  1VQL Q;  1M3C A;  3V8K A;  2E3H A;  1YI2 Q;  3G71 T;  2RK1 A;  2F1L A;  2E41 A;  3BW1 A;  4NL2 A;  3WVD B;  1VQ9 Q;  2EW3 A;  2IG0 A;  1SHG A;  2G6F X;  2DNU A;  4M77 A;  2KAF A;  3CBO A;  1M2O A;  4RKU E;  1IRX A;  4JJN K;  4C5I A;  3M0P A;  1OI1 A;  1LCK A;  2JN0 A;  2JTE A;  4LN2 A;  4ZN1 A;  4BY6 B;  4KGV B;  1WX6 A;  1QCF A;  3PNW C;  4J9C A;  2M9U A;  4EMK A;  3CCR A;  2M1H A;  3CCM A;  3I35 A;  4CC7 A;  3BY7 A;  5GMK i;  3CD6 A;  1N9R A;  2A37 A;  3JSC A;  4M7D C;  5GAN 6;  5A0D A;  4M77 D;  4XTY A;  3O8V A;  2ENM A;  2E6Z A;  4M7A F;  1SSF A;  2LC4 A;  2HKQ B;  1N27 A;  3CCV A;  4PJM A;  2PU9 B;  1KC8 R;  5LJ3 g;  4OVA A;  1WYX A;  1R77 A;  3D7S B;  1XOV A;  2R5M A;  4AFZ C;  4M77 G;  3DB3 A;  4XTX A;  1K9M R;  2QQS A;  1TSF A;  2QTX A;  3G6E A;  5IXB A;  4KRT A;  1GL5 A;  3PGG A;  1OU8 A;  1OZ3 A;  5GMK l;  2K6D A;  5KYW A;  4OMP A;  2SEM A;  3M54 A;  4RTW A;  5D6W A;  2VGM A;  5ECA A;  1VQ7 A;  2KEA A;  3TSW A;  4ORZ A;  5FU6 C;  3OBY A;  4NL3 A;  2QI2 A;  2JW4 A;  3H6Z A;  2DK3 A;  3PIP A;  3VS4 A;  1KFZ A;  1PRM C;  5IAY A;  2L2P A;  3M0R A;  4PJO C;  3L2Z A;  3CC4 T;  2DJQ A;  4A4K A;  3Q1J A;  1M90 R;  4BDZ A;  3EGU A;  2AZS A;  2MAM A;  1YP5 A;  4LE9 A;  3C94 A;  2LP5 A;  4OP0 A;  2QAS A;  1M1G A;  1NLP C;  1JJ2 A;  3ER0 A;  1X6O A;  4JJD A;  3CC2 T;  3GBQ A;  1ZUY A;  1QVG A;  1XJW B;  2JNG A;  2GTO A;  4HCC A;  3LW5 E;  2LTO A;  1I4K 1;  1M8V A;  3HPW A;  3CPW A;  1OPL A;  2GNC A;  1MHN A;  3N5B B;  1PG5 B;  2CT4 A;  2FRW A;  1Z9Q A;  1I5O B;  3JV3 A;  4QW2 A;  3UA6 A;  4RCB A;  2LRQ A;  2ED1 A;  2QAZ A;  4QQD A;  3QII A;  1VQN A;  3A8O B;  3OYF A;  1S72 A;  2P4R A;  2V8J A;  2IPO B;  4RTU A;  1OOT A;  1M3B A;  4PFZ A;  4AFS C;  3VS1 A;  3H8Z A;  2FPE A;  3S6W A;  2ZAE A;  1VQM Q;  1G3W A;  3LH5 A;  4M7A B;  3VYG A;  1VQP A;  1VQO Q;  5D6X A;  2JJ9 A;  5FRO A;  4D6W A;  5EG2 A;  2HBP A;  2LCC A;  1YIT A;  2J06 A;  4AT1 B;  3OMG A;  1FWZ A;  4M78 F;  4E7I A;  4JS4 A;  5IT9 E;  1M8M A;  4RTY A;  3TSZ A;  2X3W D;  1I8F A;  3JCM W;  4DOW A;  3HTR A;  5LJ5 j;  3ZL7 C;  3BDU A;  2FZG B;  3QO3 A;  4CRI A;  2QGG A;  2JTF A;  