1UHMA

Solution structure of the globular domain of linker histone homolog hho1p from s. cerevisiae
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
b'EASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASNFDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H1
publication title The linker histone homolog Hho1p from Saccharomyces cerevisiae represents a winged helix-turn-helix fold as determined by NMR spectroscopy.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2003-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1uhmA00
5ICEA 1HKQA 3RDIA 2E1NA 4UXNA 1REPC 4G94A 1OYWA 2M5WA 1QO0D 2L01A 3U9GA 4QWQA 1ZGJA 5HLGA 3SHFA 3MAJA 1AOYA 2LF8A 2H27A 2VODA 4Z2YA 3M8EA 4GXOA 4HF0A 2ZO4A 4MQ9F 5E8GA 1KQ9A 2EA2A 2CO5A 4PDKA 1FYLA 3M7GA 3V7RA 2K7LA 1LEBA 1HW1A 1B9NA 1IN8A 4YIIA 3OOPA 3ZPLA 1IN4A 4LLNA 2HFHA 3DXJF 3K1PA 1BJAA 4HA8A 2P4WA 3O3KA 5BQTA 1HBXG 3GZ6A 2O0YA 3V8JA 4G7OF 2JPBA 4MNUA 1S8NA 2A68F 3I54A 4P5OA 1XGMA 2G9WA 2M30A 3HSEA 3W6KB 3VOEA 1T98A 4HAMA 1RUNA 3DEUA 1T0FA 1USSA 5JR3A 1KU2A 4A6DA 4GO1A 4P55A 5EEHA 2HTSA 2H6BA 4OIPF 3KZYA 4QLCU 4CZZA 2IRFG 2BEOA 2PJPA 2RV8A 2DBBA 1I1SA 3JAMK 2EV5A 1S3JA 4HDVA 1FBUA 1R58A 2EJRA 2P5LC 4KDPA 3DQVC 2VBXA 3WTTC 1J75A 4KMFA 3D0SA 3OV8A 2DPDA 1S7AA 1R36A 1E2XA 3J81K 2NS0A 2DLLA 2KRFA 4ESFA 1T6SA 1RZ4A 1YG2A 2FEZA 1W5TA 4P9FA 3R61A 2H09A 2HWVA 5CVRA 4I09A 4KN7X 3H3ZA 3JSPA 2F2EA 1UB9A 4MHGA 1UHWA 3QOPA 3IRRA 4WF2A 3RKYA 5LGUA 3F8NA 3WTZA 4FT8A 5AIPA 3QP5A 1W7PB 4GGGA 2D45A 1XB4A 4B8XA 2X0LA 1R00A 5CJ9A 2A07F 4KFCA 3HHGA 3WGGA 4KYWA 1ON2A 2QQ9A 1R1UA 4HLYA 2EFPA 1HSJA 1X3UA 2DFIA 5D5VB 4B09A 5DCMA 1FY7A 2FBKA 2K86A 3LAJA 3GF2A 1C0WA 2KJCA 1PDNC 2A6EF 2XGXA 4PZJA 2QM3A 2X4HA 3EDPA 1R5HA 3BWGA 2FRHA 5LEJA 3HRMA 1K79A 2ZMEB 2L3DA 2CG4A 3W6JB 4G8XA 1HSTA 3WTWC 5FLXK 3I5UA 4LFUA 4E70A 3DFGA 2EFOA 2IA0A 1LNWA 5F1RA 1IW7F 2XAGA 5E1WA 1W5SA 3GFJA 1TQPA 3N97A 3TOBA 5DUKA 4P9UA 2HKOA 2F5CA 4OU0A 4Q5SF 2MH2A 2VXZA 3C18A 2K27A 3NQOA 1U5TC 2E7XA 3QRFF 4N9HA 2XVCA 3HRTA 1KYWA 1CF7B 2DW4A 2MH9A 1ZRCA 2W25A 4JK1X 5DDGA 4EJVA 5E8IA 4FHTA 1T2KA 1ULYA 2EWNA 2UXXA 2A5YB 4BNCA 4CO8A 3M1EA 3C7JA 4I02A 2ESNA 5J8FA 4ZYEA 2ISZA 1B4AA 2PQ8A 3RTRA 2ETHA 4BHCA 2QVOA 4EM1A 1VTNC 4M9SA 3TOAA 1JHFA 5A2QZ 5E17F 2VONA 5CYVA 3CUOA 2MBFA 4YG2F 4U7BA 4EMSA 4BXUA 4H0EA 3TQNA 3COAC 3ERED 3F22A 4LK1F 1V3FA 1BI2A 1BC7C 5BMZA 2IP2A 2EFNA 3BZ6A 2XROA 4MEYF 5LGTA 3MFKA 4NHJA 4GYGA 5L3FA 1KU3A 3QPTA 1RNLA 5D6FA 1LJ9A 4LLGF 4BYYA 3KP2A 4XLNF 4ENMA 1ZH5A 4RB3C 1O7LA 2HKXA 4HBLA 2CYYA 1XSVA 2QQBA 4CDGA 5CVUA 4LJZF 1BI3A 4S05A 3K0LA 1Z6RA 4HW0A 3F3XA 3TKYA 2FMLA 1D3YA 1YFHA 1I1GA 4AVPA 2FU4A 1R1VA 2B0LA 4RGSA 2HGCA 4EGYA 1J2XA 3K2ZA 4G7HF 1WRJA 2HQNA 1LVAA 5AONA 2YR2A 2JPCA 2VOPA 3CO7C 3J80K 1P92A 1OYIA 4I0AA 1TW3A 5BS6A 2ZMEA 2BGCA 2GA2A 1SFEA 4RAZA 5HDKA 3T0YA 5JHUA 4XLPF 4M6YA 3EQLF 1IAWA 1K78B 1YO5C 2LSOA 1ZGAA 2GAUA 1WI9A 4EVIA 1FZPB 3WU0A 4OOIA 1O3QA 4HOBA 2IW5A 5D5XB 4ON0A 4KICA 1OKRA 1SAXA 2O61A 3C1DA 1A04A 4OIRF 5LEKA 3E5XA 4LGWA 4G6QA 1I5ZA 1BM9A 3GX4X 2RGVA 2F5DA 5ED4A 1FNNA 5D4RA 2P8TA 2Y48A 2GXBA 4L9VA 1TBXA 3HUGA 2QBYB 4KNYA 2P7VB 1SMYF 1CF7A 4I0BA 3ZN1A 2FE3A 2DU9A 1ZLJA 2BBYA 3F6VA 1J9IA 2QLZA 1QBJA 3BPXA 3HTSB 1HW2A 1G3TA 2ZKZA 1H9GA 5DCFA 2A61A 2VE8A 2VOOA 3KZZA 3ABUA 2VBYA 3R6SA 3ZN0A 5H20A 3B02A 2H94A 1TNSA 2JTVA 2DK5A 1GXPA 1J5YA 2ZFWA 4BH9A 3FX3A 1Z91A 1PUEE 3P9KA 2KIUA 3RPUA 1FBSA 2CSOA 2LF7A 5D8KB 5KVRA 3F8CA 3JAMZ 3BROA 3E6BA 4KIFA 3MEXA 4CICA 3HRSA 1DP7P 4R8HA 5E20A 3ZMVA 4LMYA 2DTRA 2P6SA 3E5QA 3J81Z 3ZMUA 3U1DA 2V1XA 4CYDA 2CQKA 3BOQA 2DQRA 4YIFA 3GXOA 1O3SA 2K4JA 5DUIA 4EQQA 1QNTA 4M71A 4HQEA 1J7KA 5HS7A 3O2PE 2ZJ2A 1RI7A 5HLIA 4MQVA 1WQ2A 4RB1A 1YS7A 3DV8A 4HV5A 2FXAA 3WE2A 3MQ0A 1HXDA 2LKPA 3CUQB 1XDSA 2OQRA 3V8KA 5IT3A 2JSCA 4R79A 3AAFA 2FOKA 1FWZA 3KLOA 4R1HA 3FXRA 3FMSA 3TO6A 4KUMA 3MWMA 4CXFA 1E17A 1TTYA 4PCQA 2V6CA 5HDNA 4P96A 4XSXF 3TGNA 3G3ZA 2W57A 3CTAA 1BBYA 1XSDA 1K78A 4EJOA 4CHUA 3ELKA 4LB6B 1I27A 1S7OA 2OD5A 3IKVA 3ZMTA 1MJAA 2Q2EA 1T39A 2MC3A 2PMUA 3HRUA 1TW2A 1YS6A 4ENNA 5CLSA 3B73A 2FBIA 3CLOA 2IJLA 4EJUA 2CWEA 1UCRA 2MLKA 5FGMA 2GXGA 4WWCA 1PP8F 2FMYA 3I59B 5D5WB 4IRIA 2QBYA 2PMHA 2XASA 3MZYA 1G3YA 2J5PA 2XRNA 1DUXC 3V8LA 2KKOA 4KIGA 3LSTA 2ACJA 4YFXF 2FF4A 2VT2A 3F6OA 5HS8A 2HS5A 4HQMA 4XRFA 2QYOA 4A2UA 1KGSA 4IPAA 5ERIA 1SD5A 3E97A 3ECOA 1JXSA 1YW7A 2CGPA 4G7ZF 1S29A 1U6GA 4RS8A 3KP3A 4RB2C 3GYHX 4L9JA 1LB2A 4KMUX 2PI0A 1SD4A 5FFXA 2EA4A 1GHCA 2O3FA 5DV5A 3WTSC 2XAFA 3DF8A 1ZN2A 2RC4A 4Q4ZF 3GLXA 3ZQ7A 4N0BA 3REOA 4L0YB 4TV7A 1I6XA 1XGOA 3KETA 4N9IA 4RAYA 3RIRA 2MA3A 3EETA 4MGRA 1S6LA 5HDGA 1J59A 2O03A 3RJPA 1W7PD 3NRVA 3IWFA 1F1ZA 1U2WA 2GA1A 2P6TA 3T5XA 4JBAA 1K6OA 4UUVA 1FYMA 1YW9A 3M9AA 2A6HF 4ZYGA 2ESHA 2OZ6A 5E1XA 1O3RA 4UNOA 3PQJA 1D5VA 2XIGA 3ABTA 2WWYA 2K4BA 2F5EA 1TQMA 3FXUA 4A6EA 5AIQA 1L3LA 3HHHA 5H6QA 4L9NA 1O3TA 2A3SA 2CW0F 4ENJA 5ICCA 1B6AA 2DQLA 2Y75A 3J80Z 2WC2A 4WX9A 3KE2A 4YFNF 3HOTA 3LWFA 3JSOA 1WKMA 1DPRA 4FX4A 3RKXA 4U88A 1LDDA 4I98B 4Y15A 1ZHFA 2M1BA 1BC8C 2FSWA 1DDNA 1BIBA 2K02A 5F6FA 3I71A 2Q0OA 3WTXC 4ENKA 2FNPA 3WE3A 3LFKA 2DI3A 4RB0A 1XCBA 1Z9CA 3ZP5A 3F8MA 4NB5A 1RIOH 3E6DA 3BY6A 3GWZA 4K2EA 3K1MA 3LA3A 3RI4A 4ESBA 2EV6A 2TDXA 4EJTA 2KJBA 4F7ZA 2QQAA 4L0ZB 3JTGA 3IC7A 2M8EA 5KK1A 3GZ5A 2LNBA 3HSFA 3KFWX 4A5MA 2M45A 2DPUA 1NHAA 1USTA 4U0VA 1U3EM 4WXHA 2LDUA 3MCZA 2VN2A 2FBHA 2PBIA 2HOEA 4A0YA 4Q47A 3U2RA 4LD5A 3QU6A 3CJNA 4L18B 1W7PA 1XD7A 3G73A 2RNJA 1MZBA 2ADUA 2L4MA 2A69F 2P5VA 2UZKA 1QZZA 1MJ9A 4AIJA 3ULQB 3DPLC 1IXSB 2GZWA 4HLXA 1U5TB 5D5UB 1LDJA 4NQWA 4S04A 4ZYDA 2XV4S 1FP1D 2XKOA 3L09A 1G3SA 1BI0A 3GW2A 3LA2A 3MZHA 4HF2A 3SXYA 2XUBA 3N4MA 5K5QA 4ZZLA 1MJBA 4Y17A 1IZ1A 4A5NA 2F5FA 2IA1A 5CVIA 2DK8A 1AWCA 1YW8A 2D2WA 3KP7A 4HX8A 2YU3A 1JHHA 2ZNYA 2XHKA 2BE5F 1R5GA 1O57A 3SQNA 5K5RA 3GVAA 1Y0UA 3L00A 3Q9VA 4G9YA 3L9FA 4BAYA 5E18F 1T38A 3HTUA 4IRGA 2OZUA 3F21A 1P4AA 3L2CA 2HDCA 4RGUA 4HDUA 1W4MA 3EUHA 3H3UA 1GVJA 5A2QK 4G6DA 1KQ0A 1FYKA 4O3MA 3FM5A 2QENA 1SFUA 3F23A 5IT9K 1B1BA 4ETSA 4MTDA 3KP6A 1TNTA 2L4AA 2Z9OA 4U7DA 3L7WA 4IF4A 5HLHA 3BJOA 1R1TA 4IHTA 2HYFA 1ZAOA 1ZG5A 4RGXA 1SFXA 3TO9A 5DYMA 1UHMA 2AS5F 2Z99A 2EFWA 3GO5A 3RYPA 4AWXB 3QPHA 2EK5A 4ZH4F 2VC1A 1EV7A 6PAXA 3K9TA 2MD5A 2QUFA 1FC3A 2R7DA 3LAPA 3ZMZA 4KA4A 1Z6TA 2ZXJA 3FM3A 3H92A 3FXQA 3HIFA 5D6EA 5LBQA 1HKSA 4M9XA 1RUOA 2Y0MA 1ZRFA 2OQGA 2O8XA 2JRTA 4M9ZA 2W24A 2Q8KA 5D4SA 1QQIA 3RPQA 2RVCA 4WK8F 3T1BA 5TJJA 2XAJA 4YFKF 3P7NA 3DPTA 5H6RA 2EFQA 4A0ZA 2PEXA 1ZRDA 2ELHA 2Z33A 5LRRA 2JZYA 3ML6A 3TDUC 3VFZA 1BN5A 5DD4A 1Z7UA 1FBQA 1LEAA 4U0WA 3WU1B 1IN7A 2IVMA 3QP6A 4IRHA 3FHZA 5HOOA 5TRDA 3PFIA 2NYXA 3SZPA 3JW4A 1P4XA 1R23A 3TO7A 2D1HA 2BV6A 2VBWA 2VBZA 3LQQA 3NEUA 2YSRA 2PLYA 1YQAA 5K5OA 2IPQX 4HX4A 5LGNA 4WXCA 2P5KA 2HQRA 5FLXZ 2YX4A 2D1VA 3WTVC 3C3WA 2VC0A 3DKWA 5JFRA 4UV9A 3LA7A 4M74A 1P2FA 5D8LB 3F8FA 4CGZA 3WODF 2XKPA 3FMRA 4BQAA 2UXNA 3BPVA 3IHUA 3BP8A 1WSUA 5CVJA 4RGRA 3FMQA 2XAHA 1XMAA 1H9TA 1FP2A 2FA5A 2YPRA 1FPQA 2BYVE 1BI1A 4MTEA 4I01A 1ODDA 4UVBA 3GFLA 1KU7A 5CVVA 2L02A 2V1UA 3EYYA 1U8RA 1Z1DA 2UWMA 3Q5FA 3TDZC 3E3VA 3M8FA 2EV0A 3F8BA 4LG0B 3D5LA 1P4WA 4AIHA 1KU9A 2CFXA 3E5UA 4KN4X 2DAOA 4DNCA 2ZBKA 5ICGA 2L54A 3FF5A 5LHGA 1QPMA 3RYRA 1P6RA 1R22A 5LHHA 3KEOA 2PG4A 3IL2A 2OBPA 3CO6C 4AD9A 4ZZDA 2G7HA 5BPIA 2P7CB 2KIFA 4WCGA 2V1DA 2HEOA 4EM0B 3VEPA 1JGSA 1D8JA 1IXCA 5E1ZB 4M73A 3KP4A 3EYIA 4EM2A 5L3EA 3QAHA 4OIQF 2GIVA 3V7SA 1FLIA 4GCVA 1BIAA 1SMTA 1QZYA 3CUQA 2FQ3A 1LDKB 2GQQA 2R3SA 3FWEA 1SD6A 3SZTA 5FFZA 1J0RA 4JQFA 4EGZA 3HOSA 5ILUA 1FOKA 2KIMA 1XCVA 4MEXF 3T8TA 4I7HA 1EH7A 2HYGD 1IRFA 5DEQA 2W84A 4HYEA 3DP7A 1IUYA 1Q1HA 1OYYA 5L3GA 4OINF 4WXDA 1TLHB 2RN7A 4M72A 2M87A 3JTHA 1XMKA 4PGGA 1B9MA 1V4RA 1K7AA 4OMZA 2NRAC 1GXQA 1IN5A 4D0PA 3I59A 1SD7A 5FB2A 2IT0A 1EH6A 2RQPA 2VE9A 2HZTA 1FSEA 1ZYRF 1HQCA 3P9IA 1OR7A 1FSHA 1XDUA 3ZMSA 3ZMDA 2STTA 1Z05A 2WTEA 3QU3A 3I53A 1F4KA 3CDHA 4LK0F 3O6BB 3P9CA 4IHSA 3BDDA 2HR3A 4UV8A 3GFMA 2XAQA 1OPCA 2GWRA 1MDMB 4DQ2A 4UVCA 4O6JA 1YYVA 5IT9Z 1MD0A 5FD6A 2YX7A 1KYZA 1MGTA 2COMA 1G4DA 2ISYA 3Q9SA 1F5TA 3WTYC 3KP5A 3IRQA 4LG0A 1HW5A 2Z3YA 1G6NA 2QZ8A 2WV0A 3BJ6A 2EB7A 2NNNA 3R60A 2J5OA 1XSXA 2H6CA 2AXLA 4ZYHA 1YTYA 5FO5A 2STWA 3WGIA 3BJAA 2PFBA 2O6GE 5BOXA 5L3BA 3IKTA 1BOAA 3ROUA 4L5JA 2W85A 3T8RA 3VB2A 2MLGA 3E6MA 2IA2A 3VODA 4HZFA 1G3WA 4U0YA 1OMIA 1FX7A 4M6XA 3HSRA 5ILVA 1ONVA 5LRSA 2NNYA 3SFZA 4BHPA 1ZG1A 4O5VA 3WTUC 2R7FA 2V9VA 1CGPA 1DPUA 3I64A 2V79A 1IF1A 2JT1A 2OAZA 2OU2A 4XBFA 4LB5A 3V7CA 1UFMA 1L0OC 1KQ8A 2HTJA 5LHIA 3KLNA 5L3DA 4ESJA 2Z5UA 1WWXA 3V4GA 4LLLA 5JI6A 3K1NA 3J7AO 1FT9A 3LQRA 2DT5A 4PGHA 4L5IA 2ZCWA 3F72A 3GFIA 3GEZA 2NAZA 3ECHA 5F64A 4HF1A 1IRGA 1TQIA 3E6CC 5K1YA 1EH8A 2C6YA 1QGPA 4AIKA 4KT5C 3R0AA 1XGNA 1ZARA 5BPDA 4ASNA 3I58A 4A12A 1O7FA 1YIOA 1ZLKA 1U78A 1JE8A 4OMYA 3I4PA 2E1CA 3CUQC 4EJWA 3FZVA 5HS9A 4BHBA 4XSZF 3RKWA 1F9NA 2RKHA 1PP7U 2QWWA 1YLFA 2RDPA 4L9TA 3ISPA 2E7WA 4IXAA 2ZNZA 1STZA 4GYIA 5ICFA 5J8CA 1MKMA 4IJAA 4KIBA 3I0TA 3IWZA 1ON1A 5HVQC 1HKTA 4HX7A 2PN6A 3S2WA 4UHTA 4I2OA 4Y13A 5LLQA 5DD8A 3WGHA 3K69A 4A0XA 3HYIA 1XGSA 1IN6A 4OIOF 1MDMA 5L3CA 2VT3A 3KEQA 3WG9A 4FX0A 2G7UA 4Q48A 1LQ1A 1R7JA 3PQKA 1XN7A 4HV6A 5EEGA 1B59A 3GUDA 4UVAA 5ILSA 5JVTA 1KA8A 2FNAA 5FD5A 3KCCA 1H0MA 1ZREA 5J6XA 4EV0A 3R0JA 1D8KA 3R4KA 2OA4A 4IVNA 2DO7A 1ZG3A 5DCMB 1U5TA 1IXRC
chains in the Genus database with same CATH superfamily
2Y0SA 2Y69H 3JREA 3OSFA 5ICEA 1HKQA 2EIJH 1WJBA 1IJWC 5E3OA 1P9QC 3RDIA 2E1NA 2R92J 4UXNA 1REPC 4G94A 2VASA 1QVTA 1OYWA 4Y4RA 2M5WA 1QO0D 3G1OA 2L01A 4DZPA 3J7ZI 3U9GA 2VPLA 4QWQA 2MGQA 4JOMA 1ZGJA 5DM7F 5HLGA 3SHFA 4Z6YA 3MAJA 1RKTA 1AOYA 2PMZN 4C30A 2LF8A 3KZIC 3OL3A 2ZXHA 1RR7A 5M5XJ 2H27A 3S1QJ 2BY1A 3OYIA 3CMMA 1R4MB 2VODA 1X1AA 1IGNA 4Z2YA 4AC0A 3M8EA 3CLQA 5B66C 4GXOA 4HF0A 2ZO4A 4MQ9F 5E8GA 4QPQA 2DA3A 5TGTA 1KQ9A 2EA2A 2CO5A 4PDKA 2LY1A 1MSEC 1FYLA 3M7GA 3V7RA 2HVRA 3LSPA 2DMNA 2K7LA 1D0YA 1LEBA 1HW1A 1F36A 4BL0B 1B9NA 3ABLH 1IN8A 4YIIA 1Y1WJ 2CFOA 2R7ZJ 3OOPA 3BG5A 3J7YJ 3H1CA 2HOTA 4XONA 3ZPLA 1IN4A 4LLNA 5E3NA 3LSRA 1YJNI 2HFHA 3DXJF 3K1PA 1BJAA 5CKTA 4HA8A 2K85A 2P4WA 3O3KA 5BQTA 1HBXG 3JRBA 3GZ6A 2F4OB 2O0YA 3ABMH 3A03A 1JKOC 5K7HA 3V8JA 1D1CA 4G7OF 4E7ZA 2XC7A 3GBGA 4Y33A 3W3CA 2JPBA 2F6CA 4MNUA 3K70D 3M8JA 4BDZA 2ZJQF 1S8NA 3BCAA 2A68F 3I54A 3L1PA 4CCNA 5EGOA 3MKYB 4P5OA 2LBFB 1XGMA 2G9WA 1B72B 3H3VK 4IEJA 2M30A 3HSEA 3W6KB 3VOEA 3ZQHA 1A36A 1T98A 4HAMA 1YJWI 1RUNA 3DEUA 1T0FA 4BGDA 3W6VA 1USSA 5JR3A 2KHMA 1KU2A 4XRSG 3ZQFA 4A6DA 4GO1A 4P55A 1PUFB 2E1MB 2LREA 2P81A 5EEHA 2KQRA 2H8RA 2HTSA 2H6BA 4OIPF 3KZYA 1CQTA 4QLCU 4CZZA 2IRFG 2BEOA 2DYSH 1BW6A 2XB5A 1WHUA 1RKWA 3FDYA 1HOMA 4FETA 2OC6A 1VFCA 2PJPA 1TT0A 2RV8A 3CCRI 4GFBA 2DBBA 3ZR8X 1I1SA 3JAMK 2EV5A 1S3JA 4B44A 1FBUA 1R58A 2EJRA 4HDVA 2P5LC 4KDPA 4A3GJ 3DQVC 4IOAF 2VBXA 1NK3P 2NVUB 3WTTC 1J75A 2VKVA 4N4NB 2KDZA 4KMFA 2KDOA 3HZJA 4M3EA 3D0SA 3OV8A 2R5ZA 2DPDA 1V5GA 1S7AA 3I4NJ 1H88C 2IXSA 1R36A 2OCEA 1E2XA 3J81K 3DLLF 4PJNA 2NS0A 2DLLA 4EATA 3I56I 3CCLI 1T56A 3KYCB 1T8IA 1WCMJ 2KRFA 4ESFA 1T6SA 1ETKA 1RZ4A 4DJAA 1YG2A 2FEZA 2VQCA 3MD2A 1W5TA 2JJ7A 1K6YA 4P9FA 3R61A 2H09A 2HWVA 5CVRA 3OYBA 4I09A 4KN7X 3H3ZA 2OTLI 4JX5A 4CCLA 3JSPA 2F2EA 1UB9A 3DU6A 4FE4A 3SYTA 4MHGA 1UHWA 3QOPA 2R7SA 4WF2A 3RKYA 4B47A 3IRRA 4A3EJ 5LGUA 3JRGA 2HDDA 3F8NA 3WTZA 4FT8A 1X2NA 3K6GA 5AIPA 1OQYA 3QP5A 1W7PB 4GGGA 3HGYA 2D45A 3ZCOA 1XB4A 4B8XA 2X0LA 4LG3A 4FTHA 3DWLE 1R00A 4D9JA 5CJ9A 