1UH6A

Solution structure of the murine ubiquitin-like 5 protein from riken cdna 0610031k06
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
100
structure length
100
Chain Sequence
MKGSSHHHHHHSSGASLVPRGSEGAATMIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the murine ubiquitin-like 5 protein from RIKEN cDNA 0610031K06
rcsb
molecule keywords ubiquitin-like 5
molecule tags Structural genomics, unknown function
source organism Mus musculus
total genus 13
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2003-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1uh6A00
3QIJA 3R7RA 3EECA 4GMVA 3M62B 1WZ0A 4EEWA 2DZIA 1K8RB 3R3MA 2C7NB 2GBJA 4HDQA 3A1QB 1WE6A 2KX0A 2DYBA 2KHWB 3ZIMA 2C9WB 3Q3FA 4AOFA 2CHXA 1E7UA 1P98A 5HKHA 1KJTA 2N7EA 3CSFA 4EZLA 2JVCA 2UYZB 3EFUA 2HD5B 3K9PB 4G0NB 2L3ZA 3VFKA 4DXAB 4JGHB 2LVQA 2AL6A 2KDFB 2N1WA 4G50A 1J19A 1PQSA 2KFKA 2C5LC 4MSMB 2DENB 2BYEA 3WA0A 1RLFA 1GJZA 3APDA 5CHWA 3ZDTA 3ZVVA 4OVUA 4ANUA 4A20A 4II2B 4A3PA 1GUAB 4MJSB 3MTNB 3NS8A 4IC7B 2FCNA 4FHKA 2JWZA 1I35A 4BOSC 1ZW7A 4ASWC 4I6PA 2DZMA 3HHMA 5CHVC 4ANWA 2N4FA 3T9LA 2IY1B 2D2QA 1NBFC 5DPSA 3HM3A 4EZJA 1YIWA 4NJ7A 2JPHA 2MLBA 2ZVNA 3ZUNA 4EZKA 1UD7A 2AL3A 2NS5A 1WJNA 2J0KA 3EC8A 2LVPA 3UINB 3L16A 4TUUA 3KUCB 2KWUB 4E71A 5G55A 1U4AA 4E3CA 4FJZA 2OOBB 1EO6A 1VCBA 2RPQA 2K39A 4XC2A 4WJPA 4RM8A 1V5TA 2KQ7A 1WJ4A 2NBVB 3QC8B 3DVGX 4ZDVA 1IP9A 3UIOB 4HK2A 4HXDA 1V2YA 2C7MB 5E6NA 2N9PC 3W1SC 4NJ6A 4PS8A 1MG8A 4HDOA 4K7UA 3WIMA 1J8CA 2ASQA 2NPTA 1WMHA 2EMTA 4LCDE 3PRZA 3DBLI 2KJRA 3DDCB 3V60A 2KWCA 3IG3A 4NY0A 2PJHA 1LFDA 1NI2A 2BKFA 3QK0A 5AZGA 1YJ1A 5DPRA 4BKTA 4GDLB 1WRDB 2DYMA 4G11A 1WXMA 4KDLB 3PV1A 4PYUA 3KW5B 2PE6B 3A1QA 4HCNB 5FR6A 4FADA 1IYFA 1KM7A 2I1JA 1P0RA 3DCGA 3PLUA 3VUXA 3PLVA 2LGYA 2Z59B 2MBBB 3APFA 4ANVA 1E5WA 2KO3A 2JF5A 2KTFA 3O65B 4LJPB 4JIOU 4FLHA 5EDSA 2JZ3B 2KX3A 2BPSA 2D3GA 3U8ZA 4IG7B 2LASA 3AXCA 2KMCA 5D2MB 3AULA 3BINA 2V4LA 4II3B 4BKGA 3U30A 3PZDA 1KLVA 2ZJDA 3UQBA 4IM0A 1OGWA 1QZEA 1V49A 3MHSD 2K1FA 1Z2MA 5BO4B 2KTRB 3B0AA 2KLGA 3ML8A 2A5UA 3SU8X 1WGHA 2MA9B 2KDIA 5IA7A 2KOXA 4GDKB 2AWTA 1Q1OA 4K7SA 1UZXB 1H4RA 1P9DU 1OQYA 1WX7A 2IO3B 2IZVB 2JT4B 3SD5A 1Z5SB 4W9LA 4F1SA 4IW0A 2W9NA 1GG3A 4I6NB 4WWPA 4DHJD 2Y5BB 1EF1A 3ENEA 3B08A 4P7IA 3SDLC 2CHZA 1XQQA 3Q3JA 3WAPA 1E7VA 2MBOA 2WDTB 2GBKA 1TBEA 3A9KB 3ZDMC 5CTRC 2JRIB 4TQ1A 2L0FA 4AWJA 2NR2A 1Y8RC 3DPDA 1KOTA 2O2VB 2AEHA 1WGGA 2ZEQA 3IBEA 5E6PA 3NHEB 1E8XA 5AZFA 3TJPA 2KXJA 3ZLZA 2G4DB 3ZRCA 2Z0DB 1LXDA 2FUHB 4JLCA 1UH6A 3ZRFA 2ZVOA 3KH0A 1V81A 5D7GA 1P1AA 3PRPB 1BT0A 1WJUA 4M0WB 3RD2A 4W9JA 4KSLC 3ZKJC 2OJRA 2KANA 1V6EA 2MRPA 2REXA 1WIAA 1WR1A 2FCMA 2DX5B 3WANA 1M94A 3H1UA 4CYEA 3EHVA 2BYVE 4NAWB 4NQLB 3TMPB 2LRUA 3M3JA 1WXSA 5DCNA 4I6LB 3JSVB 1WI0A 5J18A 4AP4C 2MWSB 4K1RB 1RFAA 2LRWA 2XBBC 3CF6E 3I3TB 4WJQA 3V61A 2KNBA 2MBEA 4ICUA 4HVBA 3GOEA 3MJWA 2L76A 4DK5A 2NCNA 3X23A 2MCNB 1C3TA 2D10A 3ECIA 1Q5WB 2IBIB 3S2AA 2NBWB 3JVZX 3QX1A 4B95A 2V3SA 1P3QU 1E90A 2MQJA 4JQWC 4RM9A 4BFRA 4LJOB 1OEYA 5G2NA 4URKA 4M8MA 2BKRB 2ZNVC 3H7PB 4B6WA 3A9JB 4N9F4 1E8WA 4BBNF 2L7RA 3RUIB 4TQ0A 2RD0A 3T8MA 1S1QB 2JY6A 4DDID 2D07B 2CS4A 5E6OA 2DAJA 1AARA 5CHFA 4JL9A 2BF8B 1RAXA 2KTRA 2N7DA 5TR5A 3LDZE 1TZ1A 1E8YA 2WX0A 3L17A 5LXHA 2FCQA 4GDKA 3H6NA 3QCAA 4GIVA 4DHZE 2J7QB 1SE9A 2LVOA 2K6QA 4W9DA 2L05A 2O6VD 2N9XA 3KYDD 4OVVA 2WYQA 2GBNA 4GU2A 2L0TA 4XZ4A 5JHAA 3VDZA 2MSED 2UWQA 2O6VB 1WX8A 3OJ4B 1GC6A 5KHOA 2IY0B 1WF9A 3PPAA 3A9KA 3QHTA 4MSQB 1WGRA 2VRRB 2BWFA 1WH3A 2CHWA 4IWPA 3DOWA 3PREA 2I1KA 3VQIA 3HIZA 3P2BA 1OTRB 2KD0A 2EMSA 4KIKB 2IO2B 2O2VA 3VTWA 3GZNI 1WFYA 2IO0B 1EUVB 2KC2A 3PRMB 3VHTC 4WAAA 4W9CA 4ZYNA 3OJ3A 1WJ6A 1YD8U 2FIDA 3A33B 5J2RA 1WXAA 1CMXB 2ZCBA 3H7SA 4BOZB 2WWZA 4DHZB 1RRBA 3UF8A 2L8JA 2R2OA 3APCA 3U7DA 2LXCA 2WX1A 2DZKA 1LM8B 4TV3A 1C1YB 2RSUA 5LXIB 1UELA 2DAFA 2R2QA 3JSVA 3RCZA 4HWIB 4MJSA 4E74A 4KDIC 4HCPB 3HM6X 1JRUA 3QA8A 4FJVB 3RT3B 2KZRA 3B1LX 2KLCA 1YQBA 3AU5A 1LQBA 3A4SC 1YX6B 3VH4B 3QQ8B 3ZTCA 3PTFC 2CR5A 4W9IA 4MM3A 3JYUA 3WAMA 3TCAA 5DPWA 4KVGB 3HK0A 2LZ6A 3KVFB 2C60A 2JXXA 3KYCD 2GBRA 4FJYA 4M8NA 4MGZE 4X57B 2FNJB 2NVUI 2KQSA 2XK5B 3AI5A 3H7PA 4KZCA 1UGMA 2M8SA 3A9JA 4WQOB 5JZEB 2LJ5A 3RZFA 1J0GA 4MDKE 1TGZB 4FULA 1WYWB 4NQKE 4LDTD 1F9JA 3KUZA 2A4ZA 4NPNA 3VUYA 2KFJA 1WE7A 1E8ZA 5AZHA 4RMAA 5C23A 2K8HA 3D32A 5D94A 2NBUA 4LDTB 1ZKHA 3NZUA 2G3QB 1OEYJ 2HTHA 2M17A 4ANXA 3VTUA 2KC1A 2MP2B 3N3KB 4W9EA 3W1SA 1GC7A 2G4SA 3JW0X 4BVUC 4KZ0A 1WMHB 4HJKA 3SHQA 1UBIA 1WM2A 2DZJA 2RGFA 3NY5A 4GN1A 3TIXA 3ZO5B 4W9GA 2O6VA 2QHOA 1EF5A 3PT2B 4BKSD 1S3SG 3ZTDA 2GMIC 3PGEA 4CO7A 4HPLB 3AU4A 3RYTA 4GB9A 4NNJB 3N32A 4GDLA 3QWZB 3V6CB 4EKUA 3NOBA 2MBQA 3H9DA 4KIKA 4EFOA 4K7WA 1WGDA 1VD2A 2PPHA 1R4NI 5JH5C 3IVFA 2GOWA 2MX2A 3ALBA 3ZNHB 2ZPYA 4IUMB 4IM3A 1YX5B 2MW5A 4F8CB 1V9JA 4EOYA 1SIFA 2V1YA 3L54A 1XD3B 1X1MA 2JRHA 1V80A 4IWOA 3W1YA 2KVRA 4MELA 1IPGA 1G6JA 2RR9A 2ZNVB 2J0MA 2M1MA 2PE9A 3R66C 2K6DB 3LJ3A 3M95A 5KHQA 1NDDA 3N30A 4HPMB 3ZNZB 3ML9A 3DBRI 2CU1A 4J6IA 4ICVA 3PHXB 4W9KA 1WR6E 4HLEA 3TBLD 4YL8A 5C1ZA 2KN5A 1R4MI 2YLMA 2KDBA 4MGYE 2CKHB 4GOCA 2N9EB 3L0WB 3VAWA 2G45B 3WALA 1HE8A 2DYOA 4WWNA 3UIPB 3CMMB 3L13A 3L10B 2JUOA 4KV2A 5L83A 1V86A 3IFWB 4AJYB 3A4RA 3CSTA 2LD9A 3V62A 5CX3A 2XK5A 3K9OB 4KSKC 4PYZA 2XEWA 1I42A 1T0YA 2KJ6A 2LWPA 3DVNU 2L00B 4PS7A 2K25A 3DVNV 3DBHI 2C7HA 2KMAA 4PS3A 5JHBA 4DBGA 4WWOA 3VUWA 2JZZA 2K8BA 4WJOA 4MEMA 2KJHB 2LI5A 2KK8A 3RZWC 2LXAA 2MP2A 2GBMA 2PEAA 1ISNA 3VTVA 4FA6A 5L95C 3DBSA 4IWQA 2ZZPB 4MGKE 3DQVA 3NZSA 1WY8A 3ZNGC 1WM3A 3V6EB 4A3OA 2LUEA 3L08A 2KFKB 2MBHA 4GSWA 3RULA 1L2NA 1WZ3A 3UQAA 2BGFA 3OLMD 4AUQC 4NAWA 3VXWA 3BY4B 3UGBB 4FBJB 3ZW3A 3OAWA 2YVCA 4XX5A 1UBQA 4K81A 4ZRIA 4W9HA 4BKSA 3M63B 5J17A 4GGQA 4EUTA 3KUDB 4F7ZA 3QAQA 1FXTB 3C0RB 1XT9B 4IM2A 2KKCA 3VVWB 2Z0EB 2M0XA 3QJZA 2AYOB 2D11A 2HJ8A 4AJWA 2N1VA 2LGDA 2EKEC 1SGHA 5LLIA 4FN2A 2FIFA 4ZRKA 1ZGUB 3QARA 3PVLA 1GNUA 4B9KA 4DDGD 1D3ZA 2ZPNA 2B3AA 4MGIE 1L7YA 1TTNA 2HE7A 3DVGY 4CHKA 4DWFA 5DPTA 3ONSA 2K8CA 5D6JB 2FCSA 3VH3B 3PHWB 3PS6A 2BWES 3X0WA 1H8CA 3IHPC 2M4NA 4FHJA 2IO1B 3R7QA 2FAZA 2ZCCA 2KWVB 1V5OA 5GMVA 4ZRJA 5IAAC 3WAOA 4TKNA 5AEKB 2NPTB 4GXBA 2IYDB 2LGXA 4G3XB 4MH0E 3PSEB 4W9FA 3TL5A 3ZNID 4WJNA 2BYFA 4DHJB 2J0JA 1A5RA 1WXVA 2DHZA 1Q0WB 1WGYA 2KDEB 4BBNC 1WX9A
chains in the Genus database with same CATH superfamily
