1UHMA

Solution structure of the globular domain of linker histone homolog hho1p from s. cerevisiae
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
EASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASNFDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H1
publication title The linker histone homolog Hho1p from Saccharomyces cerevisiae represents a winged helix-turn-helix fold as determined by NMR spectroscopy.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2003-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1uhmA00
1IZ1A 4L18B 2V1UA 2NAZA 1H9TA 3REOA 2O0YA 3HSRA 4RB3C 3ZN0A 1YYVA 2FMLA 5BMZA 2W24A 1T2KA 1HKQA 2KIFA 3PQKA 2GIVA 4YFNF 2G9WA 1T39A 2IP2A 3I0TA 3MEXA 4KIGA 5D4RA 4ENKA 2D45A 3KP4A 1F5TA 2V9VA 4OMYA 1RZ4A 2Q2EA 2XAGA 5HDGA 1XCBA 3HRMA 2CO5A 3QPHA 1ONVA 4DQ2A 4L0ZB 5ERIA 1MGTA 1J2XA 4IJAA 1G3WA 1U3EM 2RKHA 4IRHA 3WTVC 3P9IA 5D8KB 1XSDA 3HRUA 3M8EA 5L3GA 1FX7A 1PP7U 3CTAA 3DPLC 4UVAA 4MTEA 4XRFA 3BDDA 3R0JA 2VXZA 1YW7A 3GFMA 2F5DA 2HZTA 5BPDA 3CDHA 5HDKA 5BPIA 2RDPA 2FSWA 2UZKA 2O03A 3BJAA 5JI6A 3J80K 2Z9OA 4ZZDA 5FD5A 1J5YA 4CYDA 1Z7UA 1BJAA 3ZQ7A 4WCGA 5BOXA 1R58A 4QLCU 1MKMA 3ABUA 1ODDA 1Q1HA 3K1PA 3DP7A 2VOOA 1ULYA 2WTEA 4RAYA 1R23A 2XAQA 1FBSA 4N9IA 2G7HA 3VOEA 4FT8A 1Z6RA 3I58A 5HLHA 1W4MA 2OQGA 1UFMA 4A0YA 3O2PE 3ZP5A 4M71A 2IA2A 2HDCA 1T0FA 4NHJA 4G7OF 4LD5A 5E18F 1STZA 4KMUX 2HQNA 1MJBA 5LEJA 4HQEA 1BC7C 1FBQA 1SFEA 5HS7A 4OIOF 3ZN1A 1TLHB 1P4XA 4ZH4F 3KZYA 2NRAC 1BOAA 2DPUA 4CICA 4L9JA 4GYIA 1I27A 3J80Z 3K1MA 2GXBA 4P9FA 1BI3A 3F8NA 3F8CA 4ON0A 4OINF 4EMSA 2ZJ2A 1P6RA 3C1DA 3MAJA 2DO7A 4FX4A 2OU2A 2DTRA 3C7JA 1QBJA 3FMRA 5EEHA 3P7NA 1TQPA 4M74A 3BJ6A 1BIBA 2EB7A 4A0XA 4GGGA 1ZN2A 2A6EF 2WV0A 1EH6A 1T98A 4M9XA 2XAFA 4UV8A 1W7PB 4A12A 2KRFA 3V7RA 1U2WA 1XB4A 3KP5A 1O57A 1SFUA 3E6DA 3VFZA 3KP2A 1S29A 2UXNA 1SD4A 5BQTA 3WG9A 2IJLA 3FXUA 4G7HF 3F8MA 3P9KA 4N0BA 2QZ8A 2ZFWA 4S04A 3L09A 1U5TB 5LRRA 1W5TA 1XDUA 5DUKA 4UVBA 4EM0B 2JTVA 4FHTA 3M1EA 4KYWA 2X4HA 2DU9A 3OV8A 3E6BA 1ZAOA 4BAYA 2OQRA 1YLFA 3FM3A 2PN6A 2COMA 2FRHA 4NQWA 5L3EA 3ZMSA 1T6SA 3SXYA 2A3SA 1V3FA 1B6AA 2FF4A 5K5RA 5CJ9A 4KIFA 1FYLA 2DK8A 1L0OC 4EV0A 4G8XA 4R1HA 5HOOA 4LG0B 1FSEA 1R1VA 4M6YA 1F4KA 1FPQA 1Z91A 1G3SA 3HTUA 1S6LA 4M72A 2ZNZA 4HV6A 3DEUA 3EYIA 3H92A 5H6QA 1R22A 1FYMA 1BIAA 3IKVA 1OKRA 1XGOA 2A68F 2LKPA 1U8RA 1YW9A 4HW0A 4KICA 1D8JA 4P55A 2ZNYA 5JFRA 3FMSA 1IAWA 1RUOA 4WXHA 4EJVA 1KYWA 3CUOA 3SZPA 2QYOA 2P6SA 3HRSA 5LGUA 3AAFA 4PGGA 2EV6A 1O3SA 1BM9A 2LNBA 1YQAA 1QO0D 3JSPA 2K4JA 3S2WA 2DLLA 4HBLA 4I0BA 2ZMEB 1MDMA 4S05A 4MHGA 3WU1B 1XGNA 4K2EA 2FE3A 4PZJA 1S3JA 3WTWC 3BWGA 2BV6A 1J75A 2XGXA 2DQLA 2Y75A 1O3RA 3LWFA 3LAPA 3ECHA 1R5GA 2CG4A 4L5JA 4U7BA 1RNLA 1IN6A 1IXCA 4LB6B 4KIBA 2ISYA 3IRRA 1ZRDA 2EJRA 1FT9A 5AONA 5LHHA 3F8FA 5HVQC 1SD5A 1IRGA 2DBBA 4BYYA 2LDUA 3CO6C 2JPBA 1JXSA 5CVJA 3Q5FA 1MD0A 2FOKA 4XBFA 2XKOA 1I1SA 2KIMA 1ZLJA 4ENJA 1YG2A 1ZREA 1E2XA 2MH9A 5CVVA 1K78A 3F23A 1YW8A 4AIKA 4HQMA 4Q48A 3I59A 2VODA 1EH8A 2PQ8A 1XN7A 5E1WA 5DYMA 5J8CA 3TOBA 5CLSA 1KYZA 2L02A 5ILUA 3KFWX 2JPCA 2EA4A 4EJWA 5DCMA 1R1UA 3T0YA 5ICFA 1OYYA 4LK0F 2M5WA 4KN7X 4I01A 1FP1D 1ON1A 4AIHA 1ZH5A 1FLIA 3QU3A 5LRSA 1KQ9A 4I02A 3EDPA 2W25A 2HR3A 3IKTA 3RKYA 4RS8A 2RGVA 3BPVA 2MBFA 2PMUA 2QVOA 3EYYA 3P9CA 1OMIA 4MEXF 1HW5A 4P5OA 2FBHA 4XLNF 1LJ9A 1LB2A 3DV8A 1TW2A 3DPTA 1ZG1A 4CGZA 3FM5A 3F6VA 3M9AA 1F9NA 3K69A 3F72A 3GF2A 3HRTA 4XLPF 5IT3A 1ZLKA 1EH7A 3RYRA 1JHFA 1ZGJA 3J81Z 5BS6A 2YX7A 3QP6A 4OOIA 2H09A 3IRQA 2BBYA 4U0WA 3VEPA 2XIGA 2BE5F 2HTJA 1K79A 1BI0A 3KZZA 1Z1DA 1IN4A 1FC3A 4IXAA 1EV7A 1JHHA 2FXAA 1J9IA 1RUNA 2FBKA 4M9SA 4WXCA 4RGSA 3RTRA 3VODA 2EFNA 2OAZA 1HKTA 5DCFA 4P96A 2L01A 4G7ZF 4H0EA 1QZYA 4EJTA 1D8KA 2M30A 3SQNA 5K1YA 4CHUA 3SFZA 2STTA 1YTYA 5HS8A 3KLNA 2BGCA 4Q4ZF 2Y0MA 3GZ6A 4HX7A 2ZKZA 5F6FA 1BN5A 4PGHA 2P5KA 3ISPA 3CLOA 2EWNA 2GZWA 1YS6A 3K0LA 3ZPLA 1BBYA 1Z05A 1PUEE 1XMKA 2EV5A 1HKSA 3U2RA 3TO7A 3PFIA 4KMFA 4HX4A 4ENNA 3R6SA 4CO8A 1USSA 2VBZA 3WGIA 4BHBA 5LHIA 3MFKA 1W5SA 2YSRA 4YIIA 3FMQA 4LLNA 3TOAA 1OYIA 2XAJA 1WSUA 2UXXA 2FBIA 3H3UA 1XD7A 2WC2A 1BI1A 4HX8A 3L2CA 1KQ8A 5CYVA 5IT9Z 2DQRA 2ISZA 5HLIA 3ML6A 4HDVA 1R36A 4HLXA 2Q8KA 2HQRA 5DDGA 3KEQA 3BROA 4WX9A 1E17A 1I6XA 1LQ1A 3RPUA 5J8FA 5L3CA 3DQVC 1P2FA 2VBWA 5DV5A 4OIQF 3GXOA 4WK8F 1YFHA 2M1BA 2O61A 1FBUA 5F64A 3EETA 4XSXF 2H6BA 2MLGA 3F3XA 3V8LA 4L9TA 1H9GA 1QNTA 3MCZA 2RV8A 2KKOA 2GAUA 2W85A 4TV7A 3QAHA 1ZGAA 1W7PD 3LA7A 1U78A 2Q0OA 2DW4A 3NEUA 2CSOA 4HAMA 3GYHX 5H6RA 2EFPA 4A5MA 1B9NA 2VT2A 3GFLA 2YU3A 3TGNA 1SD7A 3HTSB 5AIPA 5E17F 3D0SA 1OPCA 4F7ZA 4GO1A 2R7DA 2CW0F 1LDJA 4GYGA 2QLZA 3IC7A 3LFKA 2EA2A 4UUVA 3WE2A 3F21A 3RJPA 2PMHA 1QZZA 5L3DA 1QQIA 4U0VA 2V1DA 5TJJA 2AXLA 4BNCA 3F22A 1ZARA 2GA1A 1TTYA 3L00A 3WGGA 2MC3A 3LSTA 5TRDA 2JRTA 2GWRA 2HFHA 3I53A 2XKPA 3LA3A 3KLOA 3HHHA 1DDNA 3GZ5A 5JHUA 5FFXA 4ZYDA 3R4KA 4A2UA 3HOTA 2IT0A 2QQ9A 4MQVA 3T8TA 3FXRA 3B73A 5D8LB 3ULQB 1HQCA 4L9NA 2J5PA 3FF5A 5D6FA 2FU4A 2RNJA 5ICEA 1CGPA 3C3WA 3O3KA 1V4RA 1D5VA 3KETA 2M8EA 2MD5A 3U9GA 1MDMB 3FXQA 4ESJA 4A6DA 1UB9A 2OBPA 3ABTA 1HXDA 2Z33A 3F8BA 4MGRA 4ETSA 2RC4A 2F2EA 2ESHA 1R5HA 2QWWA 1MZBA 2FEZA 5LBQA 5CVIA 4YIFA 2NYXA 3ZMTA 4PDKA 5JR3A 2DPDA 3QP5A 5ICGA 3ERED 2PEXA 1PDNC 2STWA 4UV9A 2A61A 5LEKA 3WGHA 1YIOA 2VBYA 2DK5A 2GXGA 1KA8A 4HOBA 4CXFA 3WTYC 4O5VA 1K78B 3DFGA 3I59B 3HOSA 4O3MA 4MEYF 1DP7P 1DUXC 4I2OA 2A69F 3ROUA 1FWZA 2PJPA 5DCMB 2IA1A 1CF7A 3ECOA 1TW3A 2EFQA 5F1RA 2PLYA 3F6OA 4Y15A 5KK1A 2IRFG 6PAXA 1TBXA 2PBIA 2RN7A 3MZHA 1PP8F 1O7LA 4IHTA 4IVNA 2ZXJA 4RGRA 1XSVA 2XV4S 1QPMA 4I0AA 1USTA 4EJUA 2R3SA 5E8GA 2P4WA 1QGPA 3T1BA 1IUYA 2P5LC 2HTSA 3V7CA 4HZFA 2D2WA 4HLYA 4O6JA 3ELKA 5ED4A 1W7PA 3FZVA 3TO9A 1REPC 4KA4A 3RIRA 4BHCA 1DPUA 2K27A 2BYVE 5KVRA 2TDXA 2QM3A 2QQAA 4RB2C 4IF4A 5E1XA 1TQMA 2DT5A 4G6QA 2R7FA 2LF7A 3KEOA 4Q47A 2XROA 2HYGD 3TDZC 4HF2A 1KU9A 1TNTA 3ZMDA 4QWQA 4M73A 1U5TA 4EQQA 5J6XA 5FLXK 3COAC 2VONA 5E20A 2DAOA 3V8JA 3JTGA 4AIJA 3KP3A 2YR2A 1IRFA 1Z9CA 3WTUC 2VN2A 3CO7C 3IWZA 3FHZA 4LJZF 2YPRA 3R61A 3BOQA 3LQRA 3K9TA 4PCQA 3H3ZA 5JVTA 2HWVA 1IW7F 3V8KA 1J0RA 3M7GA 3QOPA 5HLGA 2YX4A 2B0LA 4LG0A 3C18A 3DF8A 1WRJA 3E97A 3WTXC 3HUGA 2P5VA 4WWCA 1TQIA 1FY7A 1IXRC 1AWCA 1O3QA 4JBAA 2G7UA 4IRGA 3CUQC 2NS0A 4D0PA 3BP8A 1R00A 5H20A 3WU0A 4U0YA 3FWEA 1KQ0A 1NHAA 3LA2A 3KE2A 3VB2A 1GXPA 2HKXA 5FLXZ 1UCRA 4MQ9F 2LF8A 2ACJA 3G73A 4EGYA 2GA2A 1D3YA 1LNWA 3RPQA 5L3FA 5FGMA 2QUFA 5HS9A 4GXOA 1U6GA 1UHMA 2HOEA 1B9MA 2ZBKA 3WTSC 3OOPA 1HBXG 4E70A 2XASA 3WTZA 5D5XB 1ZG5A 5DD4A 2MH2A 3V7SA 2CQKA 2DFIA 3V4GA 2MLKA 5FB2A 3GFJA 3GWZA 1G3TA 4BXUA 2W57A 1FNNA 2CWEA 3CUQA 4U88A 2ESNA 4WF2A 3KP7A 2ADUA 4BH9A 5DUIA 2HEOA 4UVCA 2PFBA 2H27A 1R1TA 4Z2YA 3HIFA 2RQPA 2L4AA 4HF0A 3QU6A 5K5OA 4EGZA 1IN5A 3I54A 4A6EA 3NRVA 3L9FA 3SHFA 4HDUA 2VE9A 4OMZA 3CJNA 3HHGA 1IF1A 3GLXA 3M8FA 2QENA 3I64A 1XSXA 3E6CC 4EM1A 5ICCA 2E7XA 1L3LA 4LB5A 3K2ZA 5A2QK 1O3TA 3WE3A 1KU7A 2FQ3A 3I71A 5FO5A 4UHTA 2F5CA 4LLLA 2ZO4A 2UWMA 4JQFA 1UHWA 2H94A 2ZCWA 2EFOA 4LFUA 4KT5C 1FOKA 1SMYF 1R7JA 4ZYGA 4IHSA 4KFCA 4ENMA 1LVAA 2FMYA 4CDGA 2ETHA 2P8TA 3GFIA 4EM2A 4L0YB 4I09A 4ZZLA 2H6CA 2VT3A 4R79A 4P9UA 1ON2A 4M6XA 3O6BB 1J7KA 3BPXA 1SMTA 3BJOA 2OD5A 4M9ZA 2IVMA 4NB5A 3J7AO 3NQOA 4YFKF 2A6HF 2CFXA 2QBYA 5A2QZ 3GW2A 2O6GE 1FYKA 3EQLF 3MQ0A 2HS5A 1HSTA 2RVCA 3TDUC 2Z99A 2WWYA 3K1NA 1B1BA 1WKMA 3ZMUA 1XCVA 1OYWA 1YS7A 2O8XA 4I98B 4ESFA 1A04A 2V79A 3I4PA 2AS5F 4G94A 2KJBA 1P4WA 3FX3A 2EV0A 5LGNA 1CF7B 5E8IA 4ASNA 1K7AA 2P6TA 1ZRCA 2KJCA 4ZYHA 4OIPF 2DI3A 1HSJA 2XUBA 3JW4A 5L3BA 4ESBA 4LMYA 3RDIA 5E1ZB 1JGSA 5CVRA 2F5FA 5D6EA 1GHCA 3TO6A 1YO5C 3IL2A 2V6CA 3N97A 3D5LA 3GX4X 2C6YA 5DD8A 2J5OA 1FP2A 2KIUA 1G4DA 2MA3A 1K6OA 1ZYRF 3T8RA 2L3DA 4KUMA 2ELHA 4G9YA 2HYFA 3W6KB 5FFZA 3BZ6A 3WODF 3HSEA 4DNCA 3RI4A 5D5VB 2K02A 3LQQA 3MWMA 3RKWA 4YFXF 1X3UA 3TKYA 5ILSA 2IA0A 2HKOA 2XAHA 4EJOA 3GO5A 1G6NA 5HDNA 3KCCA 5LGTA 2A07F 5D4SA 4Y17A 2K7LA 3TQNA 4AD9A 1AOYA 4WXDA 1VTNC 1FZPB 3QPTA 3E5UA 5D5WB 2E1NA 4UXNA 2VBXA 4A5NA 4HYEA 1KU3A 1S7AA 1ZG3A 3Q9SA 5CVUA 4ZYEA 4YG2F 2F5EA 2HGCA 1P4AA 4XSZF 5DEQA 1C0WA 1KU2A 2O3FA 4MNUA 1MJAA 1G3YA 1IN8A 2EK5A 1LDDA 3E3VA 1TNSA 1SD6A 2OZ6A 4L5IA 1KGSA 2K4BA 3MZYA 1LDKB 1MJ9A 2VC0A 2VOPA 2A5YB 2P7CB 3BY6A 4HV5A 1LEBA 4JK1X 4RGUA 2P7VB 4Q5SF 4R8HA 1Y0UA 3LAJA 2JZYA 1U5TC 5K5QA 2L54A 1ZRFA 3N4MA 1H0MA 4I7HA 3GVAA 4RAZA 4U7DA 2XHKA 2X0LA 4OU0A 2XVCA 1XGMA 1JE8A 1O7FA 3ZMVA 5D5UB 2D1HA 2NNYA 3L7WA 3U1DA 2NNNA 4G6DA 1HW1A 1SFXA 2FNAA 4FX0A 4LK1F 2FA5A 4L9VA 1DPRA 3ZMZA 2OA4A 4GCVA 2VE8A 4IRIA 2K86A 5LHGA 3E5XA 3R60A 4HF1A 1XGSA 3T5XA 2GQQA 3CUQB 1F1ZA 4KNYA 2M87A 2E1CA 1ZHFA 4N9HA 1GXQA 3J81K 4Y13A 2XRNA 3DXJF 4EVIA 3Q9VA 3JAMK 5EEGA 1IN7A 1B4AA 3IWFA 4B8XA 1B59A 4CZZA 3GUDA 3W6JB 4B09A 3JSOA 4UNOA 4RB1A 3PQJA 2JT1A 2Z5UA 2JSCA 1WWXA 4HA8A 3HYIA 1OR7A 2OZUA 1Z6TA 4BHPA 5AIQA 1LEAA 2CGPA 4A0ZA 2CYYA 3E5QA 2FNPA 3QRFF 1J59A 1GVJA 1BI2A 1HW2A 2QQBA 2Z3YA 1WQ2A 2Y48A 4MTDA 2W84A 2V1XA 2PI0A 5LLQA 1RIOH 4BQAA 4RB0A 1I5ZA 2IW5A 3R0AA 4KDPA 3JTHA 2EFWA 3RYPA 1P92A 3IHUA 2LSOA 3EUHA 1SAXA 3HSFA 1BC8C 2E7WA 2L4MA 2ZMEA 3G3ZA 1IXSB 3JAMZ 3E6MA 4KN4X 1FSHA 2VC1A 4AVPA 1S8NA 4LGWA 2IPQX 1XMAA 2BEOA 3B02A 1T38A 4IPAA 3RKXA 2D1VA 3DKWA 1XDSA 5FD6A 3GEZA 2M45A 1I1GA 2PG4A 1WI9A 4RGXA 3WTTC 3SZTA 1S7OA 5ILVA 1RI7A 2QBYB 4OIRF 3KP6A 5IT9K 3I5UA 4LLGF 4AWXB
chains in the Genus database with same CATH superfamily
1IZ1A 1FOYA 4L18B 2V1UA 2NAZA 2WAQA 1IO2A 3QPLA 3NWSA 1H9TA 5C4JJ 3REOA 1MMNA 2O0YA 3ABMH 1LE8A 3HSRA 4RB3C 5E3MA 3ZQQA 3TEDA 1MIJA 3ASNH 3ZN0A 1YYVA 2FMLA 5BMZA 2W24A 3L2VA 3GTGJ 3ONQA 2JRMA 1T2KA 1HKQA 1V55H 4UY8I 4D1QA 2KIFA 3KYCB 1UG0A 2GIVA 3PQKA 5EF6A 4YFNF 3ZOBA 3X2QH 2G9WA 4ABZA 5E3NA 1T39A 2IP2A 3I0TA 3MEXA 4KIGA 1RESA 5D4RA 4ENKA 2D45A 5KNLA 3KP4A 2ZJPF 4MLOA 2V9VA 5IOZA 1F5TA 1RZ4A 4OMYA 2B63J 2Q2EA 3BG6A 1WH7A 2XAGA 3IUOA 2CW7A 5HDGA 3FK7A 1FTTA 3ZQLA 3PJRA 2CU7A 1AHDP 1XCBA 4IHYA 3HRMA 2CO5A 2BY1A 2JN6A 1FOWA 1YITI 3QPHA 3HOWJ 1ONVA 4DQ2A 4L0ZB 5ERIA 1RRJA 1MGTA 5J1RA 1J2XA 4IJAA 1G3WA 2VJJA 1U3EM 2RKHA 3A0BC 4IRHA 1PJRA 3WTVC 5M3FJ 1H8AC 2HYJA 4RAFA 3P9IA 1IV6A 1QVUA 2WY8Q 5D8KB 1XSDA 3HRUA 1LPQA 2XSDC 3M8EA 5L3GA 1MMAA 1FX7A 1PP7U 1VF9A 2BOLA 3HOZJ 4Y52J 3CTAA 2R7VA 3DPLC 4UVAA 2F5VA 3FKIJ 1TL8A 2ZFUA 3CF2A 4XRFA 4MTEA 1DP3A 3BDDA 3R0JA 2VXZA 1YW7A 2CV2A 3GFMA 2F5DA 2EZIA 2HZTA 3CF5F 4B1RA 4BL0B 3CDHA 2G0EA 5HDKA 5BPDA 2ZB9A 5BPIA 2R7SA 2DA3A 2FD5A 2RAEA 2RDPA 2FSWA 2UZKA 2JVGA 1Z7LA 2DJIA 2O03A 3BJAA 5JI6A 3J80K 1ZR2A 2Z9OA 1VQPI 3GTLJ 4C30A 4CA0A 3OIPA 2DTZA 5FD5A 4ZZDA 1YRNA 2UUZA 1J5YA 4UUTA 4CYDA 2R5ZB 3UR3C 4XK4A 1BR2A 1Z7UA 1X2NA 3LSPA 5KCMA 1BJAA 2CQNA 2E5ZA 3ZQ7A 2BVLA 2QSFX 4WCGA 5BOXA 1R58A 4QLCU 1MKMA 1S9HA 1ODDA 1Q1HA 3ABUA 1FTZA 1D1CA 1D1BA 3K1PA 3DP7A 4E4HA 1HDDC 2MW8A 2VOOA 1ULYA 2WTEA 4RAYA 1R23A 2XAQA 1FBSA 4N9IA 1MNDA 2G7HA 3K4MA 3K7AJ 4F93B 3VOEA 1E0EA 4FT8A 2LY9A 1Z6RA 3I58A 5HLHA 4KISA 1I3AA 1W4MA 1GT0C 5KAIC 1Q1VA 2OQGA 1A6IA 3H5AA 1UFMA 1XTAA 4A3EJ 1R6RA 3GBGA 3O2PE 4A0YA 3ZP5A 4M71A 2IA2A 2HDCA 2IGKA 4ITVA 5JVGF 1WFXA 1T0FA 4NHJA 4G7OF 4LD5A 2ZXIA 4FCYA 2JA7J 3I4MJ 1T95A 4BQOA 1STZA 5E18F 2E34A 4KMUX 2HQNA 1ZTRA 2FJ1A 1MJBA 1IC8A 5LEJA 2Y2ZA 1XX5A 2M0CA 1EJ9A 4HQEA 3N05A 1BC7C 1FBQA 3RSNA 3CDLA 5IYDJ 2X1CA 1SFEA 3H5RA 2EBIA 4V19K 2ZSHB 5HS7A 4OIOF 3ZQFA 3ZN1A 3S1QJ 5CQEA 4A3DJ 1FOXA 2H8RA 1TLHB 1P4XA 4ZH4F 3KZYA 2NRAC 1BOAA 1P9QC 2DPUA 2KL4A 3AG2H 5EZHA 4IOAF 3NAUA 4CICA 3FXLA 4L9JA 4GYIA 1I27A 1FIAA 4E7IA 3J80Z 3K1MA 4E7HA 