1JQQ A;  5KE2 A;  1M90 U;  1M2V B;  1ZHI A;  2ATC B;  3SHW A;  2ZPH B;  4BB7 A;  4JJC A;  1WHH A;  2QQ9 A;  2Y4X A;  2ROL A;  3M0Q A;  4ESR A;  1QCO A;  3CBP A;  2JOY A;  4PLL A;  3BE3 A;  3P8H A;  1RAB B;  1TUG B;  2ZZD A;  5FWB A;  5GJV B;  1FMK A;  2FO0 A;  1YJ9 T;  1VQL T;  1YI2 T;  2O2O A;  2NUP B;  1OV3 A;  4IKF A;  1VQ9 T;  2KSS A;  5GAN f;  5KYY A;  4LNP A;  1PRL C;  3LWI A;  3M0S A;  4AMC A;  4QT7 A;  3CCU A;  2DVE A;  8ATC B;  3CCE Q;  2ZPE B;  3X26 B;  1MMN A;  2COZ A;  2JT4 A;  2WSF E;  3MJX A;  5HKC A;  1M27 C;  4OB3 B;  2RHY A;  2L3Q A;  4J9I A;  3L2W A;  3PT9 A;  1BB9 A;  4M77 C;  3CPF A;  4TVR A;  4C8Q F;  3X20 B;  1OQK A;  2HSE B;  1D0Y A;  1UGP B;  1OPK A;  2AIR B;  1DJ7 B;  5M9O A;  1UE9 A;  5DLO A;  2HSP A;  1V1C A;  4J7I A;  2VYT A;  3OYG A;  1BYM A;  4DEY A;  3UF4 A;  2CP0 A;  4OB1 B;  3M4Y A;  4OMQ A;  4FYV B;  4EMK C;  3GLX A;  3JCM g;  3EG3 A;  3GP8 A;  2EGC A;  5HK3 A;  4N4I A;  1WJS A;  3G4S A;  5LJ5 e;  2PVD B;  1M1K C;  5GAM f;  3OYI A;  3FJ5 A;  3L2U A;  2VKN A;  3BFM A;  2EWN A;  4OMM A;  2DER A;  1W4S A;  1Y71 A;  2P0K A;  1UG1 A;  4BE1 A;  2M0O A;  1AWX A;  1MMA A;  3JCM X;  1YWP A;  2E65 A;  3OSS C;  3HSB A;  4MZT A;  1VIE A;  1SHF A;  2X4Y A;  1W1F A;  3AHU A;  2E64 A;  1OU9 A;  4PFP A;  2OX7 A;  2VGN A;  3H9N A;  3UAT A;  3UDC A;  2P0Q A;  4ZGE B;  2QA4 Q;  1Y57 A;  2RH2 A;  5LJ3 d;  4MMK A;  4E6R A;  1KQ2 A;  2ED0 A;  3CQT A;  1E6H A;  3CCQ Q;  2DJZ A;  1WI7 A;  2QQB A;  4PJO E;  3J7A F;  1B34 A;  4PNO A;  2K3X A;  3OYC A;  4M75 F;  1AZE A;  2K7A A;  3DLM A;  4J6W A;  2K5L A;  2LJ1 A;  2RN8 A;  2X4J A;  3V8J A;  3CME Q;  1NBE B;  2RHU A;  3JB9 I;  1KG1 A;  2AHJ B;  4F7U E;  1OUL A;  5J3B A;  1YWO A;  3FLG A;  3QYG B;  2BTT A;  1WA7 A;  1WNL A;  3JB9 G;  2YRC A;  3RMS A;  1VUB A;  3VS3 A;  1J3T A;  4HT8 A;  4DBF A;  1JJ2 S;  1K8A R;  1K9A A;  2I0N A;  3QXE B;  2X9H A;  2A36 A;  2C0O A;  2DFU A;  1TS9 A;  5LJ5 d;  3CCL Q;  2DIL A;  3QDF A;  4HVU A;  3QHS A;  2OTL T;  3C0C A;  1KIK A;  1Q7Y R;  2QG9 B;  3OA6 A;  3PE0 A;  2JM8 A;  5CQY A;  1UGR B;  1RUW A;  5FW9 A;  4PJO A;  1NPP A;  4C92 F;  2FL7 A;  2J6K