2A07F 4KFCA 3BG3A 3HHGA 1D0ZA 3WGGA 2DMTA 1UZCA 1WH5A 4KYWA 2CH0A 1ON2A 2QQ9A 2BXYA 1R1UA 4HLYA 3NAUA 3CJQB 2EFPA 4IOCF 1HSJA 2IGNA 2QKMB 1X3UA 2DFIA 5D5VB 4B09A 5DCMA 1FY7A 2FBKA 1DU6A 2OPTA 2K86A 4E7HA 2VJ4A 3LAJA 2HNHA 3GF2A 3QWLA 1C0WA 4PJMA 4BU2A 1BOBA 2HXIA 2DMUA 2KJCA 2QCOA 3HOXJ 1PDNC 2A6EF 2XGXA 2XPVA 4HPQA 2K3FA 1VQNI 4PZJA 1YOVB 3WHBA 3IV5A 1GV2A 3K4CA 2QM3A 2X4HA 3EDPA 4CH7A 2EPFA 2CV1A 1R5HA 3AG1H 3BWGA 1VQKI 2FRHA 5LEJA 3HRMA 2GIZA 4IKFA 1K79A 2ZMEB 5GTHC 1HDDC 2L3DA 2CG4A 3W6JB 2DJNA 1HSTA 4G8XA 2LLKA 3WTWC 5FLXK 3I5UA 2PMZA 1UMQA 4LFUA 2FD5A 4E70A 2LRDA 1KONA 2NVTJ 2RQQA 2K9QA 2XPWA 3HEFA 3DFGA 5FLMJ 1FMVA 2I8DA 2EFOA 2IA0A 1LNWA 2IGMA 5F1RA 1IW7F 2XAGA 3KYLA 5E1WA 2JUCA 1W5SA 3GFJA 1TQPA 3N97A 4JX4A 2VKHA 3ZQCA 3TOBA 1MMGA 5DUKA 2HKOA 4P9UA 2F5CA 4OU0A 1NG6A 1XG1A 3FXOA 4Q5SF 2M9HA 2MH2A 2VXZA 3C18A 5JLWA 2K27A 3NQOA 3S3OA 1OISA 1U5TC 2E7XA 3KEYA 3QRFF 4PFOA 4N9HA 3O8HA 3QYEA 2XVCA 2X6WA 3HRTA 1KYWA 3HUGB 1VQPI 1ZGWA 2RAEA 3PL8A 5GAGJ 2DW4A 2LBFA 1CF7B 1B72A 2L9VA 2MH9A 3HKZN 1ZRCA 3TMOA 3CDIA 2LP0A 2ME0A 4BJ5C 4CCJA 1VZ0A 2W25A 4JK1X 5DDGA 4EJVA 5E8IA 4FHTA 3RKQA 5DS9A 1T2KA 3OYKA 2HQAA 2MC4A 1ULYA 2V26A 3E1SA 2EWNA 2UXXA 1PUFA 2A5YB 5B3SH 4CO8A 4BNCA 3M1EA 2L9RA 3CMYA 4XQFA 3C7JA 5GPCA 3DCFA 4I02A 2ESNA 1U9NA 5J8FA 3JRDA 4ZYEA 3D1NI 2ISZA 1B4AA 3HGGA 2PQ8A 2CUJA 3ASNH 3RTRA 1W36D 1F43A 2ETHA 3LNQA 1WJFA 4BHCA 3G1MA 4XM3A 2QVOA 4I76A 4EM1A 1VTNC 1QHHD 5LFAA 4BJTA 4M9SA 3TOAA 5EJCA 2RNGA 3QYFA 4HNTA 1JHFA 1V5EA 5A2QZ 3HOZJ 5E17F 2VONA 2O7OA 5CYVA 3CUOA 2XGCA 3JR9A 2MBFA 4YG2F 4U7BA 1EF4A 4EMSA 4BXUA 2CW7A 3SEZA 4H0EA 3TQNA 3COAC 5HLTA 3JRAA 3ERED 2Y30A 3F22A 4LK1F 3S17J 1V3FA 1BR2A 1BI2A 1BC7C 1SC7A 1ERDA 5BMZA 1MMNA 2IP2A 2EFNA 3BZ6A 2DT6A 4BUPA 1W0UA 2XROA 4MEYF 3QODA 5LGTA 3MFKA 3L2QA 1PJRA 2ZJPF 4NHJA 3S15J 1YJ9I 3VDXA 4GYGA 2A6TA 2FOWA 2LFBA 2WA0A 5L3FA 2X51A 4ABZA 4A3KJ 1LPQA 1KU3A 3G71I 5FRNA 1WI3A 3QPTA 5DTDA 1RNLA 3KPHA 5D6FA 1JGGA 2HDWA 1LJ9A 5IP6A 4XLHA 1T0FC 3RPUD 4B43A 4LLGF 2EILH 4BYYA 4IHWA 1SEUA 3G6EI 2O8KA 3KP2A 5J4YA 5B5EC 1MNMC 1S72I 3GTLJ 3IH3A 4XLNF 4ENMA 2VB6A 1ZH5A 4RB3C 2EBIA 1O7LA 2CQQA 1U9OA 2HKXA 4HBLA 2CYYA 2JA7J 1IDZA 1XSVA 2QQBA 4CDGA 5CVUA 3U1KA 3AL0C 2H8WA 2QF7A 4LJZF 1BI3A 2ELJA 4S05A 1BL0A 3K0LA 5IOYA 4BACA 1Z6RA 4HW0A 3F3XA 3TKYA 2FMLA 1D3YA 1YFHA 1I1GA 1X58A 4AVPA 1LFPA 2FU4A 1R1VA 1YITI 4XRSA 4C3IJ 2B0LA 4RGSA 2HGCA 1VQ7I 3S2HJ 4EGYA 2H1KA 1J2XA 3K2ZA 4G7HF 1WRJA 2HQNA 1LVAA 5AONA 2YR2A 2E35A 3GZNB 2JPCA 5CPRB 4XLAA 1OCZH 1VF9A 2AHQA 4HSRA 2VOPA 3CO7C 4AU7A 1OCTC 3J80K 5F0FA 1P92A 3OYMA 2IAIA 3D5SC 1OYIA 4I0AA 1TW3A 4II3A 3S93A 5BS6A 2R7VA 2ZMEA 1MBHA 2BGCA 2GA2A 3L2RA 1SFEA 4RAZA 4II2A 4J01A 3PUFA 5HDKA 3T0YA 2H1LA 1XPXA 4B4CA 3HJEA 5JHUA 4XLPF 4M6YA 4AIDA 1Q1VA 1UG0A 5FKMA 3EQLF 1IAWA 1K78B 1YO5C 2LSOA 1ZGAA 2GAUA 1WI9A 3RSNA 3ZGKA 4EVIA 1FZPB 2DTZA 3K4BA 2E60A 3WU0A 4XKCA 5IYDJ 4OOIA 1O3QA 1LFUP 2XRLA 2IW5A 4HOBA 3OYEA 5D5XB 4XMYA 3TL4X 3OIQA 4ON0A 1RPWA 4KICA 1OKRA 1SAXA 1I39A 1RETA 2O61A 1Z3XA 3C1DA 1A04A 1V5FA 3HPHA 2E71A 4OIRF 2VJ5A 5LEKA 1GT0C 2LK2A 3E5XA 4XN0A 3PJRA 4LGWA 4G6QA 3HOYJ 2CUZA 3M07A 3S3NA 1I5ZA 1BM9A 3GX4X 2RGVA 2Y31A 4I99C 2F5DA 5ED4A 1ZELA 2BY2A 3F0CA 1FNNA 5D4RA 2A5WA 2VKDA 2P8TA 2Y48A 3PIPF 4L9VA 2GXBA 1TBXA 1ETXA 2X85A 3HUGA 2QBYB 1TZLA 2P7VB 4KNYA 1SMYF 4QTRA 1CF7A 4RAFA 4I0BA 3ZN1A 3I55I 1JUSA 2FE3A 2D5VA 3GTGJ 2DU9A 3FISA 1ZLJA 4DBQA 2BBYA 2COBA 1Y6IA 3DTEA 3F6VA 1J9IA 2QLZA 2BY0A 2LC2A 1Z21A 3HKZA 3I3LA 3GCMA 2X6XA 3BPXA 3TP3A 1QBJA 1IC8A 4XN3A 1OCPA 2JA6J 1OFCX 2MABA 3HTSB 1HW2A 4A93J 1G3TA 2ZKZA 1H9GA 5DCFA 3BR3A 2A61A 1MIJA 2VE8A 1ZQ3P 3OSGA 2VOOA 3KZZA 3ABUA 3BZKA 2QGUA 2VBYA 2CQXA 3R6SA 3ZN0A 2DT7B 2W7NA 4D7MA 1FMWA 2EIMH 2L7ZA 5H20A 2IS6A 3K70C 2LKSA 2K3PA 5IOZA 3B02A 2JA8J 3DU5A 3VSKA 2H94A 1TNSA 4DYRA 1UELB 2JTVA 2P0WA 2DK5A 1GXPA 1J5YA 2X48A 3K10A 2ZFWA 4BH9A 3FX3A 1Z91A 4DYQA 1PUEE 1QZEA 3P9KA 2QA4I 2KIUA 3RPUA 1FBSA 2CSOA 2LF7A 1UJ8A 4ZDOA 4MIMA 5D8KB 1JTXA 5FLVA 1MBKA 4CCOA 5KVRA 2EZIA 3F8CA 1TWGJ 2O5RA 2ELKA 4F55A 3JAMZ 3BROA 3W2WA 1IV6A 2F48A 3E6BA 5F1JA 4KIFA 3OYHA 1E3HA 3MEXA 2DYRH 2L2OA 3HRSA 4CICA 4C3JJ 1UAAA 2K40A 1DP7P 4RM3A 4R8HA 5E20A 3ZMVA 4ZYAA 4LMYA 2DTRA 4NUBA 2DA5A 2P6SA 3UKGA 3CMEI 3BQYA 4IX7A 3E5QA 4IL6C 3J81Z 3NWSA 4XK4A 3ZMUA 3S1RJ 3U1DA 3ZOBA 4A3BJ 2KP6A 2V1XA 2E1MC 4HNUA 4CYDA 3QOEA 2CQKA 5J47A 3BOQA 2DQRA 2Z2SB 4YIFA 1YRNB 2NXNB 3GXOA 1O3SA 2BHZA 2K4JA 3MZ8A 5DUIA 4EQQA 1QNTA 4G12A 4M71A 3L2VA 4HQEA 1J7KA 1X1PA 3PUBA 5HS7A 3O2PE 5EEAA 2ZJ2A 1RI7A 1JI8A 5HLIA 4MQVA 4M3BA 3PSFA 1X4OA 4YIRX 1WQ2A 1OCOH 4RB1A 4IO9F 4BEHB 1YS7A 3DV8A 4HV5A 4OWRB 2NVQJ 3OMYA 2GXAA 2MG4A 3LL7A 2FXAA 4F92B 3WE2A 2CUFA 1GLNA 4PUSA 4ZTFA 1T33A 3MQ0A 1HXDA 2DODA 2LKPA 1XDSA 3CUQB 4CA0A 2OQRA 4C2UA 3V8KA 2ICWG 5IT3A 3K4NA 4XR6A 2JSCA 1GUUA 4R79A 3AAFA 4OAZA 2FOKA 1HCRA 4XLCA 1FWZA 4PFPA 4A3LJ 3KLOA 4R1HA 3FXRA 1RESA 5IP7J 3FMSA 3TO6A 1D5YA 2EZKA 3CMAI 1MMDA 2DA7A 4KUMA 2GLOA 2DOEA 1QVUA 1RRJA 4XKVA 1Y8QB 2OTJI 3MWMA 4CXFA 1E17A 3A1YA 5JLXA 1TTYA 4PCQA 1MBFA 2V6CA 5HDNA 3OIOA 4P96A 4XSXF 3Q0WA 3TGNA 3G3ZA 1W5CC 2W57A 3CTAA 1Y0NA 1IUFA 1BBYA 1XSDA 3FK7A 1R71A 1VQ8I 1K78A 1SVMA 5DM6F 3CP2A 4EJOA 2NOJB 4CHUA 1Y8RB 3ELKA 1I27A 4LB6B 1S7OA 2CS3A 1H8AC 3IH2A 3S14J 2OD5A 3IKVA 3ZMTA 1MJAA 5E3LA 3BLYA 2Q2EA 4HNVA 1T39A 2MC3A 2PMUA 1ORKA 3HRUA 1TW2A 1YS6A 1XMXA 2Y2ZA 4ENNA 4A3IJ 5CLSA 3S1NJ 3B73A 3I9V2 2FJ1A 2FBIA 3CJRB 3CLOA 3FXMA 4KISA 2IJLA 4EJUA 2CWEA 1UCRA 2MLKA 5FGMA 2GXGA 4BJ6C 4WWCA 1PP8F 3KIOA 2FMYA 2LG4A 3I59B 3PNTA 2IGOA 5D5WB 4IRIA 2VJIA 1KZHA 2QBYA 2PMHA 2XASA 3MZYA 4B48A 1G3YA 1YI2I 2J5PA 2XRNA 3S32A 1DUXC 3HBLA 4BE2A 3V8LA 3N05A 2KKOA 4KIGA 3SDGA 3LSTA 2ACJA 3LSIA 4YFXF 2ZMEC 2FF4A 3K4JA 2MW8A 1OCRH 2NS8A 4FASD 1XX5A 4MFEA 2DN0A 3OYDA 1MW7A 3G4SI 1VQ5I 1D1BA 2VT2A 2XDVA 1VQ9I 2M34A 3F6OA 4GRIA 5HS8A 1WZ2A 2HS5A 4HQMA 2HZDA 3CC4I 1LKXA 1QRYA 3CDLA 2Y9YA 4XRFA 2JQ7A 2QYOA 4A2UA 4C2TA 2UV1A 3JRFA 2WADA 2I5UA 1KGSA 4IPAA 5ERIA 3ZXSA 4BQQA 1SD5A 4IZZA 3E97A 3ECOA 1JXSA 1YW7A 4M6VA 2E5NA 4X1EA 2CGPA 4G7ZF 2V9PA 5HNHA 1S29A 3OWTA 1U6GA 2PJRB 4RS8A 3KP3A 4RB2C 3AL0B 4F93B 3GYHX 4L9JA 1LB2A 2BOLA 4KMUX 2PI0A 4A3FJ 1SD4A 4NC6A 3DLAA 2HOSA 3K7AJ 5FFXA 5H2FC 2EA4A 1GHCA 2O3FA 1NTCA 5DV5A 3BG9A 2M3AA 3K4MA 1X1CA 2XAFA 3WTSC 3DF8A 1P7JA 1ZN2A 2RC4A 2V1NA 3GLXA 4Q4ZF 4PJJA 3B6AA 3ZQ7A 4CCMA 3OYAA 1W36C 4ZDLA 4N0BA 5IY5H 3REOA 1R4NB 2WY7Q 4L0YB 4TV7A 2LOOA 1I6XA 2WV1A 4ITVA 3ZQQA 1XGOA 3KETA 2L9SA 3C2GA 3GTOJ 4RLFA 2GOMA 2TRTA 1NH3A 4N9IA 2R7XA 4RAYA 1S9HA 3CCEI 2JSPA 3JRIA 3RIRA 4NQWB 4XOPA 2W4SA 1W1WE 2MA3A 3EETA 4C3HJ 1SANA 4MGRA 2VIXA 3SEQA 3E7LA 2DDAA 1S6LA 4XLFA 5HDGA 3SZGA 1YRNA 2QSFX 3TEDA 2BVMA 5IPAA 1J59A 5EZHA 4BDYA 2O03A 5JVGF 2ID6A 1JT6A 3RJPA 4NC8A 2VQLA 1W7PD 3NRVA 3IWFA 4MLOA 1F1ZA 1U2WA 2M0CA 1YX5A 2GA1A 2P6TA 3T5XA 1MNEA 4JBAA 1I3QJ 5E3MA 1K6OA 1GV5A 4UUVA 1FYMA 1LFBA 2LD5A 1I6HJ 1YW9A 3M9AA 2A6HF 4BEHA 1ACIA 4ZYGA 2ESHA 2F4IA 2VXDA 2OZ6A 5E1XA 1O3RA 4UNOA 3PQJA 1D5VA 2XIGA 1WH7A 3ABTA 2WWYA 2EZLA 3K2AA 3FXLA 2K4BA 4E4HA 3BC8A 2F5EA 4F3QA 2L7MP 3ABKH 1TQMA 3FXUA 3FKJA 3LSJA 4CSWA 4A6EA 5AIQA 4B3AA 4E7JA 1L3LA 3HHHA 5H6QA 3LOCA 4L9NA 3FXKA 3OYJA 1ETVA 1O3TA 4UB6C 2IBDA 2KZGA 2GBYA 2A3SA 2CW0F 4ENJA 3BG6A 3CCQI 3MN2A 1VQOI 2LMDA 1T95A 3I4MJ 3WU2C 3SDBA 5M3FJ 5ICCA 1B6AA 2DQLA 2Y75A 3J80Z 1HLVA 2WC2A 3M3YJ 3FBNB 4WX9A 2M8GX 3KE2A 1S7EA 3AFHA 4YFNF 2YUSA 3FK6A 3LMMA 3HOTA 3LWFA 2VI6A 3JSOA 1MMAA 1WKMA 1X1DA 1I3AA 1DPRA 4FX4A 3RKXA 4U88A 1LDDA 3GMEA 4I98B 4Y15A 1ZHFA 2X6OA 2WAQN 3H9GA 2M1BA 5HNFA 1BC8C 2FSWA 3G2BA 5KHDA 3VYUB 1DDNA 1BIBA 3CQZJ 2K02A 3HDDA 3BR2A 3H5NA 3I71A 5F6FA 1Z77A 3IH4A 2Q0OA 3WTXC 4ENKA 2LYCA 5FJ8J 3QPSA 2FNPA 5GADJ 1K4SA 1FJLA 3V42A 1OCCH 2BW3B 3WE3A 3LFKA 3MKZA 2DI3A 3PO2J 4RB0A 1G8XA 1XCBA 3WHCA 4DIQA 1SVOA 2KL4A 3JRCA 1JUMA 3GTQJ 1A35A 4YRVA 3AG4H 3Q0UA 4AYBN 3LSKA 1Z9CA 3ZP5A 3F8MA 2HU9A 4BBSJ 3GTPJ 4NB5A 1RIOH 3OR1C 4RA2A 3E6DA 3S8PA 4BE1A 3BY6A 3GWZA 3CZ6A 2R5YB 2KMUA 2M7BA 4K2EA 4KITB 2E2HJ 3K1MA 3LA3A 4CUGA 3RI4A 4ESBA 2EV6A 2TDXA 2DFFA 3CP8A 4EJTA 3TW6A 2OUMA 2KJBA 4F7ZA 2QQAA 4L0ZB 3JTGA 2ZFUA 3IC7A 1O4XA 5EF6A 2M8EA 5KK1A 3GZ5A 2LNBA 2W82A 3FIWA 3HSFA 3C2BA 3M1CA 5C3EJ 1K61A 3CJTB 3KFWX 4A5MA 2M45A 2DPUA 4HRIA 1NHAA 1USTA 4U0VA 1U3EM 1AHDP 4WXHA 3GTMJ 4XKWA 2LDUA 3MCZA 4XOTA 2PJRA 1D1AA 1TWFJ 2VL8A 2VN2A 4BXFA 5FKOA 1UG2A 2FBHA 2L9NA 2DMPA 3DBHB 5EZGA 2PBIA 2HOEA 4XKBA 4Q47A 4A0YA 3BTIA 2OF7A 3H36A 3U2RA 2KISA 2E2JJ 2E2IJ 4LD5A 3QU6A 3CJNA 2JUGA 1N77A 3H9QA 5C44J 4L18B 9ANTA 2CW8A 4MO7A 1W7PA 1XD7A 3G73A 3PNVA 2RNJA 1MZBA 2ADUA 2L4MA 3OY9A 2A69F 1WFXA 3BTJA 2P5VA 3OS2A 4G6TB 2UZKA 1RC9A 1QZZA 1MJ9A 4AIJA 3G1LA 2R7UA 3ULQB 3DPLC 1J09A 1IXSB 2AQEA 2GZWA 2DXIA 4HLXA 1U5TB 4UB8C 1R6RA 3MMYB 5GAEJ 4NC7A 3M4OJ 5D5UB 1LDJA 4NQWA 4H4KC 2WAEA 1IV8A 3TP0A 4S04A 4ZYDA 3K4KA 2XV4S 2HVSA 4D5FA 1FP1D 2XKOA 2E1OA 3L09A 4FCYA 4NDLA 2LVSA 3QQAA 4DYCA 2JMWA 3DPUA 2IS4A 3H0GJ 1G3SA 4PJ0C 1BI0A 3GW2A 3LA2A 3MZHA 4HF2A 3SXYA 2XUBA 4JYKA 1XTAA 4IHXA 3N4MA 1EA3A 2ZSHB 5K5QA 4ZZLA 2M2EA 4YELA 1MJBA 4V2GA 3IAS2 1IZ1A 2AXTC 4Y17A 5J40A 2F5FA 4A5NA 2IA1A 5CVIA 2DK8A 1N78A 1AWCA 1YW8A 2D2WA 3KP7A 4A3JJ 2O9LA 2DA1A 4HX8A 2YU3A 3BTLA 1JHHA 2ZNYA 2JK3A 2XHKA 3E0JB 2W48A 2BE5F 3S1MJ 1R5GA 1O57A 3SQNA 5K5RA 3GVAA 2DMQA 3VYSB 1Y0UA 3L00A 3Q9VA 2JA5J 1FOXA 1JKPC 4G9YA 3L9FA 2QKLB 4BAYA 5E18F 1T38A 5C4JJ 3HTUA 1X1BA 5B1BH 5HODA 3VYTB 4IRGA 2JVHA 2OZUA 1V55H 4LOCA 3BCBA 5GPAA 2ZXIA 3F21A 3CD6I 4BS9A 1P4AA 1SFOJ 2KRHA 3L2CA 3OYNA 1IDYA 1BR4A 1Y39A 3O8GA 5FKNA 1MNDA 2KPMA 2HDCA 4RGUA 4HDUA 1W4MA 2EH3A 3EUHA 5C4XJ 1JTYA 4BY1J 3GTJJ 3H3UA 4DZJA 1GVJA 5A2QK 4G6DA 4BKXA 1KQ0A 3MKWB 1FYKA 2XSDC 2WAQA 4UUTA 4O3MA 3FHNA 2VQHA 3LFUA 1VQLI 3HC7A 3FM5A 3QYBA 2DFEA 3BQZA 2QENA 3LSMA 4BQOA 1T08B 1LUJB 3F23A 1SFUA 1Z0XA 5IT9K 2BW3A 5M5YJ 3KYDB 1IO2A 1B1BA 4ETSA 1ENHA 4GDFA 4MTDA 3H5RA 2XB0X 3KP6A 1TNTA 2KFDA 2L4AA 2Z9OA 1Z3YA 4U7DA 4BXXJ 3L7WA 4IF4A 1WVRA 3UNGC 4AYBA 5HLHA 4ZC3A 2R5YA 2DOAA 3BJOA 1R1TA 4IHTA 2HYFA 1ZAOA 2E19A 1ZG5A 4B1RA 2CU7A 4Y7NJ 1JJ8C 4RGXA 3RCOA 4LITA 1SFXA 3L2UA 3TO9A 3W2AA 4E7SA 2M4KA 5DYMA 1UHMA 3F9KA 1POGA 5J1RA 2AS5F 2Z99A 2EFWA 1QPIA 3GO5A 3RYPA 3IUOA 2WAFA 3HB9A 4AWXB 3QPHA 2EK5A 1ETOA 2X9DA 1BW5A 4ZH4F 2KZVA 2VC1A 1EV7A 6PAXA 4W97A 2XAUA 3ASOH 3K9TA 4B3XA 2MD5A 2QUFA 2BY3A 3OS1A 2EZHA 2E36A 1FC3A 2R7DA 3LAPA 3ZMZA 4KA4A 1Z6TA 1AU7A 2ZXJA 2B7EA 3FM3A 3FXQA 3H92A 3HIFA 5D6EA 2K9NA 4RMNA 5LBQA 1HKSA 4M9XA 1RUOA 3CCYA 1Z67A 2Y0MA 1ZRFA 3Q0VA 2OQGA 5J1YA 2K5CA 2O8XA 2JVGA 4JP0A 2JRTA 2CV2A 4M9ZA 2W24A 2Q8KA 1V54H 1E0EA 5D4SA 4RM2A 1QQIA 2V9KA 3ESWB 2CQ7A 3VYRB 2BHYA 2YU9J 3RPQA 1X3ZB 1JJ6C 2RVCA 4WK8F 4QSHA 3T1BA 1AA7A 5TJJA 2K9SA 4HSTA 2XAJA 3PO3J 3HOUJ 4X0GA 1G2HA 3FXJA 3CCMI 4YFKF 1X3WB 3P7NA 2ZSIB 3DPTA 3CCUI 3RZDJ 5H6RA 2EFQA 2HOAA 4A0ZA 2WB1N 1APLC 2PEXA 1ZRDA 2ELHA 3OYLA 4NNJA 2Z33A 3DEWA 5LRRA 2JZYA 4N4OB 4LIUA 3OYFA 3ML6A 2EQRA 3CF2A 3TDUC 3VFZA 1M1EB 3JRHA 1BN5A 1TT5B 5DD4A 3HL2A 1Z7UA 1FBQA 1LEAA 4U0WA 1DU0A 3WU1B 1IN7A 2IVMA 3QP6A 4IRHA 3FHZA 5HOOA 3CESA 5TRDA 3PFIA 2OV7A 2NYXA 2X1EA 4U87A 3SZPA 3HOVJ 1QA6A 2BXZA 3JW4A 1P4XA 3Q3SA 3S3MA 1R23A 3TO7A 1ZTRA 2D1HA 4XLEA 2BV6A 2KLOA 3DEEA 2VBWA 2VBZA 2WY8Q 3LQQA 4YEJA 3NEUA 2YSRA 3BR0A 2PLYA 2XF7A 3A0HC 3H0DA 1MBJA 1YQAA 3NWTA 5GP9A 3L2WA 5K5OA 2IPQX 4HX4A 2MSYA 2RREA 5LGNA 3SFIA 4PSWA 2GM4A 4WXCA 2P5KA 1UHSA 2HPIA 1Y1VJ 2HQRA 1A6QA 5FLXZ 5EG0B 4XIDA 2YX4A 2D1VA 3WTVC 3C3WA 2B63J 3OYGA 4EEFG 4XNFA 2VC0A 