3QIJA 4GMVA 1WZ0A 2C7NB 1A70A 4N59A 1JRPA 1T0SC 2CHXA 5HKHA 3DWGC 4EZLA 1K51A 2HD5B 3VFKA 3Q2AC 2AL6A 5JXVA 2N1WA 1J19A 1PQSA 2JU6X 4WIPA 1Q10A 2BYEA 3APDA 3AEFB 4ANUA 3B2FA 3MFGA 3Q6BA 1SEBD 3U52E 2G9HD 2JWZA 1I35A 2B76B 4B0MA 1ZW7A 3HHMA 2IY1B 1NBFC 3IT4B 1CK1A 1I4RA 1YIWA 2ZVNA 1UD7A 2QEJC 2NS5A 1AYFA 2LVPA 4TUUA 1DOXA 2KWUB 1K53A 4E3CA 1HQRD 4FJZA 3MP9A 2KQ7A 1WJ4A 1RYJA 1V2YA 2JXTA 3W1SC 4K7UA 4DXGA 2R61A 2BVCA 3DDCB 2KWCA 4NY0A 5HI1A 1TS3A 4G11A 2BS2B 1N5WA 3PV1A 4PYUA 2PE6B 5D3DA 1VLBA 2LGYA 2MBBB 1E5WA 4JIOU 4YSXB 2KMCA 4ACFA 5LNK1 1ZXHA 2V4LA 2DLBA 1KLVA 1C4CA 4IM0A 1QZEA 1ZPSA 2E3TA 2KYWA 2EELA 3ML8A 1F1HA 1ZP0B 2M19A 4ARCA 2KOXA 2AWTA 5T8IA 1FNUA 1P9DU 1OQYA 1WX7A 2FUG1 2IO3B 1Z5SB 4I6NB 2JSVX 3B08A 4P7IA 1ZDVA 2CHZA 2INCC 4BZAA 3Q8AA 5I4DA 1Y8RC 2O2VB 2N0SB 5AZFA 1E8XA 3ZRCA 2JYTA 2WDVB 3ZRFA 2ZVOA 1V81A 1WJUA 4KGRA 2OJRA 2KANA 2MRPA 5AUKA 2REXA 1WR1A 2DX5B 1YQ3B 1MFWA 2JZPA 2MWSB 2FBWB 2XBBC 3V61A 3C8YA 4HVBA 1ET6A 3GP7A 1E90A 1OEYA 3H7PB 2AX5A 3ETRA 3T8MA 1S1QB 2J53A 4MH8A 5CHFA 1BMLC 2QILA 3L17A 4GIVA 2J7QB 1UF0A 3DHIC 3KYDD 4OVVA 1FXAA 1UGJA 2XNAC 2BS4B 2MSED 1GC6A 3A9KA 4MSQB 3KWLA 4MT5A 2LGIA 3P2BA 4KIKB 4UDUC 3R2IA 2WXGA 2KC2A 3PRMB 3VHTC 4W9CA 2WP9B 2PTLA 1CMXB 2CJNA 1E7PB 2ZCBA 2R2OA 1DYQA 5LXIB 3AEDB 4MJSA 4E74A 2AQ1B 1F77A 1AWDA 1YX6B 3VH4B 3QQ8B 2CR5A 1XCTL 4W9IA 4MM3A 5DPWA 2C60A 1L0YB 1KH0A 2KQSA 4KZCA 5JZEB 3T3NA 2LJ5A 3RZFA 2NTSA 4MDKE 1TS4A 2A4ZA 4NPNA 3VUYA 1SSNA 1V1PB 1WE7A 3GZNB 1YN3A 2G3QB 2CJOA 4ANXA 3U7ZA 3N3KB 1QOBA 2MP2B 2G4SA 4BVUC 4KZ0A 1WMHB 1Y56A 2UU7A 3NY5A 1VJKA 1SBBB 2INNE 3PGEA 4CO7A 4HPLB 3AU4A 4OZAA 3N32A 1GOZA 3V6CB 4EKUA 2XN9C 1QF6A 1TYGB 4K7WA 4L1BA 1N5XA 4RGNA 2MX2A 3ZNHB 2ZPYA 1YX5B 2MW5A 3OWEB 2V3NA 2V1YA 3L54A 3ZYYX 2KVRA 1IPGA 4M00A 1ESFA 2GLSA 1NDDA 4HPMB 3ZNZB 2IGHA 3DBRI 4ICVA 4W9KA 4HRSA 3TBLD 1MPEA 3RNAC 2CKHB 1BXTA 3N1XC 3NS1A 3VAWA 4P16A 3WALA 3FILB 1YQ4B 1NI3A 3L10B 5L83A 1V86A 4EE2A 4AQ7A 3AE4B 4PYZA 1T0YA 1KRHA 3E9SA 2KMAA 1T0RC 4WWOA 3VUWA 2JZZA 2G1EA 2KJHB 3RZWC 1AN8A 2PEAA 3DQVA 3NZSA 2RDGA 4ARIA 2LUEA 4KX6B 3L08A 1YOVB 2MBHA 2WXLA 2LEKA 2BGFA 4NAWA 3BY4B 2ONQA 3ZW3A 2YVCA 4K81A 1YMHE 3C0RB 3NJTA 1J7CA 2MJEA 1F0ZA 2M0XA 4YTPB 2LHDA 2N1VA 1JWSD 4YTNB 1XCQL 1SGHA 3AE9B 2OHFA 4A9AA 4FN2A 5D3IB 4ZRKA 1D3ZA 3IXSA 2OEDA 5D6JB 3EFCA 3VH3B 3PS6A 4LLGM 3ZXVA 4FHJA 1I4XA 4A6QA 4RFBA 4HJGE 2HDEA 2VZKD 3Q69A 1V5OA 2WDQB 1EWYC 1TY2A 4GXBA 2IYDB 2LGXA 3VRBB 3DBLB 4DHJB 1A5RA 1VZ8A 1Q0WB 1WGYA 3BVZA 4XYCA 3BZDB 2RPVA 3R7RA 3EECA 3RN9C 4EEWA 1YJIA 1QLBB 3LXFA 2GBJA 2QSDA 1C4AA 2KHWB 3ZJTA 2C9WB 3Q3FA 4RF0A 2KWDA 1TKEA 1PGAA 1TT5B 1KJTA 1QT9A 3CSFA 5C2TB 5BYRA 2UYZB 3K9PB 2L3ZA 1ZUD2 3Q3OC 4JGHB 4JX1C 2KFKA 2PIAA 2C5LC 5HG2A 3WA0A 1RLFA 1FIQA 1GJZA 3ZDTA 4OVUA 3MTNB 2W54A 3ABVB 3NS8A 1K50A 4FHKA 3GB1A 3P4QB 4BOSC 1P7FA 3Q8BA 4ANWA 2RMMA 3HM3A 2HJ1A 4NJ7A 1WJNA 3UINB 3L16A 3KUCB 1T0QC 1U4AA 3J9CA 1EO6A 1VCBA 2K39A 4XC2A 4XGAB 3RMKC 3DVGX 1C9FA 1IP9A 1VZ6A 4NJ6A 4XDDA 3WIMA 1J8CA 2NPTA 3GE8C 2K9XA 4M02A 3PRZA 4C4VB 1FRDA 3DBLI 3P42A 3W2DA 3IG3A 1NI2A 2WU2B 3QK0A 5AZGA 3I57A 1QOAA 3SR6A 1JQ4A 4FADA 1KM7A 3PLUA 1KF6B 2Z59B 1FCCC 4ANVA 1N63A 2KTFA 3O65B 3LYYA 4FLHA 2JZ3B 1SIJA 2BPSA 2KX3A 1VRAB 3U8ZA 4IG7B 2LASA 4QAYA 4C7YA 5D2MB 3BINA 2Y5CA 1MVKA 4ZRQA 4II3B 3BVGA 4MACA 4BKGA 1D5MC 4JWUC 2ZJDA 1V49A 3MHSD 5BYQA 2IGDA 2K1FA 5BO4B 3B0AA 2A5UA 4GDKB 1UZXB 1K52A 3AEGB 4IW0A 3ZGZA 1GG3A 1JWMD 3AEAB 2Y5BB 3ENEA 3FKYA 1XF5L 2GBKA 3ZDMC 4TQ1A 4LNOA 4AWJA 2NR2A 2PVGC 1KOTA 1VZ7A 3Q14C 3IBEA 2GB1A 3CIRB 1OQQA 1LXDA 5H92C 2YEPB 2LJIA 2OJWA 3V05A 1P1AA 4YWGG 4W9JA 3ZKJC 1V6EA 4BBNC 4KKJA 1M94A 2LRUA 1IUEA 3M3JA 2I2YA 1PFDA 3W9CB 4C80A 4LNFA 1J7AA 4HPPA 1T5XD 3E56A 3NRZA 4LK0M 2PMVA 2H89B 2LRWA 3CF6E 2MH7A 3I9V1 2MBEA 3GOEA 3MJWA 4OW0A 4DK5A 5BMIA 2MCNB 2D10A 4B95A 2IBIB 4WWMA 2NBWB 3JVZX 3QX1A 2V3SA 1P3QU 1TS5A 5G2NA 2K0PA 2BKRB 3FC4A 4TSSA 1E8WA 2L7RA 4TQ0A 1L0VB 4KGSA 2CS4A 5IOIA 2QIEB 2D5GA 1FXIA 2BF8B 1RAXA 3H8HA 3LDZE 1TZ1A 1ZE3D 2WX0A 4RGTA 5LXHA 2FCQA 3H6NA 1WSPA 1SE9A 4W9DA 2ZW1A 2YEPF 3AE5B 4XZ4A 2WYQA 3VDZA 3AEEB 2O6VB 5KHOA 2IY0B 1WF9A 3QHTA 1WGRA 2BWFA 1WH3A 3AE7B 2WXKA 1VR9A 3VQIA 2O2VA 1UWXA 3LB8C 2IO0B 1HZ6A 1EUVB 4ZYNA 3Q8EA 1WXAA 1SE3A 2BW2A 2L8JA 2W3SA 3U7DA 2LXCA 1JW9D 1LGRA 1UELA 4HEA1 2R2QA 4KDIC 4HCPB 2INDC 3OG5A 2KZRA 1LQBA 1SF0A 3NVVA 1XLOA 3JYUA 3TCAA 4KVGB 3HK0A 3KVFB 2JXXA 2WXQA 3NVZA 2FNJB 2NVUI 2XK5B 3AI5A 3AMZA 3H7PA 1UGMA 2M8SA 4L2YA 5EE1A 4NQKE 4YTMB 2E6XA 3KUZA 4WQMA 2KFJA 5C23A 1E8ZA 5AZHA 2K8HA 2QMTA 3D32A 3PO0A 1YNTE 2QDFA 3ZXRA 1OFFA 3SHQA 4A55A 1TIFA 4GN1A 3ZO5B 1HTOA 4YSYB 1V8CA 4NNJB 2ZW0A 1FO4A 4GDLA 4JWSC 3H9DA 4KIKA 4EFOA 2N7JA 4TMAB 1R4NI 2W82A 3IVFA 4IUMB 4RNAA 4F8CB 1XD3B 2JRHA 1V80A 2AQ3B 2WXMA 3W1YA 1G6JA 2ZNVB 2J0MA 2M1MA 2K6DB 3LJ3A 2V3PA 3M95A 5KHQA 1WYGA 3ML9A 3PHXB 3SFEB 5BMHA 5G5HA 2KN5A 2YLMA 4MGYE 1N61A 2L1AA 2VH1A 2DYOA 1HTQA 1FPYA 3CWIA 1C78A 3IFWB 1YN5A 3CSTA 3O13A 4PK1A 1C76A 2D3BA 2BB5A 5H8YE 2XEWA 2LWPA 3DVNU 2L00B 3BIID 3BWUD 4PT5A 1SJED 2W55A 2K8BA 2WXOA 3EA6A 1YN4A 2MP2A 2GBMA 2L32A 2PLPA 5IN7A 4FA6A 4RGMA 5L95C 4IWQA 1WM3A 2Z8LA 2JYEA 3Q3NC 2SAKA 4GSWA 3UQAA 3DBRB 3OLMD 1FNVA 3I63C 1FNWA 3OAWA 4XX5A 5J17A 3M63B 4GGQA 4EUTA 4F7ZA 1MHHE 3B2GA 2HJ8A 4LNNA 2PKOA 2M56B 2LGDA 5LLIA 3N1YC 2WNMA 3PVLA 2L83A 4ITKA 4MGIE 2WDRB 1L7YA 3N9YC 5DPTA 3PHWB 1FM0D 2BWES 3X0WA 1NENB 3BYYB 2VH2A 2IO1B 2FAZA 2K5PA 4O1NA 4ZRJA 4TKNA 3AE6B 5AEKB 4MH0E 4W9FA 1XLNA 3RNCC 1WX9A 5IP4D 2DZIA 1CZPA 4HDQA 3A1QB 4AS1A 3ZIMA 1BUIC 3U2SC 3HUIA 1E7UA 2WGSA 1D6EC 3EFUA 4G0NB 4DXAB 1F2RC 2KDFB 4G50A 4P1CC 2X8XX 2DENB 5CHWA 2J52A 1SE4A 2D3CA 4HROA 4A3PA 4MJSB 4S0RA 5IO9A 4RF1A 2FCNA 4ASWC 4I6PA 2MJDA 2LHEA 5CHVC 2D2QA 4MM3B 5DPSA 4EZJA 3TUOA 2MLBA 4EZKA 2AL3A 3EC8A 2D3AA 4E71A 1ENFA 2N9LA 2OOBB 2RPQA 1GB4A 4WJPA 2WLBA 1V5TA 4RM8A 3UIOB 2Q5WD 4HXDA 2ON8A 1JMLA 2X38A 4HDOA 4PS8A 2ASQA 3DHHC 2EMTA 3RNGC 4LNIA 1WWTA 2DNFA 2PJHA 3B9JA 1YJ1A 5DPRA 3HVZA 2DYMA 1WXMA 4HCNB 1IYFA 1ACCA 1P0RA 4XWWA 2J4XA 3PLVA 3APFA 4XWTA 3FAHA 2KQ4X 2Y3AA 1RWSA 5EDSA 4JE3B 1NYRA 3TEYA 4RGOS 4XDCA 2D3GA 2CU3A 3AXCA 3AN1A 1T6BX 4OHJA 2LGSA 3UQBA 3ZQ4A 1Z2MA 2KTRB 1N62A 2KLGA 4C7ZA 4REZA 3URYA 1WGHA 1IBXB 2MA9B 2L52A 1Q1OA 1H4RA 2IZVB 3SD5A 2W9NA 3AE2B 3SDLC 3AECB 3Q3JA 3TEXA 4WURA 2MBOA 1PYWD 2WDTB 1TBEA 3DWMA 2JRIB 1SB3C 5EE0A 5E6PA 3NHEB 3TJPA 2G4DB 1TZOA 1FFUA 1JALA 1UH6A 5D7GA 3PRPB 1BT0A 4M0WB 1JWAD 4C4VA 4HKQA 2FCMA 3H1UA 3EHVA 4NQLB 4NAWB 1WXSA 3R2TA 1HZ5A 4I6LB 4S17A 3JSVB 5HHDG 1WI0A 5J18A 2LMCA 4AP4C 4K1RB 1XLPA 2FE8A 3V3XA 4ZHPA 3I3TB 4WJQA 1XEEA 4ICUA 4P6VF 1I4HA 2L76A 2NCNA 1L4ZB 3X23A 1C3TA 3ECIA 1Q5WB 4RM9A 4LJOB 4M8MA 3A9JB 2Y5PA 4BBNF 2RD0A 3BK2A 2JY6A 4WH4A 4DDID 2D07B 2MEKA 2BT6A 5E6OA 1GPXA 2DAJA 1AARA 3DHGC 2WXNA 2N7DA 4RCOA 5TSSA 3SFDB 4GDKA 2WXFA 3QCAA 4DHZE 3AH7A 2LVOA 1QOFA 3EUB2 2L05A 2O6VD 2N9XA 1IGDA 1PGXA 2GBNA 2L0TA 3AB5A 4ZRPA 1WX8A 3OJ4B 3AE1B 3PPAA 3DOWA 3RNBC 4NJCA 2TSSA 2IO2B 2WXIA 1IGCA 3OJ3A 1MHXA 1WJ6A 3MC8A 1YD8U 3N20C 2FIDA 3A33B 5J2RA 3L4PA 2PVOD 2V4IB 4BOZB 2WWZA 4C56C 1RRBA 3APCA 4XE0A 1MJDA 1DOIA 2WX1A 1LM8B 2RSUA 3RCZA 4HWIB 2IJ0A 3P4SB 4FJVB 4H2AA 2KLCA 1YQBA 3AU5A 3A4SC 1I4PA 3W5VB 1E9MA 2NMQA 3KYCD 2GBRA 4M8NA 4X57B 3BK1A 4WQOB 2RDHA 3AE8B 2WXPA 3DBHB 4FULA 1F9JA 2ICIA 4LDTB 1ZKHA 1OEYJ 2M17A 2KC1A 3JW0X 1UBIA 1WM2A 2DZJA 5HFYA 2O6VA 1EF5A 4BKSD 2AQ2B 3ZTDA 5IKCM 2IPKD 3RYTA 4GB9A 3I5JC 1ZXIA 3RFZB 3NOBA 2MBQA 1C77A 3UI3A 1WGDA 4IDIA 1VD2A 5JH5C 2GOWA 1EM7A 4IM3A 3KLSX 1V9JA 4EOYA 1SIFA 1X1MA 5FR3A 3KWVA 3N30A 4R3DA 4ZHOA 1L0XB 3P1MA 2CU1A 2NTTA 1WR6E 4A90A 5C1ZA 1R4MI 2KAJA 1DGJA 2KDBA 1MG4A 4GOCA 2N9EB 2BS3B 2G45B 4J3OD 1HE8A 4WWNA 3UIPB 2JUOA 3BYTB 3TEZA 2WQYB 4AJYB 3A4RA 4K3CA 2LD9A 5CX3A 2XK5A 4KSKC 1OQRA 1I42A 2KJ6A 4OZCA 2JWUA 3AV8A 4PS7A 2N9KA 1UWMA 3DVNV 3DBHI 4PS3A 3NVYA 1B9RA 1UNSA 4MEMA 