A;  1X69 A;  2DRM A;  1ZSG A;  4KH0 B;  4C8Q B;  3VS0 A;  1NM7 A;  2EYZ A;  2XDP A;  1JJ2 P;  1NYG A;  4A63 B;  1ZSZ B;  3DLL A;  1EIF A;  2LMJ A;  4PL6 A;  1O9S A;  2HNI A;  2OJ2 A;  2GQI A;  2PUK B;  5GMK m;  3CCS Q;  1RLP C;  2NUT B;  1GBR A;  4OML A;  1VQM T;  1QQJ A;  1GXI E;  3CPW P;  3C95 A;  4XTW A;  3MEU A;  2MWP A;  3V7C A;  1VQO T;  3CC2 Q;  2AKK A;  3I9Q A;  3NTH A;  3EFR A;  4UC4 A;  4PJO D;  1FX7 A;  2DET A;  4OGE A;  1QP2 A;  2KVQ G;  2VV5 A;  4CC3 A;  2GFA A;  3PVL A;  2V26 A;  4LDU A;  2V8K A;  1G83 A;  1MV3 A;  4EMH A;  2GFU A;  1UEC A;  3MEV A;  4BUG A;  2KMT A;  2CP6 A;  4F7U G;  2E12 A;  1SPK A;  1YFN A;  5CQX A;  3C12 A;  1X2K A;  2MI6 A;  2HDA A;  2M0Y A;  4DA4 A;  3CXC S;  4D8K A;  1LVK A;  2DE0 X;  3UT1 A;  2JUF A;  4M75 B;  3VYH B;  5LJ3 h;  1PNJ A;  4HA8 A;  3JCM P;  1WLP B;  2YXY A;  1I81 A;  2YLC A;  4KGX B;  4EPC A;  1M1F A;  3VV0 A;  3ULR B;  2RJE A;  3GNG A;  3QZ5 B;  2RO0 A;  1X2Q A;  2CZ7 B;  2K3Y A;  4J9E A;  3CXC P;  2FG0 A;  2DLP A;  4RTV A;  4FL6 A;  3X24 B;  4FIB A;  3I55 Q;  1RAD B;  3S3M A;  1EZZ B;  2X3X D;  2QEX T;  4C0D C;  1B3Q A;  3I56 Q;  4A54 A;  2ECZ A;  1GRI A;  1GFD A;  4C92 B;  5A0L A;  4L6V 5;  2YUN A;  1Q86 C;  2HD0 A;  1QW1 A;  3GPL A;  3FRN A;  1VOM A;  4JJB A;  3DKM A;  1W70 A;  2IVW A;  1VQL A;  2VXE A;  1SRM A;  4K11 A;  2XID A;  2CS7 A;  2GQV A;  1ABQ A;  1YJN A;  1VQ9 A;  4ME7 A;  4C5G A;  2JM9 A;  1TTH B;  2LX9 A;  1JU5 C;  1PKS A;  4HVW A;  5I22 A;  2HQH A;  4R56 A;  1YIJ A;  4N0A C;  1A0N B;  2DIQ A;  2DTO A;  1VQK Q;  2L5Q A;  3I5R A;  2CT3 A;  2A7Y A;  1WXT A;  1CKB A;  2QA4 T;  2IIM A;  1M30 A;  4LD9 K;  3RER A;  5CIU A;  3CCR Q;  3CCM Q;  1KQS S;  1Y7X A;  1KJW A;  4Q5W A;  3VRZ A;  4XTU A;  5I2S A;  1KD1 U;  2BIV A;  3SB2 A;  2O31 A;  4J8O A;  5LL6 S;  3CCQ T;  3RES A;  2GF7 A;  4JRP A;  2NYS A;  4RCC A;  2RJD A;  3NTI A;  1SSH A;  2F2X A;  5KYU B;  3CME T;  1G3S A;  1PKT A;  2EYW A;  2XDD A;  3OYJ A;  2XKO C;  5GMK h;  1ZUK A;  1BCM A;  2RHZ A;  2Y4Y A;  5KYX B;  2MK5 A;  4FCY A;  2DBK A;  2KT1 A;  4JLG A;  5GAO r;  1EX4 A;  5A0G A;  3CEY A;  3G6E Q;  3KFV A;  4XU1 A;  