1YHQI 3DKWA 1VQ4I 2Z1DA 3DTKA 4L5EA 3H35A 5BNGA 1R9TJ 5JFRA 1EJ9A 4UV9A 3LA7A 2QEXI 4M74A 1P2FA 1I50J 5D8LB 1Z7LA 2KT0A 1S5LC 3BG7A 3F8FA 2UUZA 4CGZA 3WODF 2XKPA 4AM3A 2FX0A 2LY2A 2CV0A 2M7AA 3DBLB 3FMRA 4BQAA 3D5RC 2UXNA 3DKYA 2KRCA 3BPVA 1MH4A 1E3PA 3IHUA 3BP8A 1LE8B 1FTTA 3KX2A 1PYVA 1K83J 2I10A 1WSUA 1BJZA 5CVJA 4MFDA 4RGRA 1U8BA 1QU3A 1ZR4A 2GOXB 2ID3A 2XAHA 3FMQA 3PNYA 4PSXA 1XMAA 4QIWN 2Y9ZA 1H9TA 1FP2A 1SVLA 3RQIA 2FA5A 2K9LA 2YPRA 4CCKA 3HPGA 3MKLA 1FPQA 4D1QA 2BYVE 1BR1A 3CCSI 2HQ5A 1BI1A 4MTEA 4I01A 2IGKA 2IS1A 2F5VA 3JCUC 3LSGA 1ODDA 5M3MJ 4UVBA 3U21A 3BR5A 3GFLA 1KU7A 5CVVA 4IQ4A 1N75A 3CCVI 2L02A 2VUMJ 2M4GA 2XSJC 2V1UA 3EYYA 3PFYA 2NS7A 2R0QC 3VWBA 2R7QA 1U8RA 3A02A 4A3MJ 2L7FP 1Z1DA 3WG7H 5KNLA 2UWMA 4ZTJA 1XC5A 3Q5FA 4UUSB 3CF5F 3CC7I 5J1UA 3HM5A 5EYRA 3TDZC 3E3VA 1VQ6I 3M8FA 2LH9A 1DGWY 2EV0A 2L5QA 2E5ZA 3F8BA 5K7ZA 2JA2A 2NVXJ 4LG0B 2HI3A 3D5LA 1P4WA 4AIHA 1KU9A 2CFXA 3ZQLA 3E5UA 4KN4X 2CRGA 2DAOA 3LSHA 2QSGX 4DNCA 2ZBKA 4ZJZA 5ICGA 3EUHC 2L54A 2OCCH 3FF5A 2E34A 5IYBJ 5LHGA 1QPMA 3RYRA 4DW6A 1P6RA 3BR6A 1R22A 3FKIJ 3OYCA 3ZQIA 5F04A 5LHHA 3KEOA 1TWCJ 2PG4A 3IL2A 2OBPA 3CO6C 4AD9A 4ZZDA 2G7HA 5E79C 5IP9J 5BPIA 2P7CB 2KIFA 2ZC2A 4WCGA 2V1DA 4E7LA 5FRMA 1X2MA 2DA4A 2R7OA 2HEOA 4EM0B 1WJAA 3VEPA 2VJJA 1JGSA 3HXLA 4D5CA 5KAFC 1ZR2A 2QQ8A 1D8JA 1IXCA 5E1ZB 2HXOA 2R93J 4M73A 3PM1A 3KP4A 4BY7J 3OL4A 3EYIA 4EM2A 5L3EA 3QAHA 4OIQF 2GIVA 3V7SA 1FLIA 4GCVA 1BIAA 4RDUA 4DGWB 1SMTA 1P7IA 3NARA 1QZYA 3CUQA 3VPRA 4XRMA 2FQ3A 3X2QH 1BA5A 4E6KG 1LDKB 4E7KA 2GQQA 2R3SA 3BR1A 3FWEA 2WB1A 3UR3C 1TWAJ 3W2VA 1SD6A 2R7WA 3B6CA 3ERMA 3SZTA 1FTZA 2BVLA 2Q1ZB 5FFZA 5CQGA 1J0RA 3BTCA 4JQFA 1NK2P 4EGZA 4XORA 1FOWA 2JRMA 5FKKA 3HOSA 5ILUA 1HC8A 5TISC 1FOKA 2IS2A 2KIMA 1XCVA 4V2FA 4MEXF 3T8TA 1AKHB 4I7HA 1EH7A 3RZOJ 1FIAA 4CZCA 2HYGD 1IRFA 4AUXA 1JKRC 3P5JA 1A31A 5DEQA 2W84A 4HYEA 5F0CA 4BBRJ 4V19K 4HEA2 1WPKA 2MYSA 3DP7A 2JN6A 1IUYA 1Q1HA 1OYYA 1HF0A 5L3GA 4OINF 1XS9A 1ETYA 4BQNA 4WXDA 5EG0A 1TLHB 5CQEA 4X6AJ 2RN7A 4XL9A 5GAHJ 4M72A 1B8IB 2XF6A 1JKQC 4HG2A 2V6EA 2M87A 2XGEA 3JTHA 1XMKA 4PGGA 1B9MA 1JUPA 2VKEA 1V4RA 1K7AA 4OMZA 2NRAC 5IYCJ 4XICA 3BZCA 1GXQA 1IN5A 3CC2I 4D0PA 2OJED 3H5AA 3I59A 3TBIA 1SD7A 5FB2A 2IT0A 1EH6A 1LE8A 2RQPA 2VE9A 2HZTA 3OR2C 1FSEA 1ZYRF 2DCEA 2ECCA 3VSLA 4DBRA 4E7IA 4JX6A 1HQCA 3P9IA 4M3DA 4NBQA 4A3CJ 1OR7A 1FSHA 2ME6A 1R5ID 1XDUA 3ZMSA 2V7FA 2DDBA 1H89C 3ZMDA 4CYCB 2STTA 2JWTA 2TCTA 2CUEA 1Z05A 3BT9A 1TC3C 2WTEA 3QU3A 3I53A 1F4KA 3GLLA 3IP4B 3CDHA 1YX3A 4LK0F 3O6BB 2LTPA 2G0EA 2ZXWH 4A69C 4Y3OA 3P9CA 4IHSA 3BDDA 2HR3A 1RR8C 4KT6A 4UV8A 3GFMA 2IEKA 2V4JC 2XAQA 2CQNA 1IRXA 1OPCA 4IHVA 3PIOF 4C2MJ 2GWRA 1MDMB 1OJLA 4DQ2A 4UVCA 1U0JA 3TW7A 4O6JA 1FIPA 1YYVA 4FE7A 5IT9Z 4W1UA 1MD0A 4M3FA 5J3LA 5FD6A 2K9MA 2X6YA 5J4VA 2YX7A 1KYZA 1MGTA 5F0HA 2COMA 1MBGA 2W1OA 4UUSA 1G4DA 3EUAA 5LD2C 1EKEA 2ISYA 4KJZA 3Q9SA 2VPRA 1F5TA 3WTYC 2XGDA 2EIKH 2EINH 3KP5A 2HPMA 4IQJA 3IRQA 4LG0A 1GDTA 1HW5A 2FQ4A 2Z3YA 1IG7A 1IRZA 1G6NA 2QZ8A 2WV0A 3BJ6A 5M5WJ 1ITYA 4J19A 3AKZA 2EB7A 2QSHX 2NNNA 3R60A 4LIVA 1K4TA 1G59A 3A01B 2Y0SN 3A2KA 2J5OA 1XSXA 2FUG2 2H6CA 2AXLA 4DOZA 4ZYHA 1YTYA 2MD0A 5FO5A 2STWA 3WGIA 3BJAA 2PFBA 2O6GE 4PJLA 5L3BA 3DBRB 5BOXA 3IKTA 1BOAA 3ROUA 4L5JA 4BE0A 4F52A 4RAGA 3MVPA 2W85A 3T8RA 3SJMA 2CJJA 3VB2A 2MLGA 2LKXA 1ETQA 4FISA 3HOWJ 3E6MA 4RBOA 3IAM2 1N25A 2IA2A 3VODA 4HZFA 3DTIA 5KCMA 4I6ZA 1G3WA 1OMIA 1FX7A 4U0YA 2X1CA 4M6XA 3HSRA 5ILVA 1ETWA 1ONVA 1SFKA 4F91B 5LRSA 2NNYA 5F08A 1VQMI 3SFZA 2ZB9A 4BHPA 1ZG1A 1OLTA 4O5VA 3WTUC 2R7FA 5F27A 2N8GA 4ZDPA 2V9VA 2VLAA 1YIJI 2HYJA 1CGPA 4IHYA 1MSFC 3I64A 1DPUA 1ZKGA 1X19A 1PVEA 2V79A 4RLQA 5GTIC 1IF1A 2VQGA 3S2DJ 1WJ5A 2JT1A 5B1AH 5K7FA 2L0KA 3S16J 1A6IA 1LVKA 2OAZA 2DJIA 2OU2A 1ZK8A 4XBFA 4LB5A 3V7CA 3ZRGA 1UFMA 1HDPA 1L0OC 1KQ8A 1FEXA 2HTJA 5LHIA 3KLNA 2B9SA 5L3DA 4ESJA 2Z5UA 2PX9A 1WWXA 3EUKL 3V4GA 4LLLA 5JI6A 4OAYA 1WJEA 3K1NA 1AKHA 3J7AO 1FT9A 5KAIC 3LQRA 2ZJRF 2AQFA 3PSIA 5JHFA 2DT5A 4PGHA 1WJDA 5EGOB 4L5IA 2ZCWA 3A0BC 3F72A 3GFIA 3GEZA 2NAZA 3ECHA 4J00A 5F64A 2Q2EB 1X4PA 2X1DA 4HF1A 5FKLA 1TQIA 1IRGA 2R4GA 3E6CC 2WBMA 2KIQA 4QPOA 1E3OC 3CCJI 5K1YA 1EH8A 2F4MB 2C6YA 1QGPA 2BZTA 3OS0A 1B8IA 3AG2H 4AIKA 4AVZA 1JT0A 4KT5C 3R0AA 2LR8A 1XGNA 1ZARA 5BPDA 4ASNA 3I58A 4A12A 2CMPA 1O7FA 1YIOA 1ZLKA 1SAUA 1U78A 1JE8A 4OMYA 4D7NA 3I4PA 2W00A 2E1CA 2YS9A 3CUQC 2M0MA 4EJWA 3FZVA 5HS9A 4BHBA 4XSZF 3J7AY 1D0XA 3RKWA 1DQUA 1F9NA 3AG3H 2DA6A 4Y52J 1A5JA 2RKHA 4PK4A 4FQGA 1PP7U 2QWWA 2L7KA 1YE9A 1YLFA 2RDPA 4L9TA 3ISPA 1FOYA 3QPLA 2Z16A 1Y56A 2E7WA 2MFZA 2ZNZA 1STZA 4GYIA 4IXAA 3OIPA 5ICFA 2R7TA 2LY9A 5J8CA 1W0TA 4A3DJ 2A05A 4CYCA 1MKMA 3H9JA 3ONQA 2DFHA 3RQ4A 2R5ZB 4IJAA 4KIBA 1TP4A 3I0TA 3IWZA 1ON1A 5HVQC 1VI0A 1HKTA 5EDNA 3EPZA 4HX7A 2PN6A 1WJCA 1TL8A 3S2WA 4UHTA 4I2OA 4P1WA 4Y13A 5LLQA 2DOFA 1MH3A 2ECBA 5DD8A 3WGHA 1GVDA 1HA8A 3K69A 2HVQA 2NOGA 3HYIA 4A0XA 2XF5A 1XGSA 1IN6A 4OIOF 1NG7A 1MDMA 5L3CA 1MBEA 2VT3A 3KEQA 4M3GA 3DKXA 3WG9A 4FX0A 2G7UA 1QHGA 3K4LA 4Q48A 1DGRM 1LQ1A 1R7JA 3OOUA 3C2HA 3PQKA 2R7RA 1DP3A 1XN7A 4HV6A 5EEGA 3HG9A 1VNDA 1B59A 3FBIB 2XPUA 3GUDA 4UVAA 5ILSA 5JVTA 1KA8A 2FNAA 5FD5A 3KCCA 1H0MA 4C9YA 1ZREA 4UY8I 5J6XA 4EV0A 3R0JA 1D8KA 3A4CA 1WGXA 2AO9A 3R4KA 1R49A 2OA4A 2DA2A 4IVNA 1MMSA 3GTKJ 5FROA 2DO7A 3A01A 2NVYJ 4ANJA 1TWHJ 1OR7C 1ZG3A 3ZQGA 5DCMB 1U5TA 1IXRC 4S0HB
chains in the Genus database with same CATH topology
5ICEA 1HKQA 3RDIA 2E1NA 4UXNA 1REPC 4G94A 1OYWA 2M5WA 1QO0D 2L01A 3U9GA 4QWQA 1ZGJA 5HLGA 3SHFA 3MAJA 1AOYA 2LF8A 2H27A 2VODA 4Z2YA 3M8EA 4GXOA 4HF0A 2ZO4A 4MQ9F 5E8GA 1KQ9A 2EA2A 2CO5A 4PDKA 1FYLA 3M7GA 3V7RA 2K7LA 1LEBA 1HW1A 1B9NA 1IN8A 4YIIA 3OOPA 3ZPLA 1IN4A 4LLNA 2HFHA 3DXJF 3K1PA 1BJAA 4HA8A 2P4WA 3O3KA 5BQTA 1HBXG 3GZ6A 2O0YA 3V8JA 4G7OF 2JPBA 4MNUA 1S8NA 2A68F 3I54A 4P5OA 1XGMA 2G9WA 2M30A 3HSEA 3W6KB 3VOEA 1T98A 4HAMA 1RUNA 3DEUA 1T0FA 1USSA 5JR3A 1KU2A 4A6DA 4GO1A 4P55A 5EEHA 2HTSA 2H6BA 4OIPF 3KZYA 4QLCU 4CZZA 2IRFG 2BEOA 2PJPA 2RV8A 2DBBA 1I1SA 3JAMK 2EV5A 1S3JA 4HDVA 1FBUA 1R58A 2EJRA 2P5LC 4KDPA 3DQVC 2VBXA 3WTTC 1J75A 4KMFA 3D0SA 3OV8A 2DPDA 1S7AA 1R36A 1E2XA 3J81K 2NS0A 2DLLA 2KRFA 4ESFA 1T6SA 1RZ4A 1YG2A 2FEZA 1W5TA 4P9FA 3R61A 2H09A 2HWVA 5CVRA 4I09A 4KN7X 3H3ZA 3JSPA 2F2EA 1UB9A 4MHGA 1UHWA 3QOPA 3IRRA 4WF2A 3RKYA 5LGUA 3F8NA 3WTZA 4FT8A 5AIPA 3QP5A 1W7PB 4GGGA 2D45A 1XB4A 4B8XA 2X0LA 1R00A 5CJ9A 2A07F 4KFCA 3HHGA 3WGGA 4KYWA 1ON2A 2QQ9A 1R1UA 4HLYA 2EFPA 1HSJA 1X3UA 2DFIA 5D5VB 4B09A 5DCMA 1FY7A 2FBKA 2K86A 3LAJA 3GF2A 1C0WA 2KJCA 1PDNC 2A6EF 2XGXA 4PZJA 2QM3A 2X4HA 3EDPA 1R5HA 3BWGA 2FRHA 5LEJA 3HRMA 1K79A 2ZMEB 2L3DA 2CG4A 3W6JB 4G8XA 1HSTA 3WTWC 5FLXK 3I5UA 4LFUA 4E70A 3DFGA 2EFOA 2IA0A 1LNWA 5F1RA 1IW7F 2XAGA 5E1WA 1W5SA 3GFJA 1TQPA 3N97A 3TOBA 5DUKA 4P9UA 2HKOA 2F5CA 4OU0A 4Q5SF 2MH2A 2VXZA 3C18A 2K27A 3NQOA 1U5TC 2E7XA 3QRFF 4N9HA 2XVCA 3HRTA 1KYWA 1CF7B 2DW4A 2MH9A 1ZRCA 2W25A 4JK1X 5DDGA 4EJVA 5E8IA 4FHTA 1T2KA 1ULYA 2EWNA 2UXXA 2A5YB 4BNCA 4CO8A 3M1EA 3C7JA 4I02A 2ESNA 5J8FA 4ZYEA 2ISZA 1B4AA 2PQ8A 3RTRA 2ETHA 4BHCA 2QVOA 4EM1A 1VTNC 4M9SA 3TOAA 1JHFA 5A2QZ 5E17F 2VONA 5CYVA 3CUOA 2MBFA 4YG2F 4U7BA 4EMSA 4BXUA 4H0EA 3TQNA 3COAC 3ERED 3F22A 4LK1F 1V3FA 1BI2A 1BC7C 5BMZA 2IP2A 2EFNA 3BZ6A 2XROA 4MEYF 5LGTA 3MFKA 4NHJA 4GYGA 5L3FA 1KU3A 3QPTA 1RNLA 5D6FA 1LJ9A 4LLGF 4BYYA 3KP2A 4XLNF 4ENMA 1ZH5A 4RB3C 1O7LA 2HKXA 4HBLA 2CYYA 1XSVA 2QQBA 4CDGA 5CVUA 4LJZF 1BI3A 4S05A 3K0LA 1Z6RA 4HW0A 3F3XA 3TKYA 2FMLA 1D3YA 1YFHA 1I1GA 4AVPA 2FU4A 1R1VA 2B0LA 4RGSA 2HGCA 4EGYA 1J2XA 3K2ZA 4G7HF 1WRJA 2HQNA 1LVAA 5AONA 2YR2A 2JPCA 2VOPA 3CO7C 3J80K 1P92A 1OYIA 4I0AA 1TW3A 5BS6A 2ZMEA 2BGCA 2GA2A 1SFEA 4RAZA 5HDKA 3T0YA 5JHUA 4XLPF 4M6YA 3EQLF 1IAWA 1K78B 1YO5C 2LSOA 1ZGAA 2GAUA 1WI9A 4EVIA 1FZPB 3WU0A 4OOIA 1O3QA 4HOBA 2IW5A 5D5XB 4ON0A 4KICA 1OKRA 1SAXA 2O61A 3C1DA 1A04A 4OIRF 5LEKA 3E5XA 4LGWA 4G6QA 1I5ZA 1BM9A 3GX4X 2RGVA 2F5DA 5ED4A 1FNNA 5D4RA 2P8TA 2Y48A 2GXBA 4L9VA 1TBXA 3HUGA 2QBYB 4KNYA 2P7VB 1SMYF 1CF7A 4I0BA 3ZN1A 2FE3A 2DU9A 1ZLJA 2BBYA 3F6VA 1J9IA 2QLZA 1QBJA 3BPXA 3HTSB 1HW2A 1G3TA 2ZKZA 1H9GA 5DCFA 2A61A 2VE8A 2VOOA 3KZZA 3ABUA 2VBYA 3R6SA 3ZN0A 5H20A 3B02A 2H94A 1TNSA 2JTVA 2DK5A 1GXPA 1J5YA 2ZFWA 4BH9A 3FX3A 1Z91A 1PUEE 3P9KA 2KIUA 3RPUA 1FBSA 2CSOA 2LF7A 5D8KB 5KVRA 3F8CA 3JAMZ 3BROA 3E6BA 4KIFA 3MEXA 4CICA 3HRSA 1DP7P 4R8HA 5E20A 3ZMVA 4LMYA 2DTRA 2P6SA 3E5QA 3J81Z 3ZMUA 3U1DA 2V1XA 4CYDA 2CQKA 3BOQA 2DQRA 4YIFA 3GXOA 1O3SA 2K4JA 5DUIA 4EQQA 1QNTA 4M71A 4HQEA 1J7KA 5HS7A 3O2PE 2ZJ2A 1RI7A 5HLIA 4MQVA 1WQ2A 4RB1A 1YS7A 3DV8A 4HV5A 2FXAA 3WE2A 3MQ0A 1HXDA 2LKPA 3CUQB 1XDSA 2OQRA 3V8KA 5IT3A 2JSCA 4R79A 3AAFA 2FOKA 1FWZA 3KLOA 4R1HA 3FXRA 3FMSA 3TO6A 4KUMA 3MWMA 4CXFA 1E17A 1TTYA 4PCQA 2V6CA 5HDNA 4P96A 4XSXF 3TGNA 3G3ZA 2W57A 3CTAA 1BBYA 1XSDA 1K78A 4EJOA 4CHUA 3ELKA 4LB6B 1I27A 1S7OA 2OD5A 3IKVA 3ZMTA 1MJAA 2Q2EA 1T39A 2MC3A 2PMUA 3HRUA 1TW2A 1YS6A 4ENNA 5CLSA 3B73A 2FBIA 3CLOA 2IJLA 4EJUA 2CWEA 1UCRA 2MLKA 5FGMA 2GXGA 4WWCA 1PP8F 2FMYA 3I59B 5D5WB 4IRIA 2QBYA 2PMHA 2XASA 3MZYA 1G3YA 2J5PA 2XRNA 1DUXC 3V8LA 2KKOA 4KIGA 3LSTA 2ACJA 4YFXF 2FF4A 2VT2A 3F6OA 5HS8A 2HS5A 4HQMA 4XRFA 2QYOA 4A2UA 1KGSA 4IPAA 5ERIA 1SD5A 3E97A 3ECOA 1JXSA 1YW7A 2CGPA 4G7ZF 1S29A 1U6GA 4RS8A 3KP3A 4RB2C 3GYHX 4L9JA 1LB2A 4KMUX 2PI0A 1SD4A 5FFXA 2EA4A 1GHCA 2O3FA 5DV5A 3WTSC 2XAFA 3DF8A 1ZN2A 2RC4A 4Q4ZF 3GLXA 3ZQ7A 4N0BA 3REOA 4L0YB 4TV7A 1I6XA 1XGOA 3KETA 4N9IA 4RAYA 3RIRA 2MA3A 3EETA 4MGRA 1S6LA 5HDGA 1J59A 2O03A 3RJPA 1W7PD 3NRVA 3IWFA 1F1ZA 1U2WA 2GA1A 2P6TA 3T5XA 4JBAA 1K6OA 4UUVA 1FYMA 1YW9A 3M9AA 2A6HF 4ZYGA 2ESHA 2OZ6A 5E1XA 1O3RA 4UNOA 3PQJA 1D5VA 2XIGA 3ABTA 2WWYA 2K4BA 2F5EA 1TQMA 3FXUA 4A6EA 5AIQA 1L3LA 3HHHA 5H6QA 4L9NA 1O3TA 2A3SA 2CW0F 4ENJA 5ICCA 1B6AA 2DQLA 2Y75A 3J80Z 2WC2A 4WX9A 3KE2A 4YFNF 3HOTA 3LWFA 3JSOA 1WKMA 1DPRA 4FX4A 3RKXA 4U88A 1LDDA 4I98B 4Y15A 1ZHFA 2M1BA 1BC8C 2FSWA 1DDNA 1BIBA 2K02A 5F6FA 3I71A 2Q0OA 3WTXC 4ENKA 2FNPA 3WE3A 3LFKA 2DI3A 4RB0A 1XCBA 1Z9CA 3ZP5A 3F8MA 4NB5A 1RIOH 3E6DA 3BY6A 3GWZA 4K2EA 3K1MA 3LA3A 3RI4A 4ESBA 2EV6A 2TDXA 4EJTA 2KJBA 4F7ZA 2QQAA 4L0ZB 3JTGA 3IC7A 2M8EA 5KK1A 3GZ5A 2LNBA 3HSFA 3KFWX 4A5MA 2M45A 2DPUA 1NHAA 1USTA 4U0VA 1U3EM 4WXHA 2LDUA 3MCZA 2VN2A 2FBHA 2PBIA 2HOEA 4A0YA 4Q47A 3U2RA 4LD5A 3QU6A 3CJNA 4L18B 1W7PA 1XD7A 3G73A 2RNJA 1MZBA 2ADUA 2L4MA 2A69F 2P5VA 2UZKA 1QZZA 1MJ9A 4AIJA 3ULQB 3DPLC 1IXSB 2GZWA 4HLXA 1U5TB 5D5UB 1LDJA 4NQWA 4S04A 4ZYDA 2XV4S 1FP1D 2XKOA 3L09A 1G3SA 1BI0A 3GW2A 3LA2A 3MZHA 4HF2A 3SXYA 2XUBA 3N4MA 5K5QA 4ZZLA 1MJBA 4Y17A 1IZ1A 4A5NA 2F5FA 2IA1A 5CVIA 2DK8A 1AWCA 1YW8A 2D2WA 3KP7A 4HX8A 2YU3A 1JHHA 2ZNYA 2XHKA 2BE5F 1R5GA 1O57A 3SQNA 5K5RA 3GVAA 1Y0UA 3L00A 3Q9VA 4G9YA 3L9FA 4BAYA 5E18F 1T38A 3HTUA 4IRGA 2OZUA 3F21A 1P4AA 3L2CA 2HDCA 4RGUA 4HDUA 1W4MA 3EUHA 3H3UA 1GVJA 5A2QK 4G6DA 1KQ0A 1FYKA 4O3MA 3FM5A 2QENA 1SFUA 3F23A 5IT9K 1B1BA 4ETSA 4MTDA 3KP6A 1TNTA 2L4AA 2Z9OA 4U7DA 3L7WA 4IF4A 5HLHA 3BJOA 1R1TA 4IHTA 2HYFA 1ZAOA 1ZG5A 4RGXA 1SFXA 3TO9A 5DYMA 1UHMA 2AS5F 2Z99A 2EFWA 3GO5A 3RYPA 4AWXB 3QPHA 2EK5A 4ZH4F 2VC1A 1EV7A 6PAXA 3K9TA 2MD5A 2QUFA 1FC3A 2R7DA 3LAPA 3ZMZA 4KA4A 1Z6TA 2ZXJA 3FM3A 3H92A 3FXQA 3HIFA 5D6EA 5LBQA 1HKSA 4M9XA 1RUOA 2Y0MA 1ZRFA 2OQGA 2O8XA 2JRTA 4M9ZA 2W24A 2Q8KA 5D4SA 1QQIA 3RPQA 2RVCA 4WK8F 3T1BA 5TJJA 2XAJA 4YFKF 3P7NA 3DPTA 5H6RA 2EFQA 4A0ZA 2PEXA 1ZRDA 2ELHA 2Z33A 5LRRA 2JZYA 3ML6A 3TDUC 3VFZA 1BN5A 5DD4A 1Z7UA 1FBQA 1LEAA 4U0WA 3WU1B 1IN7A 2IVMA 3QP6A 4IRHA 