1R4NB 4US9A 3P4PB 2LI5A 5G5GA 4A8XC 2KK8A 4N58A 2LXAA 1JWUD 2ZZPB 1QILA 1WY8A 1FD6A 2HTME 3ZNGC 3MC0B 3V6EB 3RULA 1STEA 1L2NA 1WZ3A 3UGBB 4JPSA 3HVDA 4ZRIA 4BKSA 3RPFC 1EU4A 4ZYSA 4IM2A 1LO5D 2Z0EB 3QJZA 1E0ZA 2D11A 1GAQB 1L6VA 2V9HA 1DOYA 2ACZB 2QCZA 4B9KA 4DDGD 1EU3A 2ZPNA 3R8BA 2B3AA 2KN4A 1QOGA 1TTNA 2HE7A 3DVGY 1NVID 1L4DB 3RNEC 3ONSA 2FCSA 3NG0A 3TEWA 2M4NA 4OZBA 4L23A 3IAM1 1I4GA 2JQRB 2KWVB 3PSEB 3GS2A 3ZNID 5FKAC 4WJNA 4P1BC 2J0JA 2KDEB 1C4PA 1E8YA 3M62B 4KKIA 1K8RB 3R3MA 1WE6A 2KX0A 2DYBA 2DWQA 4LNKA 1ZOYB 4AOFA 1P98A 1T3QA 2KT7A 2N7EA 1KLUD 2JVCA 2H88B 4K3BA 2LVQA 1FCLA 3RI7C 2K22A 4MSMB 1XXGA 1ROEA 2KMMA 3VR9B 3ZVVA 3WCQA 4A20A 4II2B 1GUAB 4IC7B 4FXCA 1PDXA 2DZMA 2N4FA 3T9LA 4NZLB 3P4RB 2JPHA 3ZUNA 2I38A 2J0KA 5G55A 3MHZA 2K3UA 4ZDVA 2NBVB 3QC8B 1V1PA 1SE2A 4HK2A 2C7MB 5E6NA 2N9PC 1J7BA 1MG8A 1TS2A 1AW7A 3Q8CA 1WMHA 4LCDE 2KJRA 3V60A 2GI9A 1LFDA 2BKFA 4BKTA 4GDLB 1WRDB 4KDLB 2V0GA 4YXDB 2PW9A 3KW5B 5FR6A 1PUTA 3A1QA 2I1JA 2MHJA 2WS3B 3DCGA 3VUXA 2WXHA 2KO3A 2JF5A 2QC8A 4LJPB 1NEKB 1B1ZA 1TKYA 4DXFA 1F2RI 2WU5B 3AULA 1WGKA 3NUHB 2M0AA 3U30A 3PZDA 1NYQA 1OGWA 2GRIA 1ET9A 1E10A 1FEHA 3N1ZC 3SU8X 2KDIA 5IA7A 4K7SA 2BB6A 2JT4B 3FILA 4W9LA 4F1SA 1RM6C 4WWPA 4DHJD 3T3OA 1EF1A 2WHIA 4RH6A 3EGRA 1XQQA 3WAPA 1E7VA 1KLGD 1KTKA 3A9KB 3BVMA 5CTRC 2DBYA 2L0FA 1MI0A 2WXJA 3DPDA 1FFVA 2AEHA 1WGGA 2ZEQA 1QKZA 3ZLZA 2KXJA 2EKIA 2Z0DB 4N6EB 2FUHB 5FK9C 4JLCA 3KH0A 3AE3B 1HEZE 2JX5A 1JROA 3RD2A 4KSLC 3Q8FA 1WIAA 3WANA 4CYEA 3MJ5A 2BYVE 3TMPB 5DCNA 1YJJA 2MJ3A 3VRAB 1RFAA 1R7SA 1D5XC 2KNBA 1WXQA 1RFKA 1I4QA 3S2AA 4JQWC 4M01A 2MQJA 4BFRA 2BBCA 3HRDD 4URKA 3NZ3A 2ZNVC 4B6WA 4N9F4 3RUIB 1XO3A 1N60A 4GLSC 1ZDXA 4JL9A 2KTRA 5TR5A 1D4BA 5BMGA 1IBXA 1UUPA 4BAXA 5BYSA 2BTEA 2K6QA 3C19A 4YT0B 2BQQA 4GU2A 5JHAA 2UWQA 1GB1A 2VRRB 2CHWA 4IWPA 3PREA 2I1KA 4HKZE 3HIZA 1OTRB 2KD0A 2EMSA 3VTWA 3GZNI 1WFYA 2SEBD 4Q2JA 4WAAA 1E6EB 4LTUA 5EE3A 3AEBB 4M0WA 2J42A 3H7SA 3NVWA 4DHZB 3UF8A 3IAS1 1XLQA 2DZKA 4TV3A 1C1YB 1L6UA 1D5ZC 2DAFA 3JSVA 2WXRA 4YSZB 2KDMA 3HM6X 1JRUA 3QA8A 3RT3B 3B1LX 1V97A 3ZTCA 3PTFC 3WAMA 2LZ6A 1KFYB 4FJYA 4ZOHC 4MGZE 2RDBC 3A9JA 1TJEA 1J0GA 1TGZB 1CJEA 1WYWB 4LDTD 4RMAA 5D94A 2NBUA 4IKGA 3NZUA 2HTHA 3VTUA 3W1SA 4W9EA 1GC7A 2KACA 3KQ4A 4HJKA 1PGBA 1VDVA 2RGFA 3TIXA 4W9GA 2QHOA 4D2KA 3PT2B 4CQNA 1S3SG 2GMIC 3QWZB 2KVZA 4OVZA 1QQRA 2PPHA 3ALBA 5EE9A 3RNFC 4USAA 2IGGA 4IWOA 4MELA 2RR9A 1SXTA 2QJLA 2PE9A 3R66C 3W5UB 4J6IA 3PZ8A 1N6ZA 4B0EA 4HLEA 2LFIA 4YL8A 3TSSA 1SJHD 1EWCA 3L0WB 1FMAD 2INPE 3CMMB 3L13A 4KV2A 3ZJUA 4IOIE 1HA5A 4DQOC 3V62A 1C79A 2BYTA 3K9OB 4KGTA 1TY0A 2K25A 2C7HA 5JHBA 4DBGA 4WJOA 3GE3C 1V1OA 1M4VA 1JCKB 3Q3MC 1ISNA 3VTVA 3DBSA 4MGKE 4A3OA 1FRRA 2KFKB 1TKGA 3VR8B 2W3RA 4AUQC 3P63A 3VXWA 4C00A 1WRIA 2IDYA 4FBJB 1JWBD 1UBQA 4W9HA 3KUDB 1R4MB 3QAQA 1FXTB 1XT9B 1P7EA 2KKCA 3VVWB 4NAMA 2AYOB 4AJWA 5AUIA 5MPOA 4US8A 1F52A 4WAFA 2EKEC 5C3JB 3U4EG 1CQVA 2FIFA 1ZGUB 3IT6B 3QARA 1L5PA 1GNUA 4CHKA 4DWFA 2K8CA 5E6JA 3ZJVA 1H8CA 3IHPC 3MC9A 3R7QA 2LUMA 5GXGB 2ZCCA 5GMVA 5IAAC 3WAOA 1I7HA 2VZKB 3SEBA 2NPTB 3PZ7A 4G3XB 3TL5A 2BYFA 3AM9A 1WXVA 2DHZA 1HXYD
chains in the Genus database with same CATH topology
3QIJA 3R7RA 3EECA 4GMVA 3M62B 1WZ0A 4EEWA 2DZIA 1K8RB 3R3MA 2C7NB 2GBJA 4HDQA 3A1QB 1WE6A 2KX0A 2DYBA 2KHWB 3ZIMA 2C9WB 3Q3FA 4AOFA 2CHXA 1E7UA 1P98A 5HKHA 1KJTA 2N7EA 3CSFA 4EZLA 2JVCA 2UYZB 3EFUA 2HD5B 3K9PB 4G0NB 2L3ZA 3VFKA 4DXAB 4JGHB 2LVQA 2AL6A 2KDFB 2N1WA 4G50A 1J19A 1PQSA 2KFKA 2C5LC 4MSMB 2DENB 2BYEA 3WA0A 1RLFA 1GJZA 3APDA 5CHWA 3ZDTA 3ZVVA 4OVUA 4ANUA 4A20A 4II2B 4A3PA 1GUAB 4MJSB 3MTNB 3NS8A 4IC7B 2FCNA 4FHKA 2JWZA 1I35A 4BOSC 1ZW7A 4ASWC 4I6PA 2DZMA 3HHMA 5CHVC 4ANWA 2N4FA 3T9LA 2IY1B 2D2QA 1NBFC 5DPSA 3HM3A 4EZJA 1YIWA 4NJ7A 2JPHA 2MLBA 2ZVNA 3ZUNA 4EZKA 1UD7A 2AL3A 2NS5A 1WJNA 2J0KA 3EC8A 2LVPA 3UINB 3L16A 4TUUA 3KUCB 2KWUB 4E71A 5G55A 1U4AA 4E3CA 4FJZA 2OOBB 1EO6A 1VCBA 2RPQA 2K39A 4XC2A 4WJPA 4RM8A 1V5TA 2KQ7A 1WJ4A 2NBVB 3QC8B 3DVGX 4ZDVA 1IP9A 3UIOB 4HK2A 4HXDA 1V2YA 2C7MB 5E6NA 2N9PC 3W1SC 4NJ6A 4PS8A 1MG8A 4HDOA 4K7UA 3WIMA 1J8CA 2ASQA 2NPTA 1WMHA 2EMTA 4LCDE 3PRZA 3DBLI 2KJRA 3DDCB 3V60A 2KWCA 3IG3A 4NY0A 2PJHA 1LFDA 1NI2A 2BKFA 3QK0A 5AZGA 1YJ1A 5DPRA 4BKTA 4GDLB 1WRDB 2DYMA 4G11A 1WXMA 4KDLB 3PV1A 4PYUA 3KW5B 2PE6B 3A1QA 4HCNB 5FR6A 4FADA 1IYFA 1KM7A 2I1JA 1P0RA 3DCGA 3PLUA 3VUXA 3PLVA 2LGYA 2Z59B 2MBBB 3APFA 4ANVA 1E5WA 2KO3A 2JF5A 2KTFA 3O65B 4LJPB 4JIOU 4FLHA 5EDSA 2JZ3B 2KX3A 2BPSA 2D3GA 3U8ZA 4IG7B 2LASA 3AXCA 2KMCA 5D2MB 3AULA 3BINA 2V4LA 4II3B 4BKGA 3U30A 3PZDA 1KLVA 2ZJDA 3UQBA 4IM0A 1OGWA 1QZEA 1V49A 3MHSD 2K1FA 1Z2MA 5BO4B 2KTRB 3B0AA 2KLGA 3ML8A 2A5UA 3SU8X 1WGHA 2MA9B 2KDIA 5IA7A 2KOXA 4GDKB 2AWTA 1Q1OA 4K7SA 1UZXB 1H4RA 1P9DU 1OQYA 1WX7A 2IO3B 2IZVB 2JT4B 3SD5A 1Z5SB 4W9LA 4F1SA 4IW0A 2W9NA 1GG3A 4I6NB 4WWPA 4DHJD 2Y5BB 1EF1A 3ENEA 3B08A 4P7IA 3SDLC 2CHZA 1XQQA 3Q3JA 3WAPA 1E7VA 2MBOA 2WDTB 2GBKA 1TBEA 3A9KB 3ZDMC 5CTRC 2JRIB 4TQ1A 2L0FA 4AWJA 2NR2A 1Y8RC 3DPDA 1KOTA 2O2VB 2AEHA 1WGGA 2ZEQA 3IBEA 5E6PA 3NHEB 1E8XA 5AZFA 3TJPA 2KXJA 3ZLZA 2G4DB 3ZRCA 2Z0DB 1LXDA 2FUHB 4JLCA 1UH6A 3ZRFA 2ZVOA 3KH0A 1V81A 5D7GA 1P1AA 3PRPB 1BT0A 1WJUA 4M0WB 3RD2A 4W9JA 4KSLC 3ZKJC 2OJRA 2KANA 1V6EA 2MRPA 2REXA 1WIAA 1WR1A 2FCMA 2DX5B 3WANA 1M94A 3H1UA 4CYEA 3EHVA 2BYVE 4NAWB 4NQLB 3TMPB 2LRUA 3M3JA 1WXSA 5DCNA 4I6LB 3JSVB 1WI0A 5J18A 4AP4C 2MWSB 4K1RB 1RFAA 2LRWA 2XBBC 3CF6E 3I3TB 4WJQA 3V61A 2KNBA 2MBEA 4ICUA 4HVBA 3GOEA 3MJWA 2L76A 4DK5A 2NCNA 3X23A 2MCNB 1C3TA 2D10A 3ECIA 1Q5WB 2IBIB 3S2AA 2NBWB 3JVZX 3QX1A 4B95A 2V3SA 1P3QU 1E90A 2MQJA 4JQWC 4RM9A 4BFRA 4LJOB 1OEYA 5G2NA 4URKA 4M8MA 2BKRB 2ZNVC 3H7PB 4B6WA 3A9JB 4N9F4 1E8WA 4BBNF 2L7RA 3RUIB 4TQ0A 2RD0A 3T8MA 1S1QB 2JY6A 4DDID 2D07B 2CS4A 5E6OA 2DAJA 1AARA 5CHFA 4JL9A 2BF8B 1RAXA 2KTRA 2N7DA 5TR5A 3LDZE 1TZ1A 1E8YA 2WX0A 3L17A 5LXHA 2FCQA 4GDKA 3H6NA 3QCAA 4GIVA 4DHZE 2J7QB 1SE9A 2LVOA 2K6QA 4W9DA 2L05A 2O6VD 2N9XA 3KYDD 4OVVA 2WYQA 2GBNA 4GU2A 2L0TA 4XZ4A 5JHAA 3VDZA 2MSED 2UWQA 2O6VB 1WX8A 3OJ4B 1GC6A 5KHOA 2IY0B 1WF9A 3PPAA 3A9KA 3QHTA 4MSQB 1WGRA 2VRRB 2BWFA 1WH3A 2CHWA 4IWPA 3DOWA 3PREA 2I1KA 3VQIA 3HIZA 3P2BA 1OTRB 2KD0A 2EMSA 4KIKB 2IO2B 2O2VA 3VTWA 3GZNI 1WFYA 2IO0B 1EUVB 2KC2A 3PRMB 3VHTC 4WAAA 4W9CA 4ZYNA 3OJ3A 1WJ6A 1YD8U 2FIDA 3A33B 5J2RA 1WXAA 1CMXB 2ZCBA 3H7SA 4BOZB 2WWZA 4DHZB 1RRBA 3UF8A 2L8JA 2R2OA 3APCA 3U7DA 2LXCA 2WX1A 2DZKA 1LM8B 4TV3A 1C1YB 2RSUA 5LXIB 1UELA 2DAFA 2R2QA 3JSVA 3RCZA 4HWIB 4MJSA 4E74A 4KDIC 4HCPB 3HM6X 1JRUA 3QA8A 4FJVB 3RT3B 2KZRA 3B1LX 2KLCA 1YQBA 3AU5A 1LQBA 3A4SC 1YX6B 3VH4B 3QQ8B 3ZTCA 3PTFC 2CR5A 4W9IA 4MM3A 3JYUA 3WAMA 3TCAA 5DPWA 4KVGB 3HK0A 2LZ6A 3KVFB 2C60A 2JXXA 3KYCD 2GBRA 4FJYA 4M8NA 4MGZE 4X57B 2FNJB 2NVUI 2KQSA 2XK5B 3AI5A 3H7PA 4KZCA 1UGMA 2M8SA 3A9JA 4WQOB 5JZEB 2LJ5A 3RZFA 1J0GA 4MDKE 1TGZB 4FULA 1WYWB 4NQKE 4LDTD 1F9JA 3KUZA 2A4ZA 4NPNA 3VUYA 2KFJA 1WE7A 1E8ZA 5AZHA 4RMAA 5C23A 2K8HA 3D32A 5D94A 2NBUA 4LDTB 1ZKHA 3NZUA 2G3QB 1OEYJ 2HTHA 2M17A 4ANXA 3VTUA 2KC1A 2MP2B 3N3KB 4W9EA 3W1SA 1GC7A 2G4SA 3JW0X 4BVUC 4KZ0A 1WMHB 4HJKA 3SHQA 1UBIA 1WM2A 2DZJA 2RGFA 3NY5A 4GN1A 