1FMV A;  2EJG A;  5A2Q E;  2LX7 A;  3CCL T;  4CI0 C;  2K2V A;  2VVK A;  1KD1 C;  2AT1 B;  3SWN C;  2V8I A;  1AWJ A;  2RA2 A;  2K5I A;  3ASK A;  3T9N A;  5I11 A;  5CKE A;  5GJW B;  2BUD A;  1ZSZ C;  1PD1 A;  5I21 A;  2DBM A;  4DBH A;  1WFW A;  3FB9 A;  1IHV A;  2OTJ A;  1PCX A;  2H3E B;  2SRC A;  2KE9 A;  4E7L A;  3QG1 A;  5DLQ E;  4M7A E;  3OMC A;  2ROT A;  1AWW A;  4YTL A;  3UWN A;  1BCO A;  3CCS T;  4PFO A;  3JCM c;  3E9F A;  4LDV A;  2D1X A;  5HY6 A;  3ME9 A;  4Y92 A;  4DOV A;  4KGZ B;  4FT4 A;  4GBQ A;  4LDX A;  2CDT A;  1AT1 B;  4FT2 A;  5GAN g;  2OTL Q;  2YT6 A;  2EQI A;  2EQU A;  4DBQ A;  3UA7 A;  4A4H A;  2X4W A;  2AKL A;  4HKE A;  2KBT A;  2XK0 A;  2A3L A;  3A8L B;  3EGX B;  4M7A A;  3VS7 A;  3L42 A;  1M1K R;  1PD0 A;  5LJ3 j;  3L2V A;  1CSK A;  3GNF B;  4JS5 A;  5DY9 A;  1NEG A;  2A0F B;  2QGF B;  5GAO n;  2DL3 A;  1UFF A;  2JZ2 A;  1M4Z A;  2X51 A;  3EG1 A;  5HK0 A;  3REB B;  1D3B B;  3JCM h;  1VQN Q;  2QXF A;  3CC7 A;  4C5E A;  5GAN 8;  1LPL A;  1CKA A;  3H0H A;  2VC8 A;  2BE7 D;  5IN1 A;  1K4U S;  2EQK A;  1M2V A;  3OBW A;  3NFC A;  5GAN 7;  2MF2 A;  1VQM A;  4MDX A;  1JO8 A;  1WDX A;  2E70 A;  3U23 A;  1ZA2 B;  3V8L A;  1VQP Q;  3OYL A;  1VQO A;  1QWF A;  5D7U A;  4M7A D;  2XU8 A;  5GAM g;  1AZG B;  3CMA A;  2BZX A;  1XQH A;  1ABO A;  1NPR A;  2C0I A;  2LJ3 A;  4C5H A;  5CKF A;  1YHQ A;  3I55 T;  3CCJ A;  4O5V A;  1WQW A;  1RAG B;  1WPY A;  2NUP A;  4M7A G;  4J9D A;  1KC8 C;  4MDW A;  4NOY A;  5FU7 B;  5KYN A;  3LH0 A;  4HCK A;  4FYX B;  4QQG A;  4QQ6 A;  4JZ3 A;  2X35 A;  4ANJ A;  3I56 T;  5CR2 A;  3P8B B;  2VUB A;  2C06 A;  3EHQ A;  4X9C A;  5LJ5 f;  2CZ1 B;  4RG8 A;  3R6O A;  3BDL A;  3CXC A;  1N9S A;  1VQ4 A;  4M7D F;  1OZ2 A;  2GCX A;  3G1J A;  1TWB A;  1X6B A;  1HJD A;  2KY9 A;  1U8R A;  2DKG A;  1VQ6 Q;  1RAF B;  4ZTF A;  2B86 A;  4OB2 B;  3RBB B;  1MV0 B;  2R58 A;  1M1K U;  1VQ8 Q;  5LJ3 e;  2QTV A;  4BY6 C;  4HT9 A;  4GLM A;  2M51 A;  5CKB A;  3RUX A;  2KDS A;  3M58 A;  1WIE A;  3CCE A;  1O75 A;  1TU0 B;  1T3S A;  2DM1 A;  1VA7 A;  2DXT A;  3P8D A;  2CP3 A;  5IHK A;  1LJO A;  4PK4 A;  5IHN A;  1ZLM A;  1WXU A;  1RAH