3FHZA 5HOOA 5TRDA 3PFIA 2NYXA 3SZPA 3JW4A 1P4XA 1R23A 3TO7A 2D1HA 2BV6A 2VBWA 2VBZA 3LQQA 3NEUA 2YSRA 2PLYA 1YQAA 5K5OA 2IPQX 4HX4A 5LGNA 4WXCA 2P5KA 2HQRA 5FLXZ 2YX4A 2D1VA 3WTVC 3C3WA 2VC0A 3DKWA 5JFRA 4UV9A 3LA7A 4M74A 1P2FA 5D8LB 3F8FA 4CGZA 3WODF 2XKPA 3FMRA 4BQAA 2UXNA 3BPVA 3IHUA 3BP8A 1WSUA 5CVJA 4RGRA 3FMQA 2XAHA 1XMAA 1H9TA 1FP2A 2FA5A 2YPRA 1FPQA 2BYVE 1BI1A 4MTEA 4I01A 1ODDA 4UVBA 3GFLA 1KU7A 5CVVA 2L02A 2V1UA 3EYYA 1U8RA 1Z1DA 2UWMA 3Q5FA 3TDZC 3E3VA 3M8FA 2EV0A 3F8BA 4LG0B 3D5LA 1P4WA 4AIHA 1KU9A 2CFXA 3E5UA 4KN4X 2DAOA 4DNCA 2ZBKA 5ICGA 2L54A 3FF5A 5LHGA 1QPMA 3RYRA 1P6RA 1R22A 5LHHA 3KEOA 2PG4A 3IL2A 2OBPA 3CO6C 4AD9A 4ZZDA 2G7HA 5BPIA 2P7CB 2KIFA 4WCGA 2V1DA 2HEOA 4EM0B 3VEPA 1JGSA 1D8JA 1IXCA 5E1ZB 4M73A 3KP4A 3EYIA 4EM2A 5L3EA 3QAHA 4OIQF 2GIVA 3V7SA 1FLIA 4GCVA 1BIAA 1SMTA 1QZYA 3CUQA 2FQ3A 1LDKB 2GQQA 2R3SA 3FWEA 1SD6A 3SZTA 5FFZA 1J0RA 4JQFA 4EGZA 3HOSA 5ILUA 1FOKA 2KIMA 1XCVA 4MEXF 3T8TA 4I7HA 1EH7A 2HYGD 1IRFA 5DEQA 2W84A 4HYEA 3DP7A 1IUYA 1Q1HA 1OYYA 5L3GA 4OINF 4WXDA 1TLHB 2RN7A 4M72A 2M87A 3JTHA 1XMKA 4PGGA 1B9MA 1V4RA 1K7AA 4OMZA 2NRAC 1GXQA 1IN5A 4D0PA 3I59A 1SD7A 5FB2A 2IT0A 1EH6A 2RQPA 2VE9A 2HZTA 1FSEA 1ZYRF 1HQCA 3P9IA 1OR7A 1FSHA 1XDUA 3ZMSA 3ZMDA 2STTA 1Z05A 2WTEA 3QU3A 3I53A 1F4KA 3CDHA 4LK0F 3O6BB 3P9CA 4IHSA 3BDDA 2HR3A 4UV8A 3GFMA 2XAQA 1OPCA 2GWRA 1MDMB 4DQ2A 4UVCA 4O6JA 1YYVA 5IT9Z 1MD0A 5FD6A 2YX7A 1KYZA 1MGTA 2COMA 1G4DA 2ISYA 3Q9SA 1F5TA 3WTYC 3KP5A 3IRQA 4LG0A 1HW5A 2Z3YA 1G6NA 2QZ8A 2WV0A 3BJ6A 2EB7A 2NNNA 3R60A 2J5OA 1XSXA 2H6CA 2AXLA 4ZYHA 1YTYA 5FO5A 2STWA 3WGIA 3BJAA 2PFBA 2O6GE 5BOXA 5L3BA 3IKTA 1BOAA 3ROUA 4L5JA 2W85A 3T8RA 3VB2A 2MLGA 3E6MA 2IA2A 3VODA 4HZFA 1G3WA 4U0YA 1OMIA 1FX7A 4M6XA 3HSRA 5ILVA 1ONVA 5LRSA 2NNYA 3SFZA 4BHPA 1ZG1A 4O5VA 3WTUC 2R7FA 2V9VA 1CGPA 1DPUA 3I64A 2V79A 1IF1A 2JT1A 2OAZA 2OU2A 4XBFA 4LB5A 3V7CA 1UFMA 1L0OC 1KQ8A 2HTJA 5LHIA 3KLNA 5L3DA 4ESJA 2Z5UA 1WWXA 3V4GA 4LLLA 5JI6A 3K1NA 3J7AO 1FT9A 3LQRA 2DT5A 4PGHA 4L5IA 2ZCWA 3F72A 3GFIA 3GEZA 2NAZA 3ECHA 5F64A 4HF1A 1IRGA 1TQIA 3E6CC 5K1YA 1EH8A 2C6YA 1QGPA 4AIKA 4KT5C 3R0AA 1XGNA 1ZARA 5BPDA 4ASNA 3I58A 4A12A 1O7FA 1YIOA 1ZLKA 1U78A 1JE8A 4OMYA 3I4PA 2E1CA 3CUQC 4EJWA 3FZVA 5HS9A 4BHBA 4XSZF 3RKWA 1F9NA 2RKHA 1PP7U 2QWWA 1YLFA 2RDPA 4L9TA 3ISPA 2E7WA 4IXAA 2ZNZA 1STZA 4GYIA 5ICFA 5J8CA 1MKMA 4IJAA 4KIBA 3I0TA 3IWZA 1ON1A 5HVQC 1HKTA 4HX7A 2PN6A 3S2WA 4UHTA 4I2OA 4Y13A 5LLQA 5DD8A 3WGHA 3K69A 4A0XA 3HYIA 1XGSA 1IN6A 4OIOF 1MDMA 5L3CA 2VT3A 3KEQA 3WG9A 4FX0A 2G7UA 4Q48A 1LQ1A 1R7JA 3PQKA 1XN7A 4HV6A 5EEGA 1B59A 3GUDA 4UVAA 5ILSA 5JVTA 1KA8A 2FNAA 5FD5A 3KCCA 1H0MA 1ZREA 5J6XA 4EV0A 3R0JA 1D8KA 3R4KA 2OA4A 4IVNA 2DO7A 1ZG3A 5DCMB 1U5TA 1IXRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ICE A;  1HKQ A;  3RDI A;  2E1N A;  4UXN A;  1REP C;  4G94 A;  1OYW A;  2M5W A;  1QO0 D;  2L01 A;  3U9G A;  4QWQ A;  1ZGJ A;  5HLG A;  3SHF A;  3MAJ A;  1AOY A;  2LF8 A;  2H27 A;  2VOD A;  4Z2Y A;  3M8E A;  4GXO A;  4HF0 A;  2ZO4 A;  4MQ9 F;  5E8G A;  1KQ9 A;  2EA2 A;  2CO5 A;  4PDK A;  1FYL A;  3M7G A;  3V7R A;  2K7L A;  1LEB A;  1HW1 A;  1B9N A;  1IN8 A;  4YII A;  3OOP A;  3ZPL A;  1IN4 A;  4LLN A;  2HFH A;  3DXJ F;  3K1P A;  1BJA A;  4HA8 A;  2P4W A;  3O3K A;  5BQT A;  1HBX G;  3GZ6 A;  2O0Y A;  3V8J A;  4G7O F;  2JPB A;  4MNU A;  1S8N A;  2A68 F;  3I54 A;  4P5O A;  1XGM A;  2G9W A;  2M30 A;  3HSE A;  3W6K B;  3VOE A;  1T98 A;  4HAM A;  1RUN A;  3DEU A;  1T0F A;  1USS A;  5JR3 A;  1KU2 A;  4A6D A;  4GO1 A;  4P55 A;  5EEH A;  2HTS A;  2H6B A;  4OIP F;  3KZY A;  4QLC U;  4CZZ A;  2IRF G;  2BEO A;  2PJP A;  2RV8 A;  2DBB A;  1I1S A;  3JAM K;  2EV5 A;  1S3J A;  4HDV A;  1FBU A;  1R58 A;  2EJR A;  2P5L C;  4KDP A;  3DQV C;  2VBX A;  3WTT C;  1J75 A;  4KMF A;  3D0S A;  3OV8 A;  2DPD A;  1S7A A;  1R36 A;  1E2X A;  3J81 K;  2NS0 A;  2DLL A;  2KRF A;  4ESF A;  1T6S A;  1RZ4 A;  1YG2 A;  2FEZ A;  1W5T A;  4P9F A;  3R61 A;  2H09 A;  2HWV A;  5CVR A;  4I09 A;  4KN7 X;  3H3Z A;  3JSP A;  2F2E A;  1UB9 A;  4MHG A;  1UHW A;  3QOP A;  3IRR A;  4WF2 A;  3RKY A;  5LGU A;  3F8N A;  3WTZ A;  4FT8 A;  5AIP A;  3QP5 A;  1W7P B;  4GGG A;  2D45 A;  1XB4 A;  4B8X A;  2X0L A;  1R00 A;  5CJ9 A;  2A07 F;  4KFC A;  3HHG A;  3WGG A;  4KYW A;  1ON2 A;  2QQ9 A;  1R1U A;  4HLY A;  2EFP A;  1HSJ A;  1X3U A;  2DFI A;  5D5V B;  4B09 A;  5DCM A;  1FY7 A;  2FBK A;  2K86 A;  3LAJ A;  3GF2 A;  1C0W A;  2KJC A;  1PDN C;  2A6E F;  2XGX A;  4PZJ A;  2QM3 A;  2X4H A;  3EDP A;  1R5H A;  3BWG A;  2FRH A;  5LEJ A;  3HRM A;  1K79 A;  2ZME B;  2L3D A;  2CG4 A;  3W6J B;  4G8X A;  1HST A;  3WTW C;  5FLX K;  3I5U A;  4LFU A;  4E70 A;  3DFG A;  2EFO A;  2IA0 A;  1LNW A;  5F1R A;  1IW7 F;  2XAG A;  5E1W A;  1W5S A;  3GFJ A;  1TQP A;  3N97 A;  3TOB A;  5DUK A;  4P9U A;  2HKO A;  2F5C A;  4OU0 A;  4Q5S F;  2MH2 A;  2VXZ A;  3C18 A;  2K27 A;  3NQO A;  1U5T C;  2E7X A;  3QRF F;  4N9H A;  2XVC A;  3HRT A;  1KYW A;  1CF7 B;  2DW4 A;  2MH9 A;  1ZRC A;  2W25 A;  4JK1 X;  5DDG A;  4EJV A;  5E8I A;  4FHT A;  1T2K A;  1ULY A;  2EWN A;  2UXX A;  2A5Y B;  4BNC A;  4CO8 A;  3M1E A;  3C7J A;  4I02 A;  2ESN A;  5J8F A;  4ZYE A;  2ISZ A;  1B4A A;  2PQ8 A;  3RTR A;  2ETH A;  4BHC A;  2QVO A;  4EM1 A;  1VTN C;  4M9S A;  3TOA A;  1JHF A;  5A2Q Z;  5E17 F;  2VON A;  5CYV A;  3CUO A;  2MBF A;  4YG2 F;  4U7B A;  4EMS A;  4BXU A;  4H0E A;  3TQN A;  3COA C;  3ERE D;  3F22 A;  4LK1 F;  1V3F A;  1BI2 A;  1BC7 C;  5BMZ A;  2IP2 A;  2EFN A;  3BZ6 A;  2XRO A;  4MEY F;  5LGT A;  3MFK A;  4NHJ A;  4GYG A;  5L3F A;  1KU3 A;  3QPT A;  1RNL A;  5D6F A;  1LJ9 A;  4LLG F;  4BYY A;  3KP2 A;  4XLN F;  4ENM A;  1ZH5 A;  4RB3 C;  1O7L A;  2HKX A;  4HBL A;  2CYY A;  1XSV A;  2QQB A;  4CDG A;  5CVU A;  4LJZ F;  1BI3 A;  4S05 A;  3K0L A;  1Z6R A;  4HW0 A;  3F3X A;  3TKY A;  2FML A;  1D3Y A;  1YFH A;  1I1G A;  4AVP A;  2FU4 A;  1R1V A;  2B0L A;  4RGS A;  2HGC A;  4EGY A;  1J2X A;  3K2Z A;  4G7H F;  1WRJ A;  2HQN A;  1LVA A;  5AON A;  2YR2 A;  2JPC A;  2VOP A;  3CO7 C;  3J80 K;  1P92 A;  1OYI A;  4I0A A;  1TW3 A;  5BS6 A;  2ZME A;  2BGC A;  2GA2 A;  1SFE A;  4RAZ A;  5HDK A;  3T0Y A;  5JHU A;  4XLP F;  4M6Y A;  3EQL F;  1IAW A;  1K78 B;  1YO5 C;  2LSO A;  1ZGA A;  2GAU A;  1WI9 A;  4EVI A;  1FZP B;  3WU0 A;  4OOI A;  1O3Q A;  4HOB A;  2IW5 A;  5D5X B;  4ON0 A;  4KIC A;  1OKR A;  1SAX A;  2O61 A;  3C1D A;  1A04 A;  4OIR F;  5LEK A;  3E5X A;  4LGW A;  4G6Q A;  1I5Z A;  1BM9 A;  3GX4 X;  2RGV A;  2F5D A;  5ED4 A;  1FNN A;  5D4R A;  2P8T A;  2Y48 A;  2GXB A;  4L9V A;  1TBX A;  3HUG A;  2QBY B;  4KNY A;  2P7V B;  1SMY F;  1CF7 A;  4I0B A;  3ZN1 A;  2FE3 A;  2DU9 A;  1ZLJ A;  2BBY A;  3F6V A;  1J9I A;  2QLZ A;  1QBJ A;  3BPX A;  3HTS B;  1HW2 A;  1G3T A;  2ZKZ A;  1H9G A;  5DCF A;  2A61 A;  2VE8 A;  2VOO A;  3KZZ A;  3ABU A;  2VBY A;  3R6S A;  3ZN0 A;  5H20 A;  3B02 A;  2H94 A;  1TNS A;  2JTV A;  2DK5 A;  1GXP A;  1J5Y A;  2ZFW A;  4BH9 A;  3FX3 A;  1Z91 A;  1PUE E;  3P9K A;  2KIU A;  3RPU A;  1FBS A;  2CSO A;  2LF7 A;  5D8K B;  5KVR A;  3F8C A;  3JAM Z;  3BRO A;  3E6B A;  4KIF A;  3MEX A;  4CIC A;  3HRS A;  1DP7 P;  4R8H A;  5E20 A;  3ZMV A;  4LMY A;  2DTR A;  2P6S A;  3E5Q A;  3J81 Z;  3ZMU A;  3U1D A;  2V1X A;  4CYD A;  2CQK A;  3BOQ A;  2DQR A;  4YIF A;  3GXO A;  1O3S A;  2K4J A;  5DUI A;  4EQQ A;  1QNT A;  4M71 A;  4HQE A;  1J7K A;  5HS7 A;  3O2P E;  2ZJ2 A;  1RI7 A;  5HLI A;  4MQV A;  1WQ2 A;  4RB1 A;  1YS7 A;  3DV8 A;  4HV5 A;  2FXA A;  3WE2 A;  3MQ0 A;  1HXD A;  2LKP A;  3CUQ B;  1XDS A;  2OQR A;  3V8K A;  5IT3 A;  2JSC A;  4R79 A;  3AAF A;  2FOK A;  1FWZ A;  3KLO A;  4R1H A;  3FXR A;  3FMS A;  3TO6 A;  4KUM A;  3MWM A;  4CXF A;  1E17 A;  1TTY A;  4PCQ A;  2V6C A;  5HDN A;  4P96 A;  4XSX F;  3TGN A;  3G3Z A;  2W57 A;  3CTA A;  1BBY A;  1XSD A;  1K78 A;  4EJO A;  4CHU A;  3ELK A;  4LB6 B;  1I27 A;  1S7O A;  2OD5 A;  3IKV A;  3ZMT A;  1MJA A;  2Q2E A;  1T39 A;  2MC3 A;  2PMU A;  3HRU A;  1TW2 A;  1YS6 A;  4ENN A;  5CLS A;  3B73 A;  2FBI A;  3CLO A;  2IJL A;  4EJU A;  2CWE A;  1UCR A;  2MLK A;  5FGM A;  2GXG A;  4WWC A;  1PP8 F;  2FMY A;  3I59 B;  5D5W B;  4IRI A;  2QBY A;  2PMH A;  2XAS A;  3MZY A;  1G3Y A;  2J5P A;  2XRN A;  1DUX C;  3V8L A;  2KKO A;  4KIG A;  3LST A;  2ACJ A;  4YFX F;  2FF4 A;  2VT2 A;  3F6O A;  5HS8 A;  2HS5 A;  4HQM A;  4XRF A;  2QYO A;  4A2U A;  1KGS A;  4IPA A;  5ERI A;  1SD5 A;  3E97 A;  3ECO A;  1JXS A;  1YW7 A;  2CGP A;  4G7Z F;  1S29 A;  1U6G A;  4RS8 A;  3KP3 A;  4RB2 C;  3GYH X;  4L9J A;  1LB2 A;  4KMU X;  2PI0 A;  1SD4 A;  5FFX A;  2EA4 A;  1GHC A;  2O3F A;  5DV5 A;  3WTS C;  2XAF A;  3DF8 A;  1ZN2 A;  2RC4 A;  4Q4Z F;  3GLX A;  3ZQ7 A;  4N0B A;  3REO A;  4L0Y B;  4TV7 A;  1I6X A;  1XGO A;  3KET A;  4N9I A;  4RAY A;  3RIR A;  2MA3 A;  3EET A;  4MGR A;  1S6L A;  5HDG A;  1J59 A;  2O03 A;  3RJP A;  1W7P D;  3NRV A;  3IWF A;  1F1Z A;  1U2W A;  2GA1 A;  2P6T A;  3T5X A;  4JBA A;  1K6O A;  4UUV A;  1FYM A;  1YW9 A;  3M9A A;  2A6H F;  4ZYG A;  2ESH A;  2OZ6 A;  5E1X A;  1O3R A;  4UNO A;  3PQJ A;  1D5V A;  2XIG A;  3ABT A;  2WWY A;  2K4B A;  2F5E A;  1TQM A;  3FXU A;  4A6E A;  5AIQ A;  1L3L A;  3HHH A;  5H6Q A;  4L9N A;  1O3T A;  2A3S A;  2CW0 F;  4ENJ A;  5ICC A;  1B6A A;  2DQL A;  2Y75 A;  3J80 Z;  2WC2 A;  4WX9 A;  3KE2 A;  4YFN F;  3HOT A;  3LWF A;  3JSO A;  1WKM A;  1DPR A;  4FX4 A;  3RKX A;  4U88 A;  1LDD A;  4I98 B;  4Y15 A;  1ZHF A;  2M1B A;  1BC8 C;  2FSW A;  1DDN A;  1BIB A;  2K02 A;  5F6F A;  3I71 A;  2Q0O A;  3WTX C;  4ENK A;  2FNP A;  3WE3 A;  3LFK A;  2DI3 A;  4RB0 A;  1XCB A;  1Z9C A;  3ZP5 A;  3F8M A;  4NB5 A;  1RIO H;  3E6D A;  3BY6 A;  3GWZ A;  4K2E A;  3K1M A;  3LA3 A;  3RI4 A;  4ESB A;  2EV6 A;  2TDX A;  4EJT A;  2KJB A;  4F7Z A;  2QQA A;  4L0Z B;  3JTG A;  3IC7 A;  2M8E A;  5KK1 A;  3GZ5 A;  2LNB A;  3HSF A;  3KFW X;  4A5M A;  2M45 A;  2DPU A;  1NHA A;  1UST A;  4U0V A;  1U3E M;  4WXH A;  2LDU A;  3MCZ A;  2VN2 A;  2FBH A;  2PBI A;  2HOE A;  4A0Y A;  4Q47 A;  3U2R A;  4LD5 A;  3QU6 A;  3CJN A;  4L18 B;  1W7P A;  1XD7 A;  3G73 A;  2RNJ A;  1MZB A;  2ADU A;  2L4M A;  2A69 F;  2P5V A;  2UZK A;  1QZZ A;  1MJ9 A;  4AIJ A;  3ULQ B;  3DPL C;  1IXS B;  2GZW A;  4HLX A;  1U5T B;  5D5U B;  1LDJ A;  4NQW A;  4S04 A;  4ZYD A;  2XV4 S;  1FP1 D;  2XKO A;  3L09 A;  1G3S A;  1BI0 A;  3GW2 A;  3LA2 A;  3MZH A;  4HF2 A;  3SXY A;  2XUB A;  3N4M A;  5K5Q A;  4ZZL A;  1MJB A;  4Y17 A;  1IZ1 A;  4A5N A;  2F5F A;  2IA1 A;  5CVI A;  2DK8 A;  1AWC A;  1YW8 A;  2D2W A;  3KP7 A;  4HX8 A;  2YU3 A;  1JHH A;  2ZNY A;  2XHK A;  2BE5 F;  1R5G A;  1O57 A;  3SQN A;  5K5R A;  3GVA A;  1Y0U A;  3L00 A;  3Q9V A;  4G9Y A;  3L9F A;  4BAY A;  5E18 F;  1T38 A;  3HTU A;  4IRG A;  2OZU A;  3F21 A;  1P4A A;  3L2C A;  2HDC A;  4RGU A;  4HDU A;  1W4M A;  3EUH A;  3H3U A;  1GVJ A;  5A2Q K;  4G6D A;  1KQ0 A;  1FYK A;  4O3M A;  3FM5 A;  2QEN A;  1SFU A;  3F23 A;  5IT9 K;  1B1B A;  4ETS A;  4MTD A;  3KP6 A;  1TNT A;  2L4A A;  2Z9O A;  4U7D A;  3L7W A;  4IF4 A;  5HLH A;  3BJO A;  1R1T A;  4IHT A;  2HYF A;  1ZAO A;  1ZG5 A;  4RGX A;  1SFX A;  3TO9 A;  5DYM A;  1UHM A;  2AS5 F;  2Z99 A;  2EFW A;  3GO5 A;  3RYP A;  4AWX B;  3QPH A;  2EK5 A;  4ZH4 F;  2VC1 A;  1EV7 A;  6PAX A;  3K9T A;  2MD5 A;  2QUF A;  1FC3 A;  2R7D A;  3LAP A;  3ZMZ A;  4KA4 A;  1Z6T A;  2ZXJ A;  3FM3 A;  3H92 A;  3FXQ A;  3HIF A;  5D6E A;  5LBQ A;  1HKS A;  4M9X A;  1RUO A;  2Y0M