3TIXA 3ZO5B 4W9GA 2O6VA 2QHOA 1EF5A 3PT2B 4BKSD 1S3SG 3ZTDA 2GMIC 3PGEA 4CO7A 4HPLB 3AU4A 3RYTA 4GB9A 4NNJB 3N32A 4GDLA 3QWZB 3V6CB 4EKUA 3NOBA 2MBQA 3H9DA 4KIKA 4EFOA 4K7WA 1WGDA 1VD2A 2PPHA 1R4NI 5JH5C 3IVFA 2GOWA 2MX2A 3ALBA 3ZNHB 2ZPYA 4IUMB 4IM3A 1YX5B 2MW5A 4F8CB 1V9JA 4EOYA 1SIFA 2V1YA 3L54A 1XD3B 1X1MA 2JRHA 1V80A 4IWOA 3W1YA 2KVRA 4MELA 1IPGA 1G6JA 2RR9A 2ZNVB 2J0MA 2M1MA 2PE9A 3R66C 2K6DB 3LJ3A 3M95A 5KHQA 1NDDA 3N30A 4HPMB 3ZNZB 3ML9A 3DBRI 2CU1A 4J6IA 4ICVA 3PHXB 4W9KA 1WR6E 4HLEA 3TBLD 4YL8A 5C1ZA 2KN5A 1R4MI 2YLMA 2KDBA 4MGYE 2CKHB 4GOCA 2N9EB 3L0WB 3VAWA 2G45B 3WALA 1HE8A 2DYOA 4WWNA 3UIPB 3CMMB 3L13A 3L10B 2JUOA 4KV2A 5L83A 1V86A 3IFWB 4AJYB 3A4RA 3CSTA 2LD9A 3V62A 5CX3A 2XK5A 3K9OB 4KSKC 4PYZA 2XEWA 1I42A 1T0YA 2KJ6A 2LWPA 3DVNU 2L00B 4PS7A 2K25A 3DVNV 3DBHI 2C7HA 2KMAA 4PS3A 5JHBA 4DBGA 4WWOA 3VUWA 2JZZA 2K8BA 4WJOA 4MEMA 2KJHB 2LI5A 2KK8A 3RZWC 2LXAA 2MP2A 2GBMA 2PEAA 1ISNA 3VTVA 4FA6A 5L95C 3DBSA 4IWQA 2ZZPB 4MGKE 3DQVA 3NZSA 1WY8A 3ZNGC 1WM3A 3V6EB 4A3OA 2LUEA 3L08A 2KFKB 2MBHA 4GSWA 3RULA 1L2NA 1WZ3A 3UQAA 2BGFA 3OLMD 4AUQC 4NAWA 3VXWA 3BY4B 3UGBB 4FBJB 3ZW3A 3OAWA 2YVCA 4XX5A 1UBQA 4K81A 4ZRIA 4W9HA 4BKSA 3M63B 5J17A 4GGQA 4EUTA 3KUDB 4F7ZA 3QAQA 1FXTB 3C0RB 1XT9B 4IM2A 2KKCA 3VVWB 2Z0EB 2M0XA 3QJZA 2AYOB 2D11A 2HJ8A 4AJWA 2N1VA 2LGDA 2EKEC 1SGHA 5LLIA 4FN2A 2FIFA 4ZRKA 1ZGUB 3QARA 3PVLA 1GNUA 4B9KA 4DDGD 1D3ZA 2ZPNA 2B3AA 4MGIE 1L7YA 1TTNA 2HE7A 3DVGY 4CHKA 4DWFA 5DPTA 3ONSA 2K8CA 5D6JB 2FCSA 3VH3B 3PHWB 3PS6A 2BWES 3X0WA 1H8CA 3IHPC 2M4NA 4FHJA 2IO1B 3R7QA 2FAZA 2ZCCA 2KWVB 1V5OA 5GMVA 4ZRJA 5IAAC 3WAOA 4TKNA 5AEKB 2NPTB 4GXBA 2IYDB 2LGXA 4G3XB 4MH0E 3PSEB 4W9FA 3TL5A 3ZNID 4WJNA 2BYFA 4DHJB 2J0JA 1A5RA 1WXVA 2DHZA 1Q0WB 1WGYA 2KDEB 4BBNC 1WX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QIJ A;  3R7R A;  3EEC A;  4GMV A;  3M62 B;  1WZ0 A;  4EEW A;  2DZI A;  1K8R B;  3R3M A;  2C7N B;  2GBJ A;  4HDQ A;  3A1Q B;  1WE6 A;  2KX0 A;  2DYB A;  2KHW B;  3ZIM A;  2C9W B;  3Q3F A;  4AOF A;  2CHX A;  1E7U A;  1P98 A;  5HKH A;  1KJT A;  2N7E A;  3CSF A;  4EZL A;  2JVC A;  2UYZ B;  3EFU A;  2HD5 B;  3K9P B;  4G0N B;  2L3Z A;  3VFK A;  4DXA B;  4JGH B;  2LVQ A;  2AL6 A;  2KDF B;  2N1W A;  4G50 A;  1J19 A;  1PQS A;  2KFK A;  2C5L C;  4MSM B;  2DEN B;  2BYE A;  3WA0 A;  1RLF A;  1GJZ A;  3APD A;  5CHW A;  3ZDT A;  3ZVV A;  4OVU A;  4ANU A;  4A20 A;  4II2 B;  4A3P A;  1GUA B;  4MJS B;  3MTN B;  3NS8 A;  4IC7 B;  2FCN A;  4FHK A;  2JWZ A;  1I35 A;  4BOS C;  1ZW7 A;  4ASW C;  4I6P A;  2DZM A;  3HHM A;  5CHV C;  4ANW A;  2N4F A;  3T9L A;  2IY1 B;  2D2Q A;  1NBF C;  5DPS A;  3HM3 A;  4EZJ A;  1YIW A;  4NJ7 A;  2JPH A;  2MLB A;  2ZVN A;  3ZUN A;  4EZK A;  1UD7 A;  2AL3 A;  2NS5 A;  1WJN A;  2J0K A;  3EC8 A;  2LVP A;  3UIN B;  3L16 A;  4TUU A;  3KUC B;  2KWU B;  4E71 A;  5G55 A;  1U4A A;  4E3C A;  4FJZ A;  2OOB B;  1EO6 A;  1VCB A;  2RPQ A;  2K39 A;  4XC2 A;  4WJP A;  4RM8 A;  1V5T A;  2KQ7 A;  1WJ4 A;  2NBV B;  3QC8 B;  3DVG X;  4ZDV A;  1IP9 A;  3UIO B;  4HK2 A;  4HXD A;  1V2Y A;  2C7M B;  5E6N A;  2N9P C;  3W1S C;  4NJ6 A;  4PS8 A;  1MG8 A;  4HDO A;  4K7U A;  3WIM A;  1J8C A;  2ASQ A;  2NPT A;  1WMH A;  2EMT A;  4LCD E;  3PRZ A;  3DBL I;  2KJR A;  3DDC B;  3V60 A;  2KWC A;  3IG3 A;  4NY0 A;  2PJH A;  1LFD A;  1NI2 A;  2BKF A;  3QK0 A;  5AZG A;  1YJ1 A;  5DPR A;  4BKT A;  4GDL B;  1WRD B;  2DYM A;  4G11 A;  1WXM A;  4KDL B;  3PV1 A;  4PYU A;  3KW5 B;  2PE6 B;  3A1Q A;  4HCN B;  5FR6 A;  4FAD A;  1IYF A;  1KM7 A;  2I1J A;  1P0R A;  3DCG A;  3PLU A;  3VUX A;  3PLV A;  2LGY A;  2Z59 B;  2MBB B;  3APF A;  4ANV A;  1E5W A;  2KO3 A;  2JF5 A;  2KTF A;  3O65 B;  4LJP B;  4JIO U;  4FLH A;  5EDS A;  2JZ3 B;  2KX3 A;  2BPS A;  2D3G A;  3U8Z A;  4IG7 B;  2LAS A;  3AXC A;  2KMC A;  5D2M B;  3AUL A;  3BIN A;  2V4L A;  4II3 B;  4BKG A;  3U30 A;  3PZD A;  1KLV A;  2ZJD A;  3UQB A;  4IM0 A;  1OGW A;  1QZE A;  1V49 A;  3MHS D;  2K1F A;  1Z2M A;  5BO4 B;  2KTR B;  3B0A A;  2KLG A;  3ML8 A;  2A5U A;  3SU8 X;  1WGH A;  2MA9 B;  2KDI A;  5IA7 A;  2KOX A;  4GDK B;  2AWT A;  1Q1O A;  4K7S A;  1UZX B;  1H4R A;  1P9D U;  1OQY A;  1WX7 A;  2IO3 B;  2IZV B;  2JT4 B;  3SD5 A;  1Z5S B;  4W9L A;  4F1S A;  4IW0 A;  2W9N A;  1GG3 A;  4I6N B;  4WWP A;  4DHJ D;  2Y5B B;  1EF1 A;  3ENE A;  3B08 A;  4P7I A;  3SDL C;  2CHZ A;  1XQQ A;  3Q3J A;  3WAP A;  1E7V A;  2MBO A;  2WDT B;  2GBK A;  1TBE A;  3A9K B;  3ZDM C;  5CTR C;  2JRI B;  4TQ1 A;  2L0F A;  4AWJ A;  2NR2 A;  1Y8R C;  3DPD A;  1KOT A;  2O2V B;  2AEH A;  1WGG A;  2ZEQ A;  3IBE A;  5E6P A;  3NHE B;  1E8X A;  5AZF A;  3TJP A;  2KXJ A;  3ZLZ A;  2G4D B;  3ZRC A;  2Z0D B;  1LXD A;  2FUH B;  4JLC A;  1UH6 A;  3ZRF A;  2ZVO A;  3KH0 A;  1V81 A;  5D7G A;  1P1A A;  3PRP B;  1BT0 A;  1WJU A;  4M0W B;  3RD2 A;  4W9J A;  4KSL C;  3ZKJ C;  2OJR A;  2KAN A;  1V6E A;  2MRP A;  2REX A;  1WIA A;  1WR1 A;  2FCM A;  2DX5 B;  3WAN A;  1M94 A;  3H1U A;  4CYE A;  3EHV A;  2BYV E;  4NAW B;  4NQL B;  3TMP B;  2LRU A;  3M3J A;  1WXS A;  5DCN A;  4I6L B;  3JSV B;  1WI0 A;  5J18 A;  4AP4 C;  2MWS B;  4K1R B;  1RFA A;  2LRW A;  2XBB C;  3CF6 E;  3I3T B;  4WJQ A;  3V61 A;  2KNB A;  2MBE A;  4ICU A;  4HVB A;  3GOE A;  3MJW A;  2L76 A;  4DK5 A;  2NCN A;  3X23 A;  2MCN B;  1C3T A;  2D10 A;  3ECI A;  1Q5W B;  2IBI B;  3S2A A;  2NBW B;  3JVZ X;  3QX1 A;  4B95 A;  2V3S A;  1P3Q U;  1E90 A;  2MQJ A;  4JQW C;  4RM9 A;  4BFR A;  4LJO B;  1OEY A;  5G2N A;  4URK A;  4M8M A;  2BKR B;  2ZNV C;  3H7P B;  4B6W A;  3A9J B;  4N9F 4;  1E8W A;  4BBN F;  2L7R A;  3RUI B;  4TQ0 A;  2RD0 A;  3T8M A;  1S1Q B;  2JY6 A;  4DDI D;  2D07 B;  2CS4 A;  5E6O A;  2DAJ A;  1AAR A;  5CHF A;  4JL9 A;  2BF8 B;  1RAX A;  2KTR A;  2N7D A;  5TR5 A;  3LDZ E;  1TZ1 A;  1E8Y A;  2WX0 A;  3L17 A;  5LXH A;  2FCQ A;  4GDK A;  3H6N A;  3QCA A;  4GIV A;  4DHZ E;  2J7Q B;  1SE9 A;  2LVO A;  2K6Q A;  4W9D A;  2L05 A;  2O6V D;  2N9X A;  3KYD D;  4OVV A;  2WYQ A;  2GBN A;  4GU2 A;  2L0T A;  4XZ4 A;  5JHA A;  3VDZ A;  2MSE D;  2UWQ A;  2O6V B;  1WX8 A;  3OJ4 B;  1GC6 A;  5KHO A;  2IY0 B;  1WF9 A;  3PPA A;  3A9K A;  3QHT A;  4MSQ B;  1WGR A;  2VRR B;  2BWF A;  1WH3 A;  2CHW A;  4IWP A;  3DOW A;  3PRE A;  2I1K A;  3VQI A;  3HIZ A;  3P2B A;  1OTR B;  2KD0 A;  2EMS A;  4KIK B;  2IO2 B;  2O2V A;  3VTW A;  3GZN I;  1WFY A;  2IO0 B;  1EUV B;  2KC2 A;  3PRM B;  3VHT C;  4WAA A;  4W9C A;  4ZYN A;  3OJ3 A;  1WJ6 A;  1YD8 U;  2FID A;  3A33 B;  5J2R A;  1WXA A;  1CMX B;  2ZCB A;  3H7S A;  4BOZ B;  2WWZ A;  4DHZ B;  1RRB A;  3UF8 A;  2L8J A;  2R2O A;  3APC A;  3U7D A;  2LXC A;  2WX1 A;  2DZK A;  1LM8 B;  4TV3 A;  1C1Y B;  2RSU A;  5LXI B;  1UEL A;  2DAF A;  2R2Q A;  3JSV A;  3RCZ A;  4HWI B;  4MJS A;  4E74 A;  4KDI C;  4HCP B;  3HM6 X;  1JRU A;  3QA8 A;  4FJV B;  3RT3 B;  2KZR A;  3B1L X;  2KLC A;  1YQB A;  3AU5 A;  1LQB A;  3A4S C;  1YX6 B;  3VH4 B;  3QQ8 B;  3ZTC A;  3PTF C;  2CR5 A;  4W9I A;  4MM3 A;  3JYU A;  3WAM A;  3TCA A;  5DPW A;  4KVG B;  3HK0 A;  2LZ6 A;  3KVF B;  2C60 A;  2JXX A;  3KYC D;  2GBR A;  4FJY A;  4M8N A;  4MGZ E;  4X57 B;  