2GXBA 3QODA 4P9FA 1BI3A 2X1EA 3F8NA 3F8CA 4ON0A 4OINF 2WA0A 4EMSA 5CKTA 2ZJ2A 3PSFA 1P6RA 2DODA 2WAFA 3C1DA 3P5JA 1AKHA 3MAJA 5F27A 2DO7A 4NC8A 4FX4A 4A3KJ 2OU2A 2WB1A 1RKWA 1ETXA 3CCEI 3IAS2 2DTRA 3C7JA 3H9JA 2QF7A 1QBJA 3FMRA 3SFIA 2JSPA 3DPUA 5EEHA 3P7NA 2OCEA 3PM1A 2HI3A 4RAGA 2IS6A 1TQPA 4M74A 3BJ6A 1ZR4A 1BIBA 1LVKA 1MBJA 1PUFA 2EB7A 4UUSB 4A0XA 2DDBA 2V6EA 4GGGA 1ZN2A 2A6EF 3FISA 2WV0A 3KEYA 1EH6A 1T98A 2EIMH 3LL7A 4M9XA 3CCQI 2XAFA 2L2OA 4XRSA 4UV8A 1W7PB 4RBOA 2QQ8A 1WH5A 4A12A 1ETOA 2KRFA 3V7RA 3Q0UA 1OFCX 1TP4A 2HQAA 1LFBA 4NC6A 1U2WA 1XB4A 3G2BA 3KP5A 1O57A 1SFUA 3E6DA 3IH2A 3VFZA 3KP2A 4E6KG 1S29A 4IX7A 2JA2A 1TT5B 1TWHJ 2UXNA 4CCJA 1SD4A 3GZNB 5BQTA 2DOAA 4XOPA 5C44J 2GXAA 3WG9A 2IJLA 1BOBA 2GBYA 2ID6A 3FXUA 4G7HF 3F8MA 1T08B 3P9KA 4N0BA 2NVUB 2QZ8A 2ZFWA 5HNHA 4S04A 4IHXA 3L09A 1U5TB 5LRRA 1W5TA 1XDUA 1Z77A 1MNEA 5DUKA 4UVBA 4RM2A 5E3OA 4EM0B 2JTVA 4FHTA 3M1EA 4KYWA 2D5VA 5DTDA 2X4HA 2DU9A 2JJ7A 3HZJA 3OV8A 4DGWB 3F0CA 5EG0A 4IHVA 3LFUA 4HEA2 3S3OA 3E6BA 1X19A 2MABA 4E7JA 1ZAOA 3E7LA 1YOVB 4BAYA 2OQRA 1YLFA 3FM3A 2PN6A 2COMA 2FRHA 4RLFA 4NQWA 5L3EA 3ZMSA 4F55A 1T6SA 2XPWA 2W00A 2XF7A 2F48A 3SXYA 1IGNA 1YI2I 2A3SA 2LTPA 1V3FA 4C9YA 1TT0A 1B6AA 2E2HJ 2CFOA 3OYHA 1VQNI 2FF4A 5K5RA 5CJ9A 3IP4B 2KFDA 2VXDA 4KIFA 5GAGJ 1RR8C 2IBDA 1FYLA 4QIWN 2HZDA 2DK8A 1L0OC 4EV0A 4G8XA 4R1HA 5E79C 5HOOA 2WAQN 4LG0B 3Q0WA 1FSEA 1R1VA 3OR1C 2K9LA 4M6YA 1F4KA 1FPQA 1SFOJ 1Z91A 2IGOA 2K85A 2JA8J 1G3SA 3HTUA 3LMMA 3LSMA 1S6LA 3D5SC 4M72A 2BHZA 3SEZA 2ZNZA 3RQ4A 4HRIA 4A3JJ 1K4SA 4HV6A 4JX5A 3DEUA 3EYIA 3H92A 5H6QA 1R22A 1FYMA 1ACIA 3FBNB 5FKOA 5IYBJ 4EATA 1BIAA 3L2QA 3IKVA 1OKRA 1JKRC 1XGOA 2A68F 2LKPA 1U8RA 1YW9A 4HW0A 4KICA 3H36A 1D8JA 4P55A 2ZNYA 5JFRA 3FMSA 3TMOA 3OYAA 1IAWA 1RUOA 4WXHA 3CP2A 4EJVA 1KYWA 3CUOA 3SZPA 2QYOA 2P6SA 4CCKA 3HRSA 3OYDA 5LGUA 4XLHA 3AAFA 1ETYA 5F0FA 1UAAA 4PGGA 2EV6A 2JA5J 4CH7A 5M3MJ 1O3SA 1BM9A 2LNBA 1YQAA 2JA6J 3TW6A 3Q0VA 1QO0D 3F9KA 4C2TA 3JSPA 2K4JA 4OWRB 2WV1A 4YELA 3S2WA 2F4OB 1R49A 2DLLA 4HBLA 1BW5A 5FJ8J 4I0BA 2ZMEB 3CLQA 1TWAJ 3W3CA 1E3HA 4S05A 4MHGA 1MDMA 4B47A 3WU1B 2M34A 3H35A 1XGNA 1MH4A 4K2EA 2FE3A 4PZJA 3QYEA 2ZSIB 4XM3A 1S3JA 4PUSA 3WTWC 2LYCA 3BWGA 2BV6A 1J75A 1UHSA 2XGXA 4NUBA 1CQTA 4G6TB 2DQLA 4A3MJ 1D5YA 2PJRA 1A6QA 1QU3A 2Y75A 1I39A 4AM3A 3UNGC 1Y6IA 3SZGA 1O3RA 3L1PA 3LWFA 3LAPA 3ECHA 1R5GA 4PSWA 1H89C 2CG4A 5FRNA 2E35A 4L5JA 4U7BA 2R93J 2R7TA 2EZLA 1RNLA 1IN6A 1S7EA 1IXCA 1HLVA 4LB6B 4KIBA 2ISYA 3NWTA 3K4NA 4E7SA 1Y39A 3IRRA 1ZRDA 2EJRA 2IGMA 3HGYA 4HPQA 3S1RJ 3TW7A 1FT9A 5AONA 4DBRA 3F8FA 5HVQC 5LHHA 1SD5A 2VLAA 1IRGA 2DBBA 4BYYA 4QPQA 2LDUA 3ZRGA 2ECCA 3CO6C 2JPBA 1JXSA 5CVJA 1SANA 3Q5FA 1WJCA 2ELKA 3JREA 1MD0A 2FOKA 4XBFA 2XKOA 4BQNA 3M4OJ 3H1CA 3HXLA 1I1SA 1LKXA 2KIMA 2X6WA 3A4CA 3K70D 2WAEA 1ZLJA 3VDXA 1LE8B 4ENJA 2K9QA 4ANJA 1YG2A 2NS8A 1ZREA 3HPGA 1E2XA 4BJTA 2MH9A 5CVVA 3G1MA 1K78A 2LKSA 4A3BJ 3F23A 1YW8A 4M3FA 4AIKA 4HQMA 4Q48A 3I59A 2VODA 1EH8A 2PQ8A 1XN7A 2ZMEC 4JX4A 2VJIA 5E1WA 5EEAA 1OISA 2XPUA 1JT0A 5JLXA 5DYMA 5IP7J 5J8CA 3TOBA 5CLSA 2NOJB 1KYZA 2L02A 4II2A 5ILUA 3KFWX 2JPCA 1APLC 3SDBA 2FX0A 3HOXJ 2EA4A 4EJWA 1TWFJ 2ZJQF 5DCMA 5HODA 1R1UA 3T0YA 3VSLA 5ICFA 3ZCOA 5JHFA 1OYYA 4LK0F 4GFBA 2M5WA 4KN7X 2Q2EB 4I01A 5DS9A 4BUPA 1VNDA 1FP1D 5TISC 1ON1A 4AIHA 4FASD 1ZH5A 1Z21A 1FLIA 3QU3A 1GV5A 3FKJA 5LRSA 3G1OA 1KQ9A 3OYBA 2HOSA 1ETKA 2I10A 4I02A 3EDPA 2W25A 2HR3A 3IH4A 3IKTA 3RKYA 4RS8A 2DMUA 2RGVA 3BPVA 1YJNI 2MBFA 3D5RC 2PMUA 4BY7J 2QVOA 2NVTJ 5FLVA 3EYYA 2LKXA 2R0QC 3P9CA 2COBA 1VQLI 2KIQA 1OMIA 3BT9A 4MEXF 4LIUA 1HW5A 4P5OA 2FBHA 4XLNF 1LJ9A 3RCOA 3FXJA 1LB2A 3DV8A 3QOEA 1TW2A 1Y8QB 4NC7A 2DA7A 2NOGA 3DPTA 1ZG1A 1W0TA 3FM5A 3F6VA 1W36D 4CGZA 3M9AA 1F9NA 1MMDA 5M5XJ 3K69A 3F72A 3GF2A 3HRTA 1KZHA 4XLPF 5IT3A 3S1MJ 3C2GA 2VQGA 1ZLKA 5K7ZA 3HOVJ 2NVXJ 1EH7A 3RYRA 2DT7B 1VQOI 4HG2A 1JHFA 2MC4A 3OSGA 2R7UA 1V5FA 1ZGJA 4CCMA 5BS6A 3J81Z 2BY2A 2YX7A 2LG4A 3QP6A 4OOIA 1AA7A 5CQGA 2H09A 4DOZA 3IRQA 2BBYA 4A3GJ 4U0WA 3VEPA 3PNYA 1YRNB 2XIGA 2BE5F 2HTJA 1K79A 1X2MA 5GTIC 2DA1A 2WB1N 1XPXA 1BI0A 3C2BA 2E19A 1Z1DA 1IN4A 3KZZA 2CV1A 1VFCA 1FC3A 4IXAA 1EV7A 1UELB 1JHHA 2L9SA 2FXAA 1FMWA 1X58A 3S32A 1J9IA 4XLEA 4NNJA 3CMEI 1RUNA 2FBKA 1JKOC 4M9SA 4WXCA 2TCTA 4RGSA 2BHYA 2Y9ZA 3RTRA 3VODA 2EFNA 2MSYA 2V7FA 2OAZA 4MFDA 1HKTA 5DCFA 1S72I 4P96A 1U0JA 2L01A 4G7ZF 2BVMA 4FE4A 2EILH 2NXNB 1QZYA 2LBFA 1D8KA 2M30A 3OIOA 4H0EA 1DU0A 3SQNA 4EJTA 3M3YJ 1GUUA 5K1YA 3SFZA 4CHUA 3HDDA 2STTA 1Y56A 2VKHA 4FISA 1YTYA 3JRGA 2E1OA 5HS8A 3KLNA 2BGCA 3WU2C 4Q4ZF 1M1EB 2Y0MA 1K4TA 3GZ6A 2HDWA 2GIZA 4HX7A 4XORA 2ZKZA 5FKNA 2LMDA 5EZGA 4XR6A 5F6FA 4UB6C 1BN5A 4PGHA 2P5KA 1JI8A 3ISPA 3CLOA 2EWNA 2GZWA 1YS6A 3OR2C 5C4XJ 4IKFA 4YRVA 3MN2A 1JJ6C 3K0LA 2H1KA 3ZPLA 1BBYA 1Z05A 1PUEE 1XMKA 4BE2A 2EV5A 2OJED 3KZIC 1HKSA 3U2RA 4BE1A 3CD6I 3TO7A 2VPLA 3W2VA 3PFIA 4KMFA 3CDIA 3HGGA 4HX4A 4ENNA 3R6SA 1JUSA 5J4YA 4CO8A 2XGCA 1USSA 2VBZA 3MVPA 3WGIA 1I6HJ 4ZDPA 4BHBA 5LHIA 3MFKA 1W5SA 2OTLI 2YSRA 4YIIA 4XKBA 1R4MB 2OF7A 3FMQA 3SYTA 2JWTA 3EUAA 4LLNA 2DMQA 3BR3A 3TOAA 4DZPA 2DXIA 3W2AA 3I9V2 5IPAA 1OYIA 3K70C 4F92B 1NK2P 2O8KA 1R9TJ 2LK2A 1AKHB 2XAJA 1WSUA 1VQKI 2UXXA 1VQMI 2FBIA 3BCBA 3H3UA 1XD7A 2BY3A 2WC2A 1BI1A 2ZC2A 4HX8A 3BCAA 3BR6A 3L2CA 5CYVA 1KQ8A 5IT9Z 2DQRA 2ISZA 2VQHA 1VQ6I 5HLIA 3ML6A 4HDVA 2EH3A 1KONA 1R36A 4HLXA 2Q8KA 2HQRA 1T0FC 4AYBA 1N78A 5DDGA 3KEQA 3JRDA 1N77A 2DT6A 1PUFB 1IDYA 3BROA 1Z67A 4WX9A 1LFUP 1E17A 1ERDA 1I6XA 1LQ1A 3RPUA 5J8FA 3CJQB 5L3CA 3DQVC 4ZYAA 1P2FA 2VBWA 5DV5A 3BR2A 4OIQF 5K7FA 2BXYA 3GXOA 4WK8F 2QA4I 3DKYA 1YHQI 3FXOA 3S14J 2R92J 1YFHA 2M1BA 2O61A 1FBUA 4RM3A 5F64A 3OS2A 1X1AA 3EETA 4XSXF 2H6BA 3K4KA 4XNFA 5EJCA 2MLGA 4M6VA 3F3XA 3V8LA 4L9TA 1H9GA 1QNTA 3MCZA 1Z3XA 4J01A 2RV8A 2KKOA 1WVRA 2GAUA 2W85A 2YS9A 4TV7A 3QAHA 1ZGAA 3DBRB 1W7PD 3LA7A 1U78A 2K9MA 2Q0OA 2DW4A 2L7MP 3NEUA 1W36C 3CMYA 2M7BA 2CSOA 2E1MC 3OYMA 4HAMA 2LC2A 3GYHX 3CMMA 3U21A 5H6RA 4U87A 1X1BA 3K4CA 3PNVA 2KISA 2EFPA 2JK3A 4A5MA 2KPMA 1B9NA 2VT2A 3BQZA 2HOAA 3GFLA 2YU3A 2W48A 2XRLA 1UG2A 3TGNA 1TZLA 3C2HA 4MIMA 1SD7A 3HTSB 1P7IA 5AIPA 1W1WE 4PJLA 1OCTC 1Z3YA 3BZCA 5E17F 2F4MB 3D0SA 5EG0B 1IV8A 3W2WA 1OPCA 4BU2A 2L9RA 3L2WA 1HC8A 5J47A 4Y3OA 4F7ZA 5B3SH 2MG4A 2K9NA 3FHNA 2ECBA 4GO1A 2R7DA 3ZQCA 2CW0F 4NQWB 3MZ8A 1LDJA 3H5NA 2VPRA 3ASOH 3OYIA 4GYGA 5J3LA 4Y4RA 3W6VA 3WG7H 2QLZA 2V9PA 3IC7A 1LFPA 3LFKA 2B7EA 2EA2A 2VQLA 4XRMA 4UUVA 3HC7A 4IQ4A 5M5WJ 3WE2A 3F21A 3RJPA 2PMHA 2VKEA 3HOUJ 1QZZA 2HNHA 5L3DA 1QQIA 2E71A 4U0VA 1DGRM 4XONA 2V1DA 2DFHA 1ENHA 5TJJA 5GAEJ 4F91B 3A0HC 3H0GJ 2AXLA 4BNCA 4QSHA 2Y0SA 4BGDA 2KRCA 3F22A 1ZARA 2GA1A 1TTYA 1E3PA 3L00A 3K6GA 4C3IJ 3WGGA 5DM6F 2MC3A 3LSTA 2VKDA 5TRDA 4E7ZA 2JRTA 4L5EA 2GWRA 3MKWB 2HFHA 2VB6A 3I53A 2XKPA 3LA3A 4A69C 3L2UA 4BKXA 3E0JB 3DWLE 1WJ5A 3KLOA 3HHHA 1DDNA 3GZ5A 5JHUA 4GRIA 5FFXA 4ZYDA 3JRBA 3R4KA 3TBIA 5JLWA 4BXFA 4A2UA 3HOTA 1IJWC 2IT0A 4HNTA 1Y8RB 1IRXA 2QQ9A 4MQVA 4PSXA 4ZC3A 3OYLA 2L7FP 3T8TA 2P0WA 3FXRA 4NBQA 4BEHA 3B73A 5D8LB 3ULQB 1HQCA 4PK4A 4L9NA 3QYBA 2J5PA 1X1DA 3FF5A 5D6FA 1YE9A 2FU4A 2RNJA 2Z1DA 4V2GA 5ICEA 1CGPA 2LY1A 3C3WA 3O3KA 1V4RA 3A01A 1MSEC 1D5VA 4QTRA 2KQRA 3KETA 2QKMB 3DU5A 2FOWA 2M8EA 4XMYA 2X9DA 2MD5A 2XDVA 3U9GA 1MDMB 1X4OA 3FXQA 2DMTA 4ESJA 4A6DA 1TWCJ 1UB9A 2OBPA 2CQ7A 2VKVA 3ABTA 1HXDA 2Z33A 4DYRA 4Y33A 3F8BA 3KYLA 4MGRA 4ETSA 2RC4A 2F2EA 2PJRB 2ESHA 3DEEA 1R5HA 2DDAA 4C2MJ 3CC7I 3B6AA 2QWWA 1MZBA 2FEZA 5LBQA 2LD5A 5CVIA 4YIFA 2NYXA 3RZDJ 2VIXA 3DTIA 3K10A 4XQFA 3ZQHA 3ZMTA 3DLLF 3CC4I 1A35A 4PDKA 5JR3A 1N25A 3QYFA 3QPSA 4H4KC 2DPDA 2ICWG 3QP5A 3VYRB 5ICGA 2O7OA 3ERMA 3ERED 1LUJB 2EPFA 2PEXA 2MD0A 1FMVA 2Q1ZB 3FXKA 1PDNC 2STWA 4C3HJ 4UV9A 2A61A 5LEKA 3WGHA 2E60A 4I76A 1YIOA 2VBYA 2DK5A 3M07A 2DA2A 2GXGA 1KA8A 5F0CA 4HOBA 4CXFA 3WTYC 1BA5A 4O5VA 1K78B 2GLOA 1FJLA 3DFGA 3I59B 4KT6A 3JCUC 3HOSA 4Y7NJ 1WHUA 4O3MA 1V5EA 4MEYF 1S5LC 1DP7P 1Y0NA 1DUXC 4I2OA 2A69F 3CCYA 4I6ZA 4BQQA 3ROUA 1FWZA 5FROA 2PJPA 5DCMB 3GTPJ 2IA1A 1CF7A 3LNQA 3MKZA 3ECOA 4N4OB 3BG9A 1OQYA 1F36A 1TW3A 3PO2J 2IAIA 2LR8A 5C3EJ 2EFQA 1QZEA 3S16J 5F1RA 2PLYA 3F6OA 4Y15A 5KK1A 3OYNA 3K2AA 4XKWA 5TGTA 2IRFG 6PAXA 2HXIA 2NVYJ 1TBXA 5IP9J 2M2EA 3CCSI 2PBIA 2RN7A 2K9SA 3MZHA 4B4CA 1PP8F 1O7LA 4IHTA 1RKTA 4JP0A 4IVNA 4W1UA 2MGQA 1N75A 2ZXJA 4RGRA 1XSVA 2XV4S 1QPMA 4I0AA 1USTA 3TL4X 1VQ5I 3PNTA 4EJUA 2VJ4A 4BE0A 3DTEA 2CJJA 2OV7A 2R3SA 3VWBA 2CQQA 2CUZA 3OSFA 2DA6A 2P4WA 5E8GA 1QGPA 1ZQ3P 5B5EC 3T1BA 4MFEA 3V42A 2OTJI 1IUYA 2AQEA 3A1YA 2P5LC 3BZKA 2IXSA 3DTKA 4B48A 2HTSA 3V7CA 4HZFA 2VUMJ 2D2WA 4HLYA 3IV5A 4O6JA 3ELKA 5J40A 2V9KA 5IYCJ 4XLFA 5ED4A 1Y1VJ 2TRTA 3OMYA 1W7PA 1MBHA 3VYTB 2EIJH 3FZVA 1AU7A 2QSGX 3TO9A 1REPC 1B8IA 3OWTA 4KA4A 3RIRA 4BHCA 1DPUA 3RPUD 3FDYA 2K27A 2WBMA 2BYVE 4DW6A 3H0DA 5KVRA 2TDXA 2QEXI 2QM3A 2QQAA 4RB2C 4IF4A 5E1XA 1TQMA 2DT5A 3ABKH 4G6QA 2R7FA 1NTCA 3I4NJ 2HQ5A 2LF7A 2R7RA 2HXOA 3KEOA 4Q47A 3QWLA 4PJMA 2CQXA 2XROA 1IG7A 1MH3A 2OC6A 4AYBN 2HYGD 3SJMA 3TDZC 2PMZA 4HF2A 1KU9A 1TNTA 3KYDB 3ZMDA 5KAFC 4QWQA 4M73A 1U5TA 4EQQA 5J6XA 4E7KA 3S3NA 5FLXK 1NH3A 3COAC 2RREA 4CCLA 2VONA 5E20A 2DAOA 2DA5A 2R5YA 1SFKA 2L0KA 3ZXSA 3V8JA 1SVLA 2P81A 3JTGA 3AFHA 3KP3A 4AIJA 1JTXA 3GTOJ 1QRYA 4N4NB 2YR2A 2HDDA 4BXXJ 2HOTA 1IDZA 1IRFA 2NS7A 1Z9CA 1ORKA 3WTUC 2L7ZA 2VN2A 5EGOA 1TWGJ 3CO7C 1JJ8C 1DGWY 3IWZA 2LREA 3JRHA 4GDFA 1ETQA 4RA2A 3B6CA 9ANTA 2IGNA 3SDGA 1QHHD 3FHZA 3CCLI 4LJZF 3I3LA 2YPRA 3R61A 3LSJA 2RQQA 5IOYA 1BW6A 3BOQA 3HKZA 2OCCH 1W5CC 1RR7A 3LQRA 4A3IJ 3K9TA 4PCQA 4X1EA 2GOXB 2IS2A 3H3ZA 3LSGA 5CPRB 5JVTA 2HWVA 1IW7F 3V8KA 4CYCA 4JX6A 1J0RA 2I8DA 3M7GA 3CP8A 1WCMJ 3QOPA 2BY0A 5HLGA 2YX4A 3BR0A 3BTIA 1Z0XA 2B0LA 4LG0A 3C18A 1PVEA 4YEJA 3DF8A 3PIOF 1WRJA 2VQCA 3AL0C 4D9JA 3E97A 2JUGA 3WTXC 4W97A 3WHCA 4Z6YA 3HUGA 1EF4A 2P5VA 5GPCA 1TQIA 4WWCA 1WZ2A 1FY7A 1IXRC 1AWCA 1O3QA 2K3FA 4I99C 4JBAA 2G7UA 4IRGA 3CUQC 2NS0A 4D0PA 2KDZA 2X85A 1V5GA 3AG4H 2VI6A 1OJLA 3BP8A 2JVHA 1R00A 5H20A 3WU0A 1GV2A 4U0YA 1MBEA 3FWEA 3JRAA 3HJEA 1KQ0A 1NHAA 3LA2A 4G12A 5EYRA 3KE2A 3VB2A 1GXPA 1SVOA 3DKXA 2HKXA 1WGXA 1K61A 5GTHC 5FLXZ 3HL2A 1UCRA 2Y0SN 2LF8A 4MQ9F 2ACJA 3G73A 4EGYA 2BW3A 2UV1A 2GA2A 2HPMA 1D3YA 1LNWA 3RPQA 4DBQA 5L3FA 5FGMA 2QUFA 5HS9A 4GXOA 2JUCA 1I50J 1U6GA 1UHMA 1U9OA 2HOEA 2LRDA 4FE7A 1B9MA 1R4NB 2ZBKA 3L2RA 3WTSC 3OOPA 1IUFA 4FETA 2LY2A 1HBXG 4E70A 3A2KA 4M3DA 2XASA 3WTZA 5D5XB 1ZG5A 4DIQA 4LITA 2R7ZJ 1JKQC 5DD4A 2MH2A 3V7SA 3LSHA 1UJ8A 2CQKA 2L7KA 2DFIA 2KDOA 2RNGA 1BR1A 2R7WA 2LP0A 3V4GA 2MLKA 5FB2A 4RLQA 2A6TA 3GFJA 3GWZA 1D0YA 1G3TA 4BXUA 2CUFA 1Y1WJ 2EQRA 1H88C 2W57A 1FNNA 1FEXA 2CWEA 2IS1A 3CUQA 4U88A 2ESNA 4WF2A 3H9GA 1ZGWA 3KP7A 2ADUA 4BH9A 5DUIA 4HSRA 2HEOA 5GADJ 4UVCA 5DM7F 4XKVA 5FKMA 2PFBA 2I5UA 3HBLA 2H27A 1R1TA 4Z2YA 3HIFA 2N8GA 2RQPA 1X3ZB 2L4AA 3OYEA 3RZOJ 3NARA 4HF0A 1X1PA 3QU6A 5K5OA 3GMEA 4EGZA 2EZHA 2X51A 4ZDOA 1IN5A 1ETWA 2KZGA 5GAHJ 1G2HA 3UKGA 3I54A 2DYSH 4A6EA 2W82A 1X3WB 3NRVA 3L9FA 1VQ9I 4PFPA 3SHFA 1JGGA 4HDUA 2VE9A 5E3LA 3BG5A 5M5YJ 4OMZA 3CJNA 3HHGA 1IF1A 3CCJI 5J4VA 3GLXA 3M8FA 2QENA 3BR1A 3I64A 4AC0A 2PX9A 1XSXA 3HEFA 4RDUA 3E6CC 5BNGA 4EM1A 5ICCA 2E7XA 1L3LA 4LB5A 3K2ZA 2M9HA 5FRMA 2F4IA 5A2QK 3O8HA 1OCOH 4XRSG 1O3TA 3WE3A 1KU7A 1NG6A 2FQ3A 2M8GX 1K83J 4D5FA 1XS9A 3A02A 3I71A 2HVRA 3HOYJ 1YIJI 1FIPA 5FO5A 4UHTA 2DMPA 2F5CA 4HNVA 4LLLA 4P1WA 1EA3A 1BL0A 2ZO4A 2UWMA 2E1MB 3OL4A 1OCZH 2M7AA 4JQFA 1GLNA 3MKLA 4E7LA 3S1NJ 1UHWA 2H94A 4PFOA 3SEQA 2ZCWA 2EFOA 4LFUA 4KT5C 3CESA 3KX2A 1B72A 1FOKA 3AG1H 5FKLA 1PYVA 