A;  1ZRF A;  2OQG A;  2O8X A;  2JRT A;  4M9Z A;  2W24 A;  2Q8K A;  5D4S A;  1QQI A;  3RPQ A;  2RVC A;  4WK8 F;  3T1B A;  5TJJ A;  2XAJ A;  4YFK F;  3P7N A;  3DPT A;  5H6R A;  2EFQ A;  4A0Z A;  2PEX A;  1ZRD A;  2ELH A;  2Z33 A;  5LRR A;  2JZY A;  3ML6 A;  3TDU C;  3VFZ A;  1BN5 A;  5DD4 A;  1Z7U A;  1FBQ A;  1LEA A;  4U0W A;  3WU1 B;  1IN7 A;  2IVM A;  3QP6 A;  4IRH A;  3FHZ A;  5HOO A;  5TRD A;  3PFI A;  2NYX A;  3SZP A;  3JW4 A;  1P4X A;  1R23 A;  3TO7 A;  2D1H A;  2BV6 A;  2VBW A;  2VBZ A;  3LQQ A;  3NEU A;  2YSR A;  2PLY A;  1YQA A;  5K5O A;  2IPQ X;  4HX4 A;  5LGN A;  4WXC A;  2P5K A;  2HQR A;  5FLX Z;  2YX4 A;  2D1V A;  3WTV C;  3C3W A;  2VC0 A;  3DKW A;  5JFR A;  4UV9 A;  3LA7 A;  4M74 A;  1P2F A;  5D8L B;  3F8F A;  4CGZ A;  3WOD F;  2XKP A;  3FMR A;  4BQA A;  2UXN A;  3BPV A;  3IHU A;  3BP8 A;  1WSU A;  5CVJ A;  4RGR A;  3FMQ A;  2XAH A;  1XMA A;  1H9T A;  1FP2 A;  2FA5 A;  2YPR A;  1FPQ A;  2BYV E;  1BI1 A;  4MTE A;  4I01 A;  1ODD A;  4UVB A;  3GFL A;  1KU7 A;  5CVV A;  2L02 A;  2V1U A;  3EYY A;  1U8R A;  1Z1D A;  2UWM A;  3Q5F A;  3TDZ C;  3E3V A;  3M8F A;  2EV0 A;  3F8B A;  4LG0 B;  3D5L A;  1P4W A;  4AIH A;  1KU9 A;  2CFX A;  3E5U A;  4KN4 X;  2DAO A;  4DNC A;  2ZBK A;  5ICG A;  2L54 A;  3FF5 A;  5LHG A;  1QPM A;  3RYR A;  1P6R A;  1R22 A;  5LHH A;  3KEO A;  2PG4 A;  3IL2 A;  2OBP A;  3CO6 C;  4AD9 A;  4ZZD A;  2G7H A;  5BPI A;  2P7C B;  2KIF A;  4WCG A;  2V1D A;  2HEO A;  4EM0 B;  3VEP A;  1JGS A;  1D8J A;  1IXC A;  5E1Z B;  4M73 A;  3KP4 A;  3EYI A;  4EM2 A;  5L3E A;  3QAH A;  4OIQ F;  2GIV A;  3V7S A;  1FLI A;  4GCV A;  1BIA A;  1SMT A;  1QZY A;  3CUQ A;  2FQ3 A;  1LDK B;  2GQQ A;  2R3S A;  3FWE A;  1SD6 A;  3SZT A;  5FFZ A;  1J0R A;  4JQF A;  4EGZ A;  3HOS A;  5ILU A;  1FOK A;  2KIM A;  1XCV A;  4MEX F;  3T8T A;  4I7H A;  1EH7 A;  2HYG D;  1IRF A;  5DEQ A;  2W84 A;  4HYE A;  3DP7 A;  1IUY A;  1Q1H A;  1OYY A;  5L3G A;  4OIN F;  4WXD A;  1TLH B;  2RN7 A;  4M72 A;  2M87 A;  3JTH A;  1XMK A;  4PGG A;  1B9M A;  1V4R A;  1K7A A;  4OMZ A;  2NRA C;  1GXQ A;  1IN5 A;  4D0P A;  3I59 A;  1SD7 A;  5FB2 A;  2IT0 A;  1EH6 A;  2RQP A;  2VE9 A;  2HZT A;  1FSE A;  1ZYR F;  1HQC A;  3P9I A;  1OR7 A;  1FSH A;  1XDU A;  3ZMS A;  3ZMD A;  2STT A;  1Z05 A;  2WTE A;  3QU3 A;  3I53 A;  1F4K A;  3CDH A;  4LK0 F;  3O6B B;  3P9C A;  4IHS A;  3BDD A;  2HR3 A;  4UV8 A;  3GFM A;  2XAQ A;  1OPC A;  2GWR A;  1MDM B;  4DQ2 A;  4UVC A;  4O6J A;  1YYV A;  5IT9 Z;  1MD0 A;  5FD6 A;  2YX7 A;  1KYZ A;  1MGT A;  2COM A;  1G4D A;  2ISY A;  3Q9S A;  1F5T A;  3WTY C;  3KP5 A;  3IRQ A;  4LG0 A;  1HW5 A;  2Z3Y A;  1G6N A;  2QZ8 A;  2WV0 A;  3BJ6 A;  2EB7 A;  2NNN A;  3R60 A;  2J5O A;  1XSX A;  2H6C A;  2AXL A;  4ZYH A;  1YTY A;  5FO5 A;  2STW A;  3WGI A;  3BJA A;  2PFB A;  2O6G E;  5BOX A;  5L3B A;  3IKT A;  1BOA A;  3ROU A;  4L5J A;  2W85 A;  3T8R A;  3VB2 A;  2MLG A;  3E6M A;  2IA2 A;  3VOD A;  4HZF A;  1G3W A;  4U0Y A;  1OMI A;  1FX7 A;  4M6X A;  3HSR A;  5ILV A;  1ONV A;  5LRS A;  2NNY A;  3SFZ A;  4BHP A;  1ZG1 A;  4O5V A;  3WTU C;  2R7F A;  2V9V A;  1CGP A;  1DPU A;  3I64 A;  2V79 A;  1IF1 A;  2JT1 A;  2OAZ A;  2OU2 A;  4XBF A;  4LB5 A;  3V7C A;  1UFM A;  1L0O C;  1KQ8 A;  2HTJ A;  5LHI A;  3KLN A;  5L3D A;  4ESJ A;  2Z5U A;  1WWX A;  3V4G A;  4LLL A;  5JI6 A;  3K1N A;  3J7A O;  1FT9 A;  3LQR A;  2DT5 A;  4PGH A;  4L5I A;  2ZCW A;  3F72 A;  3GFI A;  3GEZ A;  2NAZ A;  3ECH A;  5F64 A;  4HF1 A;  1IRG A;  1TQI A;  3E6C C;  5K1Y A;  1EH8 A;  2C6Y A;  1QGP A;  4AIK A;  4KT5 C;  3R0A A;  1XGN A;  1ZAR A;  5BPD A;  4ASN A;  3I58 A;  4A12 A;  1O7F A;  1YIO A;  1ZLK A;  1U78 A;  1JE8 A;  4OMY A;  3I4P A;  2E1C A;  3CUQ C;  4EJW A;  3FZV A;  5HS9 A;  4BHB A;  4XSZ F;  3RKW A;  1F9N A;  2RKH A;  1PP7 U;  2QWW A;  1YLF A;  2RDP A;  4L9T A;  3ISP A;  2E7W A;  4IXA A;  2ZNZ A;  1STZ A;  4GYI A;  5ICF A;  5J8C A;  1MKM A;  4IJA A;  4KIB A;  3I0T A;  3IWZ A;  1ON1 A;  5HVQ C;  1HKT A;  4HX7 A;  2PN6 A;  3S2W A;  4UHT A;  4I2O A;  4Y13 A;  5LLQ A;  5DD8 A;  3WGH A;  3K69 A;  4A0X A;  3HYI A;  1XGS A;  1IN6 A;  4OIO F;  1MDM A;  5L3C A;  2VT3 A;  3KEQ A;  3WG9 A;  4FX0 A;  2G7U A;  4Q48 A;  1LQ1 A;  1R7J A;  3PQK A;  1XN7 A;  4HV6 A;  5EEG A;  1B59 A;  3GUD A;  4UVA A;  5ILS A;  5JVT A;  1KA8 A;  2FNA A;  5FD5 A;  3KCC A;  1H0M A;  1ZRE A;  5J6X A;  4EV0 A;  3R0J A;  1D8K A;  3R4K A;  2OA4 A;  4IVN A;  2DO7 A;  1ZG3 A;  5DCM B;  1U5T A;  1IXR C; 
#chains in the Genus database with same CATH topology
 2Y0S A;  2Y69 H;  3JRE A;  3OSF A;  5ICE A;  1HKQ A;  2EIJ H;  1WJB A;  1IJW C;  5E3O A;  1P9Q C;  3RDI A;  2E1N A;  2R92 J;  4UXN A;  1REP C;  4G94 A;  2VAS A;  1QVT A;  1OYW A;  4Y4R A;  2M5W A;  1QO0 D;  3G1O A;  2L01 A;  4DZP A;  3J7Z I;  3U9G A;  2VPL A;  4QWQ A;  2MGQ A;  4JOM A;  1ZGJ A;  5DM7 F;  5HLG A;  3SHF A;  4Z6Y A;  3MAJ A;  1RKT A;  1AOY A;  2PMZ N;  4C30 A;  2LF8 A;  3KZI C;  3OL3 A;  2ZXH A;  1RR7 A;  5M5X J;  2H27 A;  3S1Q J;  2BY1 A;  3OYI A;  3CMM A;  1R4M B;  2VOD A;  1X1A A;  1IGN A;  4Z2Y A;  4AC0 A;  3M8E A;  3CLQ A;  5B66 C;  4GXO A;  4HF0 A;  2ZO4 A;  4MQ9 F;  5E8G A;  4QPQ A;  2DA3 A;  5TGT A;  1KQ9 A;  2EA2 A;  2CO5 A;  4PDK A;  2LY1 A;  1MSE C;  1FYL A;  3M7G A;  3V7R A;  2HVR A;  3LSP A;  2DMN A;  2K7L A;  1D0Y A;  1LEB A;  1HW1 A;  1F36 A;  4BL0 B;  1B9N A;  3ABL H;  1IN8 A;  4YII A;  1Y1W J;  2CFO A;  2R7Z J;  3OOP A;  3BG5 A;  3J7Y J;  3H1C A;  2HOT A;  4XON A;  3ZPL A;  1IN4 A;  4LLN A;  5E3N A;  3LSR A;  1YJN I;  2HFH A;  3DXJ F;  3K1P A;  1BJA A;  5CKT A;  4HA8 A;  2K85 A;  2P4W A;  3O3K A;  5BQT A;  1HBX G;  3JRB A;  3GZ6 A;  2F4O B;  2O0Y A;  3ABM H;  3A03 A;  1JKO C;  5K7H A;  3V8J A;  1D1C A;  4G7O F;  4E7Z A;  2XC7 A;  3GBG A;  4Y33 A;  3W3C A;  2JPB A;  2F6C A;  4MNU A;  3K70 D;  3M8J A;  4BDZ A;  2ZJQ F;  1S8N A;  3BCA A;  2A68 F;  3I54 A;  3L1P A;  4CCN A;  5EGO A;  3MKY B;  4P5O A;  2LBF B;  1XGM A;  2G9W A;  1B72 B;  3H3V K;  4IEJ A;  2M30 A;  3HSE A;  3W6K B;  3VOE A;  3ZQH A;  1A36 A;  1T98 A;  4HAM A;  1YJW I;  1RUN A;  3DEU A;  1T0F A;  4BGD A;  3W6V A;  1USS A;  5JR3 A;  2KHM A;  1KU2 A;  4XRS G;  3ZQF A;  4A6D A;  4GO1 A;  4P55 A;  1PUF B;  2E1M B;  2LRE A;  2P81 A;  5EEH A;  2KQR A;  2H8R A;  2HTS A;  2H6B A;  4OIP F;  3KZY A;  1CQT A;  4QLC U;  4CZZ A;  2IRF G;  2BEO A;  2DYS H;  1BW6 A;  2XB5 A;  1WHU A;  1RKW A;  3FDY A;  1HOM A;  4FET A;  2OC6 A;  1VFC A;  2PJP A;  1TT0 A;  2RV8 A;  3CCR I;  4GFB A;  2DBB A;  3ZR8 X;  1I1S A;  3JAM K;  2EV5 A;  1S3J A;  4B44 A;  1FBU A;  1R58 A;  2EJR A;  4HDV A;  2P5L C;  4KDP A;  4A3G J;  3DQV C;  4IOA F;  2VBX A;  1NK3 P;  2NVU B;  3WTT C;  1J75 A;  2VKV A;  4N4N B;  2KDZ A;  4KMF A;  2KDO A;  3HZJ A;  4M3E A;  3D0S A;  3OV8 A;  2R5Z A;  2DPD A;  1V5G A;  1S7A A;  3I4N J;  1H88 C;  2IXS A;  1R36 A;  2OCE A;  1E2X A;  3J81 K;  3DLL F;  4PJN A;  2NS0 A;  2DLL A;  4EAT A;  3I56 I;  3CCL I;  1T56 A;  3KYC B;  1T8I A;  1WCM J;  2KRF A;  4ESF A;  1T6S A;  1ETK A;  1RZ4 A;  4DJA A;  1YG2 A;  2FEZ A;  2VQC A;  3MD2 A;  1W5T A;  2JJ7 A;  1K6Y A;  4P9F A;  3R61 A;  2H09 A;  2HWV A;  5CVR A;  3OYB A;  4I09 A;  4KN7 X;  3H3Z A;  2OTL I;  4JX5 A;  4CCL A;  3JSP A;  2F2E A;  1UB9 A;  3DU6 A;  4FE4 A;  3SYT A;  4MHG A;  1UHW A;  3QOP A;  2R7S A;  4WF2 A;  3RKY A;  4B47 A;  3IRR A;  4A3E J;  5LGU A;  3JRG A;  2HDD A;  3F8N A;  3WTZ A;  4FT8 A;  1X2N A;  3K6G A;  5AIP A;  1OQY A;  3QP5 A;  1W7P B;  4GGG A;  3HGY A;  2D45 A;  3ZCO A;  1XB4 A;  4B8X A;  2X0L A;  4LG3 A;  4FTH A;  3DWL E;  1R00 A;  4D9J A;  5CJ9 A;  2A07 F;  4KFC A;  3BG3 A;  3HHG A;  1D0Z A;  3WGG A;  2DMT A;  1UZC A;  1WH5 A;  4KYW A;  2CH0 A;  1ON2 A;  2QQ9 A;  2BXY A;  1R1U A;  4HLY A;  3NAU A;  3CJQ B;  2EFP A;  4IOC F;  1HSJ A;  2IGN A;  2QKM B;  1X3U A;  2DFI A;  5D5V B;  4B09 A;  5DCM A;  1FY7 A;  2FBK A;  1DU6 A;  2OPT A;  2K86 A;  4E7H A;  2VJ4 A;  3LAJ A;  2HNH A;  3GF2 A;  3QWL A;  1C0W A;  4PJM A;  4BU2 A;  1BOB A;  2HXI A;  2DMU A;  2KJC A;  2QCO A;  3HOX J;  1PDN C;  2A6E F;  2XGX A;  2XPV A;  4HPQ A;  2K3F A;  1VQN I;  4PZJ A;  1YOV B;  3WHB A;  3IV5 A;  1GV2 A;  3K4C A;  2QM3 A;  2X4H A;  3EDP A;  4CH7 A;  2EPF A;  2CV1 A;  1R5H A;  3AG1 H;  3BWG A;  1VQK I;  2FRH A;  5LEJ A;  3HRM A;  2GIZ A;  4IKF A;  1K79 A;  2ZME B;  5GTH C;  1HDD C;  2L3D A;  2CG4 A;  3W6J B;  2DJN A;  1HST A;  4G8X A;  2LLK A;  3WTW C;  5FLX K;  3I5U A;  2PMZ A;  1UMQ A;  4LFU A;  2FD5 A;  4E70 A;  2LRD A;  1KON A;  2NVT J;  2RQQ A;  2K9Q A;  2XPW A;  3HEF A;  3DFG A;  5FLM J;  1FMV A;  2I8D A;  2EFO A;  2IA0 A;  1LNW A;  2IGM A;  5F1R A;  1IW7 F;  2XAG A;  3KYL A;  5E1W A;  2JUC A;  1W5S A;  3GFJ A;  1TQP A;  3N97 A;  4JX4 A;  2VKH A;  3ZQC A;  3TOB A;  1MMG A;  5DUK A;  2HKO A;  4P9U A;  2F5C A;  4OU0 A;  1NG6 A;  1XG1 A;  3FXO A;  4Q5S F;  2M9H A;  2MH2 A;  2VXZ A;  3C18 A;  5JLW A;  2K27 A;  3NQO A;  3S3O A;  1OIS A;  1U5T C;  2E7X A;  3KEY A;  3QRF F;  4PFO A;  4N9H A;  3O8H A;  3QYE A;  2XVC A;  2X6W A;  3HRT A;  1KYW A;  3HUG B;  1VQP I;  1ZGW A;  2RAE A;  3PL8 A;  5GAG J;  2DW4 A;  2LBF A;  1CF7 B;  1B72 A;  2L9V A;  2MH9 A;  3HKZ N;  1ZRC A;  3TMO A;  3CDI A;  2LP0 A;  2ME0 A;  4BJ5 C;  4CCJ A;  1VZ0 A;  2W25 A;  4JK1 X;  5DDG A;  4EJV A;  5E8I A;  4FHT A;  3RKQ A;  5DS9 A;  1T2K A;  3OYK A;  2HQA A;  2MC4 A;  1ULY A;  2V26 A;  3E1S A;  2EWN A;  2UXX A;  1PUF A;  2A5Y B;  5B3S H;  4CO8 A;  4BNC A;  3M1E A;  2L9R A;  3CMY A;  4XQF A;  3C7J A;  5GPC A;  3DCF A;  4I02 A;  2ESN A;  1U9N A;  5J8F A;  3JRD A;  4ZYE A;  3D1N I;  2ISZ A;  1B4A A;  3HGG A;  2PQ8 A;  2CUJ A;  3ASN H;  3RTR A;  1W36 D;  1F43 A;  2ETH A;  3LNQ A;  1WJF A;  4BHC A;  3G1M A;  4XM3 A;  2QVO A;  4I76 A;  4EM1 A;  1VTN C;  1QHH D;  5LFA A;  4BJT A;  4M9S A;  3TOA A;  5EJC A;  2RNG A;  3QYF A;  4HNT A;  1JHF A;  1V5E A;  5A2Q Z;  3HOZ J;  5E17 F;  2VON A;  2O7O A;  5CYV A;  3CUO A;  2XGC A;  3JR9 A;  2MBF A;  4YG2 F;  4U7B A;  1EF4 A;  4EMS A;  4BXU A;  2CW7 A;  3SEZ A;  4H0E A;  3TQN A;  3COA C;  5HLT A;  3JRA A;  3ERE D;  2Y30 A;  3F22 A;  4LK1 F;  3S17 J;  1V3F A;  1BR2 A;  1BI2 A;  1BC7 C;  1SC7 A;  1ERD A;  5BMZ A;  1MMN A;  2IP2 A;  2EFN A;  3BZ6 A;  2DT6 A;  4BUP A;  1W0U A;  2XRO A;  4MEY F;  3QOD A;  5LGT A;  3MFK A;  3L2Q A;  1PJR A;  2ZJP F;  4NHJ A;  3S15 J;  1YJ9 I;  3VDX A;  4GYG A;  2A6T A;  2FOW A;  2LFB A;  2WA0 A;  5L3F A;  2X51 A;  4ABZ A;  4A3K J;  1LPQ A;  1KU3 A;  3G71 I;  5FRN A;  1WI3 A;  3QPT A;  5DTD A;  1RNL A;  3KPH A;  5D6F A;  1JGG A;  2HDW A;  1LJ9 A;  5IP6 A;  4XLH A;  1T0F C;  3RPU D;  4B43 A;  4LLG F;  2EIL H;  4BYY A;  4IHW A;  1SEU A;  3G6E I;  2O8K A;  3KP2 A;  5J4Y A;  5B5E C;  1MNM C;  1S72 I;  3GTL J;  3IH3 A;  4XLN F;  4ENM A;  2VB6 A;  1ZH5 A;  4RB3 C;  2EBI A;  1O7L A;  2CQQ A;  1U9O A;  2HKX A;  4HBL A;  2CYY A;  2JA7 J;  1IDZ A;  1XSV A;  2QQB A;  4CDG A;  5CVU A;  3U1K A;  3AL0 C;  2H8W A;  2QF7 A;  4LJZ F;  1BI3 A;  2ELJ A;  4S05 A;  1BL0 A;  3K0L A;  5IOY A;  4BAC A;  1Z6R A;  4HW0 A;  3F3X A;  3TKY A;  2FML A;  1D3Y A;  1YFH A;  1I1G A;  1X58 A;  4AVP A;  1LFP A;  2FU4 A;  1R1V A;  1YIT I;  4XRS A;  4C3I J;  2B0L A;  4RGS A;  2HGC A;  1VQ7 I;  3S2H J;  4EGY A;  2H1K A;  1J2X A;  3K2Z A;  4G7H F;  1WRJ A;  2HQN A;  1LVA A;  5AON A;  2YR2 A;  2E35 A;  3GZN B;  2JPC A;  5CPR B;  4XLA A;  1OCZ H;  1VF9 A;  2AHQ A;  4HSR A;  2VOP A;  3CO7 C;  4AU7 A;  