B;  5IXF A;  1R0C B;  1VQK T;  1M9S A;  4QVD A;  2BZ8 A;  2WSE E;  4Y91 A;  2QEX Q;  1G3T A;  2K4Y A;  1WZO A;  3HHT B;  1ZA1 B;  2DL8 A;  3CCR T;  1T0H A;  4AFU C;  3CCM T;  3VUB A;  2QQR A;  2GTJ A;  3OSV A;  1M3A A;  1C0M A;  2DAQ A;  3QBY A;  1D1C A;  1E6G A;  1WXB A;  1ZX6 A;  5KYY B;  1SG5 A;  2LJ0 A;  3H0I A;  3SDZ A;  3EHR A;  4EMG A;  1S1N A;  3EG9 B;  2J6F A;  4KUI A;  2LCS A;  4N0A A;  1KSW A;  3REA B;  2FB7 A;  3G71 A;  1YJW Q;  1HYO A;  4PJO F;  3CCV T;  1GBQ A;  3A98 A;  4GLK A;  1NJI C;  1WQ7 A;  2FYK A;  1ACM B;  1FXX A;  2EKH A;  1WJQ A;  1VQ5 Q;  2CUD A;  3OYM A;  3QJ6 A;  3G6E T;  4LDW A;  1X6G A;  1PWT A;  4M78 B;  2FPD A;  1GCP A;  1UJ0 A;  1T3L A;  3LX7 A;  1N8R C;  1KQS A;  1QLY A;  4C8Q E;  4BAC A;  1Y96 B;  2EJ9 A;  3TEE A;  2HKN A;  1I1J A;  1YCY A;  1JXM A;  1X43 A;  1PSF A;  4F04 B;  2RM4 A;  2L3R A;  1WHL A;  3X28 B;  1IGU A;  1VQ7 T;  2ZGW A;  2FVU A;  2C0T A;  3V7S A;  2O9V A;  1BI2 A;  2K3B A;  3JB9 D;  2F2V A;  4FU6 A;  3CCQ A;  1MND A;  2MMP A;  2VWF A;  4M78 G;  3MO8 A;  5GAO l;  2PVO B;  1H3Z A;  4M7D B;  2CH4 W;  1UGQ B;  3TCJ A;  2HBW A;  1N6A A;  1K73 C;  3MP1 A;  5GMK e;  3OYA A;  3SWN A;  2XG8 D;  3ZFJ A;  4R0K A;  1Q82 C;  4IUQ A; 
#chains in the Genus database with same CATH homology
 1FYN A;  2JW4 A;  3NHN A;  4EIK A;  1OEB A;  2JMA A;  1MUZ A;  2CH4 A;  4HVV A;  1U3O A;  2X3X D;  3VS4 A;  1KFZ A;  1PRM C;  2L2P A;  1B3Q A;  3M0R A;  2ECZ A;  1H8K A;  1GRI A;  3O5Z A;  1GFD A;  2DJQ A;  5IHI A;  2YUN A;  3EGU A;  2AZS A;  5FWC A;  1YP5 A;  4LE9 A;  2LP5 A;  4JJB A;  2OI3 A;  4AG2 C;  1N5Z A;  4RUG A;  1W70 A;  1NLP C;  2KRN A;  4JJD A;  1SRM A;  4K11 A;  3GBQ A;  1ZUY A;  5EC7 A;  2GTO A;  1ABQ A;  1G2B A;  1I0C A;  2J7I A;  3QWX X;  2FEI A;  1VYU A;  2YDL A;  2JM9 A;  4HVW A;  1JU5 C;  1PKS A;  5I22 A;  1K0S A;  4AFQ C;  1AOJ A;  1OPL A;  1A0N B;  5L23 A;  2GNC A;  2RF0 A;  2CT4 A;  2FRW A;  2RQT A;  3NPF A;  1Z9Q A;  2J6O A;  3JV3 A;  4IIM A;  3R6N A;  1SRL A;  3UA6 A;  3NGP A;  1GCQ A;  1QKX A;  2RQW A;  2ED1 A;  2PNI A;  2NWM A;  1HD3 A;  3EG0 A;  2CT3 A;  3I5R A;  4M4Z A;  1WXT A;  1NG2 