1A36A 3J7AY 3LSRA 1SMYF 1R7JA 4ZYGA 1DQUA 2CH0A 1J09A 2ME6A 4IHSA 4JYKA 4KFCA 3S15J 4ENMA 1LVAA 2FMYA 4BEHB 4CDGA 2ETHA 3CJRB 5EDNA 2P8TA 3GFIA 2H8WA 2ID3A 2IS4A 3S93A 4BJ5C 3LOCA 4EM2A 4L0YB 4CCOA 4CSWA 3A01B 1TC3C 4I09A 1U9NA 4ZZLA 2DJNA 1SEUA 2H6CA 2LFBA 5B66C 4BBRJ 2XC7A 1WJBA 2VT3A 4R79A 4AIDA 2ELJA 2DOEA 4P9UA 1ON2A 1G8XA 3OIQA 2L9NA 4M6XA 3O6BB 1J7KA 3BPXA 2O9LA 3CCRI 1SMTA 3BJOA 2KT0A 4ZJZA 2OD5A 4M9ZA 1ETVA 1NK3P 2R7OA 1XC5A 3ESWB 2IVMA 1MSFC 1RC9A 1HDPA 3DU6A 1ZKGA 1QVTA 4NB5A 4C3JJ 2A5WA 1ITYA 3J7AO 3M1CA 4ZTJA 2K5CA 3HG9A 1RETA 3NQOA 1SVMA 5F08A 4J19A 2CUJA 1F43A 4YFKF 2A6HF 2CFXA 2DN0A 2QBYA 5A2QZ 2K40A 4LG3A 3GW2A 5K7HA 2O6GE 1HF0A 1FYKA 1SAUA 4J00A 3MKYB 1JTYA 3EQLF 5IP6A 3FXMA 3MQ0A 2HS5A 3EUKL 1JKPC 1HSTA 2RVCA 2HVSA 3TDUC 2Z99A 2WWYA 3KPHA 4HSTA 3K1NA 5LFAA 3PUBA 1B1BA 1WKMA 5FLMJ 3ZMUA 1XCVA 2XB0X 1X1CA 1OYWA 1YS7A 2O8XA 4I98B 2Y9YA 3ABLH 1K6YA 2DFFA 4ESFA 2M0MA 2Y30A 4YIRX 1A04A 2V79A 3I4PA 2AS5F 4G94A 2AXTC 2KJBA 1V54H 1IRZA 3TP3A 4XICA 1P4WA 3OY9A 3FX3A 2PMZN 2EV0A 2YUSA 5LGNA 4BBSJ 2GM4A 1CF7B 5E8IA 4IZZA 4ASNA 3OOUA 1K7AA 5GP9A 1WJAA 2P6TA 4B43A 1ZRCA 1GDTA 2KJCA 4ZYHA 3S17J 3CC2I 3BTJA 4KITB 1X4PA 3HPHA 1MW7A 3PFYA 2A05A 2DI3A 4OIPF 2OUMA 1HSJA 2DCEA 1P7JA 2XUBA 3JW4A 5L3BA 3FBIB 4AVZA 4ESBA 4LMYA 4IL6C 3RDIA 5E1ZB 2F6CA 2MYSA 1JGSA 5CVRA 2KZVA 1VQ4I 1HA8A 2CW8A 3GLLA 2F5FA 5D6EA 3K4BA 1GHCA 3TO6A 2XF6A 1YO5C 3IL2A 2V6CA 3N97A 1VI0A 3D5LA 5F0HA 2Z16A 4XL9A 2ZJRF 4XN3A 3HKZN 3GX4X 4AU7A 2C6YA 3WHBA 2X1DA 5DD8A 3DBHB 2J5OA 1FP2A 5LD2C 1T8IA 1T56A 2KIUA 3EPZA 1G4DA 3GTKJ 2MA3A 4PJ0C 1K6OA 1ZYRF 2XSJC 2L3DA 3T8RA 1VZ0A 1SC7A 3GTMJ 4KUMA 2ELHA 4G9YA 4KJZA 2HYFA 3W6KB 5FFZA 3BZ6A 1OCRH 3OYKA 2V4JC 5IY5H 4OAYA 3WODF 3HSEA 3FK6A 4DNCA 3VPRA 1E3OC 3BC8A 4FQGA 3RI4A 3CCUI 2HVQA 4QPOA 2Y69H 2K02A 5D5VB 3LQQA 3MWMA 2DA4A 3LSKA 4XN0A 2R5ZA 1G59A 3RKWA 4AUXA 4A3LJ 2V1NA 1A31A 3OYJA 4YFXF 2JMWA 1X3UA 3TKYA 1B8IB 2VASA 5ILSA 1ZK8A 3VYUB 1OCCH 5HLTA 2IA0A 1QPIA 2HKOA 2W1OA 5J1UA 3I55I 2M3AA 3JRCA 2XAHA 4A3FJ 2M4KA 4EJOA 3GO5A 1G6NA 3LSIA 5HDNA 1MBKA 3KCCA 3RQIA 5LGTA 4XLAA 2A07F 5D4SA 1UZCA 4CZCA 1XG1A 3M8JA 4Y17A 2K7LA 4CUGA 4DYQA 3TQNA 4AD9A 5F1JA 2BXZA 1AOYA 2KMUA 4WXDA 2X6OA 1WPKA 1VTNC 3G1LA 3TP0A 1FZPB 3QPTA 3E5UA 4BACA 5D5WB 2E1NA 4UXNA 2R5YB 3OL3A 3CCMI 2LLKA 1MBGA 2VBXA 4B44A 4A5NA 4RMNA 2VL8A 2XAUA 1GVDA 3G4SI 1HOMA 4HYEA 3BLYA 4B3AA 2XGDA 2E36A 1KU3A 1S7AA 2IEKA 1JT6A 1ZG3A 3Q9SA 5CVUA 4ZYEA 4YG2F 4FTHA 2F5EA 2HGCA 1P4AA 1EKEA 4XSZF 3CZ6A 5DEQA 4NDLA 5EGOB 1C0WA 1KU2A 2O3FA 4MNUA 4M3EA 1MJAA 1D1AA 1G3YA 1IN8A 3S8PA 2EK5A 2L9VA 3K4JA 1LDDA 1WJEA 4M3BA 2E2IJ 4BDYA 3DLAA 2EIKH 3E3VA 1R5ID 1TNSA 2ZXWH 4X6AJ 4HNUA 1SD6A 2OZ6A 4L5IA 1KGSA 2K4BA 3MZYA 1LDKB 1POGA 2XPVA 1MJ9A 2VC0A 4CYCB 2VOPA 2Z2SB 2A5YB 2CV0A 2AQFA 3CQZJ 4UB8C 2P7CB 1DU6A 3BY6A 4D7MA 4HV5A 1LEBA 4JK1X 1XMXA 2KP6A 4A3CJ 1BR4A 4RGUA 3OYGA 4PJJA 2H1LA 1W0UA 3QQAA 2P7VB 3I56I 3HUGB 4Q5SF 4R8HA 1Y0UA 2JZYA 3BTCA 1U5TC 4CCNA 5K5QA 3LAJA 2L54A 1ZRFA 3N4MA 1H0MA 4LOCA 4I7HA 3GVAA 1MNMC 4RAZA 4U7DA 1D0XA 3OS0A 2XHKA 2X0LA 1MBFA 2XVCA 1XGMA 2L5QA 4OU0A 1O7FA 3ZMVA 4EEFG 1JE8A 5D5UB 2D1HA 2NNYA 3L7WA 4XOTA 4UUSA 3J7YJ 3OYCA 3U1DA 2KHMA 5B1BH 2AO9A 2O5RA 4LIVA 2BW3B 2NNNA 3A03A 3GTQJ 4G6DA 1HW1A 1SFXA 2FNAA 4FX0A 4LK1F 3CMAI 2FA5A 4L9VA 1YX5A 2CMPA 3GCMA 1DPRA 3PIPF 4MO7A 3S2HJ 2M4GA 4BS9A 1A5JA 1BJZA 3ZMZA 1R71A 2R4GA 4BY1J 2OA4A 1WI3A 4GCVA 3PO3J 1OCPA 4PJNA 1OR7C 2VE8A 4IRIA 2K86A 5J1YA 5LHGA 2R7XA 3E5XA 3AL0B 3ZGKA 3R60A 4HF1A 4V2FA 3JRFA 3S3MA 1XGSA 3T5XA 3G6EI 2CUEA 2LBFB 3ZQIA 2LOOA 3JRIA 4XKCA 2B9SA 3ZQGA 1D0ZA 2GQQA 4A93J 2NVQJ 3CUQB 1F1ZA 4BJ6C 1HCRA 4KNYA 2M87A 2E1CA 1ZHFA 3PUFA 2K3PA 1MMGA 2FUG2 1VQ7I 3S2DJ 3DEWA 3Q3SA 4N9HA 4M3GA 1GXQA 3DCFA 3J81K 3VSKA 4ZTFA 2ME0A 4OAZA 2EZKA 3E1SA 4Y13A 3BQYA 3H9QA 3OS1A 4BDZA 2XRNA 3DXJF 4EVIA 2WY7Q 3Q9VA 4ZDLA 3JAMK 5EEGA 3BR5A 1IN7A 3GTJJ 1B4AA 3IWFA 3D1NI 3EUHC 3KIOA 3IAM2 2DFEA 4B8XA 2W7NA 1B59A 4CZZA 3GUDA 3W6JB 4B09A 3RKQA 3JSOA 4UNOA 2Y31A 2R7QA 3VYSB 4RB1A 3PQJA 2JT1A 2Z5UA 2JSCA 1WWXA 4HA8A 1WJFA 3HYIA 5H2FC 3U1KA 1YX3A 2XB5A 3G71I 1OR7A 2OZUA 1O4XA 2XF5A 1Z6TA 4BHPA 1JUMA 2EINH 3MD2A 2AHQA 5AIQA 3H3VK 5B1AH 3J7ZI 1LEAA 4II3A 2CGPA 4A0ZA 1VQ8I 2CYYA 3E5QA 3JR9A 3K4LA 2X6XA 2FNPA 3QRFF 1J59A 2OPTA 5FKKA 2E2JJ 1GVJA 1BI2A 1I3QJ 2HPIA 2KRHA 5GPAA 4F3QA 2X6YA 3MMYB 1HW2A 2QQBA 2Z3YA 1WQ2A 2Y48A 4MTDA 2W84A 3AKZA 2XGEA 2VJ5A 2LH9A 3DBLB 3HM5A 3BTLA 2DYRH 2V1XA 4XIDA 4IEJA 1B72B 2PI0A 2QGUA 5LLQA 1RIOH 4BQAA 4RB0A 4IHWA 1I5ZA 2IW5A 3R0AA 4KDPA 1UMQA 4IQJA 1OLTA 3JTHA 3PSIA 3RYPA 2EFWA 4C2UA 1P92A 2QCOA 3IHUA 4XLCA 4S0HB 2FQ4A 2X48A 3PL8A 2LSOA 2V26A 3AG3H 3IH3A 3ZR8X 3EUHA 3O8GA 2MFZA 4F52A 3CCVI 2KLOA 1SAXA 2E5NA 3HSFA 1BC8C 1QA6A 2E7WA 2L4MA 2YU9J 2ZMEA 1RPWA 3G3ZA 4D7NA 3FIWA 2JQ7A 1IXSB 1NG7A 2HU9A 2QKLB 1YJ9I 4B3XA 1MMSA 2CRGA 4DZJA 3BG3A 2GOMA 1U8BA 3CJTB 3JAMZ 3E6MA 4KN4X 1FSHA 2VC1A 4AVPA 5KHDA 1S8NA 4LGWA 2BZTA 2IPQX 1XMAA 1JUPA 4DJAA 3B02A 2ZXHA 2BEOA 2DMNA 2WADA 4IPAA 3RKXA 4IOCF 1T38A 1WJDA 2D1VA 3DKWA 2LVSA 1XDSA 5FD6A 4DYCA 3GEZA 4JOMA 5F04A 2M45A 1I1GA 2PG4A 2QSHX 1WI9A 4RGXA 5HNFA 3HB9A 3SZTA 3WTTC 1S7OA 1T33A 5ILVA 1RI7A 1ZELA 2QBYB 4OIRF 3BG7A 4X0GA 2DOFA 3KP6A 3OYFA 1QHGA 5IT9K 3I5UA 4LLGF 4IO9F 2CS3A 4AWXB 2W4SA 4D5CA 1YJWI
chains in the Genus database with same CATH topology
1IZ1A 4L18B 2V1UA 2NAZA 1H9TA 3REOA 2O0YA 3HSRA 4RB3C 3ZN0A 1YYVA 2FMLA 5BMZA 2W24A 1T2KA 1HKQA 2KIFA 3PQKA 2GIVA 4YFNF 2G9WA 1T39A 2IP2A 3I0TA 3MEXA 4KIGA 5D4RA 4ENKA 2D45A 3KP4A 1F5TA 2V9VA 4OMYA 1RZ4A 2Q2EA 2XAGA 5HDGA 1XCBA 3HRMA 2CO5A 3QPHA 1ONVA 4DQ2A 4L0ZB 5ERIA 1MGTA 1J2XA 4IJAA 1G3WA 1U3EM 2RKHA 4IRHA 3WTVC 3P9IA 5D8KB 1XSDA 3HRUA 3M8EA 5L3GA 1FX7A 1PP7U 3CTAA 3DPLC 4UVAA 4MTEA 4XRFA 3BDDA 3R0JA 2VXZA 1YW7A 3GFMA 2F5DA 2HZTA 5BPDA 3CDHA 5HDKA 5BPIA 2RDPA 2FSWA 2UZKA 2O03A 3BJAA 5JI6A 3J80K 2Z9OA 4ZZDA 5FD5A 1J5YA 4CYDA 1Z7UA 1BJAA 3ZQ7A 4WCGA 5BOXA 1R58A 4QLCU 1MKMA 3ABUA 1ODDA 1Q1HA 3K1PA 3DP7A 2VOOA 1ULYA 2WTEA 4RAYA 1R23A 2XAQA 1FBSA 4N9IA 2G7HA 3VOEA 4FT8A 1Z6RA 3I58A 5HLHA 1W4MA 2OQGA 1UFMA 4A0YA 3O2PE 3ZP5A 4M71A 2IA2A 2HDCA 1T0FA 4NHJA 4G7OF 4LD5A 5E18F 1STZA 4KMUX 2HQNA 1MJBA 5LEJA 4HQEA 1BC7C 1FBQA 1SFEA 5HS7A 4OIOF 3ZN1A 1TLHB 1P4XA 4ZH4F 3KZYA 2NRAC 1BOAA 2DPUA 4CICA 4L9JA 4GYIA 1I27A 3J80Z 3K1MA 2GXBA 4P9FA 1BI3A 3F8NA 3F8CA 4ON0A 4OINF 4EMSA 2ZJ2A 1P6RA 3C1DA 3MAJA 2DO7A 4FX4A 2OU2A 2DTRA 3C7JA 1QBJA 3FMRA 5EEHA 3P7NA 1TQPA 4M74A 3BJ6A 1BIBA 2EB7A 4A0XA 4GGGA 1ZN2A 2A6EF 2WV0A 1EH6A 1T98A 4M9XA 2XAFA 4UV8A 1W7PB 4A12A 2KRFA 3V7RA 1U2WA 1XB4A 3KP5A 1O57A 1SFUA 3E6DA 3VFZA 3KP2A 1S29A 2UXNA 1SD4A 5BQTA 3WG9A 2IJLA 3FXUA 4G7HF 3F8MA 3P9KA 4N0BA 2QZ8A 2ZFWA 4S04A 3L09A 1U5TB 5LRRA 1W5TA 1XDUA 5DUKA 4UVBA 4EM0B 2JTVA 4FHTA 3M1EA 4KYWA 2X4HA 2DU9A 3OV8A 3E6BA 1ZAOA 4BAYA 2OQRA 1YLFA 3FM3A 2PN6A 2COMA 2FRHA 4NQWA 5L3EA 3ZMSA 1T6SA 3SXYA 2A3SA 1V3FA 1B6AA 2FF4A 5K5RA 5CJ9A 4KIFA 1FYLA 2DK8A 1L0OC 4EV0A 4G8XA 4R1HA 5HOOA 4LG0B 1FSEA 1R1VA 4M6YA 1F4KA 1FPQA 1Z91A 1G3SA 3HTUA 1S6LA 4M72A 2ZNZA 4HV6A 3DEUA 3EYIA 3H92A 5H6QA 1R22A 1FYMA 1BIAA 3IKVA 1OKRA 1XGOA 2A68F 2LKPA 1U8RA 1YW9A 4HW0A 4KICA 1D8JA 4P55A 2ZNYA 5JFRA 3FMSA 1IAWA 1RUOA 4WXHA 4EJVA 1KYWA 3CUOA 3SZPA 2QYOA 2P6SA 3HRSA 5LGUA 3AAFA 4PGGA 2EV6A 1O3SA 1BM9A 2LNBA 1YQAA 1QO0D 3JSPA 2K4JA 3S2WA 2DLLA 4HBLA 4I0BA 2ZMEB 1MDMA 4S05A 4MHGA 3WU1B 1XGNA 4K2EA 2FE3A 4PZJA 1S3JA 3WTWC 3BWGA 2BV6A 1J75A 2XGXA 2DQLA 2Y75A 1O3RA 3LWFA 3LAPA 3ECHA 1R5GA 2CG4A 4L5JA 4U7BA 1RNLA 1IN6A 1IXCA 4LB6B 4KIBA 2ISYA 3IRRA 1ZRDA 2EJRA 1FT9A 5AONA 5LHHA 3F8FA 5HVQC 1SD5A 1IRGA 2DBBA 4BYYA 2LDUA 3CO6C 2JPBA 1JXSA 5CVJA 3Q5FA 1MD0A 2FOKA 4XBFA 2XKOA 1I1SA 2KIMA 1ZLJA 4ENJA 1YG2A 1ZREA 1E2XA 2MH9A 5CVVA 1K78A 3F23A 1YW8A 4AIKA 4HQMA 4Q48A 3I59A 2VODA 1EH8A 2PQ8A 1XN7A 5E1WA 5DYMA 5J8CA 3TOBA 5CLSA 1KYZA 2L02A 5ILUA 3KFWX 2JPCA 2EA4A 4EJWA 5DCMA 1R1UA 3T0YA 5ICFA 1OYYA 4LK0F 2M5WA 4KN7X 4I01A 1FP1D 1ON1A 4AIHA 1ZH5A 1FLIA 3QU3A 5LRSA 1KQ9A 4I02A 3EDPA 2W25A 2HR3A 3IKTA 3RKYA 4RS8A 2RGVA 3BPVA 2MBFA 2PMUA 2QVOA 3EYYA 3P9CA 1OMIA 4MEXF 1HW5A 4P5OA 2FBHA 4XLNF 1LJ9A 1LB2A 3DV8A 1TW2A 3DPTA 1ZG1A 4CGZA 3FM5A 3F6VA 3M9AA 1F9NA 3K69A 3F72A 3GF2A 3HRTA 4XLPF 5IT3A 1ZLKA 1EH7A 3RYRA 1JHFA 1ZGJA 3J81Z 5BS6A 2YX7A 3QP6A 4OOIA 2H09A 3IRQA 2BBYA 4U0WA 3VEPA 2XIGA 2BE5F 2HTJA 1K79A 1BI0A 3KZZA 1Z1DA 1IN4A 1FC3A 4IXAA 1EV7A 1JHHA 2FXAA 1J9IA 1RUNA 2FBKA 4M9SA 4WXCA 4RGSA 3RTRA 3VODA 2EFNA 2OAZA 1HKTA 5DCFA 4P96A 2L01A 4G7ZF 4H0EA 1QZYA 4EJTA 1D8KA 2M30A 3SQNA 5K1YA 4CHUA 3SFZA 2STTA 1YTYA 5HS8A 3KLNA 2BGCA 4Q4ZF 2Y0MA 3GZ6A 4HX7A 2ZKZA 5F6FA 1BN5A 4PGHA 2P5KA 3ISPA 3CLOA 2EWNA 2GZWA 1YS6A 3K0LA 3ZPLA 1BBYA 1Z05A 1PUEE 1XMKA 2EV5A 1HKSA 3U2RA 3TO7A 3PFIA 4KMFA 4HX4A 4ENNA 3R6SA 4CO8A 1USSA 2VBZA 3WGIA 4BHBA 5LHIA 3MFKA 1W5SA 2YSRA 4YIIA 3FMQA 4LLNA 3TOAA 1OYIA 2XAJA 1WSUA 2UXXA 2FBIA 3H3UA 1XD7A 2WC2A 1BI1A 4HX8A 3L2CA 1KQ8A 5CYVA 5IT9Z 2DQRA 2ISZA 5HLIA 3ML6A 4HDVA 1R36A 4HLXA 2Q8KA 2HQRA 5DDGA 3KEQA 3BROA 4WX9A 1E17A 1I6XA 1LQ1A 3RPUA 5J8FA 5L3CA 3DQVC 1P2FA 2VBWA 5DV5A 4OIQF 3GXOA 4WK8F 1YFHA 2M1BA 2O61A 1FBUA 5F64A 3EETA 4XSXF 2H6BA 2MLGA 3F3XA 3V8LA 4L9TA 1H9GA 1QNTA 3MCZA 2RV8A 2KKOA 2GAUA 2W85A 4TV7A 3QAHA 1ZGAA 1W7PD 3LA7A 1U78A 2Q0OA 2DW4A 3NEUA 2CSOA 4HAMA 3GYHX 5H6RA 2EFPA 4A5MA 1B9NA 2VT2A 3GFLA 2YU3A 3TGNA 1SD7A 3HTSB 5AIPA 5E17F 3D0SA 1OPCA 4F7ZA 4GO1A 2R7DA 2CW0F 1LDJA 4GYGA 2QLZA 3IC7A 3LFKA 2EA2A 4UUVA 3WE2A 3F21A 3RJPA 2PMHA 1QZZA 5L3DA 1QQIA 4U0VA 2V1DA 5TJJA 2AXLA 4BNCA 3F22A 1ZARA 2GA1A 1TTYA 3L00A 3WGGA 2MC3A 3LSTA 5TRDA 2JRTA 2GWRA 2HFHA 3I53A 2XKPA 3LA3A 3KLOA 3HHHA 1DDNA 3GZ5A 5JHUA 5FFXA 4ZYDA 3R4KA 4A2UA 3HOTA 2IT0A 2QQ9A 4MQVA 3T8TA 3FXRA 3B73A 5D8LB 3ULQB 1HQCA 4L9NA 2J5PA 3FF5A 5D6FA 2FU4A 2RNJA 5ICEA 1CGPA 3C3WA 3O3KA 1V4RA 1D5VA 3KETA 2M8EA 2MD5A 3U9GA 1MDMB 3FXQA 4ESJA 4A6DA 1UB9A 2OBPA 3ABTA 1HXDA 2Z33A 3F8BA 4MGRA 4ETSA 2RC4A 2F2EA 2ESHA 1R5HA 2QWWA 1MZBA 2FEZA 5LBQA 5CVIA 4YIFA 2NYXA 3ZMTA 4PDKA 5JR3A 2DPDA 3QP5A 5ICGA 3ERED 2PEXA 1PDNC 2STWA 4UV9A 2A61A 5LEKA 3WGHA 1YIOA 2VBYA 2DK5A 2GXGA 1KA8A 4HOBA 4CXFA 3WTYC 4O5VA 1K78B 3DFGA 3I59B 3HOSA 4O3MA 4MEYF 1DP7P 1DUXC 4I2OA 2A69F 3ROUA 1FWZA 2PJPA 5DCMB 2IA1A 1CF7A 3ECOA 1TW3A 2EFQA 5F1RA 2PLYA 3F6OA 4Y15A 5KK1A 2IRFG 6PAXA 1TBXA 2PBIA 2RN7A 3MZHA 1PP8F 1O7LA 4IHTA 4IVNA 2ZXJA 4RGRA 1XSVA 2XV4S 1QPMA 4I0AA 1USTA 4EJUA 2R3SA 5E8GA 2P4WA 1QGPA 3T1BA 1IUYA 2P5LC 2HTSA 3V7CA 4HZFA 2D2WA 4HLYA 4O6JA 3ELKA 5ED4A 1W7PA 3FZVA 3TO9A 1REPC 4KA4A 3RIRA 4BHCA 1DPUA 2K27A 2BYVE 5KVRA 2TDXA 2QM3A 2QQAA 4RB2C 4IF4A 5E1XA 1TQMA 2DT5A 4G6QA 2R7FA 2LF7A 3KEOA 4Q47A 2XROA 2HYGD 3TDZC 4HF2A 1KU9A 1TNTA 3ZMDA 4QWQA 4M73A 1U5TA 4EQQA 5J6XA 5FLXK 3COAC 2VONA 5E20A 2DAOA 3V8JA 3JTGA 4AIJA 3KP3A 2YR2A 1IRFA 1Z9CA 3WTUC 2VN2A 3CO7C 3IWZA 3FHZA 4LJZF 2YPRA 3R61A 3BOQA 3LQRA 3K9TA 4PCQA 3H3ZA 5JVTA 2HWVA 1IW7F 3V8KA 1J0RA 3M7GA 3QOPA 5HLGA 2YX4A 2B0LA 4LG0A 3C18A 3DF8A 1WRJA 3E97A 3WTXC 3HUGA 2P5VA 4WWCA 1TQIA 1FY7A 1IXRC 1AWCA 1O3QA 4JBAA 2G7UA 4IRGA 3CUQC 2NS0A 4D0PA 3BP8A 1R00A 5H20A 3WU0A 4U0YA 3FWEA 1KQ0A 1NHAA 3LA2A 3KE2A 3VB2A 1GXPA 2HKXA 5FLXZ 1UCRA 4MQ9F 2LF8A 2ACJA 3G73A 4EGYA 2GA2A 1D3YA 1LNWA 3RPQA 5L3FA 5FGMA 2QUFA 5HS9A 4GXOA 1U6GA 1UHMA 2HOEA 1B9MA 2ZBKA 3WTSC 3OOPA 1HBXG 4E70A 2XASA 3WTZA 5D5XB 1ZG5A 5DD4A 2MH2A 3V7SA 2CQKA 2DFIA 3V4GA 2MLKA 5FB2A 3GFJA 3GWZA 1G3TA 4BXUA 2W57A 1FNNA 2CWEA 3CUQA 4U88A 2ESNA 4WF2A 3KP7A 2ADUA 4BH9A 5DUIA 2HEOA 4UVCA 2PFBA 2H27A 1R1TA 4Z2YA 3HIFA 