1OCT C;  3J80 K;  5F0F A;  1P92 A;  3OYM A;  2IAI A;  3D5S C;  1OYI A;  4I0A A;  1TW3 A;  4II3 A;  3S93 A;  5BS6 A;  2R7V A;  2ZME A;  1MBH A;  2BGC A;  2GA2 A;  3L2R A;  1SFE A;  4RAZ A;  4II2 A;  4J01 A;  3PUF A;  5HDK A;  3T0Y A;  2H1L A;  1XPX A;  4B4C A;  3HJE A;  5JHU A;  4XLP F;  4M6Y A;  4AID A;  1Q1V A;  1UG0 A;  5FKM A;  3EQL F;  1IAW A;  1K78 B;  1YO5 C;  2LSO A;  1ZGA A;  2GAU A;  1WI9 A;  3RSN A;  3ZGK A;  4EVI A;  1FZP B;  2DTZ A;  3K4B A;  2E60 A;  3WU0 A;  4XKC A;  5IYD J;  4OOI A;  1O3Q A;  1LFU P;  2XRL A;  2IW5 A;  4HOB A;  3OYE A;  5D5X B;  4XMY A;  3TL4 X;  3OIQ A;  4ON0 A;  1RPW A;  4KIC A;  1OKR A;  1SAX A;  1I39 A;  1RET A;  2O61 A;  1Z3X A;  3C1D A;  1A04 A;  1V5F A;  3HPH A;  2E71 A;  4OIR F;  2VJ5 A;  5LEK A;  1GT0 C;  2LK2 A;  3E5X A;  4XN0 A;  3PJR A;  4LGW A;  4G6Q A;  3HOY J;  2CUZ A;  3M07 A;  3S3N A;  1I5Z A;  1BM9 A;  3GX4 X;  2RGV A;  2Y31 A;  4I99 C;  2F5D A;  5ED4 A;  1ZEL A;  2BY2 A;  3F0C A;  1FNN A;  5D4R A;  2A5W A;  2VKD A;  2P8T A;  2Y48 A;  3PIP F;  4L9V A;  2GXB A;  1TBX A;  1ETX A;  2X85 A;  3HUG A;  2QBY B;  1TZL A;  2P7V B;  4KNY A;  1SMY F;  4QTR A;  1CF7 A;  4RAF A;  4I0B A;  3ZN1 A;  3I55 I;  1JUS A;  2FE3 A;  2D5V A;  3GTG J;  2DU9 A;  3FIS A;  1ZLJ A;  4DBQ A;  2BBY A;  2COB A;  1Y6I A;  3DTE A;  3F6V A;  1J9I A;  2QLZ A;  2BY0 A;  2LC2 A;  1Z21 A;  3HKZ A;  3I3L A;  3GCM A;  2X6X A;  3BPX A;  3TP3 A;  1QBJ A;  1IC8 A;  4XN3 A;  1OCP A;  2JA6 J;  1OFC X;  2MAB A;  3HTS B;  1HW2 A;  4A93 J;  1G3T A;  2ZKZ A;  1H9G A;  5DCF A;  3BR3 A;  2A61 A;  1MIJ A;  2VE8 A;  1ZQ3 P;  3OSG A;  2VOO A;  3KZZ A;  3ABU A;  3BZK A;  2QGU A;  2VBY A;  2CQX A;  3R6S A;  3ZN0 A;  2DT7 B;  2W7N A;  4D7M A;  1FMW A;  2EIM H;  2L7Z A;  5H20 A;  2IS6 A;  3K70 C;  2LKS A;  2K3P A;  5IOZ A;  3B02 A;  2JA8 J;  3DU5 A;  3VSK A;  2H94 A;  1TNS A;  4DYR A;  1UEL B;  2JTV A;  2P0W A;  2DK5 A;  1GXP A;  1J5Y A;  2X48 A;  3K10 A;  2ZFW A;  4BH9 A;  3FX3 A;  1Z91 A;  4DYQ A;  1PUE E;  1QZE A;  3P9K A;  2QA4 I;  2KIU A;  3RPU A;  1FBS A;  2CSO A;  2LF7 A;  1UJ8 A;  4ZDO A;  4MIM A;  5D8K B;  1JTX A;  5FLV A;  1MBK A;  4CCO A;  5KVR A;  2EZI A;  3F8C A;  1TWG J;  2O5R A;  2ELK A;  4F55 A;  3JAM Z;  3BRO A;  3W2W A;  1IV6 A;  2F48 A;  3E6B A;  5F1J A;  4KIF A;  3OYH A;  1E3H A;  3MEX A;  2DYR H;  2L2O A;  3HRS A;  4CIC A;  4C3J J;  1UAA A;  2K40 A;  1DP7 P;  4RM3 A;  4R8H A;  5E20 A;  3ZMV A;  4ZYA A;  4LMY A;  2DTR A;  4NUB A;  2DA5 A;  2P6S A;  3UKG A;  3CME I;  3BQY A;  4IX7 A;  3E5Q A;  4IL6 C;  3J81 Z;  3NWS A;  4XK4 A;  3ZMU A;  3S1R J;  3U1D A;  3ZOB A;  4A3B J;  2KP6 A;  2V1X A;  2E1M C;  4HNU A;  4CYD A;  3QOE A;  2CQK A;  5J47 A;  3BOQ A;  2DQR A;  2Z2S B;  4YIF A;  1YRN B;  2NXN B;  3GXO A;  1O3S A;  2BHZ A;  2K4J A;  3MZ8 A;  5DUI A;  4EQQ A;  1QNT A;  4G12 A;  4M71 A;  3L2V A;  4HQE A;  1J7K A;  1X1P A;  3PUB A;  5HS7 A;  3O2P E;  5EEA A;  2ZJ2 A;  1RI7 A;  1JI8 A;  5HLI A;  4MQV A;  4M3B A;  3PSF A;  1X4O A;  4YIR X;  1WQ2 A;  1OCO H;  4RB1 A;  4IO9 F;  4BEH B;  1YS7 A;  3DV8 A;  4HV5 A;  4OWR B;  2NVQ J;  3OMY A;  2GXA A;  2MG4 A;  3LL7 A;  2FXA A;  4F92 B;  3WE2 A;  2CUF A;  1GLN A;  4PUS A;  4ZTF A;  1T33 A;  3MQ0 A;  1HXD A;  2DOD A;  2LKP A;  1XDS A;  3CUQ B;  4CA0 A;  2OQR A;  4C2U A;  3V8K A;  2ICW G;  5IT3 A;  3K4N A;  4XR6 A;  2JSC A;  1GUU A;  4R79 A;  3AAF A;  4OAZ A;  2FOK A;  1HCR A;  4XLC A;  1FWZ A;  4PFP A;  4A3L J;  3KLO A;  4R1H A;  3FXR A;  1RES A;  5IP7 J;  3FMS A;  3TO6 A;  1D5Y A;  2EZK A;  3CMA I;  1MMD A;  2DA7 A;  4KUM A;  2GLO A;  2DOE A;  1QVU A;  1RRJ A;  4XKV A;  1Y8Q B;  2OTJ I;  3MWM A;  4CXF A;  1E17 A;  3A1Y A;  5JLX A;  1TTY A;  4PCQ A;  1MBF A;  2V6C A;  5HDN A;  3OIO A;  4P96 A;  4XSX F;  3Q0W A;  3TGN A;  3G3Z A;  1W5C C;  2W57 A;  3CTA A;  1Y0N A;  1IUF A;  1BBY A;  1XSD A;  3FK7 A;  1R71 A;  1VQ8 I;  1K78 A;  1SVM A;  5DM6 F;  3CP2 A;  4EJO A;  2NOJ B;  4CHU A;  1Y8R B;  3ELK A;  1I27 A;  4LB6 B;  1S7O A;  2CS3 A;  1H8A C;  3IH2 A;  3S14 J;  2OD5 A;  3IKV A;  3ZMT A;  1MJA A;  5E3L A;  3BLY A;  2Q2E A;  4HNV A;  1T39 A;  2MC3 A;  2PMU A;  1ORK A;  3HRU A;  1TW2 A;  1YS6 A;  1XMX A;  2Y2Z A;  4ENN A;  4A3I J;  5CLS A;  3S1N J;  3B73 A;  3I9V 2;  2FJ1 A;  2FBI A;  3CJR B;  3CLO A;  3FXM A;  4KIS A;  2IJL A;  4EJU A;  2CWE A;  1UCR A;  2MLK A;  5FGM A;  2GXG A;  4BJ6 C;  4WWC A;  1PP8 F;  3KIO A;  2FMY A;  2LG4 A;  3I59 B;  3PNT A;  2IGO A;  5D5W B;  4IRI A;  2VJI A;  1KZH A;  2QBY A;  2PMH A;  2XAS A;  3MZY A;  4B48 A;  1G3Y A;  1YI2 I;  2J5P A;  2XRN A;  3S32 A;  1DUX C;  3HBL A;  4BE2 A;  3V8L A;  3N05 A;  2KKO A;  4KIG A;  3SDG A;  3LST A;  2ACJ A;  3LSI A;  4YFX F;  2ZME C;  2FF4 A;  3K4J A;  2MW8 A;  1OCR H;  2NS8 A;  4FAS D;  1XX5 A;  4MFE A;  2DN0 A;  3OYD A;  1MW7 A;  3G4S I;  1VQ5 I;  1D1B A;  2VT2 A;  2XDV A;  1VQ9 I;  2M34 A;  3F6O A;  4GRI A;  5HS8 A;  1WZ2 A;  2HS5 A;  4HQM A;  2HZD A;  3CC4 I;  1LKX A;  1QRY A;  3CDL A;  2Y9Y A;  4XRF A;  2JQ7 A;  2QYO A;  4A2U A;  4C2T A;  2UV1 A;  3JRF A;  2WAD A;  2I5U A;  1KGS A;  4IPA A;  5ERI A;  3ZXS A;  4BQQ A;  1SD5 A;  4IZZ A;  3E97 A;  3ECO A;  1JXS A;  1YW7 A;  4M6V A;  2E5N A;  4X1E A;  2CGP A;  4G7Z F;  2V9P A;  5HNH A;  1S29 A;  3OWT A;  1U6G A;  2PJR B;  4RS8 A;  3KP3 A;  4RB2 C;  3AL0 B;  4F93 B;  3GYH X;  4L9J A;  1LB2 A;  2BOL A;  4KMU X;  2PI0 A;  4A3F J;  1SD4 A;  4NC6 A;  3DLA A;  2HOS A;  3K7A J;  5FFX A;  5H2F C;  2EA4 A;  1GHC A;  2O3F A;  1NTC A;  5DV5 A;  3BG9 A;  2M3A A;  3K4M A;  1X1C A;  2XAF A;  3WTS C;  3DF8 A;  1P7J A;  1ZN2 A;  2RC4 A;  2V1N A;  3GLX A;  4Q4Z F;  4PJJ A;  3B6A A;  3ZQ7 A;  4CCM A;  3OYA A;  1W36 C;  4ZDL A;  4N0B A;  5IY5 H;  3REO A;  1R4N B;  2WY7 Q;  4L0Y B;  4TV7 A;  2LOO A;  1I6X A;  2WV1 A;  4ITV A;  3ZQQ A;  1XGO A;  3KET A;  2L9S A;  3C2G A;  3GTO J;  4RLF A;  2GOM A;  2TRT A;  1NH3 A;  4N9I A;  2R7X A;  4RAY A;  1S9H A;  3CCE I;  2JSP A;  3JRI A;  3RIR A;  4NQW B;  4XOP A;  2W4S A;  1W1W E;  2MA3 A;  3EET A;  4C3H J;  1SAN A;  4MGR A;  2VIX A;  3SEQ A;  3E7L A;  2DDA A;  1S6L A;  4XLF A;  5HDG A;  3SZG A;  1YRN A;  2QSF X;  3TED A;  2BVM A;  5IPA A;  1J59 A;  5EZH A;  4BDY A;  2O03 A;  5JVG F;  2ID6 A;  1JT6 A;  3RJP A;  4NC8 A;  2VQL A;  1W7P D;  3NRV A;  3IWF A;  4MLO A;  1F1Z A;  1U2W A;  2M0C A;  1YX5 A;  2GA1 A;  2P6T A;  3T5X A;  1MNE A;  4JBA A;  1I3Q J;  5E3M A;  1K6O A;  1GV5 A;  4UUV A;  1FYM A;  1LFB A;  2LD5 A;  1I6H J;  1YW9 A;  3M9A A;  2A6H F;  4BEH A;  1ACI A;  4ZYG A;  2ESH A;  2F4I A;  2VXD A;  2OZ6 A;  5E1X A;  1O3R A;  4UNO A;  3PQJ A;  1D5V A;  2XIG A;  1WH7 A;  3ABT A;  2WWY A;  2EZL A;  3K2A A;  3FXL A;  2K4B A;  4E4H A;  3BC8 A;  2F5E A;  4F3Q A;  2L7M P;  3ABK H;  1TQM A;  3FXU A;  3FKJ A;  3LSJ A;  4CSW A;  4A6E A;  5AIQ A;  4B3A A;  4E7J A;  1L3L A;  3HHH A;  5H6Q A;  3LOC A;  4L9N A;  3FXK A;  3OYJ A;  1ETV A;  1O3T A;  4UB6 C;  2IBD A;  2KZG A;  2GBY A;  2A3S A;  2CW0 F;  4ENJ A;  3BG6 A;  3CCQ I;  3MN2 A;  1VQO I;  2LMD A;  1T95 A;  3I4M J;  3WU2 C;  3SDB A;  5M3F J;  5ICC A;  1B6A A;  2DQL A;  2Y75 A;  3J80 Z;  1HLV A;  2WC2 A;  3M3Y J;  3FBN B;  4WX9 A;  2M8G X;  3KE2 A;  1S7E A;  3AFH A;  4YFN F;  2YUS A;  3FK6 A;  3LMM A;  3HOT A;  3LWF A;  2VI6 A;  3JSO A;  1MMA A;  1WKM A;  1X1D A;  1I3A A;  1DPR A;  4FX4 A;  3RKX A;  4U88 A;  1LDD A;  3GME A;  4I98 B;  4Y15 A;  1ZHF A;  2X6O A;  2WAQ N;  3H9G A;  2M1B A;  5HNF A;  1BC8 C;  2FSW A;  3G2B A;  5KHD A;  3VYU B;  1DDN A;  1BIB A;  3CQZ J;  2K02 A;  3HDD A;  3BR2 A;  3H5N A;  3I71 A;  5F6F A;  1Z77 A;  3IH4 A;  2Q0O A;  3WTX C;  4ENK A;  2LYC A;  5FJ8 J;  3QPS A;  2FNP A;  5GAD J;  1K4S A;  1FJL A;  3V42 A;  1OCC H;  2BW3 B;  3WE3 A;  3LFK A;  3MKZ A;  2DI3 A;  3PO2 J;  4RB0 A;  1G8X A;  1XCB A;  3WHC A;  4DIQ A;  1SVO A;  2KL4 A;  3JRC A;  1JUM A;  3GTQ J;  1A35 A;  4YRV A;  3AG4 H;  3Q0U A;  4AYB N;  3LSK A;  1Z9C A;  3ZP5 A;  3F8M A;  2HU9 A;  4BBS J;  3GTP J;  4NB5 A;  1RIO H;  3OR1 C;  4RA2 A;  3E6D A;  3S8P A;  4BE1 A;  3BY6 A;  3GWZ A;  3CZ6 A;  2R5Y B;  2KMU A;  2M7B A;  4K2E A;  4KIT B;  2E2H J;  3K1M A;  3LA3 A;  4CUG A;  3RI4 A;  4ESB A;  2EV6 A;  2TDX A;  2DFF A;  3CP8 A;  4EJT A;  3TW6 A;  2OUM A;  2KJB A;  4F7Z A;  2QQA A;  4L0Z B;  3JTG A;  2ZFU A;  3IC7 A;  1O4X A;  5EF6 A;  2M8E A;  5KK1 A;  3GZ5 A;  2LNB A;  2W82 A;  3FIW A;  3HSF A;  3C2B A;  3M1C A;  5C3E J;  1K61 A;  3CJT B;  3KFW X;  4A5M A;  2M45 A;  2DPU A;  4HRI A;  1NHA A;  1UST A;  4U0V A;  1U3E M;  1AHD P;  4WXH A;  3GTM J;  4XKW A;  2LDU A;  3MCZ A;  4XOT A;  2PJR A;  1D1A A;  1TWF J;  2VL8 A;  2VN2 A;  4BXF A;  5FKO A;  1UG2 A;  2FBH A;  2L9N A;  2DMP A;  3DBH B;  5EZG A;  2PBI A;  2HOE A;  4XKB A;  4Q47 A;  4A0Y A;  3BTI A;  2OF7 A;  3H36 A;  3U2R A;  2KIS A;  2E2J J;  2E2I J;  4LD5 A;  3QU6 A;  3CJN A;  2JUG A;  1N77 A;  3H9Q A;  5C44 J;  4L18 B;  9ANT A;  2CW8 A;  4MO7 A;  1W7P A;  1XD7 A;  3G73 A;  3PNV A;  2RNJ A;  1MZB A;  2ADU A;  2L4M A;  3OY9 A;  2A69 F;  1WFX A;  3BTJ A;  2P5V A;  3OS2 A;  4G6T B;  2UZK A;  1RC9 A;  1QZZ A;  1MJ9 A;  4AIJ A;  3G1L A;  2R7U A;  3ULQ B;  3DPL C;  1J09 A;  1IXS B;  2AQE A;  2GZW A;  2DXI A;  4HLX A;  1U5T B;  4UB8 C;  1R6R A;  3MMY B;  5GAE J;  4NC7 A;  3M4O J;  5D5U B;  1LDJ A;  4NQW A;  4H4K C;  2WAE A;  1IV8 A;  3TP0 A;  4S04 A;  4ZYD A;  3K4K A;  2XV4 S;  2HVS A;  4D5F A;  1FP1 D;  2XKO A;  2E1O A;  3L09 A;  4FCY A;  4NDL A;  2LVS A;  3QQA A;  4DYC A;  2JMW A;  3DPU A;  2IS4 A;  3H0G J;  1G3S A;  4PJ0 C;  1BI0 A;  3GW2 A;  3LA2 A;  3MZH A;  4HF2 A;  3SXY A;  2XUB A;  4JYK A;  1XTA A;  4IHX A;  3N4M A;  1EA3 A;  2ZSH B;  5K5Q A;  4ZZL A;  2M2E A;  4YEL A;  1MJB A;  4V2G A;  3IAS 2;  1IZ1 A;  2AXT C;  4Y17 A;  5J40 A;  2F5F A;  4A5N A;  2IA1 A;  5CVI A;  2DK8 A;  1N78 A;  1AWC A;  1YW8 A;  2D2W A;  3KP7 A;  4A3J J;  2O9L A;  2DA1 A;  4HX8 A;  2YU3 A;  3BTL A;  1JHH A;  2ZNY A;  2JK3 A;  2XHK A;  3E0J B;  2W48 A;  2BE5 F;  3S1M J;  1R5G A;  1O57 A;  3SQN A;  5K5R A;  3GVA A;  2DMQ A;  3VYS B;  1Y0U A;  3L00 A;  3Q9V A;  2JA5 J;  1FOX A;  1JKP C;  4G9Y A;  3L9F A;  2QKL B;  4BAY A;  5E18 F;  1T38 A;  5C4J J;  3HTU A;  1X1B A;  5B1B H;  5HOD A;  3VYT B;  4IRG A;  2JVH A;  2OZU A;  1V55 H;  4LOC A;  3BCB A;  5GPA A;  2ZXI A;  3F21 A;  3CD6 I;  4BS9 A;  1P4A A;  1SFO J;  2KRH A;  3L2C A;  3OYN A;  1IDY A;  1BR4 A;  1Y39 A;  3O8G A;  5FKN A;  1MND A;  2KPM A;  2HDC A;  4RGU A;  4HDU A;  1W4M A;  2EH3 A;  3EUH A;  5C4X J;  1JTY A;  4BY1 J;  3GTJ J;  3H3U A;  4DZJ A;  1GVJ A;  5A2Q K;  4G6D A;  4BKX A;  1KQ0 A;  3MKW B;  1FYK A;  2XSD C;  2WAQ A;  4UUT A;  4O3M A;  3FHN A;  2VQH A;  3LFU A;  1VQL I;  3HC7 A;  3FM5 A;  3QYB A;  2DFE A;  3BQZ A;  2QEN A;  3LSM A;  4BQO A;  1T08 B;  1LUJ B;  3F23 A;  1SFU A;  1Z0X A;  5IT9 K;  2BW3 A;  5M5Y J;  3KYD B;  1IO2 A;  1B1B A;  4ETS A;  1ENH A;  4GDF A;  4MTD A;  3H5R A;  2XB0 X;  3KP6 A;  1TNT A;  2KFD A;  2L4A A;  2Z9O A;  1Z3Y A;  4U7D A;  4BXX J;  3L7W A;  4IF4 A;  1WVR A;  3UNG C;  4AYB A;  5HLH A;  4ZC3 A;  2R5Y A;  2DOA A;  3BJO A;  1R1T A;  4IHT A;  2HYF A;  1ZAO A;  2E19 A;  1ZG5 A;  4B1R A;  2CU7 A;  4Y7N J;  1JJ8 C;  4RGX A;  3RCO A;  4LIT A;  1SFX A;  3L2U A;  3TO9 A;  3W2A A;  4E7S A;  2M4K A;  5DYM A;  1UHM A;  3F9K A;  1POG A;  5J1R A;  2AS5 F;  2Z99 A;  2EFW A;  1QPI A;  3GO5 A;  3RYP A;  3IUO A;  2WAF A;  3HB9 A;  4AWX B;  3QPH A;  