2FNJ B;  2NVU I;  2KQS A;  2XK5 B;  3AI5 A;  3H7P A;  4KZC A;  1UGM A;  2M8S A;  3A9J A;  4WQO B;  5JZE B;  2LJ5 A;  3RZF A;  1J0G A;  4MDK E;  1TGZ B;  4FUL A;  1WYW B;  4NQK E;  4LDT D;  1F9J A;  3KUZ A;  2A4Z A;  4NPN A;  3VUY A;  2KFJ A;  1WE7 A;  1E8Z A;  5AZH A;  4RMA A;  5C23 A;  2K8H A;  3D32 A;  5D94 A;  2NBU A;  4LDT B;  1ZKH A;  3NZU A;  2G3Q B;  1OEY J;  2HTH A;  2M17 A;  4ANX A;  3VTU A;  2KC1 A;  2MP2 B;  3N3K B;  4W9E A;  3W1S A;  1GC7 A;  2G4S A;  3JW0 X;  4BVU C;  4KZ0 A;  1WMH B;  4HJK A;  3SHQ A;  1UBI A;  1WM2 A;  2DZJ A;  2RGF A;  3NY5 A;  4GN1 A;  3TIX A;  3ZO5 B;  4W9G A;  2O6V A;  2QHO A;  1EF5 A;  3PT2 B;  4BKS D;  1S3S G;  3ZTD A;  2GMI C;  3PGE A;  4CO7 A;  4HPL B;  3AU4 A;  3RYT A;  4GB9 A;  4NNJ B;  3N32 A;  4GDL A;  3QWZ B;  3V6C B;  4EKU A;  3NOB A;  2MBQ A;  3H9D A;  4KIK A;  4EFO A;  4K7W A;  1WGD A;  1VD2 A;  2PPH A;  1R4N I;  5JH5 C;  3IVF A;  2GOW A;  2MX2 A;  3ALB A;  3ZNH B;  2ZPY A;  4IUM B;  4IM3 A;  1YX5 B;  2MW5 A;  4F8C B;  1V9J A;  4EOY A;  1SIF A;  2V1Y A;  3L54 A;  1XD3 B;  1X1M A;  2JRH A;  1V80 A;  4IWO A;  3W1Y A;  2KVR A;  4MEL A;  1IPG A;  1G6J A;  2RR9 A;  2ZNV B;  2J0M A;  2M1M A;  2PE9 A;  3R66 C;  2K6D B;  3LJ3 A;  3M95 A;  5KHQ A;  1NDD A;  3N30 A;  4HPM B;  3ZNZ B;  3ML9 A;  3DBR I;  2CU1 A;  4J6I A;  4ICV A;  3PHX B;  4W9K A;  1WR6 E;  4HLE A;  3TBL D;  4YL8 A;  5C1Z A;  2KN5 A;  1R4M I;  2YLM A;  2KDB A;  4MGY E;  2CKH B;  4GOC A;  2N9E B;  3L0W B;  3VAW A;  2G45 B;  3WAL A;  1HE8 A;  2DYO A;  4WWN A;  3UIP B;  3CMM B;  3L13 A;  3L10 B;  2JUO A;  4KV2 A;  5L83 A;  1V86 A;  3IFW B;  4AJY B;  3A4R A;  3CST A;  2LD9 A;  3V62 A;  5CX3 A;  2XK5 A;  3K9O B;  4KSK C;  4PYZ A;  2XEW A;  1I42 A;  1T0Y A;  2KJ6 A;  2LWP A;  3DVN U;  2L00 B;  4PS7 A;  2K25 A;  3DVN V;  3DBH I;  2C7H A;  2KMA A;  4PS3 A;  5JHB A;  4DBG A;  4WWO A;  3VUW A;  2JZZ A;  2K8B A;  4WJO A;  4MEM A;  2KJH B;  2LI5 A;  2KK8 A;  3RZW C;  2LXA A;  2MP2 A;  2GBM A;  2PEA A;  1ISN A;  3VTV A;  4FA6 A;  5L95 C;  3DBS A;  4IWQ A;  2ZZP B;  4MGK E;  3DQV A;  3NZS A;  1WY8 A;  3ZNG C;  1WM3 A;  3V6E B;  4A3O A;  2LUE A;  3L08 A;  2KFK B;  2MBH A;  4GSW A;  3RUL A;  1L2N A;  1WZ3 A;  3UQA A;  2BGF A;  3OLM D;  4AUQ C;  4NAW A;  3VXW A;  3BY4 B;  3UGB B;  4FBJ B;  3ZW3 A;  3OAW A;  2YVC A;  4XX5 A;  1UBQ A;  4K81 A;  4ZRI A;  4W9H A;  4BKS A;  3M63 B;  5J17 A;  4GGQ A;  4EUT A;  3KUD B;  4F7Z A;  3QAQ A;  1FXT B;  3C0R B;  1XT9 B;  4IM2 A;  2KKC A;  3VVW B;  2Z0E B;  2M0X A;  3QJZ A;  2AYO B;  2D11 A;  2HJ8 A;  4AJW A;  2N1V A;  2LGD A;  2EKE C;  1SGH A;  5LLI A;  4FN2 A;  2FIF A;  4ZRK A;  1ZGU B;  3QAR A;  3PVL A;  1GNU A;  4B9K A;  4DDG D;  1D3Z A;  2ZPN A;  2B3A A;  4MGI E;  1L7Y A;  1TTN A;  2HE7 A;  3DVG Y;  4CHK A;  4DWF A;  5DPT A;  3ONS A;  2K8C A;  5D6J B;  2FCS A;  3VH3 B;  3PHW B;  3PS6 A;  2BWE S;  3X0W A;  1H8C A;  3IHP C;  2M4N A;  4FHJ A;  2IO1 B;  3R7Q A;  2FAZ A;  2ZCC A;  2KWV B;  1V5O A;  5GMV A;  4ZRJ A;  5IAA C;  3WAO A;  4TKN A;  5AEK B;  2NPT B;  4GXB A;  2IYD B;  2LGX A;  4G3X B;  4MH0 E;  3PSE B;  4W9F A;  3TL5 A;  3ZNI D;  4WJN A;  2BYF A;  4DHJ B;  2J0J A;  1A5R A;  1WXV A;  2DHZ A;  1Q0W B;  1WGY A;  2KDE B;  4BBN C;  1WX9 A; 
#chains in the Genus database with same CATH topology
 3QIJ A;  4GMV A;  1WZ0 A;  2C7N B;  1A70 A;  4N59 A;  1JRP A;  1T0S C;  2CHX A;  5HKH A;  3DWG C;  4EZL A;  1K51 A;  2HD5 B;  3VFK A;  3Q2A C;  2AL6 A;  5JXV A;  2N1W A;  1J19 A;  1PQS A;  2JU6 X;  4WIP A;  1Q10 A;  2BYE A;  3APD A;  3AEF B;  4ANU A;  3B2F A;  3MFG A;  3Q6B A;  1SEB D;  3U52 E;  2G9H D;  2JWZ A;  1I35 A;  2B76 B;  4B0M A;  1ZW7 A;  3HHM A;  2IY1 B;  1NBF C;  3IT4 B;  1CK1 A;  1I4R A;  1YIW A;  2ZVN A;  1UD7 A;  2QEJ C;  2NS5 A;  1AYF A;  2LVP A;  4TUU A;  1DOX A;  2KWU B;  1K53 A;  4E3C A;  1HQR D;  4FJZ A;  3MP9 A;  2KQ7 A;  1WJ4 A;  1RYJ A;  1V2Y A;  2JXT A;  3W1S C;  4K7U A;  4DXG A;  2R61 A;  2BVC A;  3DDC B;  2KWC A;  4NY0 A;  5HI1 A;  1TS3 A;  4G11 A;  2BS2 B;  1N5W A;  3PV1 A;  4PYU A;  2PE6 B;  5D3D A;  1VLB A;  2LGY A;  2MBB B;  1E5W A;  4JIO U;  4YSX B;  2KMC A;  4ACF A;  5LNK 1;  1ZXH A;  2V4L A;  2DLB A;  1KLV A;  1C4C A;  4IM0 A;  1QZE A;  1ZPS A;  2E3T A;  2KYW A;  2EEL A;  3ML8 A;  1F1H A;  1ZP0 B;  2M19 A;  4ARC A;  2KOX A;  2AWT A;  5T8I A;  1FNU A;  1P9D U;  1OQY A;  1WX7 A;  2FUG 1;  2IO3 B;  1Z5S B;  4I6N B;  2JSV X;  3B08 A;  4P7I A;  1ZDV A;  2CHZ A;  2INC C;  4BZA A;  3Q8A A;  5I4D A;  1Y8R C;  2O2V B;  2N0S B;  5AZF A;  1E8X A;  3ZRC A;  2JYT A;  2WDV B;  3ZRF A;  2ZVO A;  1V81 A;  1WJU A;  4KGR A;  2OJR A;  2KAN A;  2MRP A;  5AUK A;  2REX A;  1WR1 A;  2DX5 B;  1YQ3 B;  1MFW A;  2JZP A;  2MWS B;  2FBW B;  2XBB C;  3V61 A;  3C8Y A;  4HVB A;  1ET6 A;  3GP7 A;  1E90 A;  1OEY A;  3H7P B;  2AX5 A;  3ETR A;  3T8M A;  1S1Q B;  2J53 A;  4MH8 A;  5CHF A;  1BML C;  2QIL A;  3L17 A;  4GIV A;  2J7Q B;  1UF0 A;  3DHI C;  3KYD D;  4OVV A;  1FXA A;  1UGJ A;  2XNA C;  2BS4 B;  2MSE D;  1GC6 A;  3A9K A;  4MSQ B;  3KWL A;  4MT5 A;  2LGI A;  3P2B A;  4KIK B;  4UDU C;  3R2I A;  2WXG A;  2KC2 A;  3PRM B;  3VHT C;  4W9C A;  2WP9 B;  2PTL A;  1CMX B;  2CJN A;  1E7P B;  2ZCB A;  2R2O A;  1DYQ A;  5LXI B;  3AED B;  4MJS A;  4E74 A;  2AQ1 B;  1F77 A;  1AWD A;  1YX6 B;  3VH4 B;  3QQ8 B;  2CR5 A;  1XCT L;  4W9I A;  4MM3 A;  5DPW A;  2C60 A;  1L0Y B;  1KH0 A;  2KQS A;  4KZC A;  5JZE B;  3T3N A;  2LJ5 A;  3RZF A;  2NTS A;  4MDK E;  1TS4 A;  2A4Z A;  4NPN A;  3VUY A;  1SSN A;  1V1P B;  1WE7 A;  3GZN B;  1YN3 A;  2G3Q B;  2CJO A;  4ANX A;  3U7Z A;  3N3K B;  1QOB A;  2MP2 B;  2G4S A;  4BVU C;  4KZ0 A;  1WMH B;  1Y56 A;  2UU7 A;  3NY5 A;  1VJK A;  1SBB B;  2INN E;  3PGE A;  4CO7 A;  4HPL B;  3AU4 A;  4OZA A;  3N32 A;  1GOZ A;  3V6C B;  4EKU A;  2XN9 C;  1QF6 A;  1TYG B;  4K7W A;  4L1B A;  1N5X A;  4RGN A;  2MX2 A;  3ZNH B;  2ZPY A;  1YX5 B;  2MW5 A;  3OWE B;  2V3N A;  2V1Y A;  3L54 A;  3ZYY X;  2KVR A;  1IPG A;  4M00 A;  1ESF A;  2GLS A;  1NDD A;  4HPM B;  3ZNZ B;  2IGH A;  3DBR I;  4ICV A;  4W9K A;  4HRS A;  3TBL D;  1MPE A;  3RNA C;  2CKH B;  1BXT A;  3N1X C;  3NS1 A;  3VAW A;  4P16 A;  3WAL A;  3FIL B;  1YQ4 B;  1NI3 A;  3L10 B;  5L83 A;  1V86 A;  4EE2 A;  4AQ7 A;  3AE4 B;  4PYZ A;  1T0Y A;  1KRH A;  3E9S A;  2KMA A;  1T0R C;  4WWO A;  3VUW A;  2JZZ A;  2G1E A;  2KJH B;  3RZW C;  1AN8 A;  2PEA A;  3DQV A;  3NZS A;  2RDG A;  4ARI A;  2LUE A;  4KX6 B;  3L08 A;  1YOV B;  2MBH A;  2WXL A;  2LEK A;  2BGF A;  4NAW A;  3BY4 B;  2ONQ A;  3ZW3 A;  2YVC A;  4K81 A;  1YMH E;  3C0R B;  3NJT A;  1J7C A;  2MJE A;  1F0Z A;  2M0X A;  4YTP B;  2LHD A;  2N1V A;  1JWS D;  4YTN B;  1XCQ L;  1SGH A;  3AE9 B;  2OHF A;  4A9A A;  4FN2 A;  5D3I B;  4ZRK A;  1D3Z A;  3IXS A;  2OED A;  5D6J B;  3EFC A;  3VH3 B;  3PS6 A;  4LLG M;  3ZXV A;  4FHJ A;  1I4X A;  4A6Q A;  4RFB A;  4HJG E;  2HDE A;  2VZK D;  3Q69 A;  1V5O A;  2WDQ B;  1EWY C;  1TY2 A;  4GXB A;  2IYD B;  2LGX A;  3VRB B;  3DBL B;  4DHJ B;  1A5R A;  1VZ8 A;  1Q0W B;  1WGY A;  3BVZ A;  4XYC A;  3BZD B;  2RPV A;  3R7R A;  3EEC A;  