2RQPA 2L4AA 4HF0A 3QU6A 5K5OA 4EGZA 1IN5A 3I54A 4A6EA 3NRVA 3L9FA 3SHFA 4HDUA 2VE9A 4OMZA 3CJNA 3HHGA 1IF1A 3GLXA 3M8FA 2QENA 3I64A 1XSXA 3E6CC 4EM1A 5ICCA 2E7XA 1L3LA 4LB5A 3K2ZA 5A2QK 1O3TA 3WE3A 1KU7A 2FQ3A 3I71A 5FO5A 4UHTA 2F5CA 4LLLA 2ZO4A 2UWMA 4JQFA 1UHWA 2H94A 2ZCWA 2EFOA 4LFUA 4KT5C 1FOKA 1SMYF 1R7JA 4ZYGA 4IHSA 4KFCA 4ENMA 1LVAA 2FMYA 4CDGA 2ETHA 2P8TA 3GFIA 4EM2A 4L0YB 4I09A 4ZZLA 2H6CA 2VT3A 4R79A 4P9UA 1ON2A 4M6XA 3O6BB 1J7KA 3BPXA 1SMTA 3BJOA 2OD5A 4M9ZA 2IVMA 4NB5A 3J7AO 3NQOA 4YFKF 2A6HF 2CFXA 2QBYA 5A2QZ 3GW2A 2O6GE 1FYKA 3EQLF 3MQ0A 2HS5A 1HSTA 2RVCA 3TDUC 2Z99A 2WWYA 3K1NA 1B1BA 1WKMA 3ZMUA 1XCVA 1OYWA 1YS7A 2O8XA 4I98B 4ESFA 1A04A 2V79A 3I4PA 2AS5F 4G94A 2KJBA 1P4WA 3FX3A 2EV0A 5LGNA 1CF7B 5E8IA 4ASNA 1K7AA 2P6TA 1ZRCA 2KJCA 4ZYHA 4OIPF 2DI3A 1HSJA 2XUBA 3JW4A 5L3BA 4ESBA 4LMYA 3RDIA 5E1ZB 1JGSA 5CVRA 2F5FA 5D6EA 1GHCA 3TO6A 1YO5C 3IL2A 2V6CA 3N97A 3D5LA 3GX4X 2C6YA 5DD8A 2J5OA 1FP2A 2KIUA 1G4DA 2MA3A 1K6OA 1ZYRF 3T8RA 2L3DA 4KUMA 2ELHA 4G9YA 2HYFA 3W6KB 5FFZA 3BZ6A 3WODF 3HSEA 4DNCA 3RI4A 5D5VB 2K02A 3LQQA 3MWMA 3RKWA 4YFXF 1X3UA 3TKYA 5ILSA 2IA0A 2HKOA 2XAHA 4EJOA 3GO5A 1G6NA 5HDNA 3KCCA 5LGTA 2A07F 5D4SA 4Y17A 2K7LA 3TQNA 4AD9A 1AOYA 4WXDA 1VTNC 1FZPB 3QPTA 3E5UA 5D5WB 2E1NA 4UXNA 2VBXA 4A5NA 4HYEA 1KU3A 1S7AA 1ZG3A 3Q9SA 5CVUA 4ZYEA 4YG2F 2F5EA 2HGCA 1P4AA 4XSZF 5DEQA 1C0WA 1KU2A 2O3FA 4MNUA 1MJAA 1G3YA 1IN8A 2EK5A 1LDDA 3E3VA 1TNSA 1SD6A 2OZ6A 4L5IA 1KGSA 2K4BA 3MZYA 1LDKB 1MJ9A 2VC0A 2VOPA 2A5YB 2P7CB 3BY6A 4HV5A 1LEBA 4JK1X 4RGUA 2P7VB 4Q5SF 4R8HA 1Y0UA 3LAJA 2JZYA 1U5TC 5K5QA 2L54A 1ZRFA 3N4MA 1H0MA 4I7HA 3GVAA 4RAZA 4U7DA 2XHKA 2X0LA 4OU0A 2XVCA 1XGMA 1JE8A 1O7FA 3ZMVA 5D5UB 2D1HA 2NNYA 3L7WA 3U1DA 2NNNA 4G6DA 1HW1A 1SFXA 2FNAA 4FX0A 4LK1F 2FA5A 4L9VA 1DPRA 3ZMZA 2OA4A 4GCVA 2VE8A 4IRIA 2K86A 5LHGA 3E5XA 3R60A 4HF1A 1XGSA 3T5XA 2GQQA 3CUQB 1F1ZA 4KNYA 2M87A 2E1CA 1ZHFA 4N9HA 1GXQA 3J81K 4Y13A 2XRNA 3DXJF 4EVIA 3Q9VA 3JAMK 5EEGA 1IN7A 1B4AA 3IWFA 4B8XA 1B59A 4CZZA 3GUDA 3W6JB 4B09A 3JSOA 4UNOA 4RB1A 3PQJA 2JT1A 2Z5UA 2JSCA 1WWXA 4HA8A 3HYIA 1OR7A 2OZUA 1Z6TA 4BHPA 5AIQA 1LEAA 2CGPA 4A0ZA 2CYYA 3E5QA 2FNPA 3QRFF 1J59A 1GVJA 1BI2A 1HW2A 2QQBA 2Z3YA 1WQ2A 2Y48A 4MTDA 2W84A 2V1XA 2PI0A 5LLQA 1RIOH 4BQAA 4RB0A 1I5ZA 2IW5A 3R0AA 4KDPA 3JTHA 2EFWA 3RYPA 1P92A 3IHUA 2LSOA 3EUHA 1SAXA 3HSFA 1BC8C 2E7WA 2L4MA 2ZMEA 3G3ZA 1IXSB 3JAMZ 3E6MA 4KN4X 1FSHA 2VC1A 4AVPA 1S8NA 4LGWA 2IPQX 1XMAA 2BEOA 3B02A 1T38A 4IPAA 3RKXA 2D1VA 3DKWA 1XDSA 5FD6A 3GEZA 2M45A 1I1GA 2PG4A 1WI9A 4RGXA 3WTTC 3SZTA 1S7OA 5ILVA 1RI7A 2QBYB 4OIRF 3KP6A 5IT9K 3I5UA 4LLGF 4AWXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZ1 A;  4L18 B;  2V1U A;  2NAZ A;  1H9T A;  3REO A;  2O0Y A;  3HSR A;  4RB3 C;  3ZN0 A;  1YYV A;  2FML A;  5BMZ A;  2W24 A;  1T2K A;  1HKQ A;  2KIF A;  3PQK A;  2GIV A;  4YFN F;  2G9W A;  1T39 A;  2IP2 A;  3I0T A;  3MEX A;  4KIG A;  5D4R A;  4ENK A;  2D45 A;  3KP4 A;  1F5T A;  2V9V A;  4OMY A;  1RZ4 A;  2Q2E A;  2XAG A;  5HDG A;  1XCB A;  3HRM A;  2CO5 A;  3QPH A;  1ONV A;  4DQ2 A;  4L0Z B;  5ERI A;  1MGT A;  1J2X A;  4IJA A;  1G3W A;  1U3E M;  2RKH A;  4IRH A;  3WTV C;  3P9I A;  5D8K B;  1XSD A;  3HRU A;  3M8E A;  5L3G A;  1FX7 A;  1PP7 U;  3CTA A;  3DPL C;  4UVA A;  4MTE A;  4XRF A;  3BDD A;  3R0J A;  2VXZ A;  1YW7 A;  3GFM A;  2F5D A;  2HZT A;  5BPD A;  3CDH A;  5HDK A;  5BPI A;  2RDP A;  2FSW A;  2UZK A;  2O03 A;  3BJA A;  5JI6 A;  3J80 K;  2Z9O A;  4ZZD A;  5FD5 A;  1J5Y A;  4CYD A;  1Z7U A;  1BJA A;  3ZQ7 A;  4WCG A;  5BOX A;  1R58 A;  4QLC U;  1MKM A;  3ABU A;  1ODD A;  1Q1H A;  3K1P A;  3DP7 A;  2VOO A;  1ULY A;  2WTE A;  4RAY A;  1R23 A;  2XAQ A;  1FBS A;  4N9I A;  2G7H A;  3VOE A;  4FT8 A;  1Z6R A;  3I58 A;  5HLH A;  1W4M A;  2OQG A;  1UFM A;  4A0Y A;  3O2P E;  3ZP5 A;  4M71 A;  2IA2 A;  2HDC A;  1T0F A;  4NHJ A;  4G7O F;  4LD5 A;  5E18 F;  1STZ A;  4KMU X;  2HQN A;  1MJB A;  5LEJ A;  4HQE A;  1BC7 C;  1FBQ A;  1SFE A;  5HS7 A;  4OIO F;  3ZN1 A;  1TLH B;  1P4X A;  4ZH4 F;  3KZY A;  2NRA C;  1BOA A;  2DPU A;  4CIC A;  4L9J A;  4GYI A;  1I27 A;  3J80 Z;  3K1M A;  2GXB A;  4P9F A;  1BI3 A;  3F8N A;  3F8C A;  4ON0 A;  4OIN F;  4EMS A;  2ZJ2 A;  1P6R A;  3C1D A;  3MAJ A;  2DO7 A;  4FX4 A;  2OU2 A;  2DTR A;  3C7J A;  1QBJ A;  3FMR A;  5EEH A;  3P7N A;  1TQP A;  4M74 A;  3BJ6 A;  1BIB A;  2EB7 A;  4A0X A;  4GGG A;  1ZN2 A;  2A6E F;  2WV0 A;  1EH6 A;  1T98 A;  4M9X A;  2XAF A;  4UV8 A;  1W7P B;  4A12 A;  2KRF A;  3V7R A;  1U2W A;  1XB4 A;  3KP5 A;  1O57 A;  1SFU A;  3E6D A;  3VFZ A;  3KP2 A;  1S29 A;  2UXN A;  1SD4 A;  5BQT A;  3WG9 A;  2IJL A;  3FXU A;  4G7H F;  3F8M A;  3P9K A;  4N0B A;  2QZ8 A;  2ZFW A;  4S04 A;  3L09 A;  1U5T B;  5LRR A;  1W5T A;  1XDU A;  5DUK A;  4UVB A;  4EM0 B;  2JTV A;  4FHT A;  3M1E A;  4KYW A;  2X4H A;  2DU9 A;  3OV8 A;  3E6B A;  1ZAO A;  4BAY A;  2OQR A;  1YLF A;  3FM3 A;  2PN6 A;  2COM A;  2FRH A;  4NQW A;  5L3E A;  3ZMS A;  1T6S A;  3SXY A;  2A3S A;  1V3F A;  1B6A A;  2FF4 A;  5K5R A;  5CJ9 A;  4KIF A;  1FYL A;  2DK8 A;  1L0O C;  4EV0 A;  4G8X A;  4R1H A;  5HOO A;  4LG0 B;  1FSE A;  1R1V A;  4M6Y A;  1F4K A;  1FPQ A;  1Z91 A;  1G3S A;  3HTU A;  1S6L A;  4M72 A;  2ZNZ A;  4HV6 A;  3DEU A;  3EYI A;  3H92 A;  5H6Q A;  1R22 A;  1FYM A;  1BIA A;  3IKV A;  1OKR A;  1XGO A;  2A68 F;  2LKP A;  1U8R A;  1YW9 A;  4HW0 A;  4KIC A;  1D8J A;  4P55 A;  2ZNY A;  5JFR A;  3FMS A;  1IAW A;  1RUO A;  4WXH A;  4EJV A;  1KYW A;  3CUO A;  3SZP A;  2QYO A;  2P6S A;  3HRS A;  5LGU A;  3AAF A;  4PGG A;  2EV6 A;  1O3S A;  1BM9 A;  2LNB A;  1YQA A;  1QO0 D;  3JSP A;  2K4J A;  3S2W A;  2DLL A;  4HBL A;  4I0B A;  2ZME B;  1MDM A;  4S05 A;  4MHG A;  3WU1 B;  1XGN A;  4K2E A;  2FE3 A;  4PZJ A;  1S3J A;  3WTW C;  3BWG A;  2BV6 A;  1J75 A;  2XGX A;  2DQL A;  2Y75 A;  1O3R A;  3LWF A;  3LAP A;  3ECH A;  1R5G A;  2CG4 A;  4L5J A;  4U7B A;  1RNL A;  1IN6 A;  1IXC A;  4LB6 B;  4KIB A;  2ISY A;  3IRR A;  1ZRD A;  2EJR A;  1FT9 A;  5AON A;  5LHH A;  3F8F A;  5HVQ C;  1SD5 A;  1IRG A;  2DBB A;  4BYY A;  2LDU A;  3CO6 C;  2JPB A;  1JXS A;  5CVJ A;  3Q5F A;  1MD0 A;  2FOK A;  4XBF A;  2XKO A;  1I1S A;  2KIM A;  1ZLJ A;  4ENJ A;  1YG2 A;  1ZRE A;  1E2X A;  2MH9 A;  5CVV A;  1K78 A;  3F23 A;  1YW8 A;  4AIK A;  4HQM A;  4Q48 A;  3I59 A;  2VOD A;  1EH8 A;  2PQ8 A;  1XN7 A;  5E1W A;  5DYM A;  5J8C A;  3TOB A;  5CLS A;  1KYZ A;  2L02 A;  5ILU A;  3KFW X;  2JPC A;  2EA4 A;  4EJW A;  5DCM A;  1R1U A;  3T0Y A;  5ICF A;  1OYY A;  4LK0 F;  2M5W A;  4KN7 X;  4I01 A;  1FP1 D;  1ON1 A;  4AIH A;  1ZH5 A;  1FLI A;  3QU3 A;  5LRS A;  1KQ9 A;  4I02 A;  3EDP A;  2W25 A;  2HR3 A;  3IKT A;  3RKY A;  4RS8 A;  2RGV A;  3BPV A;  2MBF A;  2PMU A;  2QVO A;  3EYY A;  3P9C A;  1OMI A;  4MEX F;  1HW5 A;  4P5O A;  2FBH A;  4XLN F;  1LJ9 A;  1LB2 A;  3DV8 A;  1TW2 A;  3DPT A;  1ZG1 A;  4CGZ A;  3FM5 A;  3F6V A;  3M9A A;  1F9N A;  3K69 A;  3F72 A;  3GF2 A;  3HRT A;  4XLP F;  5IT3 A;  1ZLK A;  1EH7 A;  3RYR A;  1JHF A;  1ZGJ A;  3J81 Z;  5BS6 A;  2YX7 A;  3QP6 A;  4OOI A;  2H09 A;  3IRQ A;  2BBY A;  4U0W A;  3VEP A;  2XIG A;  2BE5 F;  2HTJ A;  1K79 A;  1BI0 A;  3KZZ A;  1Z1D A;  1IN4 A;  1FC3 A;  4IXA A;  1EV7 A;  1JHH A;  2FXA A;  1J9I A;  1RUN A;  2FBK A;  4M9S A;  4WXC A;  4RGS A;  3RTR A;  3VOD A;  2EFN A;  2OAZ A;  1HKT A;  5DCF A;  4P96 A;  2L01 A;  4G7Z F;  4H0E A;  1QZY A;  4EJT A;  1D8K A;  2M30 A;  3SQN A;  5K1Y A;  4CHU A;  3SFZ A;  2STT A;  1YTY A;  5HS8 A;  3KLN A;  2BGC A;  4Q4Z F;  2Y0M A;  3GZ6 A;  4HX7 A;  2ZKZ A;  5F6F A;  1BN5 A;  4PGH A;  2P5K A;  3ISP A;  3CLO A;  2EWN A;  2GZW A;  1YS6 A;  3K0L A;  3ZPL A;  1BBY A;  1Z05 A;  1PUE E;  1XMK A;  2EV5 A;  1HKS A;  3U2R A;  3TO7 A;  3PFI A;  4KMF A;  4HX4 A;  4ENN A;  3R6S A;  4CO8 A;  1USS A;  2VBZ A;  3WGI A;  4BHB A;  5LHI A;  3MFK A;  1W5S A;  2YSR A;  4YII A;  3FMQ A;  4LLN A;  3TOA A;  1OYI A;  2XAJ A;  1WSU A;  2UXX A;  2FBI A;  3H3U A;  1XD7 A;  2WC2 A;  1BI1 A;  4HX8 A;  3L2C A;  1KQ8 A;  5CYV A;  5IT9 Z;  2DQR A;  2ISZ A;  5HLI A;  3ML6 A;  4HDV A;  1R36 A;  4HLX A;  2Q8K A;  2HQR A;  5DDG A;  3KEQ A;  3BRO A;  4WX9 A;  1E17 A;  1I6X A;  1LQ1 A;  3RPU A;  5J8F A;  5L3C A;  3DQV C;  1P2F A;  2VBW A;  5DV5 A;  4OIQ F;  3GXO A;  4WK8 F;  1YFH A;  2M1B A;  2O61 A;  1FBU A;  5F64 A;  3EET A;  4XSX F;  2H6B A;  2MLG A;  3F3X A;  3V8L A;  4L9T A;  1H9G A;  1QNT A;  3MCZ A;  2RV8 A;  2KKO A;  2GAU A;  2W85 A;  4TV7 A;  3QAH A;  1ZGA A;  1W7P D;  3LA7 A;  1U78 A;  2Q0O A;  2DW4 A;  3NEU A;  2CSO A;  4HAM A;  3GYH X;  5H6R A;  2EFP A;  4A5M A;  1B9N A;  2VT2 A;  3GFL A;  2YU3 A;  3TGN A;  1SD7 A;  3HTS B;  5AIP A;  5E17 F;  3D0S A;  1OPC A;  4F7Z A;  4GO1 A;  2R7D A;  2CW0 F;  1LDJ A;  4GYG A;  2QLZ A;  3IC7 A;  3LFK A;  2EA2 A;  4UUV A;  3WE2 A;  3F21 A;  3RJP A;  2PMH A;  1QZZ A;  5L3D A;  1QQI A;  4U0V A;  2V1D A;  5TJJ A;  2AXL A;  4BNC A;  3F22 A;  1ZAR A;  2GA1 A;  1TTY A;  3L00 A;  3WGG A;  2MC3 A;  3LST A;  5TRD A;  2JRT A;  2GWR A;  2HFH A;  3I53 A;  2XKP A;  3LA3 A;  3KLO A;  3HHH A;  1DDN A;  3GZ5 A;  5JHU A;  5FFX A;  4ZYD A;  3R4K A;  4A2U A;  3HOT A;  2IT0 A;  2QQ9 A;  4MQV A;  3T8T A;  3FXR A;  3B73 A;  5D8L B;  3ULQ B;  1HQC A;  4L9N A;  2J5P A;  3FF5 A;  5D6F A;  2FU4 A;  2RNJ A;  5ICE A;  1CGP A;  3C3W A;  3O3K A;  1V4R A;  1D5V A;  3KET A;  2M8E A;  2MD5 A;  3U9G A;  1MDM B;  3FXQ A;  4ESJ A;  4A6D A;  1UB9 A;  2OBP A;  3ABT A;  1HXD A;  2Z33 A;  3F8B A;  4MGR A;  4ETS A;  2RC4 A;  2F2E A;  2ESH A;  1R5H A;  2QWW A;  1MZB A;  2FEZ A;  5LBQ A;  5CVI A;  4YIF A;  2NYX A;  3ZMT A;  4PDK A;  5JR3 A;  2DPD A;  3QP5 A;  5ICG A;  3ERE D;  2PEX A;  1PDN C;  2STW A;  4UV9 A;  2A61 A;  5LEK A;  3WGH A;  1YIO A;  2VBY A;  2DK5 A;  2GXG A;  1KA8 A;  4HOB A;  4CXF A;  3WTY C;  4O5V A;  1K78 B;  3DFG A;  3I59 B;  3HOS A;  4O3M A;  4MEY F;  1DP7 P;  1DUX C;  4I2O A;  2A69 F;  3ROU A;  1FWZ A;  2PJP A;  5DCM B;  2IA1 A;  1CF7 A;  3ECO A;  1TW3 A;  2EFQ A;  5F1R A;  2PLY A;  3F6O A;  4Y15 A;  5KK1 A;  2IRF G;  6PAX A;  1TBX A;  2PBI A;  2RN7 A;  3MZH A;  1PP8 F;  1O7L A;  4IHT A;  4IVN A;  2ZXJ A;  4RGR A;  1XSV A;  2XV4 S;  1QPM A;  4I0A A;  1UST A;  4EJU A;  2R3S A;  5E8G A;  2P4W A;  1QGP A;  3T1B A;  1IUY A;  2P5L C;  2HTS A;  3V7C A;  4HZF A;  2D2W A;  4HLY A;  4O6J A;  3ELK A;  5ED4 A;  1W7P A;  3FZV A;  3TO9 A;  1REP C;  4KA4 A;  3RIR A;  4BHC A;  1DPU A;  2K27 A;  2BYV E;  5KVR A;  2TDX A;  2QM3 A;  2QQA A;  4RB2 C;  4IF4 A;  5E1X A;  1TQM A;  2DT5 A;  4G6Q A;  2R7F A;  2LF7 A;  3KEO A;  4Q47 A;  2XRO A;  2HYG D;  3TDZ C;  4HF2 A;  1KU9 A;  1TNT A;  3ZMD A;  4QWQ A;  4M73 A;  1U5T A;  4EQQ A;  5J6X A;  5FLX K;  3COA C;  2VON A;  5E20 A;  2DAO A;  3V8J A;  3JTG A;  4AIJ A;  3KP3 A;  2YR2 A;  1IRF A;  1Z9C A;  3WTU C;  2VN2 A;  3CO7 C;  3IWZ A;  3FHZ A;  4LJZ F;  2YPR A;  3R61 A;  3BOQ A;  3LQR A;  3K9T A;  4PCQ A;  3H3Z A;  5JVT A;  2HWV A;  1IW7 F;  3V8K A;  1J0R A;  3M7G A;  3QOP A;  5HLG A;  2YX4 A;  2B0L A;  4LG0 A;  3C18 A;  3DF8 A;  1WRJ A;  3E97 A;  3WTX C;  3HUG A;  2P5V A;  4WWC A;  1TQI A;  1FY7 A;  1IXR C;  1AWC A;  1O3Q A;  4JBA A;  2G7U A;  4IRG A;  3CUQ C;  2NS0 A;  4D0P A;  3BP8 A;  1R00 A;  5H20 A;  3WU0 A;  4U0Y A;  3FWE A;  1KQ0 A;  1NHA A;  3LA2 A;  3KE2 A;  3VB2 A;  1GXP A;  2HKX A;  5FLX Z;  1UCR A;  4MQ9 F;  2LF8 A;  2ACJ A;  3G73 A;  4EGY A;  2GA2 A;  1D3Y A;  1LNW A;  3RPQ A;  5L3F A;  5FGM A;  2QUF A;  5HS9 A;  4GXO