2EK5 A;  1ETO A;  2X9D A;  1BW5 A;  4ZH4 F;  2KZV A;  2VC1 A;  1EV7 A;  6PAX A;  4W97 A;  2XAU A;  3ASO H;  3K9T A;  4B3X A;  2MD5 A;  2QUF A;  2BY3 A;  3OS1 A;  2EZH A;  2E36 A;  1FC3 A;  2R7D A;  3LAP A;  3ZMZ A;  4KA4 A;  1Z6T A;  1AU7 A;  2ZXJ A;  2B7E A;  3FM3 A;  3FXQ A;  3H92 A;  3HIF A;  5D6E A;  2K9N A;  4RMN A;  5LBQ A;  1HKS A;  4M9X A;  1RUO A;  3CCY A;  1Z67 A;  2Y0M A;  1ZRF A;  3Q0V A;  2OQG A;  5J1Y A;  2K5C A;  2O8X A;  2JVG A;  4JP0 A;  2JRT A;  2CV2 A;  4M9Z A;  2W24 A;  2Q8K A;  1V54 H;  1E0E A;  5D4S A;  4RM2 A;  1QQI A;  2V9K A;  3ESW B;  2CQ7 A;  3VYR B;  2BHY A;  2YU9 J;  3RPQ A;  1X3Z B;  1JJ6 C;  2RVC A;  4WK8 F;  4QSH A;  3T1B A;  1AA7 A;  5TJJ A;  2K9S A;  4HST A;  2XAJ A;  3PO3 J;  3HOU J;  4X0G A;  1G2H A;  3FXJ A;  3CCM I;  4YFK F;  1X3W B;  3P7N A;  2ZSI B;  3DPT A;  3CCU I;  3RZD J;  5H6R A;  2EFQ A;  2HOA A;  4A0Z A;  2WB1 N;  1APL C;  2PEX A;  1ZRD A;  2ELH A;  3OYL A;  4NNJ A;  2Z33 A;  3DEW A;  5LRR A;  2JZY A;  4N4O B;  4LIU A;  3OYF A;  3ML6 A;  2EQR A;  3CF2 A;  3TDU C;  3VFZ A;  1M1E B;  3JRH A;  1BN5 A;  1TT5 B;  5DD4 A;  3HL2 A;  1Z7U A;  1FBQ A;  1LEA A;  4U0W A;  1DU0 A;  3WU1 B;  1IN7 A;  2IVM A;  3QP6 A;  4IRH A;  3FHZ A;  5HOO A;  3CES A;  5TRD A;  3PFI A;  2OV7 A;  2NYX A;  2X1E A;  4U87 A;  3SZP A;  3HOV J;  1QA6 A;  2BXZ A;  3JW4 A;  1P4X A;  3Q3S A;  3S3M A;  1R23 A;  3TO7 A;  1ZTR A;  2D1H A;  4XLE A;  2BV6 A;  2KLO A;  3DEE A;  2VBW A;  2VBZ A;  2WY8 Q;  3LQQ A;  4YEJ A;  3NEU A;  2YSR A;  3BR0 A;  2PLY A;  2XF7 A;  3A0H C;  3H0D A;  1MBJ A;  1YQA A;  3NWT A;  5GP9 A;  3L2W A;  5K5O A;  2IPQ X;  4HX4 A;  2MSY A;  2RRE A;  5LGN A;  3SFI A;  4PSW A;  2GM4 A;  4WXC A;  2P5K A;  1UHS A;  2HPI A;  1Y1V J;  2HQR A;  1A6Q A;  5FLX Z;  5EG0 B;  4XID A;  2YX4 A;  2D1V A;  3WTV C;  3C3W A;  2B63 J;  3OYG A;  4EEF G;  4XNF A;  2VC0 A;  1YHQ I;  3DKW A;  1VQ4 I;  2Z1D A;  3DTK A;  4L5E A;  3H35 A;  5BNG A;  1R9T J;  5JFR A;  1EJ9 A;  4UV9 A;  3LA7 A;  2QEX I;  4M74 A;  1P2F A;  1I50 J;  5D8L B;  1Z7L A;  2KT0 A;  1S5L C;  3BG7 A;  3F8F A;  2UUZ A;  4CGZ A;  3WOD F;  2XKP A;  4AM3 A;  2FX0 A;  2LY2 A;  2CV0 A;  2M7A A;  3DBL B;  3FMR A;  4BQA A;  3D5R C;  2UXN A;  3DKY A;  2KRC A;  3BPV A;  1MH4 A;  1E3P A;  3IHU A;  3BP8 A;  1LE8 B;  1FTT A;  3KX2 A;  1PYV A;  1K83 J;  2I10 A;  1WSU A;  1BJZ A;  5CVJ A;  4MFD A;  4RGR A;  1U8B A;  1QU3 A;  1ZR4 A;  2GOX B;  2ID3 A;  2XAH A;  3FMQ A;  3PNY A;  4PSX A;  1XMA A;  4QIW N;  2Y9Z A;  1H9T A;  1FP2 A;  1SVL A;  3RQI A;  2FA5 A;  2K9L A;  2YPR A;  4CCK A;  3HPG A;  3MKL A;  1FPQ A;  4D1Q A;  2BYV E;  1BR1 A;  3CCS I;  2HQ5 A;  1BI1 A;  4MTE A;  4I01 A;  2IGK A;  2IS1 A;  2F5V A;  3JCU C;  3LSG A;  1ODD A;  5M3M J;  4UVB A;  3U21 A;  3BR5 A;  3GFL A;  1KU7 A;  5CVV A;  4IQ4 A;  1N75 A;  3CCV I;  2L02 A;  2VUM J;  2M4G A;  2XSJ C;  2V1U A;  3EYY A;  3PFY A;  2NS7 A;  2R0Q C;  3VWB A;  2R7Q A;  1U8R A;  3A02 A;  4A3M J;  2L7F P;  1Z1D A;  3WG7 H;  5KNL A;  2UWM A;  4ZTJ A;  1XC5 A;  3Q5F A;  4UUS B;  3CF5 F;  3CC7 I;  5J1U A;  3HM5 A;  5EYR A;  3TDZ C;  3E3V A;  1VQ6 I;  3M8F A;  2LH9 A;  1DGW Y;  2EV0 A;  2L5Q A;  2E5Z A;  3F8B A;  5K7Z A;  2JA2 A;  2NVX J;  4LG0 B;  2HI3 A;  3D5L A;  1P4W A;  4AIH A;  1KU9 A;  2CFX A;  3ZQL A;  3E5U A;  4KN4 X;  2CRG A;  2DAO A;  3LSH A;  2QSG X;  4DNC A;  2ZBK A;  4ZJZ A;  5ICG A;  3EUH C;  2L54 A;  2OCC H;  3FF5 A;  2E34 A;  5IYB J;  5LHG A;  1QPM A;  3RYR A;  4DW6 A;  1P6R A;  3BR6 A;  1R22 A;  3FKI J;  3OYC A;  3ZQI A;  5F04 A;  5LHH A;  3KEO A;  1TWC J;  2PG4 A;  3IL2 A;  2OBP A;  3CO6 C;  4AD9 A;  4ZZD A;  2G7H A;  5E79 C;  5IP9 J;  5BPI A;  2P7C B;  2KIF A;  2ZC2 A;  4WCG A;  2V1D A;  4E7L A;  5FRM A;  1X2M A;  2DA4 A;  2R7O A;  2HEO A;  4EM0 B;  1WJA A;  3VEP A;  2VJJ A;  1JGS A;  3HXL A;  4D5C A;  5KAF C;  1ZR2 A;  2QQ8 A;  1D8J A;  1IXC A;  5E1Z B;  2HXO A;  2R93 J;  4M73 A;  3PM1 A;  3KP4 A;  4BY7 J;  3OL4 A;  3EYI A;  4EM2 A;  5L3E A;  3QAH A;  4OIQ F;  2GIV A;  3V7S A;  1FLI A;  4GCV A;  1BIA A;  4RDU A;  4DGW B;  1SMT A;  1P7I A;  3NAR A;  1QZY A;  3CUQ A;  3VPR A;  4XRM A;  2FQ3 A;  3X2Q H;  1BA5 A;  4E6K G;  1LDK B;  4E7K A;  2GQQ A;  2R3S A;  3BR1 A;  3FWE A;  2WB1 A;  3UR3 C;  1TWA J;  3W2V A;  1SD6 A;  2R7W A;  3B6C A;  3ERM A;  3SZT A;  1FTZ A;  2BVL A;  2Q1Z B;  5FFZ A;  5CQG A;  1J0R A;  3BTC A;  4JQF A;  1NK2 P;  4EGZ A;  4XOR A;  1FOW A;  2JRM A;  5FKK A;  3HOS A;  5ILU A;  1HC8 A;  5TIS C;  1FOK A;  2IS2 A;  2KIM A;  1XCV A;  4V2F A;  4MEX F;  3T8T A;  1AKH B;  4I7H A;  1EH7 A;  3RZO J;  1FIA A;  4CZC A;  2HYG D;  1IRF A;  4AUX A;  1JKR C;  3P5J A;  1A31 A;  5DEQ A;  2W84 A;  4HYE A;  5F0C A;  4BBR J;  4V19 K;  4HEA 2;  1WPK A;  2MYS A;  3DP7 A;  2JN6 A;  1IUY A;  1Q1H A;  1OYY A;  1HF0 A;  5L3G A;  4OIN F;  1XS9 A;  1ETY A;  4BQN A;  4WXD A;  5EG0 A;  1TLH B;  5CQE A;  4X6A J;  2RN7 A;  4XL9 A;  5GAH J;  4M72 A;  1B8I B;  2XF6 A;  1JKQ C;  4HG2 A;  2V6E A;  2M87 A;  2XGE A;  3JTH A;  1XMK A;  4PGG A;  1B9M A;  1JUP A;  2VKE A;  1V4R A;  1K7A A;  4OMZ A;  2NRA C;  5IYC J;  4XIC A;  3BZC A;  1GXQ A;  1IN5 A;  3CC2 I;  4D0P A;  2OJE D;  3H5A A;  3I59 A;  3TBI A;  1SD7 A;  5FB2 A;  2IT0 A;  1EH6 A;  1LE8 A;  2RQP A;  2VE9 A;  2HZT A;  3OR2 C;  1FSE A;  1ZYR F;  2DCE A;  2ECC A;  3VSL A;  4DBR A;  4E7I A;  4JX6 A;  1HQC A;  3P9I A;  4M3D A;  4NBQ A;  4A3C J;  1OR7 A;  1FSH A;  2ME6 A;  1R5I D;  1XDU A;  3ZMS A;  2V7F A;  2DDB A;  1H89 C;  3ZMD A;  4CYC B;  2STT A;  2JWT A;  2TCT A;  2CUE A;  1Z05 A;  3BT9 A;  1TC3 C;  2WTE A;  3QU3 A;  3I53 A;  1F4K A;  3GLL A;  3IP4 B;  3CDH A;  1YX3 A;  4LK0 F;  3O6B B;  2LTP A;  2G0E A;  2ZXW H;  4A69 C;  4Y3O A;  3P9C A;  4IHS A;  3BDD A;  2HR3 A;  1RR8 C;  4KT6 A;  4UV8 A;  3GFM A;  2IEK A;  2V4J C;  2XAQ A;  2CQN A;  1IRX A;  1OPC A;  4IHV A;  3PIO F;  4C2M J;  2GWR A;  1MDM B;  1OJL A;  4DQ2 A;  4UVC A;  1U0J A;  3TW7 A;  4O6J A;  1FIP A;  1YYV A;  4FE7 A;  5IT9 Z;  4W1U A;  1MD0 A;  4M3F A;  5J3L A;  5FD6 A;  2K9M A;  2X6Y A;  5J4V A;  2YX7 A;  1KYZ A;  1MGT A;  5F0H A;  2COM A;  1MBG A;  2W1O A;  4UUS A;  1G4D A;  3EUA A;  5LD2 C;  1EKE A;  2ISY A;  4KJZ A;  3Q9S A;  2VPR A;  1F5T A;  3WTY C;  2XGD A;  2EIK H;  2EIN H;  3KP5 A;  2HPM A;  4IQJ A;  3IRQ A;  4LG0 A;  1GDT A;  1HW5 A;  2FQ4 A;  2Z3Y A;  1IG7 A;  1IRZ A;  1G6N A;  2QZ8 A;  2WV0 A;  3BJ6 A;  5M5W J;  1ITY A;  4J19 A;  3AKZ A;  2EB7 A;  2QSH X;  2NNN A;  3R60 A;  4LIV A;  1K4T A;  1G59 A;  3A01 B;  2Y0S N;  3A2K A;  2J5O A;  1XSX A;  2FUG 2;  2H6C A;  2AXL A;  4DOZ A;  4ZYH A;  1YTY A;  2MD0 A;  5FO5 A;  2STW A;  3WGI A;  3BJA A;  2PFB A;  2O6G E;  4PJL A;  5L3B A;  3DBR B;  5BOX A;  3IKT A;  1BOA A;  3ROU A;  4L5J A;  4BE0 A;  4F52 A;  4RAG A;  3MVP A;  2W85 A;  3T8R A;  3SJM A;  2CJJ A;  3VB2 A;  2MLG A;  2LKX A;  1ETQ A;  4FIS A;  3HOW J;  3E6M A;  4RBO A;  3IAM 2;  1N25 A;  2IA2 A;  3VOD A;  4HZF A;  3DTI A;  5KCM A;  4I6Z A;  1G3W A;  1OMI A;  1FX7 A;  4U0Y A;  2X1C A;  4M6X A;  3HSR A;  5ILV A;  1ETW A;  1ONV A;  1SFK A;  4F91 B;  5LRS A;  2NNY A;  5F08 A;  1VQM I;  3SFZ A;  2ZB9 A;  4BHP A;  1ZG1 A;  1OLT A;  4O5V A;  3WTU C;  2R7F A;  5F27 A;  2N8G A;  4ZDP A;  2V9V A;  2VLA A;  1YIJ I;  2HYJ A;  1CGP A;  4IHY A;  1MSF C;  3I64 A;  1DPU A;  1ZKG A;  1X19 A;  1PVE A;  2V79 A;  4RLQ A;  5GTI C;  1IF1 A;  2VQG A;  3S2D J;  1WJ5 A;  2JT1 A;  5B1A H;  5K7F A;  2L0K A;  3S16 J;  1A6I A;  1LVK A;  2OAZ A;  2DJI A;  2OU2 A;  1ZK8 A;  4XBF A;  4LB5 A;  3V7C A;  3ZRG A;  1UFM A;  1HDP A;  1L0O C;  1KQ8 A;  1FEX A;  2HTJ A;  5LHI A;  3KLN A;  2B9S A;  5L3D A;  4ESJ A;  2Z5U A;  2PX9 A;  1WWX A;  3EUK L;  3V4G A;  4LLL A;  5JI6 A;  4OAY A;  1WJE A;  3K1N A;  1AKH A;  3J7A O;  1FT9 A;  5KAI C;  3LQR A;  2ZJR F;  2AQF A;  3PSI A;  5JHF A;  2DT5 A;  4PGH A;  1WJD A;  5EGO B;  4L5I A;  2ZCW A;  3A0B C;  3F72 A;  3GFI A;  3GEZ A;  2NAZ A;  3ECH A;  4J00 A;  5F64 A;  2Q2E B;  1X4P A;  2X1D A;  4HF1 A;  5FKL A;  1TQI A;  1IRG A;  2R4G A;  3E6C C;  2WBM A;  2KIQ A;  4QPO A;  1E3O C;  3CCJ I;  5K1Y A;  1EH8 A;  2F4M B;  2C6Y A;  1QGP A;  2BZT A;  3OS0 A;  1B8I A;  3AG2 H;  4AIK A;  4AVZ A;  1JT0 A;  4KT5 C;  3R0A A;  2LR8 A;  1XGN A;  1ZAR A;  5BPD A;  4ASN A;  3I58 A;  4A12 A;  2CMP A;  1O7F A;  1YIO A;  1ZLK A;  1SAU A;  1U78 A;  1JE8 A;  4OMY A;  4D7N A;  3I4P A;  2W00 A;  2E1C A;  2YS9 A;  3CUQ C;  2M0M A;  4EJW A;  3FZV A;  5HS9 A;  4BHB A;  4XSZ F;  3J7A Y;  1D0X A;  3RKW A;  1DQU A;  1F9N A;  3AG3 H;  2DA6 A;  4Y52 J;  1A5J A;  2RKH A;  4PK4 A;  4FQG A;  1PP7 U;  2QWW A;  2L7K A;  1YE9 A;  1YLF A;  2RDP A;  4L9T A;  3ISP A;  1FOY A;  3QPL A;  2Z16 A;  1Y56 A;  2E7W A;  2MFZ A;  2ZNZ A;  1STZ A;  4GYI A;  4IXA A;  3OIP A;  5ICF A;  2R7T A;  2LY9 A;  5J8C A;  1W0T A;  4A3D J;  2A05 A;  4CYC A;  1MKM A;  3H9J A;  3ONQ A;  2DFH A;  3RQ4 A;  2R5Z B;  4IJA A;  4KIB A;  1TP4 A;  3I0T A;  3IWZ A;  1ON1 A;  5HVQ C;  1VI0 A;  1HKT A;  5EDN A;  3EPZ A;  4HX7 A;  2PN6 A;  1WJC A;  1TL8 A;  3S2W A;  4UHT A;  4I2O A;  4P1W A;  4Y13 A;  5LLQ A;  2DOF A;  1MH3 A;  2ECB A;  5DD8 A;  3WGH A;  1GVD A;  1HA8 A;  3K69 A;  2HVQ A;  2NOG A;  3HYI A;  4A0X A;  2XF5 A;  1XGS A;  1IN6 A;  4OIO F;  1NG7 A;  1MDM A;  5L3C A;  1MBE A;  2VT3 A;  3KEQ A;  4M3G A;  3DKX A;  3WG9 A;  4FX0 A;  2G7U A;  1QHG A;  3K4L A;  4Q48 A;  1DGR M;  1LQ1 A;  1R7J A;  3OOU A;  3C2H A;  3PQK A;  2R7R A;  1DP3 A;  1XN7 A;  4HV6 A;  5EEG A;  3HG9 A;  1VND A;  1B59 A;  3FBI B;  2XPU A;  3GUD A;  4UVA A;  5ILS A;  5JVT A;  1KA8 A;  2FNA A;  5FD5 A;  3KCC A;  1H0M A;  4C9Y A;  1ZRE A;  4UY8 I;  5J6X A;  4EV0 A;  3R0J A;  1D8K A;  3A4C A;  1WGX A;  2AO9 A;  3R4K A;  1R49 A;  2OA4 A;  2DA2 A;  4IVN A;  1MMS A;  3GTK J;  5FRO A;  2DO7 A;  3A01 A;  2NVY J;  4ANJ A;  1TWH J;  1OR7 C;  1ZG3 A;  3ZQG A;  5DCM B;  1U5T A;  1IXR C;  4S0H B; 
#chains in the Genus database with same CATH homology