A;  1CKB A;  2DRK A;  2IIM A;  1M30 A;  2P4R A;  3VS5 A;  2MIO A;  4RTU A;  1OOT A;  2EGA A;  1KJW A;  2KNB B;  1M3B A;  3VRZ A;  2EBP A;  4AFS C;  2D8H A;  2O31 A;  3VS1 A;  2FPE A;  1JEG A;  4ZNX A;  1RLQ C;  3LH5 A;  2DF6 A;  1SSH A;  2F2X A;  3PVQ A;  2E5K A;  4HXJ A;  1NEB A;  4OMN A;  4J9B A;  2J06 A;  2DL5 A;  2KR3 A;  4RTX A;  1PKT A;  2EYW A;  2CSI A;  1M8M A;  4RTY A;  4X1V A;  2K79 A;  1ZUK A;  3TSZ A;  2X3W D;  2EVR A;  4J9H A;  2AK5 A;  2KYB A;  2V1Q A;  1HSQ A;  2DBK A;  3M0T A;  2KT1 A;  3ZL7 C;  1JXO A;  2D8J A;  4F16 A;  3KFV A;  3SEM A;  1JQQ A;  3RNJ A;  1K1Z A;  3H41 A;  2LX7 A;  4Z8A A;  3SHW A;  2V1R A;  2DL7 A;  4JJC A;  5IH2 A;  3M0Q A;  2ROL A;  2VVK A;  2EYY A;  4ESR A;  1SEM A;  2RPN A;  4DEX A;  2KXC A;  1AWJ A;  5I11 A;  1U5S A;  5GJW B;  5FWB A;  5GJV B;  2PZ1 A;  2DBM A;  4CC4 B;  1FMK A;  2FO0 A;  2NUZ A;  1WFW A;  2LQW A;  1IO6 A;  2KRO A;  2O2O A;  2LQN A;  2W10 A;  1ZBJ A;  2SRC A;  4JPB W;  1OV3 A;  2KE9 A;  2RQU A;  4LNP A;  1PRL C;  3M0S A;  3VS2 A;  2ROT A;  1AWW A;  1YNZ A;  4QT7 A;  1QWE A;  1YN8 A;  4JZ4 A;  1TG0 A;  2D1X A;  2LNH B;  2JT4 A;  4Y92 A;  1M27 C;  2CUB A;  2FRY A;  2YSQ A;  2DMO A;  3QWY A;  4D8D A;  3H0F A;  2W0Z A;  2L3Q A;  4J9I A;  2KRS A;  4GBQ A;  1X27 A;  1BB9 A;  1AVZ C;  2CDT A;  2A28 A;  2KT8 A;  2XMF A;  1OPK A;  1UE9 A;  2YT6 A;  2MCN A;  2HSP A;  2EQI A;  1V1C A;  1I07 A;  2DVJ A;  3UA7 A;  1UHF A;  2JS2 A;  4DEY A;  2AKL A;  3UF4 A;  2KBT A;  2O9S A;  2EYX A;  1H3H A;  4WCI A;  1K0X A;  4RTZ A;  2F2W A;  4OMQ A;  3EG3 A;  3VS7 A;  2EGC A;  1CSK A;  4J9F A;  1NEG A;  1AEY A;  2DL3 A;  1UFF A;  3EG1 A;  3REB B;  2RQR A;  1Z9Z A;  1QKW A;  1UHC A;  1RI9 A;  4J9G A;  3FJ5 A;  2VKN A;  2MOX A;  4OMM A;  1UG1 A;  1CKA A;  3H0H A;  3M0U A;  3VRY A;  1AWX A;  1YWP A;  2JXB A;  1K4U S;  2RNA A;  1SHF A;  1NLO C;  1W1F A;  3EG2 A;  1TUD A;  1JO8 A;  1WDX A;  3U23 A;  2KGT A;  1K76 A;  1AD5 A;  1VYV A;  1QWF A;  2KRM A;  1YCS B;  2RQV A;  3NMZ C;  4F17 A;  3UAT A;  1AZG B;  2JMC A;  1BU1 A;  2ABL A;  2YUO A;  2A08 A;  4CC2 A;  2LZ6 B;  1Y57 A;  2BZX A;  3IQL A;  4LUE A;  2DL4 A;  