A;  1U6G A;  1UHM A;  2HOE A;  1B9M A;  2ZBK A;  3WTS C;  3OOP A;  1HBX G;  4E70 A;  2XAS A;  3WTZ A;  5D5X B;  1ZG5 A;  5DD4 A;  2MH2 A;  3V7S A;  2CQK A;  2DFI A;  3V4G A;  2MLK A;  5FB2 A;  3GFJ A;  3GWZ A;  1G3T A;  4BXU A;  2W57 A;  1FNN A;  2CWE A;  3CUQ A;  4U88 A;  2ESN A;  4WF2 A;  3KP7 A;  2ADU A;  4BH9 A;  5DUI A;  2HEO A;  4UVC A;  2PFB A;  2H27 A;  1R1T A;  4Z2Y A;  3HIF A;  2RQP A;  2L4A A;  4HF0 A;  3QU6 A;  5K5O A;  4EGZ A;  1IN5 A;  3I54 A;  4A6E A;  3NRV A;  3L9F A;  3SHF A;  4HDU A;  2VE9 A;  4OMZ A;  3CJN A;  3HHG A;  1IF1 A;  3GLX A;  3M8F A;  2QEN A;  3I64 A;  1XSX A;  3E6C C;  4EM1 A;  5ICC A;  2E7X A;  1L3L A;  4LB5 A;  3K2Z A;  5A2Q K;  1O3T A;  3WE3 A;  1KU7 A;  2FQ3 A;  3I71 A;  5FO5 A;  4UHT A;  2F5C A;  4LLL A;  2ZO4 A;  2UWM A;  4JQF A;  1UHW A;  2H94 A;  2ZCW A;  2EFO A;  4LFU A;  4KT5 C;  1FOK A;  1SMY F;  1R7J A;  4ZYG A;  4IHS A;  4KFC A;  4ENM A;  1LVA A;  2FMY A;  4CDG A;  2ETH A;  2P8T A;  3GFI A;  4EM2 A;  4L0Y B;  4I09 A;  4ZZL A;  2H6C A;  2VT3 A;  4R79 A;  4P9U A;  1ON2 A;  4M6X A;  3O6B B;  1J7K A;  3BPX A;  1SMT A;  3BJO A;  2OD5 A;  4M9Z A;  2IVM A;  4NB5 A;  3J7A O;  3NQO A;  4YFK F;  2A6H F;  2CFX A;  2QBY A;  5A2Q Z;  3GW2 A;  2O6G E;  1FYK A;  3EQL F;  3MQ0 A;  2HS5 A;  1HST A;  2RVC A;  3TDU C;  2Z99 A;  2WWY A;  3K1N A;  1B1B A;  1WKM A;  3ZMU A;  1XCV A;  1OYW A;  1YS7 A;  2O8X A;  4I98 B;  4ESF A;  1A04 A;  2V79 A;  3I4P A;  2AS5 F;  4G94 A;  2KJB A;  1P4W A;  3FX3 A;  2EV0 A;  5LGN A;  1CF7 B;  5E8I A;  4ASN A;  1K7A A;  2P6T A;  1ZRC A;  2KJC A;  4ZYH A;  4OIP F;  2DI3 A;  1HSJ A;  2XUB A;  3JW4 A;  5L3B A;  4ESB A;  4LMY A;  3RDI A;  5E1Z B;  1JGS A;  5CVR A;  2F5F A;  5D6E A;  1GHC A;  3TO6 A;  1YO5 C;  3IL2 A;  2V6C A;  3N97 A;  3D5L A;  3GX4 X;  2C6Y A;  5DD8 A;  2J5O A;  1FP2 A;  2KIU A;  1G4D A;  2MA3 A;  1K6O A;  1ZYR F;  3T8R A;  2L3D A;  4KUM A;  2ELH A;  4G9Y A;  2HYF A;  3W6K B;  5FFZ A;  3BZ6 A;  3WOD F;  3HSE A;  4DNC A;  3RI4 A;  5D5V B;  2K02 A;  3LQQ A;  3MWM A;  3RKW A;  4YFX F;  1X3U A;  3TKY A;  5ILS A;  2IA0 A;  2HKO A;  2XAH A;  4EJO A;  3GO5 A;  1G6N A;  5HDN A;  3KCC A;  5LGT A;  2A07 F;  5D4S A;  4Y17 A;  2K7L A;  3TQN A;  4AD9 A;  1AOY A;  4WXD A;  1VTN C;  1FZP B;  3QPT A;  3E5U A;  5D5W B;  2E1N A;  4UXN A;  2VBX A;  4A5N A;  4HYE A;  1KU3 A;  1S7A A;  1ZG3 A;  3Q9S A;  5CVU A;  4ZYE A;  4YG2 F;  2F5E A;  2HGC A;  1P4A A;  4XSZ F;  5DEQ A;  1C0W A;  1KU2 A;  2O3F A;  4MNU A;  1MJA A;  1G3Y A;  1IN8 A;  2EK5 A;  1LDD A;  3E3V A;  1TNS A;  1SD6 A;  2OZ6 A;  4L5I A;  1KGS A;  2K4B A;  3MZY A;  1LDK B;  1MJ9 A;  2VC0 A;  2VOP A;  2A5Y B;  2P7C B;  3BY6 A;  4HV5 A;  1LEB A;  4JK1 X;  4RGU A;  2P7V B;  4Q5S F;  4R8H A;  1Y0U A;  3LAJ A;  2JZY A;  1U5T C;  5K5Q A;  2L54 A;  1ZRF A;  3N4M A;  1H0M A;  4I7H A;  3GVA A;  4RAZ A;  4U7D A;  2XHK A;  2X0L A;  4OU0 A;  2XVC A;  1XGM A;  1JE8 A;  1O7F A;  3ZMV A;  5D5U B;  2D1H A;  2NNY A;  3L7W A;  3U1D A;  2NNN A;  4G6D A;  1HW1 A;  1SFX A;  2FNA A;  4FX0 A;  4LK1 F;  2FA5 A;  4L9V A;  1DPR A;  3ZMZ A;  2OA4 A;  4GCV A;  2VE8 A;  4IRI A;  2K86 A;  5LHG A;  3E5X A;  3R60 A;  4HF1 A;  1XGS A;  3T5X A;  2GQQ A;  3CUQ B;  1F1Z A;  4KNY A;  2M87 A;  2E1C A;  1ZHF A;  4N9H A;  1GXQ A;  3J81 K;  4Y13 A;  2XRN A;  3DXJ F;  4EVI A;  3Q9V A;  3JAM K;  5EEG A;  1IN7 A;  1B4A A;  3IWF A;  4B8X A;  1B59 A;  4CZZ A;  3GUD A;  3W6J B;  4B09 A;  3JSO A;  4UNO A;  4RB1 A;  3PQJ A;  2JT1 A;  2Z5U A;  2JSC A;  1WWX A;  4HA8 A;  3HYI A;  1OR7 A;  2OZU A;  1Z6T A;  4BHP A;  5AIQ A;  1LEA A;  2CGP A;  4A0Z A;  2CYY A;  3E5Q A;  2FNP A;  3QRF F;  1J59 A;  1GVJ A;  1BI2 A;  1HW2 A;  2QQB A;  2Z3Y A;  1WQ2 A;  2Y48 A;  4MTD A;  2W84 A;  2V1X A;  2PI0 A;  5LLQ A;  1RIO H;  4BQA A;  4RB0 A;  1I5Z A;  2IW5 A;  3R0A A;  4KDP A;  3JTH A;  2EFW A;  3RYP A;  1P92 A;  3IHU A;  2LSO A;  3EUH A;  1SAX A;  3HSF A;  1BC8 C;  2E7W A;  2L4M A;  2ZME A;  3G3Z A;  1IXS B;  3JAM Z;  3E6M A;  4KN4 X;  1FSH A;  2VC1 A;  4AVP A;  1S8N A;  4LGW A;  2IPQ X;  1XMA A;  2BEO A;  3B02 A;  1T38 A;  4IPA A;  3RKX A;  2D1V A;  3DKW A;  1XDS A;  5FD6 A;  3GEZ A;  2M45 A;  1I1G A;  2PG4 A;  1WI9 A;  4RGX A;  3WTT C;  3SZT A;  1S7O A;  5ILV A;  1RI7 A;  2QBY B;  4OIR F;  3KP6 A;  5IT9 K;  3I5U A;  4LLG F;  4AWX B; 
#chains in the Genus database with same CATH topology
 1IZ1 A;  1FOY A;  4L18 B;  2V1U A;  2NAZ A;  2WAQ A;  1IO2 A;  3QPL A;  3NWS A;  1H9T A;  5C4J J;  3REO A;  1MMN A;  2O0Y A;  3ABM H;  1LE8 A;  3HSR A;  4RB3 C;  5E3M A;  3ZQQ A;  3TED A;  1MIJ A;  3ASN H;  3ZN0 A;  1YYV A;  2FML A;  5BMZ A;  2W24 A;  3L2V A;  3GTG J;  3ONQ A;  2JRM A;  1T2K A;  1HKQ A;  1V55 H;  4UY8 I;  4D1Q A;  2KIF A;  3KYC B;  1UG0 A;  2GIV A;  3PQK A;  5EF6 A;  4YFN F;  3ZOB A;  3X2Q H;  2G9W A;  4ABZ A;  5E3N A;  1T39 A;  2IP2 A;  3I0T A;  3MEX A;  4KIG A;  1RES A;  5D4R A;  4ENK A;  2D45 A;  5KNL A;  3KP4 A;  2ZJP F;  4MLO A;  2V9V A;  5IOZ A;  1F5T A;  1RZ4 A;  4OMY A;  2B63 J;  2Q2E A;  3BG6 A;  1WH7 A;  2XAG A;  3IUO A;  2CW7 A;  5HDG A;  3FK7 A;  1FTT A;  3ZQL A;  3PJR A;  2CU7 A;  1AHD P;  1XCB A;  4IHY A;  3HRM A;  2CO5 A;  2BY1 A;  2JN6 A;  1FOW A;  1YIT I;  3QPH A;  3HOW J;  1ONV A;  4DQ2 A;  4L0Z B;  5ERI A;  1RRJ A;  1MGT A;  5J1R A;  1J2X A;  4IJA A;  1G3W A;  2VJJ A;  1U3E M;  2RKH A;  3A0B C;  4IRH A;  1PJR A;  3WTV C;  5M3F J;  1H8A C;  2HYJ A;  4RAF A;  3P9I A;  1IV6 A;  1QVU A;  2WY8 Q;  5D8K B;  1XSD A;  3HRU A;  1LPQ A;  2XSD C;  3M8E A;  5L3G A;  1MMA A;  1FX7 A;  1PP7 U;  1VF9 A;  2BOL A;  3HOZ J;  4Y52 J;  3CTA A;  2R7V A;  3DPL C;  4UVA A;  2F5V A;  3FKI J;  1TL8 A;  2ZFU A;  3CF2 A;  4XRF A;  4MTE A;  1DP3 A;  3BDD A;  3R0J A;  2VXZ A;  1YW7 A;  2CV2 A;  3GFM A;  2F5D A;  2EZI A;  2HZT A;  3CF5 F;  4B1R A;  4BL0 B;  3CDH A;  2G0E A;  5HDK A;  5BPD A;  2ZB9 A;  5BPI A;  2R7S A;  2DA3 A;  2FD5 A;  2RAE A;  2RDP A;  2FSW A;  2UZK A;  2JVG A;  1Z7L A;  2DJI A;  2O03 A;  3BJA A;  5JI6 A;  3J80 K;  1ZR2 A;  2Z9O A;  1VQP I;  3GTL J;  4C30 A;  4CA0 A;  3OIP A;  2DTZ A;  5FD5 A;  4ZZD A;  1YRN A;  2UUZ A;  1J5Y A;  4UUT A;  4CYD A;  2R5Z B;  3UR3 C;  4XK4 A;  1BR2 A;  1Z7U A;  1X2N A;  3LSP A;  5KCM A;  1BJA A;  2CQN A;  2E5Z A;  3ZQ7 A;  2BVL A;  2QSF X;  4WCG A;  5BOX A;  1R58 A;  4QLC U;  1MKM A;  1S9H A;  1ODD A;  1Q1H A;  3ABU A;  1FTZ A;  1D1C A;  1D1B A;  3K1P A;  3DP7 A;  4E4H A;  1HDD C;  2MW8 A;  2VOO A;  1ULY A;  2WTE A;  4RAY A;  1R23 A;  2XAQ A;  1FBS A;  4N9I A;  1MND A;  2G7H A;  3K4M A;  3K7A J;  4F93 B;  3VOE A;  1E0E A;  4FT8 A;  2LY9 A;  1Z6R A;  3I58 A;  5HLH A;  4KIS A;  1I3A A;  1W4M A;  1GT0 C;  5KAI C;  1Q1V A;  2OQG A;  1A6I A;  3H5A A;  1UFM A;  1XTA A;  4A3E J;  1R6R A;  3GBG A;  3O2P E;  4A0Y A;  3ZP5 A;  4M71 A;  2IA2 A;  2HDC A;  2IGK A;  4ITV A;  5JVG F;  1WFX A;  1T0F A;  4NHJ A;  4G7O F;  4LD5 A;  2ZXI A;  4FCY A;  2JA7 J;  3I4M J;  1T95 A;  4BQO A;  1STZ A;  5E18 F;  2E34 A;  4KMU X;  2HQN A;  1ZTR A;  2FJ1 A;  1MJB A;  1IC8 A;  5LEJ A;  2Y2Z A;  1XX5 A;  2M0C A;  1EJ9 A;  4HQE A;  3N05 A;  1BC7 C;  1FBQ A;  3RSN A;  3CDL A;  5IYD J;  2X1C A;  1SFE A;  3H5R A;  2EBI A;  4V19 K;  2ZSH B;  5HS7 A;  4OIO F;  3ZQF A;  3ZN1 A;  3S1Q J;  5CQE A;  4A3D J;  1FOX A;  2H8R A;  1TLH B;  1P4X A;  4ZH4 F;  3KZY A;  2NRA C;  1BOA A;  1P9Q C;  2DPU A;  2KL4 A;  3AG2 H;  5EZH A;  4IOA F;  3NAU A;  4CIC A;  3FXL A;  4L9J A;  4GYI A;  1I27 A;  1FIA A;  4E7I A;  3J80 Z;  3K1M A;  4E7H A;  2GXB A;  3QOD A;  4P9F A;  1BI3 A;  2X1E A;  3F8N A;  3F8C A;  4ON0 A;  4OIN F;  2WA0 A;  4EMS A;  5CKT A;  2ZJ2 A;  3PSF A;  1P6R A;  2DOD A;  2WAF A;  3C1D A;  3P5J A;  1AKH A;  3MAJ A;  5F27 A;  2DO7 A;  4NC8 A;  4FX4 A;  4A3K J;  2OU2 A;  2WB1 A;  1RKW A;  1ETX A;  3CCE I;  3IAS 2;  2DTR A;  3C7J A;  3H9J A;  2QF7 A;  1QBJ A;  3FMR A;  3SFI A;  2JSP A;  3DPU A;  5EEH A;  3P7N A;  2OCE A;  3PM1 A;  2HI3 A;  4RAG A;  2IS6 A;  1TQP A;  4M74 A;  3BJ6 A;  1ZR4 A;  1BIB A;  1LVK A;  1MBJ A;  1PUF A;  2EB7 A;  4UUS B;  4A0X A;  2DDB A;  2V6E A;  4GGG A;  1ZN2 A;  2A6E F;  3FIS A;  2WV0 A;  3KEY A;  1EH6 A;  1T98 A;  2EIM H;  3LL7 A;  4M9X A;  3CCQ I;  2XAF A;  2L2O A;  4XRS A;  4UV8 A;  1W7P B;  4RBO A;  2QQ8 A;  1WH5 A;  4A12 A;  1ETO A;  2KRF A;  3V7R A;  3Q0U A;  1OFC X;  1TP4 A;  2HQA A;  1LFB A;  4NC6 A;  1U2W A;  1XB4 A;  3G2B A;  3KP5 A;  1O57 A;  1SFU A;  3E6D A;  3IH2 A;  3VFZ A;  3KP2 A;  4E6K G;  1S29 A;  4IX7 A;  2JA2 A;  1TT5 B;  1TWH J;  2UXN A;  4CCJ A;  1SD4 A;  3GZN B;  5BQT A;  2DOA A;  4XOP A;  5C44 J;  2GXA A;  3WG9 A;  2IJL A;  1BOB A;  2GBY A;  2ID6 A;  3FXU A;  4G7H F;  3F8M A;  1T08 B;  3P9K A;  4N0B A;  2NVU B;  2QZ8 A;  2ZFW A;  5HNH A;  4S04 A;  4IHX A;  3L09 A;  1U5T B;  5LRR A;  1W5T A;  1XDU A;  1Z77 A;  1MNE A;  5DUK A;  4UVB A;  4RM2 A;  5E3O A;  4EM0 B;  2JTV A;  4FHT A;  3M1E A;  4KYW A;  2D5V A;  5DTD A;  2X4H A;  2DU9 A;  2JJ7 A;  3HZJ A;  3OV8 A;  4DGW B;  3F0C A;  5EG0 A;  4IHV A;  3LFU A;  4HEA 2;  3S3O A;  3E6B A;  1X19 A;  2MAB A;  4E7J A;  1ZAO A;  3E7L A;  1YOV B;  4BAY A;  2OQR A;  1YLF A;  3FM3 A;  2PN6 A;  2COM A;  2FRH A;  4RLF A;  4NQW A;  5L3E A;  3ZMS A;  4F55 A;  1T6S A;  2XPW A;  2W00 A;  2XF7 A;  2F48 A;  3SXY A;  1IGN A;  1YI2 I;  2A3S A;  2LTP A;  1V3F A;  4C9Y A;  1TT0 A;  1B6A A;  2E2H J;  2CFO A;  3OYH A;  1VQN I;  2FF4 A;  5K5R A;  5CJ9 A;  3IP4 B;  2KFD A;  2VXD A;  4KIF A;  5GAG J;  1RR8 C;  2IBD A;  1FYL A;  4QIW N;  2HZD A;  2DK8 A;  1L0O C;  4EV0 A;  4G8X A;  4R1H A;  5E79 C;  5HOO A;  2WAQ N;  4LG0 B;  3Q0W A;  1FSE A;  1R1V A;  3OR1 C;  2K9L A;  4M6Y A;  1F4K A;  1FPQ A;  1SFO J;  1Z91 A;  2IGO A;  2K85 A;  2JA8 J;  1G3S A;  3HTU A;  3LMM A;  3LSM A;  1S6L A;  3D5S C;  4M72 A;  2BHZ A;  3SEZ A;  2ZNZ A;  3RQ4 A;  4HRI A;  4A3J J;  1K4S A;  4HV6 A;  4JX5 A;  3DEU A;  3EYI A;  3H92 A;  5H6Q A;  1R22 A;  1FYM A;  1ACI A;  3FBN B;  5FKO A;  5IYB J;  4EAT A;  1BIA A;  3L2Q A;  3IKV A;  1OKR A;  1JKR C;  1XGO A;  2A68 F;  2LKP A;  1U8R A;  1YW9 A;  4HW0 A;  4KIC A;  3H36 A;  1D8J A;  4P55 A;  2ZNY A;  5JFR A;  3FMS A;  3TMO A;  3OYA A;  1IAW A;  1RUO A;  4WXH A;  3CP2 A;  4EJV A;  1KYW A;  3CUO A;  3SZP A;  2QYO A;  2P6S A;  4CCK A;  3HRS A;  3OYD A;  5LGU A;  4XLH A;  3AAF A;  1ETY A;  5F0F A;  1UAA A;  4PGG A;  2EV6 A;  2JA5 J;  4CH7 A;  5M3M J;  1O3S A;  1BM9 A;  2LNB A;  1YQA A;  2JA6 J;  3TW6 A;  3Q0V A;  1QO0 D;  3F9K A;  4C2T A;  3JSP A;  2K4J A;  4OWR B;  2WV1 A;  4YEL A;  3S2W A;  2F4O B;  1R49 A;  2DLL A;  4HBL A;  1BW5 A;  5FJ8 J;  4I0B A;  2ZME B;  3CLQ A;  1TWA J;  3W3C A;  1E3H A;  4S05 A;  4MHG A;  1MDM A;  4B47 A;  3WU1 B;  2M34 A;  3H35 A;  1XGN A;  1MH4 A;  4K2E A;  2FE3 A;  4PZJ A;  3QYE A;  2ZSI B;  4XM3 A;  1S3J A;  4PUS A;  3WTW C;  2LYC A;  3BWG A;  2BV6 A;  1J75 A;  1UHS A;  2XGX A;  4NUB A;  1CQT A;  4G6T B;  2DQL A;  4A3M J;  1D5Y A;  2PJR A;  1A6Q A;  1QU3 A;  2Y75 A;  1I39 A;  4AM3 A;  3UNG C;  1Y6I A;  3SZG A;  1O3R A;  3L1P A;  3LWF A;  3LAP A;  3ECH A;  1R5G A;  4PSW A;  1H89 C;  2CG4 A;  5FRN A;  2E35 A;  4L5J A;  4U7B A;  2R93 J;  2R7T A;  2EZL A;  1RNL A;  1IN6 A;  1S7E A;  1IXC A;  1HLV A;  4LB6 B;  4KIB A;  2ISY A;  3NWT A;  3K4N A;  4E7S A;  1Y39 A;  3IRR A;  1ZRD A;  2EJR A;  2IGM A;  3HGY A;  4HPQ A;  3S1R J;  3TW7 A;  1FT9 A;  5AON A;  4DBR A;  3F8F A;  5HVQ C;  5LHH A;  1SD5 A;  2VLA A;  1IRG A;  2DBB A;  4BYY A;  4QPQ A;  2LDU