3RN9 C;  4EEW A;  1YJI A;  1QLB B;  3LXF A;  2GBJ A;  2QSD A;  1C4A A;  2KHW B;  3ZJT A;  2C9W B;  3Q3F A;  4RF0 A;  2KWD A;  1TKE A;  1PGA A;  1TT5 B;  1KJT A;  1QT9 A;  3CSF A;  5C2T B;  5BYR A;  2UYZ B;  3K9P B;  2L3Z A;  1ZUD 2;  3Q3O C;  4JGH B;  4JX1 C;  2KFK A;  2PIA A;  2C5L C;  5HG2 A;  3WA0 A;  1RLF A;  1FIQ A;  1GJZ A;  3ZDT A;  4OVU A;  3MTN B;  2W54 A;  3ABV B;  3NS8 A;  1K50 A;  4FHK A;  3GB1 A;  3P4Q B;  4BOS C;  1P7F A;  3Q8B A;  4ANW A;  2RMM A;  3HM3 A;  2HJ1 A;  4NJ7 A;  1WJN A;  3UIN B;  3L16 A;  3KUC B;  1T0Q C;  1U4A A;  3J9C A;  1EO6 A;  1VCB A;  2K39 A;  4XC2 A;  4XGA B;  3RMK C;  3DVG X;  1C9F A;  1IP9 A;  1VZ6 A;  4NJ6 A;  4XDD A;  3WIM A;  1J8C A;  2NPT A;  3GE8 C;  2K9X A;  4M02 A;  3PRZ A;  4C4V B;  1FRD A;  3DBL I;  3P42 A;  3W2D A;  3IG3 A;  1NI2 A;  2WU2 B;  3QK0 A;  5AZG A;  3I57 A;  1QOA A;  3SR6 A;  1JQ4 A;  4FAD A;  1KM7 A;  3PLU A;  1KF6 B;  2Z59 B;  1FCC C;  4ANV A;  1N63 A;  2KTF A;  3O65 B;  3LYY A;  4FLH A;  2JZ3 B;  1SIJ A;  2BPS A;  2KX3 A;  1VRA B;  3U8Z A;  4IG7 B;  2LAS A;  4QAY A;  4C7Y A;  5D2M B;  3BIN A;  2Y5C A;  1MVK A;  4ZRQ A;  4II3 B;  3BVG A;  4MAC A;  4BKG A;  1D5M C;  4JWU C;  2ZJD A;  1V49 A;  3MHS D;  5BYQ A;  2IGD A;  2K1F A;  5BO4 B;  3B0A A;  2A5U A;  4GDK B;  1UZX B;  1K52 A;  3AEG B;  4IW0 A;  3ZGZ A;  1GG3 A;  1JWM D;  3AEA B;  2Y5B B;  3ENE A;  3FKY A;  1XF5 L;  2GBK A;  3ZDM C;  4TQ1 A;  4LNO A;  4AWJ A;  2NR2 A;  2PVG C;  1KOT A;  1VZ7 A;  3Q14 C;  3IBE A;  2GB1 A;  3CIR B;  1OQQ A;  1LXD A;  5H92 C;  2YEP B;  2LJI A;  2OJW A;  3V05 A;  1P1A A;  4YWG G;  4W9J A;  3ZKJ C;  1V6E A;  4BBN C;  4KKJ A;  1M94 A;  2LRU A;  1IUE A;  3M3J A;  2I2Y A;  1PFD A;  3W9C B;  4C80 A;  4LNF A;  1J7A A;  4HPP A;  1T5X D;  3E56 A;  3NRZ A;  4LK0 M;  2PMV A;  2H89 B;  2LRW A;  3CF6 E;  2MH7 A;  3I9V 1;  2MBE A;  3GOE A;  3MJW A;  4OW0 A;  4DK5 A;  5BMI A;  2MCN B;  2D10 A;  4B95 A;  2IBI B;  4WWM A;  2NBW B;  3JVZ X;  3QX1 A;  2V3S A;  1P3Q U;  1TS5 A;  5G2N A;  2K0P A;  2BKR B;  3FC4 A;  4TSS A;  1E8W A;  2L7R A;  4TQ0 A;  1L0V B;  4KGS A;  2CS4 A;  5IOI A;  2QIE B;  2D5G A;  1FXI A;  2BF8 B;  1RAX A;  3H8H A;  3LDZ E;  1TZ1 A;  1ZE3 D;  2WX0 A;  4RGT A;  5LXH A;  2FCQ A;  3H6N A;  1WSP A;  1SE9 A;  4W9D A;  2ZW1 A;  2YEP F;  3AE5 B;  4XZ4 A;  2WYQ A;  3VDZ A;  3AEE B;  2O6V B;  5KHO A;  2IY0 B;  1WF9 A;  3QHT A;  1WGR A;  2BWF A;  1WH3 A;  3AE7 B;  2WXK A;  1VR9 A;  3VQI A;  2O2V A;  1UWX A;  3LB8 C;  2IO0 B;  1HZ6 A;  1EUV B;  4ZYN A;  3Q8E A;  1WXA A;  1SE3 A;  2BW2 A;  2L8J A;  2W3S A;  3U7D A;  2LXC A;  1JW9 D;  1LGR A;  1UEL A;  4HEA 1;  2R2Q A;  4KDI C;  4HCP B;  2IND C;  3OG5 A;  2KZR A;  1LQB A;  1SF0 A;  3NVV A;  1XLO A;  3JYU A;  3TCA A;  4KVG B;  3HK0 A;  3KVF B;  2JXX A;  2WXQ A;  3NVZ A;  2FNJ B;  2NVU I;  2XK5 B;  3AI5 A;  3AMZ A;  3H7P A;  1UGM A;  2M8S A;  4L2Y A;  5EE1 A;  4NQK E;  4YTM B;  2E6X A;  3KUZ A;  4WQM A;  2KFJ A;  5C23 A;  1E8Z A;  5AZH A;  2K8H A;  2QMT A;  3D32 A;  3PO0 A;  1YNT E;  2QDF A;  3ZXR A;  1OFF A;  3SHQ A;  4A55 A;  1TIF A;  4GN1 A;  3ZO5 B;  1HTO A;  4YSY B;  1V8C A;  4NNJ B;  2ZW0 A;  1FO4 A;  4GDL A;  4JWS C;  3H9D A;  4KIK A;  4EFO A;  2N7J A;  4TMA B;  1R4N I;  2W82 A;  3IVF A;  4IUM B;  4RNA A;  4F8C B;  1XD3 B;  2JRH A;  1V80 A;  2AQ3 B;  2WXM A;  3W1Y A;  1G6J A;  2ZNV B;  2J0M A;  2M1M A;  2K6D B;  3LJ3 A;  2V3P A;  3M95 A;  5KHQ A;  1WYG A;  3ML9 A;  3PHX B;  3SFE B;  5BMH A;  5G5H A;  2KN5 A;  2YLM A;  4MGY E;  1N61 A;  2L1A A;  2VH1 A;  2DYO A;  1HTQ A;  1FPY A;  3CWI A;  1C78 A;  3IFW B;  1YN5 A;  3CST A;  3O13 A;  4PK1 A;  1C76 A;  2D3B A;  2BB5 A;  5H8Y E;  2XEW A;  2LWP A;  3DVN U;  2L00 B;  3BII D;  3BWU D;  4PT5 A;  1SJE D;  2W55 A;  2K8B A;  2WXO A;  3EA6 A;  1YN4 A;  2MP2 A;  2GBM A;  2L32 A;  2PLP A;  5IN7 A;  4FA6 A;  4RGM A;  5L95 C;  4IWQ A;  1WM3 A;  2Z8L A;  2JYE A;  3Q3N C;  2SAK A;  4GSW A;  3UQA A;  3DBR B;  3OLM D;  1FNV A;  3I63 C;  1FNW A;  3OAW A;  4XX5 A;  5J17 A;  3M63 B;  4GGQ A;  4EUT A;  4F7Z A;  1MHH E;  3B2G A;  2HJ8 A;  4LNN A;  2PKO A;  2M56 B;  2LGD A;  5LLI A;  3N1Y C;  2WNM A;  3PVL A;  2L83 A;  4ITK A;  4MGI E;  2WDR B;  1L7Y A;  3N9Y C;  5DPT A;  3PHW B;  1FM0 D;  2BWE S;  3X0W A;  1NEN B;  3BYY B;  2VH2 A;  2IO1 B;  2FAZ A;  2K5P A;  4O1N A;  4ZRJ A;  4TKN A;  3AE6 B;  5AEK B;  4MH0 E;  4W9F A;  1XLN A;  3RNC C;  1WX9 A;  5IP4 D;  2DZI A;  1CZP A;  4HDQ A;  3A1Q B;  4AS1 A;  3ZIM A;  1BUI C;  3U2S C;  3HUI A;  1E7U A;  2WGS A;  1D6E C;  3EFU A;  4G0N B;  4DXA B;  1F2R C;  2KDF B;  4G50 A;  4P1C C;  2X8X X;  2DEN B;  5CHW A;  2J52 A;  1SE4 A;  2D3C A;  4HRO A;  4A3P A;  4MJS B;  4S0R A;  5IO9 A;  4RF1 A;  2FCN A;  4ASW C;  4I6P A;  2MJD A;  2LHE A;  5CHV C;  2D2Q A;  4MM3 B;  5DPS A;  4EZJ A;  3TUO A;  2MLB A;  4EZK A;  2AL3 A;  3EC8 A;  2D3A A;  4E71 A;  1ENF A;  2N9L A;  2OOB B;  2RPQ A;  1GB4 A;  4WJP A;  2WLB A;  1V5T A;  4RM8 A;  3UIO B;  2Q5W D;  4HXD A;  2ON8 A;  1JML A;  2X38 A;  4HDO A;  4PS8 A;  2ASQ A;  3DHH C;  2EMT A;  3RNG C;  4LNI A;  1WWT A;  2DNF A;  2PJH A;  3B9J A;  1YJ1 A;  5DPR A;  3HVZ A;  2DYM A;  1WXM A;  4HCN B;  1IYF A;  1ACC A;  1P0R A;  4XWW A;  2J4X A;  3PLV A;  3APF A;  4XWT A;  3FAH A;  2KQ4 X;  2Y3A A;  1RWS A;  5EDS A;  4JE3 B;  1NYR A;  3TEY A;  4RGO S;  4XDC A;  2D3G A;  2CU3 A;  3AXC A;  3AN1 A;  1T6B X;  4OHJ A;  2LGS A;  3UQB A;  3ZQ4 A;  1Z2M A;  2KTR B;  1N62 A;  2KLG A;  4C7Z A;  4REZ A;  3URY A;  1WGH A;  1IBX B;  2MA9 B;  2L52 A;  1Q1O A;  1H4R A;  2IZV B;  3SD5 A;  2W9N A;  3AE2 B;  3SDL C;  3AEC B;  3Q3J A;  3TEX A;  4WUR A;  2MBO A;  1PYW D;  2WDT B;  1TBE A;  3DWM A;  2JRI B;  1SB3 C;  5EE0 A;  5E6P A;  3NHE B;  3TJP A;  2G4D B;  1TZO A;  1FFU A;  1JAL A;  1UH6 A;  5D7G A;  3PRP B;  1BT0 A;  4M0W B;  1JWA D;  4C4V A;  4HKQ A;  2FCM A;  3H1U A;  3EHV A;  4NQL B;  4NAW B;  1WXS A;  3R2T A;  1HZ5 A;  4I6L B;  4S17 A;  3JSV B;  5HHD G;  1WI0 A;  5J18 A;  2LMC A;  4AP4 C;  4K1R B;  1XLP A;  2FE8 A;  3V3X A;  4ZHP A;  3I3T B;  4WJQ A;  1XEE A;  4ICU A;  4P6V F;  1I4H A;  2L76 A;  2NCN A;  1L4Z B;  3X23 A;  1C3T A;  3ECI A;  1Q5W B;  4RM9 A;  4LJO B;  4M8M A;  3A9J B;  2Y5P A;  4BBN F;  2RD0 A;  3BK2 A;  2JY6 A;  4WH4 A;  4DDI D;  2D07 B;  2MEK A;  2BT6 A;  5E6O A;  1GPX A;  2DAJ A;  1AAR A;  3DHG C;  2WXN A;  2N7D A;  4RCO A;  5TSS A;  3SFD B;  4GDK A;  2WXF A;  3QCA A;  4DHZ E;  3AH7 A;  2LVO A;  1QOF A;  3EUB 2;  2L05 A;  2O6V D;  2N9X A;  1IGD A;  1PGX A;  2GBN A;  2L0T A;  3AB5 A;  4ZRP A;  1WX8 A;  3OJ4 B;  3AE1 B;  3PPA A;  3DOW A;  3RNB C;  4NJC A;  2TSS A;  2IO2 B;  2WXI A;  1IGC A;  3OJ3 A;  1MHX A;  1WJ6 A;  3MC8 A;  1YD8 U;  3N20 C;  2FID A;  3A33 B;  5J2R A;  3L4P A;  2PVO D;  2V4I B;  4BOZ B;  2WWZ A;  4C56 C;  1RRB A;  3APC A;  4XE0 A;  1MJD A;  1DOI A;  2WX1 A;  1LM8 B;  2RSU A;  3RCZ A;  4HWI B;  2IJ0 A;  3P4S B;  4FJV B;  4H2A A;  2KLC A;  1YQB A;  3AU5 A;  3A4S C;  1I4P A;  3W5V B;  1E9M A;  2NMQ A;  3KYC D;  2GBR A;  4M8N A;  4X57 B;  3BK1 A;  4WQO B;  2RDH A;  3AE8 B;  2WXP A;  3DBH B;  4FUL