1ABO A;  2C0I A;  2LJ3 A;  4E6R A;  1E7O A;  2ED0 A;  3CQT A;  1UGV A;  1E6H A;  4J9D A;  1WI7 A;  1UJY A;  3VS6 A;  2RMO A;  3THK A;  1U06 A;  4HCK A;  1NYF A;  1AZE A;  2K7A A;  4JZ3 A;  2L0A A;  2PTK A;  2L3S A;  2LJ1 A;  2RN8 A;  3EHQ A;  4FSS A;  1B07 A;  2EPD A;  1YWO A;  2HCK A;  4IIO A;  2DX1 A;  2BTT A;  1X6B A;  2GGR A;  1UTI A;  1WA7 A;  4Z89 A;  1HJD A;  2L3P A;  1ARK A;  3VS3 A;  2D0N A;  2B86 A;  3RBB B;  1J3T A;  1MV0 B;  1K9A A;  2I0N A;  1H92 A;  2A36 A;  2C0O A;  2O88 A;  4GLM A;  2M51 A;  2FPF A;  2DIL A;  4HVU A;  1EFN A;  1KIK A;  3C0C A;  1UDL A;  1WIE A;  1ZUU A;  2JM8 A;  3PE0 A;  4RTT A;  1RUW A;  5FW9 A;  2DYB A;  3I5S A;  1T3S A;  2DM1 A;  1VA7 A;  2QDL A;  2GBQ A;  2J6K A;  5IHK A;  2J05 A;  5IHN A;  4F14 A;  1ZLM A;  1X69 A;  1WXU A;  2DRM A;  5IXF A;  1ZSG A;  3VS0 A;  1NM7 A;  2EYZ A;  1M3C A;  5HCK A;  1NYG A;  2BZ8 A;  4A63 B;  1BBZ A;  2DL8 A;  2CRE A;  2LMJ A;  1T0H A;  4AFU C;  2EW3 A;  2GTJ A;  1SHG A;  2OJ2 A;  1M3A A;  2G6F X;  2GQI A;  2DNU A;  2YUP A;  1GCQ C;  1RLP C;  1E6G A;  1WXB A;  1ZX6 A;  2LJ0 A;  3H0I A;  1GBR A;  4OML A;  3EHR A;  3M0P A;  2ESW A;  1S1N A;  2YUQ A;  1LCK A;  2J6F A;  2JTE A;  4LN2 A;  2LCS A;  4Z88 A;  2AKK A;  3I9Q A;  2OAW A;  1KSW A;  3REA B;  1WX6 A;  1GBQ A;  1QCF A;  3A98 A;  4J9C A;  3I35 A;  4CC7 A;  4AG1 C;  1UUE A;  4CC3 A;  2A37 A;  2K2M A;  2EKH A;  1BK2 A;  2CUD A;  1W6X A;  1AWO A;  3PVL A;  2AZV A;  2JS0 A;  2BZY A;  1X6G A;  1PWT A;  1VYT A;  2FPD A;  1GCP A;  1G83 A;  1UJ0 A;  1T3L A;  1MV3 A;  1UEC A;  2ENM A;  1QLY A;  2CSQ A;  1I1J A;  1JXM A;  1SPK A;  1X43 A;  1WYX A;  1XOV A;  2EGE A;  4AFZ C;  4LUD A;  1X2K A;  2C0T A;  2HDA A;  2O9V A;  2M0Y A;  5IXB A;  4KRT A;  2HEQ A;  2K3B A;  4D8K A;  1GL5 A;  2DE0 X;  2K9G A;  2F2V A;  2H8H A;  2KXD A;  1PNJ A;  1PHT A;  2VWF A;  2DA9 A;  2K6D A;  4OMP A;  2SEM A;  1WLP B;  3TVT A;  4RTW A;  2CH4 W;  3ULR B;  1TUC A;  1X2Q A;  5ECA A;  2HBW A;  4OMO A;  4J9E A;  2KEA A;  2FG0 A;  2DLP A;  3TSW A;  1T0J A;  4ORZ A;  2KYM A;  4RTV A;  1GFC A;  1Y0M A;  4R0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...