A;  3ZRG A;  2ECC A;  3CO6 C;  2JPB A;  1JXS A;  5CVJ A;  1SAN A;  3Q5F A;  1WJC A;  2ELK A;  3JRE A;  1MD0 A;  2FOK A;  4XBF A;  2XKO A;  4BQN A;  3M4O J;  3H1C A;  3HXL A;  1I1S A;  1LKX A;  2KIM A;  2X6W A;  3A4C A;  3K70 D;  2WAE A;  1ZLJ A;  3VDX A;  1LE8 B;  4ENJ A;  2K9Q A;  4ANJ A;  1YG2 A;  2NS8 A;  1ZRE A;  3HPG A;  1E2X A;  4BJT A;  2MH9 A;  5CVV A;  3G1M A;  1K78 A;  2LKS A;  4A3B J;  3F23 A;  1YW8 A;  4M3F A;  4AIK A;  4HQM A;  4Q48 A;  3I59 A;  2VOD A;  1EH8 A;  2PQ8 A;  1XN7 A;  2ZME C;  4JX4 A;  2VJI A;  5E1W A;  5EEA A;  1OIS A;  2XPU A;  1JT0 A;  5JLX A;  5DYM A;  5IP7 J;  5J8C A;  3TOB A;  5CLS A;  2NOJ B;  1KYZ A;  2L02 A;  4II2 A;  5ILU A;  3KFW X;  2JPC A;  1APL C;  3SDB A;  2FX0 A;  3HOX J;  2EA4 A;  4EJW A;  1TWF J;  2ZJQ F;  5DCM A;  5HOD A;  1R1U A;  3T0Y A;  3VSL A;  5ICF A;  3ZCO A;  5JHF A;  1OYY A;  4LK0 F;  4GFB A;  2M5W A;  4KN7 X;  2Q2E B;  4I01 A;  5DS9 A;  4BUP A;  1VND A;  1FP1 D;  5TIS C;  1ON1 A;  4AIH A;  4FAS D;  1ZH5 A;  1Z21 A;  1FLI A;  3QU3 A;  1GV5 A;  3FKJ A;  5LRS A;  3G1O A;  1KQ9 A;  3OYB A;  2HOS A;  1ETK A;  2I10 A;  4I02 A;  3EDP A;  2W25 A;  2HR3 A;  3IH4 A;  3IKT A;  3RKY A;  4RS8 A;  2DMU A;  2RGV A;  3BPV A;  1YJN I;  2MBF A;  3D5R C;  2PMU A;  4BY7 J;  2QVO A;  2NVT J;  5FLV A;  3EYY A;  2LKX A;  2R0Q C;  3P9C A;  2COB A;  1VQL I;  2KIQ A;  1OMI A;  3BT9 A;  4MEX F;  4LIU A;  1HW5 A;  4P5O A;  2FBH A;  4XLN F;  1LJ9 A;  3RCO A;  3FXJ A;  1LB2 A;  3DV8 A;  3QOE A;  1TW2 A;  1Y8Q B;  4NC7 A;  2DA7 A;  2NOG A;  3DPT A;  1ZG1 A;  1W0T A;  3FM5 A;  3F6V A;  1W36 D;  4CGZ A;  3M9A A;  1F9N A;  1MMD A;  5M5X J;  3K69 A;  3F72 A;  3GF2 A;  3HRT A;  1KZH A;  4XLP F;  5IT3 A;  3S1M J;  3C2G A;  2VQG A;  1ZLK A;  5K7Z A;  3HOV J;  2NVX J;  1EH7 A;  3RYR A;  2DT7 B;  1VQO I;  4HG2 A;  1JHF A;  2MC4 A;  3OSG A;  2R7U A;  1V5F A;  1ZGJ A;  4CCM A;  5BS6 A;  3J81 Z;  2BY2 A;  2YX7 A;  2LG4 A;  3QP6 A;  4OOI A;  1AA7 A;  5CQG A;  2H09 A;  4DOZ A;  3IRQ A;  2BBY A;  4A3G J;  4U0W A;  3VEP A;  3PNY A;  1YRN B;  2XIG A;  2BE5 F;  2HTJ A;  1K79 A;  1X2M A;  5GTI C;  2DA1 A;  2WB1 N;  1XPX A;  1BI0 A;  3C2B A;  2E19 A;  1Z1D A;  1IN4 A;  3KZZ A;  2CV1 A;  1VFC A;  1FC3 A;  4IXA A;  1EV7 A;  1UEL B;  1JHH A;  2L9S A;  2FXA A;  1FMW A;  1X58 A;  3S32 A;  1J9I A;  4XLE A;  4NNJ A;  3CME I;  1RUN A;  2FBK A;  1JKO C;  4M9S A;  4WXC A;  2TCT A;  4RGS A;  2BHY A;  2Y9Z A;  3RTR A;  3VOD A;  2EFN A;  2MSY A;  2V7F A;  2OAZ A;  4MFD A;  1HKT A;  5DCF A;  1S72 I;  4P96 A;  1U0J A;  2L01 A;  4G7Z F;  2BVM A;  4FE4 A;  2EIL H;  2NXN B;  1QZY A;  2LBF A;  1D8K A;  2M30 A;  3OIO A;  4H0E A;  1DU0 A;  3SQN A;  4EJT A;  3M3Y J;  1GUU A;  5K1Y A;  3SFZ A;  4CHU A;  3HDD A;  2STT A;  1Y56 A;  2VKH A;  4FIS A;  1YTY A;  3JRG A;  2E1O A;  5HS8 A;  3KLN A;  2BGC A;  3WU2 C;  4Q4Z F;  1M1E B;  2Y0M A;  1K4T A;  3GZ6 A;  2HDW A;  2GIZ A;  4HX7 A;  4XOR A;  2ZKZ A;  5FKN A;  2LMD A;  5EZG A;  4XR6 A;  5F6F A;  4UB6 C;  1BN5 A;  4PGH A;  2P5K A;  1JI8 A;  3ISP A;  3CLO A;  2EWN A;  2GZW A;  1YS6 A;  3OR2 C;  5C4X J;  4IKF A;  4YRV A;  3MN2 A;  1JJ6 C;  3K0L A;  2H1K A;  3ZPL A;  1BBY A;  1Z05 A;  1PUE E;  1XMK A;  4BE2 A;  2EV5 A;  2OJE D;  3KZI C;  1HKS A;  3U2R A;  4BE1 A;  3CD6 I;  3TO7 A;  2VPL A;  3W2V A;  3PFI A;  4KMF A;  3CDI A;  3HGG A;  4HX4 A;  4ENN A;  3R6S A;  1JUS A;  5J4Y A;  4CO8 A;  2XGC A;  1USS A;  2VBZ A;  3MVP A;  3WGI A;  1I6H J;  4ZDP A;  4BHB A;  5LHI A;  3MFK A;  1W5S A;  2OTL I;  2YSR A;  4YII A;  4XKB A;  1R4M B;  2OF7 A;  3FMQ A;  3SYT A;  2JWT A;  3EUA A;  4LLN A;  2DMQ A;  3BR3 A;  3TOA A;  4DZP A;  2DXI A;  3W2A A;  3I9V 2;  5IPA A;  1OYI A;  3K70 C;  4F92 B;  1NK2 P;  2O8K A;  1R9T J;  2LK2 A;  1AKH B;  2XAJ A;  1WSU A;  1VQK I;  2UXX A;  1VQM I;  2FBI A;  3BCB A;  3H3U A;  1XD7 A;  2BY3 A;  2WC2 A;  1BI1 A;  2ZC2 A;  4HX8 A;  3BCA A;  3BR6 A;  3L2C A;  5CYV A;  1KQ8 A;  5IT9 Z;  2DQR A;  2ISZ A;  2VQH A;  1VQ6 I;  5HLI A;  3ML6 A;  4HDV A;  2EH3 A;  1KON A;  1R36 A;  4HLX A;  2Q8K A;  2HQR A;  1T0F C;  4AYB A;  1N78 A;  5DDG A;  3KEQ A;  3JRD A;  1N77 A;  2DT6 A;  1PUF B;  1IDY A;  3BRO A;  1Z67 A;  4WX9 A;  1LFU P;  1E17 A;  1ERD A;  1I6X A;  1LQ1 A;  3RPU A;  5J8F A;  3CJQ B;  5L3C A;  3DQV C;  4ZYA A;  1P2F A;  2VBW A;  5DV5 A;  3BR2 A;  4OIQ F;  5K7F A;  2BXY A;  3GXO A;  4WK8 F;  2QA4 I;  3DKY A;  1YHQ I;  3FXO A;  3S14 J;  2R92 J;  1YFH A;  2M1B A;  2O61 A;  1FBU A;  4RM3 A;  5F64 A;  3OS2 A;  1X1A A;  3EET A;  4XSX F;  2H6B A;  3K4K A;  4XNF A;  5EJC A;  2MLG A;  4M6V A;  3F3X A;  3V8L A;  4L9T A;  1H9G A;  1QNT A;  3MCZ A;  1Z3X A;  4J01 A;  2RV8 A;  2KKO A;  1WVR A;  2GAU A;  2W85 A;  2YS9 A;  4TV7 A;  3QAH A;  1ZGA A;  3DBR B;  1W7P D;  3LA7 A;  1U78 A;  2K9M A;  2Q0O A;  2DW4 A;  2L7M P;  3NEU A;  1W36 C;  3CMY A;  2M7B A;  2CSO A;  2E1M C;  3OYM A;  4HAM A;  2LC2 A;  3GYH X;  3CMM A;  3U21 A;  5H6R A;  4U87 A;  1X1B A;  3K4C A;  3PNV A;  2KIS A;  2EFP A;  2JK3 A;  4A5M A;  2KPM A;  1B9N A;  2VT2 A;  3BQZ A;  2HOA A;  3GFL A;  2YU3 A;  2W48 A;  2XRL A;  1UG2 A;  3TGN A;  1TZL A;  3C2H A;  4MIM A;  1SD7 A;  3HTS B;  1P7I A;  5AIP A;  1W1W E;  4PJL A;  1OCT C;  1Z3Y A;  3BZC A;  5E17 F;  2F4M B;  3D0S A;  5EG0 B;  1IV8 A;  3W2W A;  1OPC A;  4BU2 A;  2L9R A;  3L2W A;  1HC8 A;  5J47 A;  4Y3O A;  4F7Z A;  5B3S H;  2MG4 A;  2K9N A;  3FHN A;  2ECB A;  4GO1 A;  2R7D A;  3ZQC A;  2CW0 F;  4NQW B;  3MZ8 A;  1LDJ A;  3H5N A;  2VPR A;  3ASO H;  3OYI A;  4GYG A;  5J3L A;  4Y4R A;  3W6V A;  3WG7 H;  2QLZ A;  2V9P A;  3IC7 A;  1LFP A;  3LFK A;  2B7E A;  2EA2 A;  2VQL A;  4XRM A;  4UUV A;  3HC7 A;  4IQ4 A;  5M5W J;  3WE2 A;  3F21 A;  3RJP A;  2PMH A;  2VKE A;  3HOU J;  1QZZ A;  2HNH A;  5L3D A;  1QQI A;  2E71 A;  4U0V A;  1DGR M;  4XON A;  2V1D A;  2DFH A;  1ENH A;  5TJJ A;  5GAE J;  4F91 B;  3A0H C;  3H0G J;  2AXL A;  4BNC A;  4QSH A;  2Y0S A;  4BGD A;  2KRC A;  3F22 A;  1ZAR A;  2GA1 A;  1TTY A;  1E3P A;  3L00 A;  3K6G A;  4C3I J;  3WGG A;  5DM6 F;  2MC3 A;  3LST A;  2VKD A;  5TRD A;  4E7Z A;  2JRT A;  4L5E A;  2GWR A;  3MKW B;  2HFH A;  2VB6 A;  3I53 A;  2XKP A;  3LA3 A;  4A69 C;  3L2U A;  4BKX A;  3E0J B;  3DWL E;  1WJ5 A;  3KLO A;  3HHH A;  1DDN A;  3GZ5 A;  5JHU A;  4GRI A;  5FFX A;  4ZYD A;  3JRB A;  3R4K A;  3TBI A;  5JLW A;  4BXF A;  4A2U A;  3HOT A;  1IJW C;  2IT0 A;  4HNT A;  1Y8R B;  1IRX A;  2QQ9 A;  4MQV A;  4PSX A;  4ZC3 A;  3OYL A;  2L7F P;  3T8T A;  2P0W A;  3FXR A;  4NBQ A;  4BEH A;  3B73 A;  5D8L B;  3ULQ B;  1HQC A;  4PK4 A;  4L9N A;  3QYB A;  2J5P A;  1X1D A;  3FF5 A;  5D6F A;  1YE9 A;  2FU4 A;  2RNJ A;  2Z1D A;  4V2G A;  5ICE A;  1CGP A;  2LY1 A;  3C3W A;  3O3K A;  1V4R A;  3A01 A;  1MSE C;  1D5V A;  4QTR A;  2KQR A;  3KET A;  2QKM B;  3DU5 A;  2FOW A;  2M8E A;  4XMY A;  2X9D A;  2MD5 A;  2XDV A;  3U9G A;  1MDM B;  1X4O A;  3FXQ A;  2DMT A;  4ESJ A;  4A6D A;  1TWC J;  1UB9 A;  2OBP A;  2CQ7 A;  2VKV A;  3ABT A;  1HXD A;  2Z33 A;  4DYR A;  4Y33 A;  3F8B A;  3KYL A;  4MGR A;  4ETS A;  2RC4 A;  2F2E A;  2PJR B;  2ESH A;  3DEE A;  1R5H A;  2DDA A;  4C2M J;  3CC7 I;  3B6A A;  2QWW A;  1MZB A;  2FEZ A;  5LBQ A;  2LD5 A;  5CVI A;  4YIF A;  2NYX A;  3RZD J;  2VIX A;  3DTI A;  3K10 A;  4XQF A;  3ZQH A;  3ZMT A;  3DLL F;  3CC4 I;  1A35 A;  4PDK A;  5JR3 A;  1N25 A;  3QYF A;  3QPS A;  4H4K C;  2DPD A;  2ICW G;  3QP5 A;  3VYR B;  5ICG A;  2O7O A;  3ERM A;  3ERE D;  1LUJ B;  2EPF A;  2PEX A;  2MD0 A;  1FMV A;  2Q1Z B;  3FXK A;  1PDN C;  2STW A;  4C3H J;  4UV9 A;  2A61 A;  5LEK A;  3WGH A;  2E60 A;  4I76 A;  1YIO A;  2VBY A;  2DK5 A;  3M07 A;  2DA2 A;  2GXG A;  1KA8 A;  5F0C A;  4HOB A;  4CXF A;  3WTY C;  1BA5 A;  4O5V A;  1K78 B;  2GLO A;  1FJL A;  3DFG A;  3I59 B;  4KT6 A;  3JCU C;  3HOS A;  4Y7N J;  1WHU A;  4O3M A;  1V5E A;  4MEY F;  1S5L C;  1DP7 P;  1Y0N A;  1DUX C;  4I2O A;  2A69 F;  3CCY A;  4I6Z A;  4BQQ A;  3ROU A;  1FWZ A;  5FRO A;  2PJP A;  5DCM B;  3GTP J;  2IA1 A;  1CF7 A;  3LNQ A;  3MKZ A;  3ECO A;  4N4O B;  3BG9 A;  1OQY A;  1F36 A;  1TW3 A;  3PO2 J;  2IAI A;  2LR8 A;  5C3E J;  2EFQ A;  1QZE A;  3S16 J;  5F1R A;  2PLY A;  3F6O A;  4Y15 A;  5KK1 A;  3OYN A;  3K2A A;  4XKW A;  5TGT A;  2IRF G;  6PAX A;  2HXI A;  2NVY J;  1TBX A;  5IP9 J;  2M2E A;  3CCS I;  2PBI A;  2RN7 A;  2K9S A;  3MZH A;  4B4C A;  1PP8 F;  1O7L A;  4IHT A;  1RKT A;  4JP0 A;  4IVN A;  4W1U A;  2MGQ A;  1N75 A;  2ZXJ A;  4RGR A;  1XSV A;  2XV4 S;  1QPM A;  4I0A A;  1UST A;  3TL4 X;  1VQ5 I;  3PNT A;  4EJU A;  2VJ4 A;  4BE0 A;  3DTE A;  2CJJ A;  2OV7 A;  2R3S A;  3VWB A;  2CQQ A;  2CUZ A;  3OSF A;  2DA6 A;  2P4W A;  5E8G A;  1QGP A;  1ZQ3 P;  5B5E C;  3T1B A;  4MFE A;  3V42 A;  2OTJ I;  1IUY A;  2AQE A;  3A1Y A;  2P5L C;  3BZK A;  2IXS A;  3DTK A;  4B48 A;  2HTS A;  3V7C A;  4HZF A;  2VUM J;  2D2W A;  4HLY A;  3IV5 A;  4O6J A;  3ELK A;  5J40 A;  2V9K A;  5IYC J;  4XLF A;  5ED4 A;  1Y1V J;  2TRT A;  3OMY A;  1W7P A;  1MBH A;  3VYT B;  2EIJ H;  3FZV A;  1AU7 A;  2QSG X;  3TO9 A;  1REP C;  1B8I A;  3OWT A;  4KA4 A;  3RIR A;  4BHC A;  1DPU A;  3RPU D;  3FDY A;  2K27 A;  2WBM A;  2BYV E;  4DW6 A;  3H0D A;  5KVR A;  2TDX A;  2QEX I;  2QM3 A;  2QQA A;  4RB2 C;  4IF4 A;  5E1X A;  1TQM A;  2DT5 A;  3ABK H;  4G6Q A;  2R7F A;  1NTC A;  3I4N J;  2HQ5 A;  2LF7 A;  2R7R A;  2HXO A;  3KEO A;  4Q47 A;  3QWL A;  4PJM A;  2CQX A;  2XRO A;  1IG7 A;  1MH3 A;  2OC6 A;  4AYB N;  2HYG D;  3SJM A;  3TDZ C;  2PMZ A;  4HF2 A;  1KU9 A;  1TNT A;  3KYD B;  3ZMD A;  5KAF C;  4QWQ A;  4M73 A;  1U5T A;  4EQQ A;  5J6X A;  4E7K A;  3S3N A;  5FLX K;  1NH3 A;  3COA C;  2RRE A;  4CCL A;  2VON A;  5E20 A;  2DAO A;  2DA5 A;  2R5Y A;  1SFK A;  2L0K A;  3ZXS A;  3V8J A;  1SVL A;  2P81 A;  3JTG A;  3AFH A;  3KP3 A;  4AIJ A;  1JTX A;  3GTO J;  1QRY A;  4N4N B;  2YR2 A;  2HDD A;  4BXX J;  2HOT A;  1IDZ A;  1IRF A;  2NS7 A;  1Z9C A;  1ORK A;  3WTU C;  2L7Z A;  2VN2 A;  5EGO A;  1TWG J;  3CO7 C;  1JJ8 C;  1DGW Y;  3IWZ A;  2LRE A;  3JRH A;  4GDF A;  1ETQ A;  4RA2 A;  3B6C A;  9ANT A;  2IGN A;  3SDG A;  1QHH D;  3FHZ A;  3CCL I;  4LJZ F;  3I3L A;  2YPR A;  3R61 A;  3LSJ A;  2RQQ A;  5IOY A;  1BW6 A;  3BOQ A;  3HKZ A;  2OCC H;  1W5C C;  1RR7 A;  3LQR A;  4A3I J;  3K9T A;  4PCQ A;  4X1E A;  2GOX B;  2IS2 A;  3H3Z A;  3LSG A;  5CPR B;  5JVT A;  2HWV A;  1IW7 F;  3V8K A;  4CYC A;  4JX6 A;  1J0R A;  2I8D A;  3M7G A;  3CP8 A;  1WCM J;  3QOP A;  2BY0 A;  5HLG A;  2YX4 A;  3BR0 A;  3BTI A;  1Z0X A;  2B0L A;  4LG0 A;  3C18 A;  1PVE A;  4YEJ A;  3DF8 A;  3PIO F;  1WRJ A;  2VQC A;  3AL0 C;  4D9J A;  3E97 A;  2JUG A;  3WTX C;  4W97 A;  3WHC A;  4Z6Y A;  3HUG A;  1EF4 A;  2P5V A;  5GPC A;  1TQI A;  4WWC A;  1WZ2 A;  1FY7 A;  1IXR C;  1AWC A;  1O3Q A;  2K3F A;  4I99 C;  4JBA A;  2G7U A;  4IRG A;  3CUQ C;  2NS0 A;  4D0P A;  2KDZ A;  2X85 A;  1V5G A;  3AG4 H;  2VI6 A;  1OJL A;  3BP8 A;  2JVH A;  1R00 A;  5H20 A;  3WU0 A;  1GV2 A;  4U0Y A;  1MBE A;  3FWE A;  3JRA A;  3HJE A;  1KQ0 A;  1NHA A;  3LA2 A;  4G12 A;  5EYR A;  3KE2 A;  3VB2 A;  1GXP A;  1SVO A;  3DKX A;  2HKX A;  1WGX A;  1K61 A;  5GTH C;  5FLX Z;  3HL2 A;  1UCR A;  2Y0S N;  2LF8 A;  4MQ9 F;  2ACJ A;  3G73 A;  4EGY A;  2BW3 A;  2UV1 A;  2GA2 A;  2HPM A;  1D3Y A;  1LNW A;  3RPQ A;  4DBQ A;  5L3F A;  5FGM A;  2QUF A;  5HS9 A;  4GXO A;  2JUC A;  1I50 J;  1U6G A;  1UHM A;  1U9O A;  2HOE A;  2LRD A;  4FE7 A;  1B9M A;  1R4N B;  2ZBK A;  3L2R A;  3WTS C;  3OOP A;  