A;  1F9J A;  2ICI A;  4LDT B;  1ZKH A;  1OEY J;  2M17 A;  2KC1 A;  3JW0 X;  1UBI A;  1WM2 A;  2DZJ A;  5HFY A;  2O6V A;  1EF5 A;  4BKS D;  2AQ2 B;  3ZTD A;  5IKC M;  2IPK D;  3RYT A;  4GB9 A;  3I5J C;  1ZXI A;  3RFZ B;  3NOB A;  2MBQ A;  1C77 A;  3UI3 A;  1WGD A;  4IDI A;  1VD2 A;  5JH5 C;  2GOW A;  1EM7 A;  4IM3 A;  3KLS X;  1V9J A;  4EOY A;  1SIF A;  1X1M A;  5FR3 A;  3KWV A;  3N30 A;  4R3D A;  4ZHO A;  1L0X B;  3P1M A;  2CU1 A;  2NTT A;  1WR6 E;  4A90 A;  5C1Z A;  1R4M I;  2KAJ A;  1DGJ A;  2KDB A;  1MG4 A;  4GOC A;  2N9E B;  2BS3 B;  2G45 B;  4J3O D;  1HE8 A;  4WWN A;  3UIP B;  2JUO A;  3BYT B;  3TEZ A;  2WQY B;  4AJY B;  3A4R A;  4K3C A;  2LD9 A;  5CX3 A;  2XK5 A;  4KSK C;  1OQR A;  1I42 A;  2KJ6 A;  4OZC A;  2JWU A;  3AV8 A;  4PS7 A;  2N9K A;  1UWM A;  3DVN V;  3DBH I;  4PS3 A;  3NVY A;  1B9R A;  1UNS A;  4MEM A;  1R4N B;  4US9 A;  3P4P B;  2LI5 A;  5G5G A;  4A8X C;  2KK8 A;  4N58 A;  2LXA A;  1JWU D;  2ZZP B;  1QIL A;  1WY8 A;  1FD6 A;  2HTM E;  3ZNG C;  3MC0 B;  3V6E B;  3RUL A;  1STE A;  1L2N A;  1WZ3 A;  3UGB B;  4JPS A;  3HVD A;  4ZRI A;  4BKS A;  3RPF C;  1EU4 A;  4ZYS A;  4IM2 A;  1LO5 D;  2Z0E B;  3QJZ A;  1E0Z A;  2D11 A;  1GAQ B;  1L6V A;  2V9H A;  1DOY A;  2ACZ B;  2QCZ A;  4B9K A;  4DDG D;  1EU3 A;  2ZPN A;  3R8B A;  2B3A A;  2KN4 A;  1QOG A;  1TTN A;  2HE7 A;  3DVG Y;  1NVI D;  1L4D B;  3RNE C;  3ONS A;  2FCS A;  3NG0 A;  3TEW A;  2M4N A;  4OZB A;  4L23 A;  3IAM 1;  1I4G A;  2JQR B;  2KWV B;  3PSE B;  3GS2 A;  3ZNI D;  5FKA C;  4WJN A;  4P1B C;  2J0J A;  2KDE B;  1C4P A;  1E8Y A;  3M62 B;  4KKI A;  1K8R B;  3R3M A;  1WE6 A;  2KX0 A;  2DYB A;  2DWQ A;  4LNK A;  1ZOY B;  4AOF A;  1P98 A;  1T3Q A;  2KT7 A;  2N7E A;  1KLU D;  2JVC A;  2H88 B;  4K3B A;  2LVQ A;  1FCL A;  3RI7 C;  2K22 A;  4MSM B;  1XXG A;  1ROE A;  2KMM A;  3VR9 B;  3ZVV A;  3WCQ A;  4A20 A;  4II2 B;  1GUA B;  4IC7 B;  4FXC A;  1PDX A;  2DZM A;  2N4F A;  3T9L A;  4NZL B;  3P4R B;  2JPH A;  3ZUN A;  2I38 A;  2J0K A;  5G55 A;  3MHZ A;  2K3U A;  4ZDV A;  2NBV B;  3QC8 B;  1V1P A;  1SE2 A;  4HK2 A;  2C7M B;  5E6N A;  2N9P C;  1J7B A;  1MG8 A;  1TS2 A;  1AW7 A;  3Q8C A;  1WMH A;  4LCD E;  2KJR A;  3V60 A;  2GI9 A;  1LFD A;  2BKF A;  4BKT A;  4GDL B;  1WRD B;  4KDL B;  2V0G A;  4YXD B;  2PW9 A;  3KW5 B;  5FR6 A;  1PUT A;  3A1Q A;  2I1J A;  2MHJ A;  2WS3 B;  3DCG A;  3VUX A;  2WXH A;  2KO3 A;  2JF5 A;  2QC8 A;  4LJP B;  1NEK B;  1B1Z A;  1TKY A;  4DXF A;  1F2R I;  2WU5 B;  3AUL A;  1WGK A;  3NUH B;  2M0A A;  3U30 A;  3PZD A;  1NYQ A;  1OGW A;  2GRI A;  1ET9 A;  1E10 A;  1FEH A;  3N1Z C;  3SU8 X;  2KDI A;  5IA7 A;  4K7S A;  2BB6 A;  2JT4 B;  3FIL A;  4W9L A;  4F1S A;  1RM6 C;  4WWP A;  4DHJ D;  3T3O A;  1EF1 A;  2WHI A;  4RH6 A;  3EGR A;  1XQQ A;  3WAP A;  1E7V A;  1KLG D;  1KTK A;  3A9K B;  3BVM A;  5CTR C;  2DBY A;  2L0F A;  1MI0 A;  2WXJ A;  3DPD A;  1FFV A;  2AEH A;  1WGG A;  2ZEQ A;  1QKZ A;  3ZLZ A;  2KXJ A;  2EKI A;  2Z0D B;  4N6E B;  2FUH B;  5FK9 C;  4JLC A;  3KH0 A;  3AE3 B;  1HEZ E;  2JX5 A;  1JRO A;  3RD2 A;  4KSL C;  3Q8F A;  1WIA A;  3WAN A;  4CYE A;  3MJ5 A;  2BYV E;  3TMP B;  5DCN A;  1YJJ A;  2MJ3 A;  3VRA B;  1RFA A;  1R7S A;  1D5X C;  2KNB A;  1WXQ A;  1RFK A;  1I4Q A;  3S2A A;  4JQW C;  4M01 A;  2MQJ A;  4BFR A;  2BBC A;  3HRD D;  4URK A;  3NZ3 A;  2ZNV C;  4B6W A;  4N9F 4;  3RUI B;  1XO3 A;  1N60 A;  4GLS C;  1ZDX A;  4JL9 A;  2KTR A;  5TR5 A;  1D4B A;  5BMG A;  1IBX A;  1UUP A;  4BAX A;  5BYS A;  2BTE A;  2K6Q A;  3C19 A;  4YT0 B;  2BQQ A;  4GU2 A;  5JHA A;  2UWQ A;  1GB1 A;  2VRR B;  2CHW A;  4IWP A;  3PRE A;  2I1K A;  4HKZ E;  3HIZ A;  1OTR B;  2KD0 A;  2EMS A;  3VTW A;  3GZN I;  1WFY A;  2SEB D;  4Q2J A;  4WAA A;  1E6E B;  4LTU A;  5EE3 A;  3AEB B;  4M0W A;  2J42 A;  3H7S A;  3NVW A;  4DHZ B;  3UF8 A;  3IAS 1;  1XLQ A;  2DZK A;  4TV3 A;  1C1Y B;  1L6U A;  1D5Z C;  2DAF A;  3JSV A;  2WXR A;  4YSZ B;  2KDM A;  3HM6 X;  1JRU A;  3QA8 A;  3RT3 B;  3B1L X;  1V97 A;  3ZTC A;  3PTF C;  3WAM A;  2LZ6 A;  1KFY B;  4FJY A;  4ZOH C;  4MGZ E;  2RDB C;  3A9J A;  1TJE A;  1J0G A;  1TGZ B;  1CJE A;  1WYW B;  4LDT D;  4RMA A;  5D94 A;  2NBU A;  4IKG A;  3NZU A;  2HTH A;  3VTU A;  3W1S A;  4W9E A;  1GC7 A;  2KAC A;  3KQ4 A;  4HJK A;  1PGB A;  1VDV A;  2RGF A;  3TIX A;  4W9G A;  2QHO A;  4D2K A;  3PT2 B;  4CQN A;  1S3S G;  2GMI C;  3QWZ B;  2KVZ A;  4OVZ A;  1QQR A;  2PPH A;  3ALB A;  5EE9 A;  3RNF C;  4USA A;  2IGG A;  4IWO A;  4MEL A;  2RR9 A;  1SXT A;  2QJL A;  2PE9 A;  3R66 C;  3W5U B;  4J6I A;  3PZ8 A;  1N6Z A;  4B0E A;  4HLE A;  2LFI A;  4YL8 A;  3TSS A;  1SJH D;  1EWC A;  3L0W B;  1FMA D;  2INP E;  3CMM B;  3L13 A;  4KV2 A;  3ZJU A;  4IOI E;  1HA5 A;  4DQO C;  3V62 A;  1C79 A;  2BYT A;  3K9O B;  4KGT A;  1TY0 A;  2K25 A;  2C7H A;  5JHB A;  4DBG A;  4WJO A;  3GE3 C;  1V1O A;  1M4V A;  1JCK B;  3Q3M C;  1ISN A;  3VTV A;  3DBS A;  4MGK E;  4A3O A;  1FRR A;  2KFK B;  1TKG A;  3VR8 B;  2W3R A;  4AUQ C;  3P63 A;  3VXW A;  4C00 A;  1WRI A;  2IDY A;  4FBJ B;  1JWB D;  1UBQ A;  4W9H A;  3KUD B;  1R4M B;  3QAQ A;  1FXT B;  1XT9 B;  1P7E A;  2KKC A;  3VVW B;  4NAM A;  2AYO B;  4AJW A;  5AUI A;  5MPO A;  4US8 A;  1F52 A;  4WAF A;  2EKE C;  5C3J B;  3U4E G;  1CQV A;  2FIF A;  1ZGU B;  3IT6 B;  3QAR A;  1L5P A;  1GNU A;  4CHK A;  4DWF A;  2K8C A;  5E6J A;  3ZJV A;  1H8C A;  3IHP C;  3MC9 A;  3R7Q A;  2LUM A;  5GXG B;  2ZCC A;  5GMV A;  5IAA C;  3WAO A;  1I7H A;  2VZK B;  3SEB A;  2NPT B;  3PZ7 A;  4G3X B;  3TL5 A;  2BYF A;  3AM9 A;  1WXV A;  2DHZ A;  1HXY D; 
#chains in the Genus database with same CATH homology
 3QIJ A;  3R7R A;  3EEC A;  4GMV A;  3M62 B;  1WZ0 A;  4EEW A;  2DZI A;  1K8R B;  3R3M A;  2C7N B;  2GBJ A;  4HDQ A;  3A1Q B;  1WE6 A;  2KX0 A;  2DYB A;  2KHW B;  3ZIM A;  2C9W B;  3Q3F A;  4AOF A;  2CHX A;  1E7U A;  1P98 A;  5HKH A;  1KJT A;  2N7E A;  3CSF A;  4EZL A;  2JVC A;  2UYZ B;  3EFU A;  2HD5 B;  3K9P B;  4G0N B;  2L3Z A;  3VFK A;  4DXA B;  4JGH B;  2LVQ A;  2AL6 A;  2KDF B;  2N1W A;  4G50 A;  1J19 A;  1PQS A;  2KFK A;  2C5L C;  4MSM B;  2DEN B;  2BYE A;  3WA0 A;  1RLF A;  1GJZ A;  3APD A;  5CHW A;  3ZDT A;  3ZVV A;  4OVU A;  4ANU A;  4A20 A;  4II2 B;  4A3P A;  1GUA B;  4MJS B;  3MTN B;  3NS8 A;  4IC7 B;  2FCN A;  4FHK A;  2JWZ A;  1I35 A;  4BOS C;  1ZW7 A;  4ASW C;  4I6P A;  2DZM A;  3HHM A;  5CHV C;  4ANW A;  2N4F A;  3T9L A;  2IY1 B;  2D2Q A;  1NBF C;  5DPS A;  3HM3 A;  4EZJ A;  1YIW A;  4NJ7 A;  2JPH A;  2MLB A;  2ZVN A;  3ZUN A;  4EZK A;  1UD7 A;  2AL3 A;  2NS5 A;  1WJN A;  2J0K A;  3EC8 A;  2LVP A;  3UIN B;  3L16 A;  4TUU A;  3KUC B;  2KWU B;  4E71 A;  5G55 A;  1U4A A;  4E3C A;  4FJZ A;  2OOB B;  1EO6 A;  1VCB A;  2RPQ A;  2K39 A;  4XC2 A;  4WJP A;  4RM8 A;  1V5T A;  2KQ7 A;  1WJ4 A;  2NBV B;  3QC8 B;  3DVG X;  4ZDV A;  1IP9 A;  3UIO B;  4HK2 A;  4HXD A;  1V2Y A;  2C7M B;  5E6N A;  2N9P C;  3W1S C;  4NJ6 A;  4PS8 A;  1MG8 A;  4HDO A;  4K7U A;  3WIM A;  1J8C A;  2ASQ A;  2NPT A;  1WMH A;  2EMT A;  4LCD E;  3PRZ A;  3DBL I;  2KJR A;  3DDC B;  3V60 A;  2KWC A;  3IG3 A;  4NY0 A;  2PJH A;  1LFD