1IUF A;  4FET A;  2LY2 A;  1HBX G;  4E70 A;  3A2K A;  4M3D A;  2XAS A;  3WTZ A;  5D5X B;  1ZG5 A;  4DIQ A;  4LIT A;  2R7Z J;  1JKQ C;  5DD4 A;  2MH2 A;  3V7S A;  3LSH A;  1UJ8 A;  2CQK A;  2L7K A;  2DFI A;  2KDO A;  2RNG A;  1BR1 A;  2R7W A;  2LP0 A;  3V4G A;  2MLK A;  5FB2 A;  4RLQ A;  2A6T A;  3GFJ A;  3GWZ A;  1D0Y A;  1G3T A;  4BXU A;  2CUF A;  1Y1W J;  2EQR A;  1H88 C;  2W57 A;  1FNN A;  1FEX A;  2CWE A;  2IS1 A;  3CUQ A;  4U88 A;  2ESN A;  4WF2 A;  3H9G A;  1ZGW A;  3KP7 A;  2ADU A;  4BH9 A;  5DUI A;  4HSR A;  2HEO A;  5GAD J;  4UVC A;  5DM7 F;  4XKV A;  5FKM A;  2PFB A;  2I5U A;  3HBL A;  2H27 A;  1R1T A;  4Z2Y A;  3HIF A;  2N8G A;  2RQP A;  1X3Z B;  2L4A A;  3OYE A;  3RZO J;  3NAR A;  4HF0 A;  1X1P A;  3QU6 A;  5K5O A;  3GME A;  4EGZ A;  2EZH A;  2X51 A;  4ZDO A;  1IN5 A;  1ETW A;  2KZG A;  5GAH J;  1G2H A;  3UKG A;  3I54 A;  2DYS H;  4A6E A;  2W82 A;  1X3W B;  3NRV A;  3L9F A;  1VQ9 I;  4PFP A;  3SHF A;  1JGG A;  4HDU A;  2VE9 A;  5E3L A;  3BG5 A;  5M5Y J;  4OMZ A;  3CJN A;  3HHG A;  1IF1 A;  3CCJ I;  5J4V A;  3GLX A;  3M8F A;  2QEN A;  3BR1 A;  3I64 A;  4AC0 A;  2PX9 A;  1XSX A;  3HEF A;  4RDU A;  3E6C C;  5BNG A;  4EM1 A;  5ICC A;  2E7X A;  1L3L A;  4LB5 A;  3K2Z A;  2M9H A;  5FRM A;  2F4I A;  5A2Q K;  3O8H A;  1OCO H;  4XRS G;  1O3T A;  3WE3 A;  1KU7 A;  1NG6 A;  2FQ3 A;  2M8G X;  1K83 J;  4D5F A;  1XS9 A;  3A02 A;  3I71 A;  2HVR A;  3HOY J;  1YIJ I;  1FIP A;  5FO5 A;  4UHT A;  2DMP A;  2F5C A;  4HNV A;  4LLL A;  4P1W A;  1EA3 A;  1BL0 A;  2ZO4 A;  2UWM A;  2E1M B;  3OL4 A;  1OCZ H;  2M7A A;  4JQF A;  1GLN A;  3MKL A;  4E7L A;  3S1N J;  1UHW A;  2H94 A;  4PFO A;  3SEQ A;  2ZCW A;  2EFO A;  4LFU A;  4KT5 C;  3CES A;  3KX2 A;  1B72 A;  1FOK A;  3AG1 H;  5FKL A;  1PYV A;  1A36 A;  3J7A Y;  3LSR A;  1SMY F;  1R7J A;  4ZYG A;  1DQU A;  2CH0 A;  1J09 A;  2ME6 A;  4IHS A;  4JYK A;  4KFC A;  3S15 J;  4ENM A;  1LVA A;  2FMY A;  4BEH B;  4CDG A;  2ETH A;  3CJR B;  5EDN A;  2P8T A;  3GFI A;  2H8W A;  2ID3 A;  2IS4 A;  3S93 A;  4BJ5 C;  3LOC A;  4EM2 A;  4L0Y B;  4CCO A;  4CSW A;  3A01 B;  1TC3 C;  4I09 A;  1U9N A;  4ZZL A;  2DJN A;  1SEU A;  2H6C A;  2LFB A;  5B66 C;  4BBR J;  2XC7 A;  1WJB A;  2VT3 A;  4R79 A;  4AID A;  2ELJ A;  2DOE A;  4P9U A;  1ON2 A;  1G8X A;  3OIQ A;  2L9N A;  4M6X A;  3O6B B;  1J7K A;  3BPX A;  2O9L A;  3CCR I;  1SMT A;  3BJO A;  2KT0 A;  4ZJZ A;  2OD5 A;  4M9Z A;  1ETV A;  1NK3 P;  2R7O A;  1XC5 A;  3ESW B;  2IVM A;  1MSF C;  1RC9 A;  1HDP A;  3DU6 A;  1ZKG A;  1QVT A;  4NB5 A;  4C3J J;  2A5W A;  1ITY A;  3J7A O;  3M1C A;  4ZTJ A;  2K5C A;  3HG9 A;  1RET A;  3NQO A;  1SVM A;  5F08 A;  4J19 A;  2CUJ A;  1F43 A;  4YFK F;  2A6H F;  2CFX A;  2DN0 A;  2QBY A;  5A2Q Z;  2K40 A;  4LG3 A;  3GW2 A;  5K7H A;  2O6G E;  1HF0 A;  1FYK A;  1SAU A;  4J00 A;  3MKY B;  1JTY A;  3EQL F;  5IP6 A;  3FXM A;  3MQ0 A;  2HS5 A;  3EUK L;  1JKP C;  1HST A;  2RVC A;  2HVS A;  3TDU C;  2Z99 A;  2WWY A;  3KPH A;  4HST A;  3K1N A;  5LFA A;  3PUB A;  1B1B A;  1WKM A;  5FLM J;  3ZMU A;  1XCV A;  2XB0 X;  1X1C A;  1OYW A;  1YS7 A;  2O8X A;  4I98 B;  2Y9Y A;  3ABL H;  1K6Y A;  2DFF A;  4ESF A;  2M0M A;  2Y30 A;  4YIR X;  1A04 A;  2V79 A;  3I4P A;  2AS5 F;  4G94 A;  2AXT C;  2KJB A;  1V54 H;  1IRZ A;  3TP3 A;  4XIC A;  1P4W A;  3OY9 A;  3FX3 A;  2PMZ N;  2EV0 A;  2YUS A;  5LGN A;  4BBS J;  2GM4 A;  1CF7 B;  5E8I A;  4IZZ A;  4ASN A;  3OOU A;  1K7A A;  5GP9 A;  1WJA A;  2P6T A;  4B43 A;  1ZRC A;  1GDT A;  2KJC A;  4ZYH A;  3S17 J;  3CC2 I;  3BTJ A;  4KIT B;  1X4P A;  3HPH A;  1MW7 A;  3PFY A;  2A05 A;  2DI3 A;  4OIP F;  2OUM A;  1HSJ A;  2DCE A;  1P7J A;  2XUB A;  3JW4 A;  5L3B A;  3FBI B;  4AVZ A;  4ESB A;  4LMY A;  4IL6 C;  3RDI A;  5E1Z B;  2F6C A;  2MYS A;  1JGS A;  5CVR A;  2KZV A;  1VQ4 I;  1HA8 A;  2CW8 A;  3GLL A;  2F5F A;  5D6E A;  3K4B A;  1GHC A;  3TO6 A;  2XF6 A;  1YO5 C;  3IL2 A;  2V6C A;  3N97 A;  1VI0 A;  3D5L A;  5F0H A;  2Z16 A;  4XL9 A;  2ZJR F;  4XN3 A;  3HKZ N;  3GX4 X;  4AU7 A;  2C6Y A;  3WHB A;  2X1D A;  5DD8 A;  3DBH B;  2J5O A;  1FP2 A;  5LD2 C;  1T8I A;  1T56 A;  2KIU A;  3EPZ A;  1G4D A;  3GTK J;  2MA3 A;  4PJ0 C;  1K6O A;  1ZYR F;  2XSJ C;  2L3D A;  3T8R A;  1VZ0 A;  1SC7 A;  3GTM J;  4KUM A;  2ELH A;  4G9Y A;  4KJZ A;  2HYF A;  3W6K B;  5FFZ A;  3BZ6 A;  1OCR H;  3OYK A;  2V4J C;  5IY5 H;  4OAY A;  3WOD F;  3HSE A;  3FK6 A;  4DNC A;  3VPR A;  1E3O C;  3BC8 A;  4FQG A;  3RI4 A;  3CCU I;  2HVQ A;  4QPO A;  2Y69 H;  2K02 A;  5D5V B;  3LQQ A;  3MWM A;  2DA4 A;  3LSK A;  4XN0 A;  2R5Z A;  1G59 A;  3RKW A;  4AUX A;  4A3L J;  2V1N A;  1A31 A;  3OYJ A;  4YFX F;  2JMW A;  1X3U A;  3TKY A;  1B8I B;  2VAS A;  5ILS A;  1ZK8 A;  3VYU B;  1OCC H;  5HLT A;  2IA0 A;  1QPI A;  2HKO A;  2W1O A;  5J1U A;  3I55 I;  2M3A A;  3JRC A;  2XAH A;  4A3F J;  2M4K A;  4EJO A;  3GO5 A;  1G6N A;  3LSI A;  5HDN A;  1MBK A;  3KCC A;  3RQI A;  5LGT A;  4XLA A;  2A07 F;  5D4S A;  1UZC A;  4CZC A;  1XG1 A;  3M8J A;  4Y17 A;  2K7L A;  4CUG A;  4DYQ A;  3TQN A;  4AD9 A;  5F1J A;  2BXZ A;  1AOY A;  2KMU A;  4WXD A;  2X6O A;  1WPK A;  1VTN C;  3G1L A;  3TP0 A;  1FZP B;  3QPT A;  3E5U A;  4BAC A;  5D5W B;  2E1N A;  4UXN A;  2R5Y B;  3OL3 A;  3CCM I;  2LLK A;  1MBG A;  2VBX A;  4B44 A;  4A5N A;  4RMN A;  2VL8 A;  2XAU A;  1GVD A;  3G4S I;  1HOM A;  4HYE A;  3BLY A;  4B3A A;  2XGD A;  2E36 A;  1KU3 A;  1S7A A;  2IEK A;  1JT6 A;  1ZG3 A;  3Q9S A;  5CVU A;  4ZYE A;  4YG2 F;  4FTH A;  2F5E A;  2HGC A;  1P4A A;  1EKE A;  4XSZ F;  3CZ6 A;  5DEQ A;  4NDL A;  5EGO B;  1C0W A;  1KU2 A;  2O3F A;  4MNU A;  4M3E A;  1MJA A;  1D1A A;  1G3Y A;  1IN8 A;  3S8P A;  2EK5 A;  2L9V A;  3K4J A;  1LDD A;  1WJE A;  4M3B A;  2E2I J;  4BDY A;  3DLA A;  2EIK H;  3E3V A;  1R5I D;  1TNS A;  2ZXW H;  4X6A J;  4HNU A;  1SD6 A;  2OZ6 A;  4L5I A;  1KGS A;  2K4B A;  3MZY A;  1LDK B;  1POG A;  2XPV A;  1MJ9 A;  2VC0 A;  4CYC B;  2VOP A;  2Z2S B;  2A5Y B;  2CV0 A;  2AQF A;  3CQZ J;  4UB8 C;  2P7C B;  1DU6 A;  3BY6 A;  4D7M A;  4HV5 A;  1LEB A;  4JK1 X;  1XMX A;  2KP6 A;  4A3C J;  1BR4 A;  4RGU A;  3OYG A;  4PJJ A;  2H1L A;  1W0U A;  3QQA A;  2P7V B;  3I56 I;  3HUG B;  4Q5S F;  4R8H A;  1Y0U A;  2JZY A;  3BTC A;  1U5T C;  4CCN A;  5K5Q A;  3LAJ A;  2L54 A;  1ZRF A;  3N4M A;  1H0M A;  4LOC A;  4I7H A;  3GVA A;  1MNM C;  4RAZ A;  4U7D A;  1D0X A;  3OS0 A;  2XHK A;  2X0L A;  1MBF A;  2XVC A;  1XGM A;  2L5Q A;  4OU0 A;  1O7F A;  3ZMV A;  4EEF G;  1JE8 A;  5D5U B;  2D1H A;  2NNY A;  3L7W A;  4XOT A;  4UUS A;  3J7Y J;  3OYC A;  3U1D A;  2KHM A;  5B1B H;  2AO9 A;  2O5R A;  4LIV A;  2BW3 B;  2NNN A;  3A03 A;  3GTQ J;  4G6D A;  1HW1 A;  1SFX A;  2FNA A;  4FX0 A;  4LK1 F;  3CMA I;  2FA5 A;  4L9V A;  1YX5 A;  2CMP A;  3GCM A;  1DPR A;  3PIP F;  4MO7 A;  3S2H J;  2M4G A;  4BS9 A;  1A5J A;  1BJZ A;  3ZMZ A;  1R71 A;  2R4G A;  4BY1 J;  2OA4 A;  1WI3 A;  4GCV A;  3PO3 J;  1OCP A;  4PJN A;  1OR7 C;  2VE8 A;  4IRI A;  2K86 A;  5J1Y A;  5LHG A;  2R7X A;  3E5X A;  3AL0 B;  3ZGK A;  3R60 A;  4HF1 A;  4V2F A;  3JRF A;  3S3M A;  1XGS A;  3T5X A;  3G6E I;  2CUE A;  2LBF B;  3ZQI A;  2LOO A;  3JRI A;  4XKC A;  2B9S A;  3ZQG A;  1D0Z A;  2GQQ A;  4A93 J;  2NVQ J;  3CUQ B;  1F1Z A;  4BJ6 C;  1HCR A;  4KNY A;  2M87 A;  2E1C A;  1ZHF A;  3PUF A;  2K3P A;  1MMG A;  2FUG 2;  1VQ7 I;  3S2D J;  3DEW A;  3Q3S A;  4N9H A;  4M3G A;  1GXQ A;  3DCF A;  3J81 K;  3VSK A;  4ZTF A;  2ME0 A;  4OAZ A;  2EZK A;  3E1S A;  4Y13 A;  3BQY A;  3H9Q A;  3OS1 A;  4BDZ A;  2XRN A;  3DXJ F;  4EVI A;  2WY7 Q;  3Q9V A;  4ZDL A;  3JAM K;  5EEG A;  3BR5 A;  1IN7 A;  3GTJ J;  1B4A A;  3IWF A;  3D1N I;  3EUH C;  3KIO A;  3IAM 2;  2DFE A;  4B8X A;  2W7N A;  1B59 A;  4CZZ A;  3GUD A;  3W6J B;  4B09 A;  3RKQ A;  3JSO A;  4UNO A;  2Y31 A;  2R7Q A;  3VYS B;  4RB1 A;  3PQJ A;  2JT1 A;  2Z5U A;  2JSC A;  1WWX A;  4HA8 A;  1WJF A;  3HYI A;  5H2F C;  3U1K A;  1YX3 A;  2XB5 A;  3G71 I;  1OR7 A;  2OZU A;  1O4X A;  2XF5 A;  1Z6T A;  4BHP A;  1JUM A;  2EIN H;  3MD2 A;  2AHQ A;  5AIQ A;  3H3V K;  5B1A H;  3J7Z I;  1LEA A;  4II3 A;  2CGP A;  4A0Z A;  1VQ8 I;  2CYY A;  3E5Q A;  3JR9 A;  3K4L A;  2X6X A;  2FNP A;  3QRF F;  1J59 A;  2OPT A;  5FKK A;  2E2J J;  1GVJ A;  1BI2 A;  1I3Q J;  2HPI A;  2KRH A;  5GPA A;  4F3Q A;  2X6Y A;  3MMY B;  1HW2 A;  2QQB A;  2Z3Y A;  1WQ2 A;  2Y48 A;  4MTD A;  2W84 A;  3AKZ A;  2XGE A;  2VJ5 A;  2LH9 A;  3DBL B;  3HM5 A;  3BTL A;  2DYR H;  2V1X A;  4XID A;  4IEJ A;  1B72 B;  2PI0 A;  2QGU A;  5LLQ A;  1RIO H;  4BQA A;  4RB0 A;  4IHW A;  1I5Z A;  2IW5 A;  3R0A A;  4KDP A;  1UMQ A;  4IQJ A;  1OLT A;  3JTH A;  3PSI A;  3RYP A;  2EFW A;  4C2U A;  1P92 A;  2QCO A;  3IHU A;  4XLC A;  4S0H B;  2FQ4 A;  2X48 A;  3PL8 A;  2LSO A;  2V26 A;  3AG3 H;  3IH3 A;  3ZR8 X;  3EUH A;  3O8G A;  2MFZ A;  4F52 A;  3CCV I;  2KLO A;  1SAX A;  2E5N A;  3HSF A;  1BC8 C;  1QA6 A;  2E7W A;  2L4M A;  2YU9 J;  2ZME A;  1RPW A;  3G3Z A;  4D7N A;  3FIW A;  2JQ7 A;  1IXS B;  1NG7 A;  2HU9 A;  2QKL B;  1YJ9 I;  4B3X A;  1MMS A;  2CRG A;  4DZJ A;  3BG3 A;  2GOM A;  1U8B A;  3CJT B;  3JAM Z;  3E6M A;  4KN4 X;  1FSH A;  2VC1 A;  4AVP A;  5KHD A;  1S8N A;  4LGW A;  2BZT A;  2IPQ X;  1XMA A;  1JUP A;  4DJA A;  3B02 A;  2ZXH A;  2BEO A;  2DMN A;  2WAD A;  4IPA A;  3RKX A;  4IOC F;  1T38 A;  1WJD A;  2D1V A;  3DKW A;  2LVS A;  1XDS A;  5FD6 A;  4DYC A;  3GEZ A;  4JOM A;  5F04 A;  2M45 A;  1I1G A;  2PG4 A;  2QSH X;  1WI9 A;  4RGX A;  5HNF A;  3HB9 A;  3SZT A;  3WTT C;  1S7O A;  1T33 A;  5ILV A;  1RI7 A;  1ZEL A;  2QBY B;  4OIR F;  3BG7 A;  4X0G A;  2DOF A;  3KP6 A;  3OYF A;  1QHG A;  5IT9 K;  3I5U A;  4LLG F;  4IO9 F;  2CS3 A;  4AWX B;  2W4S A;  4D5C A;  1YJW I; 
#chains in the Genus database with same CATH homology