A;  1NI2 A;  2BKF A;  3QK0 A;  5AZG A;  1YJ1 A;  5DPR A;  4BKT A;  4GDL B;  1WRD B;  2DYM A;  4G11 A;  1WXM A;  4KDL B;  3PV1 A;  4PYU A;  3KW5 B;  2PE6 B;  3A1Q A;  4HCN B;  5FR6 A;  4FAD A;  1IYF A;  1KM7 A;  2I1J A;  1P0R A;  3DCG A;  3PLU A;  3VUX A;  3PLV A;  2LGY A;  2Z59 B;  2MBB B;  3APF A;  4ANV A;  1E5W A;  2KO3 A;  2JF5 A;  2KTF A;  3O65 B;  4LJP B;  4JIO U;  4FLH A;  5EDS A;  2JZ3 B;  2KX3 A;  2BPS A;  2D3G A;  3U8Z A;  4IG7 B;  2LAS A;  3AXC A;  2KMC A;  5D2M B;  3AUL A;  3BIN A;  2V4L A;  4II3 B;  4BKG A;  3U30 A;  3PZD A;  1KLV A;  2ZJD A;  3UQB A;  4IM0 A;  1OGW A;  1QZE A;  1V49 A;  3MHS D;  2K1F A;  1Z2M A;  5BO4 B;  2KTR B;  3B0A A;  2KLG A;  3ML8 A;  2A5U A;  3SU8 X;  1WGH A;  2MA9 B;  2KDI A;  5IA7 A;  2KOX A;  4GDK B;  2AWT A;  1Q1O A;  4K7S A;  1UZX B;  1H4R A;  1P9D U;  1OQY A;  1WX7 A;  2IO3 B;  2IZV B;  2JT4 B;  3SD5 A;  1Z5S B;  4W9L A;  4F1S A;  4IW0 A;  2W9N A;  1GG3 A;  4I6N B;  4WWP A;  4DHJ D;  2Y5B B;  1EF1 A;  3ENE A;  3B08 A;  4P7I A;  3SDL C;  2CHZ A;  1XQQ A;  3Q3J A;  3WAP A;  1E7V A;  2MBO A;  2WDT B;  2GBK A;  1TBE A;  3A9K B;  3ZDM C;  5CTR C;  2JRI B;  4TQ1 A;  2L0F A;  4AWJ A;  2NR2 A;  1Y8R C;  3DPD A;  1KOT A;  2O2V B;  2AEH A;  1WGG A;  2ZEQ A;  3IBE A;  5E6P A;  3NHE B;  1E8X A;  5AZF A;  3TJP A;  2KXJ A;  3ZLZ A;  2G4D B;  3ZRC A;  2Z0D B;  1LXD A;  2FUH B;  4JLC A;  1UH6 A;  3ZRF A;  2ZVO A;  3KH0 A;  1V81 A;  5D7G A;  1P1A A;  3PRP B;  1BT0 A;  1WJU A;  4M0W B;  3RD2 A;  4W9J A;  4KSL C;  3ZKJ C;  2OJR A;  2KAN A;  1V6E A;  2MRP A;  2REX A;  1WIA A;  1WR1 A;  2FCM A;  2DX5 B;  3WAN A;  1M94 A;  3H1U A;  4CYE A;  3EHV A;  2BYV E;  4NAW B;  4NQL B;  3TMP B;  2LRU A;  3M3J A;  1WXS A;  5DCN A;  4I6L B;  3JSV B;  1WI0 A;  5J18 A;  4AP4 C;  2MWS B;  4K1R B;  1RFA A;  2LRW A;  2XBB C;  3CF6 E;  3I3T B;  4WJQ A;  3V61 A;  2KNB A;  2MBE A;  4ICU A;  4HVB A;  3GOE A;  3MJW A;  2L76 A;  4DK5 A;  2NCN A;  3X23 A;  2MCN B;  1C3T A;  2D10 A;  3ECI A;  1Q5W B;  2IBI B;  3S2A A;  2NBW B;  3JVZ X;  3QX1 A;  4B95 A;  2V3S A;  1P3Q U;  1E90 A;  2MQJ A;  4JQW C;  4RM9 A;  4BFR A;  4LJO B;  1OEY A;  5G2N A;  4URK A;  4M8M A;  2BKR B;  2ZNV C;  3H7P B;  4B6W A;  3A9J B;  4N9F 4;  1E8W A;  4BBN F;  2L7R A;  3RUI B;  4TQ0 A;  2RD0 A;  3T8M A;  1S1Q B;  2JY6 A;  4DDI D;  2D07 B;  2CS4 A;  5E6O A;  2DAJ A;  1AAR A;  5CHF A;  4JL9 A;  2BF8 B;  1RAX A;  2KTR A;  2N7D A;  5TR5 A;  3LDZ E;  1TZ1 A;  1E8Y A;  2WX0 A;  3L17 A;  5LXH A;  2FCQ A;  4GDK A;  3H6N A;  3QCA A;  4GIV A;  4DHZ E;  2J7Q B;  1SE9 A;  2LVO A;  2K6Q A;  4W9D A;  2L05 A;  2O6V D;  2N9X A;  3KYD D;  4OVV A;  2WYQ A;  2GBN A;  4GU2 A;  2L0T A;  4XZ4 A;  5JHA A;  3VDZ A;  2MSE D;  2UWQ A;  2O6V B;  1WX8 A;  3OJ4 B;  1GC6 A;  5KHO A;  2IY0 B;  1WF9 A;  3PPA A;  3A9K A;  3QHT A;  4MSQ B;  1WGR A;  2VRR B;  2BWF A;  1WH3 A;  2CHW A;  4IWP A;  3DOW A;  3PRE A;  2I1K A;  3VQI A;  3HIZ A;  3P2B A;  1OTR B;  2KD0 A;  2EMS A;  4KIK B;  2IO2 B;  2O2V A;  3VTW A;  3GZN I;  1WFY A;  2IO0 B;  1EUV B;  2KC2 A;  3PRM B;  3VHT C;  4WAA A;  4W9C A;  4ZYN A;  3OJ3 A;  1WJ6 A;  1YD8 U;  2FID A;  3A33 B;  5J2R A;  1WXA A;  1CMX B;  2ZCB A;  3H7S A;  4BOZ B;  2WWZ A;  4DHZ B;  1RRB A;  3UF8 A;  2L8J A;  2R2O A;  3APC A;  3U7D A;  2LXC A;  2WX1 A;  2DZK A;  1LM8 B;  4TV3 A;  1C1Y B;  2RSU A;  5LXI B;  1UEL A;  2DAF A;  2R2Q A;  3JSV A;  3RCZ A;  4HWI B;  4MJS A;  4E74 A;  4KDI C;  4HCP B;  3HM6 X;  1JRU A;  3QA8 A;  4FJV B;  3RT3 B;  2KZR A;  3B1L X;  2KLC A;  1YQB A;  3AU5 A;  1LQB A;  3A4S C;  1YX6 B;  3VH4 B;  3QQ8 B;  3ZTC A;  3PTF C;  2CR5 A;  4W9I A;  4MM3 A;  3JYU A;  3WAM A;  3TCA A;  5DPW A;  4KVG B;  3HK0 A;  2LZ6 A;  3KVF B;  2C60 A;  2JXX A;  3KYC D;  2GBR A;  4FJY A;  4M8N A;  4MGZ E;  4X57 B;  2FNJ B;  2NVU I;  2KQS A;  2XK5 B;  3AI5 A;  3H7P A;  4KZC A;  1UGM A;  2M8S A;  3A9J A;  4WQO B;  5JZE B;  2LJ5 A;  3RZF A;  1J0G A;  4MDK E;  1TGZ B;  4FUL A;  1WYW B;  4NQK E;  4LDT D;  1F9J A;  3KUZ A;  2A4Z A;  4NPN A;  3VUY A;  2KFJ A;  1WE7 A;  1E8Z A;  5AZH A;  4RMA A;  5C23 A;  2K8H A;  3D32 A;  5D94 A;  2NBU A;  4LDT B;  1ZKH A;  3NZU A;  2G3Q B;  1OEY J;  2HTH A;  2M17 A;  4ANX A;  3VTU A;  2KC1 A;  2MP2 B;  3N3K B;  4W9E A;  3W1S A;  1GC7 A;  2G4S A;  3JW0 X;  4BVU C;  4KZ0 A;  1WMH B;  4HJK A;  3SHQ A;  1UBI A;  1WM2 A;  2DZJ A;  2RGF A;  3NY5 A;  4GN1 A;  3TIX A;  3ZO5 B;  4W9G A;  2O6V A;  2QHO A;  1EF5 A;  3PT2 B;  4BKS D;  1S3S G;  3ZTD A;  2GMI C;  3PGE A;  4CO7 A;  4HPL B;  3AU4 A;  3RYT A;  4GB9 A;  4NNJ B;  3N32 A;  4GDL A;  3QWZ B;  3V6C B;  4EKU A;  3NOB A;  2MBQ A;  3H9D A;  4KIK A;  4EFO A;  4K7W A;  1WGD A;  1VD2 A;  2PPH A;  1R4N I;  5JH5 C;  3IVF A;  2GOW A;  2MX2 A;  3ALB A;  3ZNH B;  2ZPY A;  4IUM B;  4IM3 A;  1YX5 B;  2MW5 A;  4F8C B;  1V9J A;  4EOY A;  1SIF A;  2V1Y A;  3L54 A;  1XD3 B;  1X1M A;  2JRH A;  1V80 A;  4IWO A;  3W1Y A;  2KVR A;  4MEL A;  1IPG A;  1G6J A;  2RR9 A;  2ZNV B;  2J0M A;  2M1M A;  2PE9 A;  3R66 C;  2K6D B;  3LJ3 A;  3M95 A;  5KHQ A;  1NDD A;  3N30 A;  4HPM B;  3ZNZ B;  3ML9 A;  3DBR I;  2CU1 A;  4J6I A;  4ICV A;  3PHX B;  4W9K A;  1WR6 E;  4HLE A;  3TBL D;  4YL8 A;  5C1Z A;  2KN5 A;  1R4M I;  2YLM A;  2KDB A;  4MGY E;  2CKH B;  4GOC A;  2N9E B;  3L0W B;  3VAW A;  2G45 B;  3WAL A;  1HE8 A;  2DYO A;  4WWN A;  3UIP B;  3CMM B;  3L13 A;  3L10 B;  2JUO A;  4KV2 A;  5L83 A;  1V86 A;  3IFW B;  4AJY B;  3A4R A;  3CST A;  2LD9 A;  3V62 A;  5CX3 A;  2XK5 A;  3K9O B;  4KSK C;  4PYZ A;  2XEW A;  1I42 A;  1T0Y A;  2KJ6 A;  2LWP A;  3DVN U;  2L00 B;  4PS7 A;  2K25 A;  3DVN V;  3DBH I;  2C7H A;  2KMA A;  4PS3 A;  5JHB A;  4DBG A;  4WWO A;  3VUW A;  2JZZ A;  2K8B A;  4WJO A;  4MEM A;  2KJH B;  2LI5 A;  2KK8 A;  3RZW C;  2LXA A;  2MP2 A;  2GBM A;  2PEA A;  1ISN A;  3VTV A;  4FA6 A;  5L95 C;  3DBS A;  4IWQ A;  2ZZP B;  4MGK E;  3DQV A;  3NZS A;  1WY8 A;  3ZNG C;  1WM3 A;  3V6E B;  4A3O A;  2LUE A;  3L08 A;  2KFK B;  2MBH A;  4GSW A;  3RUL A;  1L2N A;  1WZ3 A;  3UQA A;  2BGF A;  3OLM D;  4AUQ C;  4NAW A;  3VXW A;  3BY4 B;  3UGB B;  4FBJ B;  3ZW3 A;  3OAW A;  2YVC A;  4XX5 A;  1UBQ A;  4K81 A;  4ZRI A;  4W9H A;  4BKS A;  3M63 B;  5J17 A;  4GGQ A;  4EUT A;  3KUD B;  4F7Z A;  3QAQ A;  1FXT B;  3C0R B;  1XT9 B;  4IM2 A;  2KKC A;  3VVW B;  2Z0E B;  2M0X A;  3QJZ A;  2AYO B;  2D11 A;  2HJ8 A;  4AJW A;  2N1V A;  2LGD A;  2EKE C;  1SGH A;  5LLI A;  4FN2 A;  2FIF A;  4ZRK A;  1ZGU B;  3QAR A;  3PVL A;  1GNU A;  4B9K A;  4DDG D;  1D3Z A;  2ZPN A;  2B3A A;  4MGI E;  1L7Y A;  1TTN A;  2HE7 A;  3DVG Y;  4CHK A;  4DWF A;  5DPT A;  3ONS A;  2K8C A;  5D6J B;  2FCS A;  3VH3 B;  3PHW B;  3PS6 A;  2BWE S;  3X0W A;  1H8C A;  3IHP C;  2M4N A;  4FHJ A;  2IO1 B;  3R7Q A;  2FAZ A;  2ZCC A;  2KWV B;  1V5O A;  5GMV A;  4ZRJ A;  5IAA C;  3WAO A;  4TKN A;  5AEK B;  2NPT B;  4GXB A;  2IYD B;  2LGX A;  4G3X B;  4MH0 E;  3PSE B;  4W9F A;  3TL5 A;  3ZNI D;  4WJN A;  2BYF A;  4DHJ B;  2J0J A;  1A5R A;  1WXV A;  2DHZ A;  1Q0W B;  1WGY A;  2KDE B;  4BBN C;  1WX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...