 1IZ1 A;  4L18 B;  2V1U A;  2NAZ A;  1H9T A;  3REO A;  2O0Y A;  3HSR A;  4RB3 C;  3ZN0 A;  1YYV A;  2FML A;  5BMZ A;  2W24 A;  1T2K A;  1HKQ A;  2KIF A;  3PQK A;  2GIV A;  4YFN F;  2G9W A;  1T39 A;  2IP2 A;  3I0T A;  3MEX A;  4KIG A;  5D4R A;  4ENK A;  2D45 A;  3KP4 A;  1F5T A;  2V9V A;  4OMY A;  1RZ4 A;  2Q2E A;  2XAG A;  5HDG A;  1XCB A;  3HRM A;  2CO5 A;  3QPH A;  1ONV A;  4DQ2 A;  4L0Z B;  5ERI A;  1MGT A;  1J2X A;  4IJA A;  1G3W A;  1U3E M;  2RKH A;  4IRH A;  3WTV C;  3P9I A;  5D8K B;  1XSD A;  3HRU A;  3M8E A;  5L3G A;  1FX7 A;  1PP7 U;  3CTA A;  3DPL C;  4UVA A;  4MTE A;  4XRF A;  3BDD A;  3R0J A;  2VXZ A;  1YW7 A;  3GFM A;  2F5D A;  2HZT A;  5BPD A;  3CDH A;  5HDK A;  5BPI A;  2RDP A;  2FSW A;  2UZK A;  2O03 A;  3BJA A;  5JI6 A;  3J80 K;  2Z9O A;  4ZZD A;  5FD5 A;  1J5Y A;  4CYD A;  1Z7U A;  1BJA A;  3ZQ7 A;  4WCG A;  5BOX A;  1R58 A;  4QLC U;  1MKM A;  3ABU A;  1ODD A;  1Q1H A;  3K1P A;  3DP7 A;  2VOO A;  1ULY A;  2WTE A;  4RAY A;  1R23 A;  2XAQ A;  1FBS A;  4N9I A;  2G7H A;  3VOE A;  4FT8 A;  1Z6R A;  3I58 A;  5HLH A;  1W4M A;  2OQG A;  1UFM A;  4A0Y A;  3O2P E;  3ZP5 A;  4M71 A;  2IA2 A;  2HDC A;  1T0F A;  4NHJ A;  4G7O F;  4LD5 A;  5E18 F;  1STZ A;  4KMU X;  2HQN A;  1MJB A;  5LEJ A;  4HQE A;  1BC7 C;  1FBQ A;  1SFE A;  5HS7 A;  4OIO F;  3ZN1 A;  1TLH B;  1P4X A;  4ZH4 F;  3KZY A;  2NRA C;  1BOA A;  2DPU A;  4CIC A;  4L9J A;  4GYI A;  1I27 A;  3J80 Z;  3K1M A;  2GXB A;  4P9F A;  1BI3 A;  3F8N A;  3F8C A;  4ON0 A;  4OIN F;  4EMS A;  2ZJ2 A;  1P6R A;  3C1D A;  3MAJ A;  2DO7 A;  4FX4 A;  2OU2 A;  2DTR A;  3C7J A;  1QBJ A;  3FMR A;  5EEH A;  3P7N A;  1TQP A;  4M74 A;  3BJ6 A;  1BIB A;  2EB7 A;  4A0X A;  4GGG A;  1ZN2 A;  2A6E F;  2WV0 A;  1EH6 A;  1T98 A;  4M9X A;  2XAF A;  4UV8 A;  1W7P B;  4A12 A;  2KRF A;  3V7R A;  1U2W A;  1XB4 A;  3KP5 A;  1O57 A;  1SFU A;  3E6D A;  3VFZ A;  3KP2 A;  1S29 A;  2UXN A;  1SD4 A;  5BQT A;  3WG9 A;  2IJL A;  3FXU A;  4G7H F;  3F8M A;  3P9K A;  4N0B A;  2QZ8 A;  2ZFW A;  4S04 A;  3L09 A;  1U5T B;  5LRR A;  1W5T A;  1XDU A;  5DUK A;  4UVB A;  4EM0 B;  2JTV A;  4FHT A;  3M1E A;  4KYW A;  2X4H A;  2DU9 A;  3OV8 A;  3E6B A;  1ZAO A;  4BAY A;  2OQR A;  1YLF A;  3FM3 A;  2PN6 A;  2COM A;  2FRH A;  4NQW A;  5L3E A;  3ZMS A;  1T6S A;  3SXY A;  2A3S A;  1V3F A;  1B6A A;  2FF4 A;  5K5R A;  5CJ9 A;  4KIF A;  1FYL A;  2DK8 A;  1L0O C;  4EV0 A;  4G8X A;  4R1H A;  5HOO A;  4LG0 B;  1FSE A;  1R1V A;  4M6Y A;  1F4K A;  1FPQ A;  1Z91 A;  1G3S A;  3HTU A;  1S6L A;  4M72 A;  2ZNZ A;  4HV6 A;  3DEU A;  3EYI A;  3H92 A;  5H6Q A;  1R22 A;  1FYM A;  1BIA A;  3IKV A;  1OKR A;  1XGO A;  2A68 F;  2LKP A;  1U8R A;  1YW9 A;  4HW0 A;  4KIC A;  1D8J A;  4P55 A;  2ZNY A;  5JFR A;  3FMS A;  1IAW A;  1RUO A;  4WXH A;  4EJV A;  1KYW A;  3CUO A;  3SZP A;  2QYO A;  2P6S A;  3HRS A;  5LGU A;  3AAF A;  4PGG A;  2EV6 A;  1O3S A;  1BM9 A;  2LNB A;  1YQA A;  1QO0 D;  3JSP A;  2K4J A;  3S2W A;  2DLL A;  4HBL A;  4I0B A;  2ZME B;  1MDM A;  4S05 A;  4MHG A;  3WU1 B;  1XGN A;  4K2E A;  2FE3 A;  4PZJ A;  1S3J A;  3WTW C;  3BWG A;  2BV6 A;  1J75 A;  2XGX A;  2DQL A;  2Y75 A;  1O3R A;  3LWF A;  3LAP A;  3ECH A;  1R5G A;  2CG4 A;  4L5J A;  4U7B A;  1RNL A;  1IN6 A;  1IXC A;  4LB6 B;  4KIB A;  2ISY A;  3IRR A;  1ZRD A;  2EJR A;  1FT9 A;  5AON A;  5LHH A;  3F8F A;  5HVQ C;  1SD5 A;  1IRG A;  2DBB A;  4BYY A;  2LDU A;  3CO6 C;  2JPB A;  1JXS A;  5CVJ A;  3Q5F A;  1MD0 A;  2FOK A;  4XBF A;  2XKO A;  1I1S A;  2KIM A;  1ZLJ A;  4ENJ A;  1YG2 A;  1ZRE A;  1E2X A;  2MH9 A;  5CVV A;  1K78 A;  3F23 A;  1YW8 A;  4AIK A;  4HQM A;  4Q48 A;  3I59 A;  2VOD A;  1EH8 A;  2PQ8 A;  1XN7 A;  5E1W A;  5DYM A;  5J8C A;  3TOB A;  5CLS A;  1KYZ A;  2L02 A;  5ILU A;  3KFW X;  2JPC A;  2EA4 A;  4EJW A;  5DCM A;  1R1U A;  3T0Y A;  5ICF A;  1OYY A;  4LK0 F;  2M5W A;  4KN7 X;  4I01 A;  1FP1 D;  1ON1 A;  4AIH A;  1ZH5 A;  1FLI A;  3QU3 A;  5LRS A;  1KQ9 A;  4I02 A;  3EDP A;  2W25 A;  2HR3 A;  3IKT A;  3RKY A;  4RS8 A;  2RGV A;  3BPV A;  2MBF A;  2PMU A;  2QVO A;  3EYY A;  3P9C A;  1OMI A;  4MEX F;  1HW5 A;  4P5O A;  2FBH A;  4XLN F;  1LJ9 A;  1LB2 A;  3DV8 A;  1TW2 A;  3DPT A;  1ZG1 A;  4CGZ A;  3FM5 A;  3F6V A;  3M9A A;  1F9N A;  3K69 A;  3F72 A;  3GF2 A;  3HRT A;  4XLP F;  5IT3 A;  1ZLK A;  1EH7 A;  3RYR A;  1JHF A;  1ZGJ A;  3J81 Z;  5BS6 A;  2YX7 A;  3QP6 A;  4OOI A;  2H09 A;  3IRQ A;  2BBY A;  4U0W A;  3VEP A;  2XIG A;  2BE5 F;  2HTJ A;  1K79 A;  1BI0 A;  3KZZ A;  1Z1D A;  1IN4 A;  1FC3 A;  4IXA A;  1EV7 A;  1JHH A;  2FXA A;  1J9I A;  1RUN A;  2FBK A;  4M9S A;  4WXC A;  4RGS A;  3RTR A;  3VOD A;  2EFN A;  2OAZ A;  1HKT A;  5DCF A;  4P96 A;  2L01 A;  4G7Z F;  4H0E A;  1QZY A;  4EJT A;  1D8K A;  2M30 A;  3SQN A;  5K1Y A;  4CHU A;  3SFZ A;  2STT A;  1YTY A;  5HS8 A;  3KLN A;  2BGC A;  4Q4Z F;  2Y0M A;  3GZ6 A;  4HX7 A;  2ZKZ A;  5F6F A;  1BN5 A;  4PGH A;  2P5K A;  3ISP A;  3CLO A;  2EWN A;  2GZW A;  1YS6 A;  3K0L A;  3ZPL A;  1BBY A;  1Z05 A;  1PUE E;  1XMK A;  2EV5 A;  1HKS A;  3U2R A;  3TO7 A;  3PFI A;  4KMF A;  4HX4 A;  4ENN A;  3R6S A;  4CO8 A;  1USS A;  2VBZ A;  3WGI A;  4BHB A;  5LHI A;  3MFK A;  1W5S A;  2YSR A;  4YII A;  3FMQ A;  4LLN A;  3TOA A;  1OYI A;  2XAJ A;  1WSU A;  2UXX A;  2FBI A;  3H3U A;  1XD7 A;  2WC2 A;  1BI1 A;  4HX8 A;  3L2C A;  1KQ8 A;  5CYV A;  5IT9 Z;  2DQR A;  2ISZ A;  5HLI A;  3ML6 A;  4HDV A;  1R36 A;  4HLX A;  2Q8K A;  2HQR A;  5DDG A;  3KEQ A;  3BRO A;  4WX9 A;  1E17 A;  1I6X A;  1LQ1 A;  3RPU A;  5J8F A;  5L3C A;  3DQV C;  1P2F A;  2VBW A;  5DV5 A;  4OIQ F;  3GXO A;  4WK8 F;  1YFH A;  2M1B A;  2O61 A;  1FBU A;  5F64 A;  3EET A;  4XSX F;  2H6B A;  2MLG A;  3F3X A;  3V8L A;  4L9T A;  1H9G A;  1QNT A;  3MCZ A;  2RV8 A;  2KKO A;  2GAU A;  2W85 A;  4TV7 A;  3QAH A;  1ZGA A;  1W7P D;  3LA7 A;  1U78 A;  2Q0O A;  2DW4 A;  3NEU A;  2CSO A;  4HAM A;  3GYH X;  5H6R A;  2EFP A;  4A5M A;  1B9N A;  2VT2 A;  3GFL A;  2YU3 A;  3TGN A;  1SD7 A;  3HTS B;  5AIP A;  5E17 F;  3D0S A;  1OPC A;  4F7Z A;  4GO1 A;  2R7D A;  2CW0 F;  1LDJ A;  4GYG A;  2QLZ A;  3IC7 A;  3LFK A;  2EA2 A;  4UUV A;  3WE2 A;  3F21 A;  3RJP A;  2PMH A;  1QZZ A;  5L3D A;  1QQI A;  4U0V A;  2V1D A;  5TJJ A;  2AXL A;  4BNC A;  3F22 A;  1ZAR A;  2GA1 A;  1TTY A;  3L00 A;  3WGG A;  2MC3 A;  3LST A;  5TRD A;  2JRT A;  2GWR A;  2HFH A;  3I53 A;  2XKP A;  3LA3 A;  3KLO A;  3HHH A;  1DDN A;  3GZ5 A;  5JHU A;  5FFX A;  4ZYD A;  3R4K A;  4A2U A;  3HOT A;  2IT0 A;  2QQ9 A;  4MQV A;  3T8T A;  3FXR A;  3B73 A;  5D8L B;  3ULQ B;  1HQC A;  4L9N A;  2J5P A;  3FF5 A;  5D6F A;  2FU4 A;  2RNJ A;  5ICE A;  1CGP A;  3C3W A;  3O3K A;  1V4R A;  1D5V A;  3KET A;  2M8E A;  2MD5 A;  3U9G A;  1MDM B;  3FXQ A;  4ESJ A;  4A6D A;  1UB9 A;  2OBP A;  3ABT A;  1HXD A;  2Z33 A;  3F8B A;  4MGR A;  4ETS A;  2RC4 A;  2F2E A;  2ESH A;  1R5H A;  2QWW A;  1MZB A;  2FEZ A;  5LBQ A;  5CVI A;  4YIF A;  2NYX A;  3ZMT A;  4PDK A;  5JR3 A;  2DPD A;  3QP5 A;  5ICG A;  3ERE D;  2PEX A;  1PDN C;  2STW A;  4UV9 A;  2A61 A;  5LEK A;  3WGH A;  1YIO A;  2VBY A;  2DK5 A;  2GXG A;  1KA8 A;  4HOB A;  4CXF A;  3WTY C;  4O5V A;  1K78 B;  3DFG A;  3I59 B;  3HOS A;  4O3M A;  4MEY F;  1DP7 P;  1DUX C;  4I2O A;  2A69 F;  3ROU A;  1FWZ A;  2PJP A;  5DCM B;  2IA1 A;  1CF7 A;  3ECO A;  1TW3 A;  2EFQ A;  5F1R A;  2PLY A;  3F6O A;  4Y15 A;  5KK1 A;  2IRF G;  6PAX A;  1TBX A;  2PBI A;  2RN7 A;  3MZH A;  1PP8 F;  1O7L A;  4IHT A;  4IVN A;  2ZXJ A;  4RGR A;  1XSV A;  2XV4 S;  1QPM A;  4I0A A;  1UST A;  4EJU A;  2R3S A;  5E8G A;  2P4W A;  1QGP A;  3T1B A;  1IUY A;  2P5L C;  2HTS A;  3V7C A;  4HZF A;  2D2W A;  4HLY A;  4O6J A;  3ELK A;  5ED4 A;  1W7P A;  3FZV A;  3TO9 A;  1REP C;  4KA4 A;  3RIR A;  4BHC A;  1DPU A;  2K27 A;  2BYV E;  5KVR A;  2TDX A;  2QM3 A;  2QQA A;  4RB2 C;  4IF4 A;  5E1X A;  1TQM A;  2DT5 A;  4G6Q A;  2R7F A;  2LF7 A;  3KEO A;  4Q47 A;  2XRO A;  2HYG D;  3TDZ C;  4HF2 A;  1KU9 A;  1TNT A;  3ZMD A;  4QWQ A;  4M73 A;  1U5T A;  4EQQ A;  5J6X A;  5FLX K;  3COA C;  2VON A;  5E20 A;  2DAO A;  3V8J A;  3JTG A;  4AIJ A;  3KP3 A;  2YR2 A;  1IRF A;  1Z9C A;  3WTU C;  2VN2 A;  3CO7 C;  3IWZ A;  3FHZ A;  4LJZ F;  2YPR A;  3R61 A;  3BOQ A;  3LQR A;  3K9T A;  4PCQ A;  3H3Z A;  5JVT A;  2HWV A;  1IW7 F;  3V8K A;  1J0R A;  3M7G A;  3QOP A;  5HLG A;  2YX4 A;  2B0L A;  4LG0 A;  3C18 A;  3DF8 A;  1WRJ A;  3E97 A;  3WTX C;  3HUG A;  2P5V A;  4WWC A;  1TQI A;  1FY7 A;  1IXR C;  1AWC A;  1O3Q A;  4JBA A;  2G7U A;  4IRG A;  3CUQ C;  2NS0 A;  4D0P A;  3BP8 A;  1R00 A;  5H20 A;  3WU0 A;  4U0Y A;  3FWE A;  1KQ0 A;  1NHA A;  3LA2 A;  3KE2 A;  3VB2 A;  1GXP A;  2HKX A;  5FLX Z;  1UCR A;  4MQ9 F;  2LF8 A;  2ACJ A;  3G73 A;  4EGY A;  2GA2 A;  1D3Y A;  1LNW A;  3RPQ A;  5L3F A;  5FGM A;  2QUF A;  5HS9 A;  4GXO A;  1U6G A;  1UHM A;  2HOE A;  1B9M A;  2ZBK A;  3WTS C;  3OOP A;  1HBX G;  4E70 A;  2XAS A;  3WTZ A;  5D5X B;  1ZG5 A;  5DD4 A;  2MH2 A;  3V7S A;  2CQK A;  2DFI A;  3V4G A;  2MLK A;  5FB2 A;  3GFJ A;  3GWZ A;  1G3T A;  4BXU A;  2W57 A;  1FNN A;  2CWE A;  3CUQ A;  4U88 A;  2ESN A;  4WF2 A;  3KP7 A;  2ADU A;  4BH9 A;  5DUI A;  2HEO A;  4UVC A;  2PFB A;  2H27 A;  1R1T A;  4Z2Y A;  3HIF A;  2RQP A;  2L4A A;  4HF0 A;  3QU6 A;  5K5O A;  4EGZ A;  1IN5 A;  3I54 A;  4A6E A;  3NRV A;  3L9F A;  3SHF A;  4HDU A;  2VE9 A;  4OMZ A;  3CJN A;  3HHG A;  1IF1 A;  3GLX A;  3M8F A;  2QEN A;  3I64 A;  1XSX A;  3E6C C;  4EM1 A;  5ICC A;  2E7X A;  1L3L A;  4LB5 A;  3K2Z A;  5A2Q K;  1O3T A;  3WE3 A;  1KU7 A;  2FQ3 A;  3I71 A;  5FO5 A;  4UHT A;  2F5C A;  4LLL A;  2ZO4 A;  2UWM A;  4JQF A;  1UHW A;  2H94 A;  2ZCW A;  2EFO A;  4LFU A;  4KT5 C;  1FOK A;  1SMY F;  1R7J A;  4ZYG A;  4IHS A;  4KFC A;  4ENM A;  1LVA A;  2FMY A;  4CDG A;  2ETH A;  2P8T A;  3GFI A;  4EM2 A;  4L0Y B;  4I09 A;  4ZZL A;  2H6C A;  2VT3 A;  4R79 A;  4P9U A;  1ON2 A;  4M6X A;  3O6B B;  1J7K A;  3BPX A;  1SMT A;  3BJO A;  2OD5 A;  4M9Z A;  2IVM A;  4NB5 A;  3J7A O;  3NQO A;  4YFK F;  2A6H F;  2CFX A;  2QBY A;  5A2Q Z;  3GW2 A;  2O6G E;  1FYK A;  3EQL F;  3MQ0 A;  2HS5 A;  1HST A;  2RVC A;  3TDU C;  2Z99 A;  2WWY A;  3K1N A;  1B1B A;  1WKM A;  3ZMU A;  1XCV A;  1OYW A;  1YS7 A;  2O8X A;  4I98 B;  4ESF A;  1A04 A;  2V79 A;  3I4P A;  2AS5 F;  4G94 A;  2KJB A;  1P4W A;  3FX3 A;  2EV0 A;  5LGN A;  1CF7 B;  5E8I A;  4ASN A;  1K7A A;  2P6T A;  1ZRC A;  2KJC A;  4ZYH A;  4OIP F;  2DI3 A;  1HSJ A;  2XUB A;  3JW4 A;  5L3B A;  4ESB A;  4LMY A;  3RDI A;  5E1Z B;  1JGS A;  5CVR A;  2F5F A;  5D6E A;  1GHC A;  3TO6 A;  1YO5 C;  3IL2 A;  2V6C A;  3N97 A;  3D5L A;  3GX4 X;  2C6Y A;  5DD8 A;  2J5O A;  1FP2 A;  2KIU A;  1G4D A;  2MA3 A;  1K6O A;  1ZYR F;  3T8R A;  2L3D A;  4KUM A;  2ELH A;  4G9Y A;  2HYF A;  3W6K B;  5FFZ A;  3BZ6 A;  3WOD F;  3HSE A;  4DNC A;  3RI4 A;  5D5V B;  2K02 A;  3LQQ A;  3MWM A;  3RKW A;  4YFX F;  1X3U A;  3TKY A;  5ILS A;  2IA0 A;  2HKO A;  2XAH A;  4EJO A;  3GO5 A;  1G6N A;  5HDN A;  3KCC A;  5LGT A;  2A07 F;  5D4S A;  4Y17 A;  2K7L A;  3TQN A;  4AD9 A;  1AOY A;  4WXD A;  1VTN C;  1FZP B;  3QPT A;  3E5U A;  5D5W B;  2E1N A;  4UXN A;  2VBX A;  4A5N A;  4HYE A;  1KU3 A;  1S7A A;  1ZG3 A;  3Q9S A;  5CVU A;  4ZYE A;  4YG2 F;  2F5E A;  2HGC A;  1P4A A;  4XSZ F;  5DEQ A;  1C0W A;  1KU2 A;  2O3F A;  4MNU A;  1MJA A;  1G3Y A;  1IN8 A;  2EK5 A;  1LDD A;  3E3V A;  1TNS A;  1SD6 A;  2OZ6 A;  4L5I A;  1KGS A;  2K4B A;  3MZY A;  1LDK B;  1MJ9 A;  2VC0 A;  2VOP A;  2A5Y B;  2P7C B;  3BY6 A;  4HV5 A;  1LEB A;  4JK1 X;  4RGU A;  2P7V B;  4Q5S F;  4R8H A;  1Y0U A;  3LAJ A;  2JZY A;  1U5T C;  5K5Q A;  2L54 A;  1ZRF A;  3N4M A;  1H0M A;  4I7H A;  3GVA A;  4RAZ A;  4U7D A;  2XHK A;  2X0L A;  4OU0 A;  2XVC A;  1XGM A;  1JE8 A;  1O7F A;  3ZMV A;  5D5U B;  2D1H A;  2NNY A;  3L7W A;  3U1D A;  2NNN A;  4G6D A;  1HW1 A;  1SFX A;  2FNA A;  4FX0 A;  4LK1 F;  2FA5 A;  4L9V A;  1DPR A;  3ZMZ A;  2OA4 A;  4GCV A;  2VE8 A;  4IRI A;  2K86 A;  5LHG A;  3E5X A;  3R60 A;  4HF1 A;  1XGS A;  3T5X A;  2GQQ A;  3CUQ B;  1F1Z A;  4KNY A;  2M87 A;  2E1C A;  1ZHF A;  4N9H A;  1GXQ A;  3J81 K;  4Y13 A;  2XRN A;  3DXJ F;  4EVI A;  3Q9V A;  3JAM K;  5EEG A;  1IN7 A;  1B4A A;  3IWF A;  4B8X A;  1B59 A;  4CZZ A;  3GUD A;  3W6J B;  4B09 A;  3JSO A;  4UNO A;  4RB1 A;  3PQJ A;  2JT1 A;  2Z5U A;  2JSC A;  1WWX A;  4HA8 A;  3HYI A;  1OR7 A;  2OZU A;  1Z6T A;  4BHP A;  5AIQ A;  1LEA A;  2CGP A;  4A0Z A;  2CYY A;  3E5Q A;  2FNP A;  3QRF F;  1J59 A;  1GVJ A;  1BI2 A;  1HW2 A;  2QQB A;  2Z3Y A;  1WQ2 A;  2Y48 A;  4MTD A;  2W84 A;  2V1X A;  2PI0 A;  5LLQ A;  1RIO H;  4BQA A;  4RB0 A;  1I5Z A;  2IW5 A;  3R0A A;  4KDP A;  3JTH A;  2EFW A;  3RYP A;  1P92 A;  3IHU A;  2LSO A;  3EUH A;  1SAX A;  3HSF A;  1BC8 C;  2E7W A;  2L4M A;  2ZME A;  3G3Z A;  1IXS B;  3JAM Z;  3E6M A;  4KN4 X;  1FSH A;  2VC1 A;  4AVP A;  1S8N A;  4LGW A;  2IPQ X;  1XMA A;  2BEO A;  3B02 A;  1T38 A;  4IPA A;  3RKX A;  2D1V A;  3DKW A;  1XDS A;  5FD6 A;  3GEZ A;  2M45 A;  1I1G A;  2PG4 A;  1WI9 A;  4RGX A;  3WTT C;  3SZT A;  1S7O A;  5ILV A;  1RI7 A;  2QBY B;  4OIR F;  3KP6 A;  5IT9 K;  3I5U A;  4LLG F;  4AWX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...