 5ICE A;  1HKQ A;  3RDI A;  2E1N A;  4UXN A;  1REP C;  4G94 A;  1OYW A;  2M5W A;  1QO0 D;  2L01 A;  3U9G A;  4QWQ A;  1ZGJ A;  5HLG A;  3SHF A;  3MAJ A;  1AOY A;  2LF8 A;  2H27 A;  2VOD A;  4Z2Y A;  3M8E A;  4GXO A;  4HF0 A;  2ZO4 A;  4MQ9 F;  5E8G A;  1KQ9 A;  2EA2 A;  2CO5 A;  4PDK A;  1FYL A;  3M7G A;  3V7R A;  2K7L A;  1LEB A;  1HW1 A;  1B9N A;  1IN8 A;  4YII A;  3OOP A;  3ZPL A;  1IN4 A;  4LLN A;  2HFH A;  3DXJ F;  3K1P A;  1BJA A;  4HA8 A;  2P4W A;  3O3K A;  5BQT A;  1HBX G;  3GZ6 A;  2O0Y A;  3V8J A;  4G7O F;  2JPB A;  4MNU A;  1S8N A;  2A68 F;  3I54 A;  4P5O A;  1XGM A;  2G9W A;  2M30 A;  3HSE A;  3W6K B;  3VOE A;  1T98 A;  4HAM A;  1RUN A;  3DEU A;  1T0F A;  1USS A;  5JR3 A;  1KU2 A;  4A6D A;  4GO1 A;  4P55 A;  5EEH A;  2HTS A;  2H6B A;  4OIP F;  3KZY A;  4QLC U;  4CZZ A;  2IRF G;  2BEO A;  2PJP A;  2RV8 A;  2DBB A;  1I1S A;  3JAM K;  2EV5 A;  1S3J A;  4HDV A;  1FBU A;  1R58 A;  2EJR A;  2P5L C;  4KDP A;  3DQV C;  2VBX A;  3WTT C;  1J75 A;  4KMF A;  3D0S A;  3OV8 A;  2DPD A;  1S7A A;  1R36 A;  1E2X A;  3J81 K;  2NS0 A;  2DLL A;  2KRF A;  4ESF A;  1T6S A;  1RZ4 A;  1YG2 A;  2FEZ A;  1W5T A;  4P9F A;  3R61 A;  2H09 A;  2HWV A;  5CVR A;  4I09 A;  4KN7 X;  3H3Z A;  3JSP A;  2F2E A;  1UB9 A;  4MHG A;  1UHW A;  3QOP A;  3IRR A;  4WF2 A;  3RKY A;  5LGU A;  3F8N A;  3WTZ A;  4FT8 A;  5AIP A;  3QP5 A;  1W7P B;  4GGG A;  2D45 A;  1XB4 A;  4B8X A;  2X0L A;  1R00 A;  5CJ9 A;  2A07 F;  4KFC A;  3HHG A;  3WGG A;  4KYW A;  1ON2 A;  2QQ9 A;  1R1U A;  4HLY A;  2EFP A;  1HSJ A;  1X3U A;  2DFI A;  5D5V B;  4B09 A;  5DCM A;  1FY7 A;  2FBK A;  2K86 A;  3LAJ A;  3GF2 A;  1C0W A;  2KJC A;  1PDN C;  2A6E F;  2XGX A;  4PZJ A;  2QM3 A;  2X4H A;  3EDP A;  1R5H A;  3BWG A;  2FRH A;  5LEJ A;  3HRM A;  1K79 A;  2ZME B;  2L3D A;  2CG4 A;  3W6J B;  4G8X A;  1HST A;  3WTW C;  5FLX K;  3I5U A;  4LFU A;  4E70 A;  3DFG A;  2EFO A;  2IA0 A;  1LNW A;  5F1R A;  1IW7 F;  2XAG A;  5E1W A;  1W5S A;  3GFJ A;  1TQP A;  3N97 A;  3TOB A;  5DUK A;  4P9U A;  2HKO A;  2F5C A;  4OU0 A;  4Q5S F;  2MH2 A;  2VXZ A;  3C18 A;  2K27 A;  3NQO A;  1U5T C;  2E7X A;  3QRF F;  4N9H A;  2XVC A;  3HRT A;  1KYW A;  1CF7 B;  2DW4 A;  2MH9 A;  1ZRC A;  2W25 A;  4JK1 X;  5DDG A;  4EJV A;  5E8I A;  4FHT A;  1T2K A;  1ULY A;  2EWN A;  2UXX A;  2A5Y B;  4BNC A;  4CO8 A;  3M1E A;  3C7J A;  4I02 A;  2ESN A;  5J8F A;  4ZYE A;  2ISZ A;  1B4A A;  2PQ8 A;  3RTR A;  2ETH A;  4BHC A;  2QVO A;  4EM1 A;  1VTN C;  4M9S A;  3TOA A;  1JHF A;  5A2Q Z;  5E17 F;  2VON A;  5CYV A;  3CUO A;  2MBF A;  4YG2 F;  4U7B A;  4EMS A;  4BXU A;  4H0E A;  3TQN A;  3COA C;  3ERE D;  3F22 A;  4LK1 F;  1V3F A;  1BI2 A;  1BC7 C;  5BMZ A;  2IP2 A;  2EFN A;  3BZ6 A;  2XRO A;  4MEY F;  5LGT A;  3MFK A;  4NHJ A;  4GYG A;  5L3F A;  1KU3 A;  3QPT A;  1RNL A;  5D6F A;  1LJ9 A;  4LLG F;  4BYY A;  3KP2 A;  4XLN F;  4ENM A;  1ZH5 A;  4RB3 C;  1O7L A;  2HKX A;  4HBL A;  2CYY A;  1XSV A;  2QQB A;  4CDG A;  5CVU A;  4LJZ F;  1BI3 A;  4S05 A;  3K0L A;  1Z6R A;  4HW0 A;  3F3X A;  3TKY A;  2FML A;  1D3Y A;  1YFH A;  1I1G A;  4AVP A;  2FU4 A;  1R1V A;  2B0L A;  4RGS A;  2HGC A;  4EGY A;  1J2X A;  3K2Z A;  4G7H F;  1WRJ A;  2HQN A;  1LVA A;  5AON A;  2YR2 A;  2JPC A;  2VOP A;  3CO7 C;  3J80 K;  1P92 A;  1OYI A;  4I0A A;  1TW3 A;  5BS6 A;  2ZME A;  2BGC A;  2GA2 A;  1SFE A;  4RAZ A;  5HDK A;  3T0Y A;  5JHU A;  4XLP F;  4M6Y A;  3EQL F;  1IAW A;  1K78 B;  1YO5 C;  2LSO A;  1ZGA A;  2GAU A;  1WI9 A;  4EVI A;  1FZP B;  3WU0 A;  4OOI A;  1O3Q A;  4HOB A;  2IW5 A;  5D5X B;  4ON0 A;  4KIC A;  1OKR A;  1SAX A;  2O61 A;  3C1D A;  1A04 A;  4OIR F;  5LEK A;  3E5X A;  4LGW A;  4G6Q A;  1I5Z A;  1BM9 A;  3GX4 X;  2RGV A;  2F5D A;  5ED4 A;  1FNN A;  5D4R A;  2P8T A;  2Y48 A;  2GXB A;  4L9V A;  1TBX A;  3HUG A;  2QBY B;  4KNY A;  2P7V B;  1SMY F;  1CF7 A;  4I0B A;  3ZN1 A;  2FE3 A;  2DU9 A;  1ZLJ A;  2BBY A;  3F6V A;  1J9I A;  2QLZ A;  1QBJ A;  3BPX A;  3HTS B;  1HW2 A;  1G3T A;  2ZKZ A;  1H9G A;  5DCF A;  2A61 A;  2VE8 A;  2VOO A;  3KZZ A;  3ABU A;  2VBY A;  3R6S A;  3ZN0 A;  5H20 A;  3B02 A;  2H94 A;  1TNS A;  2JTV A;  2DK5 A;  1GXP A;  1J5Y A;  2ZFW A;  4BH9 A;  3FX3 A;  1Z91 A;  1PUE E;  3P9K A;  2KIU A;  3RPU A;  1FBS A;  2CSO A;  2LF7 A;  5D8K B;  5KVR A;  3F8C A;  3JAM Z;  3BRO A;  3E6B A;  4KIF A;  3MEX A;  4CIC A;  3HRS A;  1DP7 P;  4R8H A;  5E20 A;  3ZMV A;  4LMY A;  2DTR A;  2P6S A;  3E5Q A;  3J81 Z;  3ZMU A;  3U1D A;  2V1X A;  4CYD A;  2CQK A;  3BOQ A;  2DQR A;  4YIF A;  3GXO A;  1O3S A;  2K4J A;  5DUI A;  4EQQ A;  1QNT A;  4M71 A;  4HQE A;  1J7K A;  5HS7 A;  3O2P E;  2ZJ2 A;  1RI7 A;  5HLI A;  4MQV A;  1WQ2 A;  4RB1 A;  1YS7 A;  3DV8 A;  4HV5 A;  2FXA A;  3WE2 A;  3MQ0 A;  1HXD A;  2LKP A;  3CUQ B;  1XDS A;  2OQR A;  3V8K A;  5IT3 A;  2JSC A;  4R79 A;  3AAF A;  2FOK A;  1FWZ A;  3KLO A;  4R1H A;  3FXR A;  3FMS A;  3TO6 A;  4KUM A;  3MWM A;  4CXF A;  1E17 A;  1TTY A;  4PCQ A;  2V6C A;  5HDN A;  4P96 A;  4XSX F;  3TGN A;  3G3Z A;  2W57 A;  3CTA A;  1BBY A;  1XSD A;  1K78 A;  4EJO A;  4CHU A;  3ELK A;  4LB6 B;  1I27 A;  1S7O A;  2OD5 A;  3IKV A;  3ZMT A;  1MJA A;  2Q2E A;  1T39 A;  2MC3 A;  2PMU A;  3HRU A;  1TW2 A;  1YS6 A;  4ENN A;  5CLS A;  3B73 A;  2FBI A;  3CLO A;  2IJL A;  4EJU A;  2CWE A;  1UCR A;  2MLK A;  5FGM A;  2GXG A;  4WWC A;  1PP8 F;  2FMY A;  3I59 B;  5D5W B;  4IRI A;  2QBY A;  2PMH A;  2XAS A;  3MZY A;  1G3Y A;  2J5P A;  2XRN A;  1DUX C;  3V8L A;  2KKO A;  4KIG A;  3LST A;  2ACJ A;  4YFX F;  2FF4 A;  2VT2 A;  3F6O A;  5HS8 A;  2HS5 A;  4HQM A;  4XRF A;  2QYO A;  4A2U A;  1KGS A;  4IPA A;  5ERI A;  1SD5 A;  3E97 A;  3ECO A;  1JXS A;  1YW7 A;  2CGP A;  4G7Z F;  1S29 A;  1U6G A;  4RS8 A;  3KP3 A;  4RB2 C;  3GYH X;  4L9J A;  1LB2 A;  4KMU X;  2PI0 A;  1SD4 A;  5FFX A;  2EA4 A;  1GHC A;  2O3F A;  5DV5 A;  3WTS C;  2XAF A;  3DF8 A;  1ZN2 A;  2RC4 A;  4Q4Z F;  3GLX A;  3ZQ7 A;  4N0B A;  3REO A;  4L0Y B;  4TV7 A;  1I6X A;  1XGO A;  3KET A;  4N9I A;  4RAY A;  3RIR A;  2MA3 A;  3EET A;  4MGR A;  1S6L A;  5HDG A;  1J59 A;  2O03 A;  3RJP A;  1W7P D;  3NRV A;  3IWF A;  1F1Z A;  1U2W A;  2GA1 A;  2P6T A;  3T5X A;  4JBA A;  1K6O A;  4UUV A;  1FYM A;  1YW9 A;  3M9A A;  2A6H F;  4ZYG A;  2ESH A;  2OZ6 A;  5E1X A;  1O3R A;  4UNO A;  3PQJ A;  1D5V A;  2XIG A;  3ABT A;  2WWY A;  2K4B A;  2F5E A;  1TQM A;  3FXU A;  4A6E A;  5AIQ A;  1L3L A;  3HHH A;  5H6Q A;  4L9N A;  1O3T A;  2A3S A;  2CW0 F;  4ENJ A;  5ICC A;  1B6A A;  2DQL A;  2Y75 A;  3J80 Z;  2WC2 A;  4WX9 A;  3KE2 A;  4YFN F;  3HOT A;  3LWF A;  3JSO A;  1WKM A;  1DPR A;  4FX4 A;  3RKX A;  4U88 A;  1LDD A;  4I98 B;  4Y15 A;  1ZHF A;  2M1B A;  1BC8 C;  2FSW A;  1DDN A;  1BIB A;  2K02 A;  5F6F A;  3I71 A;  2Q0O A;  3WTX C;  4ENK A;  2FNP A;  3WE3 A;  3LFK A;  2DI3 A;  4RB0 A;  1XCB A;  1Z9C A;  3ZP5 A;  3F8M A;  4NB5 A;  1RIO H;  3E6D A;  3BY6 A;  3GWZ A;  4K2E A;  3K1M A;  3LA3 A;  3RI4 A;  4ESB A;  2EV6 A;  2TDX A;  4EJT A;  2KJB A;  4F7Z A;  2QQA A;  4L0Z B;  3JTG A;  3IC7 A;  2M8E A;  5KK1 A;  3GZ5 A;  2LNB A;  3HSF A;  3KFW X;  4A5M A;  2M45 A;  2DPU A;  1NHA A;  1UST A;  4U0V A;  1U3E M;  4WXH A;  2LDU A;  3MCZ A;  2VN2 A;  2FBH A;  2PBI A;  2HOE A;  4A0Y A;  4Q47 A;  3U2R A;  4LD5 A;  3QU6 A;  3CJN A;  4L18 B;  1W7P A;  1XD7 A;  3G73 A;  2RNJ A;  1MZB A;  2ADU A;  2L4M A;  2A69 F;  2P5V A;  2UZK A;  1QZZ A;  1MJ9 A;  4AIJ A;  3ULQ B;  3DPL C;  1IXS B;  2GZW A;  4HLX A;  1U5T B;  5D5U B;  1LDJ A;  4NQW A;  4S04 A;  4ZYD A;  2XV4 S;  1FP1 D;  2XKO A;  3L09 A;  1G3S A;  1BI0 A;  3GW2 A;  3LA2 A;  3MZH A;  4HF2 A;  3SXY A;  2XUB A;  3N4M A;  5K5Q A;  4ZZL A;  1MJB A;  4Y17 A;  1IZ1 A;  4A5N A;  2F5F A;  2IA1 A;  5CVI A;  2DK8 A;  1AWC A;  1YW8 A;  2D2W A;  3KP7 A;  4HX8 A;  2YU3 A;  1JHH A;  2ZNY A;  2XHK A;  2BE5 F;  1R5G A;  1O57 A;  3SQN A;  5K5R A;  3GVA A;  1Y0U A;  3L00 A;  3Q9V A;  4G9Y A;  3L9F A;  4BAY A;  5E18 F;  1T38 A;  3HTU A;  4IRG A;  2OZU A;  3F21 A;  1P4A A;  3L2C A;  2HDC A;  4RGU A;  4HDU A;  1W4M A;  3EUH A;  3H3U A;  1GVJ A;  5A2Q K;  4G6D A;  1KQ0 A;  1FYK A;  4O3M A;  3FM5 A;  2QEN A;  1SFU A;  3F23 A;  5IT9 K;  1B1B A;  4ETS A;  4MTD A;  3KP6 A;  1TNT A;  2L4A A;  2Z9O A;  4U7D A;  3L7W A;  4IF4 A;  5HLH A;  3BJO A;  1R1T A;  4IHT A;  2HYF A;  1ZAO A;  1ZG5 A;  4RGX A;  1SFX A;  3TO9 A;  5DYM A;  1UHM A;  2AS5 F;  2Z99 A;  2EFW A;  3GO5 A;  3RYP A;  4AWX B;  3QPH A;  2EK5 A;  4ZH4 F;  2VC1 A;  1EV7 A;  6PAX A;  3K9T A;  2MD5 A;  2QUF A;  1FC3 A;  2R7D A;  3LAP A;  3ZMZ A;  4KA4 A;  1Z6T A;  2ZXJ A;  3FM3 A;  3H92 A;  3FXQ A;  3HIF A;  5D6E A;  5LBQ A;  1HKS A;  4M9X A;  1RUO A;  2Y0M A;  1ZRF A;  2OQG A;  2O8X A;  2JRT A;  4M9Z A;  2W24 A;  2Q8K A;  5D4S A;  1QQI A;  3RPQ A;  2RVC A;  4WK8 F;  3T1B A;  5TJJ A;  2XAJ A;  4YFK F;  3P7N A;  3DPT A;  5H6R A;  2EFQ A;  4A0Z A;  2PEX A;  1ZRD A;  2ELH A;  2Z33 A;  5LRR A;  2JZY A;  3ML6 A;  3TDU C;  3VFZ A;  1BN5 A;  5DD4 A;  1Z7U A;  1FBQ A;  1LEA A;  4U0W A;  3WU1 B;  1IN7 A;  2IVM A;  3QP6 A;  4IRH A;  3FHZ A;  5HOO A;  5TRD A;  3PFI A;  2NYX A;  3SZP A;  3JW4 A;  1P4X A;  1R23 A;  3TO7 A;  2D1H A;  2BV6 A;  2VBW A;  2VBZ A;  3LQQ A;  3NEU A;  2YSR A;  2PLY A;  1YQA A;  5K5O A;  2IPQ X;  4HX4 A;  5LGN A;  4WXC A;  2P5K A;  2HQR A;  5FLX Z;  2YX4 A;  2D1V A;  3WTV C;  3C3W A;  2VC0 A;  3DKW A;  5JFR A;  4UV9 A;  3LA7 A;  4M74 A;  1P2F A;  5D8L B;  3F8F A;  4CGZ A;  3WOD F;  2XKP A;  3FMR A;  4BQA A;  2UXN A;  3BPV A;  3IHU A;  3BP8 A;  1WSU A;  5CVJ A;  4RGR A;  3FMQ A;  2XAH A;  1XMA A;  1H9T A;  1FP2 A;  2FA5 A;  2YPR A;  1FPQ A;  2BYV E;  1BI1 A;  4MTE A;  4I01 A;  1ODD A;  4UVB A;  3GFL A;  1KU7 A;  5CVV A;  2L02 A;  2V1U A;  3EYY A;  1U8R A;  1Z1D A;  2UWM A;  3Q5F A;  3TDZ C;  3E3V A;  3M8F A;  2EV0 A;  3F8B A;  4LG0 B;  3D5L A;  1P4W A;  4AIH A;  1KU9 A;  2CFX A;  3E5U A;  4KN4 X;  2DAO A;  4DNC A;  2ZBK A;  5ICG A;  2L54 A;  3FF5 A;  5LHG A;  1QPM A;  3RYR A;  1P6R A;  1R22 A;  5LHH A;  3KEO A;  2PG4 A;  3IL2 A;  2OBP A;  3CO6 C;  4AD9 A;  4ZZD A;  2G7H A;  5BPI A;  2P7C B;  2KIF A;  4WCG A;  2V1D A;  2HEO A;  4EM0 B;  3VEP A;  1JGS A;  1D8J A;  1IXC A;  5E1Z B;  4M73 A;  3KP4 A;  3EYI A;  4EM2 A;  5L3E A;  3QAH A;  4OIQ F;  2GIV A;  3V7S A;  1FLI A;  4GCV A;  1BIA A;  1SMT A;  1QZY A;  3CUQ A;  2FQ3 A;  1LDK B;  2GQQ A;  2R3S A;  3FWE A;  1SD6 A;  3SZT A;  5FFZ A;  1J0R A;  4JQF A;  4EGZ A;  3HOS A;  5ILU A;  1FOK A;  2KIM A;  1XCV A;  4MEX F;  3T8T A;  4I7H A;  1EH7 A;  2HYG D;  1IRF A;  5DEQ A;  2W84 A;  4HYE A;  3DP7 A;  1IUY A;  1Q1H A;  1OYY A;  5L3G A;  4OIN F;  4WXD A;  1TLH B;  2RN7 A;  4M72 A;  2M87 A;  3JTH A;  1XMK A;  4PGG A;  1B9M A;  1V4R A;  1K7A A;  4OMZ A;  2NRA C;  1GXQ A;  1IN5 A;  4D0P A;  3I59 A;  1SD7 A;  5FB2 A;  2IT0 A;  1EH6 A;  2RQP A;  2VE9 A;  2HZT A;  1FSE A;  1ZYR F;  1HQC A;  3P9I A;  1OR7 A;  1FSH A;  1XDU A;  3ZMS A;  3ZMD A;  2STT A;  1Z05 A;  2WTE A;  3QU3 A;  3I53 A;  1F4K A;  3CDH A;  4LK0 F;  3O6B B;  3P9C A;  4IHS A;  3BDD A;  2HR3 A;  4UV8 A;  3GFM A;  2XAQ A;  1OPC A;  2GWR A;  1MDM B;  4DQ2 A;  4UVC A;  4O6J A;  1YYV A;  5IT9 Z;  1MD0 A;  5FD6 A;  2YX7 A;  1KYZ A;  1MGT A;  2COM A;  1G4D A;  2ISY A;  3Q9S A;  1F5T A;  3WTY C;  3KP5 A;  3IRQ A;  4LG0 A;  1HW5 A;  2Z3Y A;  1G6N A;  2QZ8 A;  2WV0 A;  3BJ6 A;  2EB7 A;  2NNN A;  3R60 A;  2J5O A;  1XSX A;  2H6C A;  2AXL A;  4ZYH A;  1YTY A;  5FO5 A;  2STW A;  3WGI A;  3BJA A;  2PFB A;  2O6G E;  5BOX A;  5L3B A;  3IKT A;  1BOA A;  3ROU A;  4L5J A;  2W85 A;  3T8R A;  3VB2 A;  2MLG A;  3E6M A;  2IA2 A;  3VOD A;  4HZF A;  1G3W A;  4U0Y A;  1OMI A;  1FX7 A;  4M6X A;  3HSR A;  5ILV A;  1ONV A;  5LRS A;  2NNY A;  3SFZ A;  4BHP A;  1ZG1 A;  4O5V A;  3WTU C;  2R7F A;  2V9V A;  1CGP A;  1DPU A;  3I64 A;  2V79 A;  1IF1 A;  2JT1 A;  2OAZ A;  2OU2 A;  4XBF A;  4LB5 A;  3V7C A;  1UFM A;  1L0O C;  1KQ8 A;  2HTJ A;  5LHI A;  3KLN A;  5L3D A;  4ESJ A;  2Z5U A;  1WWX A;  3V4G A;  4LLL A;  5JI6 A;  3K1N A;  3J7A O;  1FT9 A;  3LQR A;  2DT5 A;  4PGH A;  4L5I A;  2ZCW A;  3F72 A;  3GFI A;  3GEZ A;  2NAZ A;  3ECH A;  5F64 A;  4HF1 A;  1IRG A;  1TQI A;  3E6C C;  5K1Y A;  1EH8 A;  2C6Y A;  1QGP A;  4AIK A;  4KT5 C;  3R0A A;  1XGN A;  1ZAR A;  5BPD A;  4ASN A;  3I58 A;  4A12 A;  1O7F A;  1YIO A;  1ZLK A;  1U78 A;  1JE8 A;  4OMY A;  3I4P A;  2E1C A;  3CUQ C;  4EJW A;  3FZV A;  5HS9 A;  4BHB A;  4XSZ F;  3RKW A;  1F9N A;  2RKH A;  1PP7 U;  2QWW A;  1YLF A;  2RDP A;  4L9T A;  3ISP A;  2E7W A;  4IXA A;  2ZNZ A;  1STZ A;  4GYI A;  5ICF A;  5J8C A;  1MKM A;  4IJA A;  4KIB A;  3I0T A;  3IWZ A;  1ON1 A;  5HVQ C;  1HKT A;  4HX7 A;  2PN6 A;  3S2W A;  4UHT A;  4I2O A;  4Y13 A;  5LLQ A;  5DD8 A;  3WGH A;  3K69 A;  4A0X A;  3HYI A;  1XGS A;  1IN6 A;  4OIO F;  1MDM A;  5L3C A;  2VT3 A;  3KEQ A;  3WG9 A;  4FX0 A;  2G7U A;  4Q48 A;  1LQ1 A;  1R7J A;  3PQK A;  1XN7 A;  4HV6 A;  5EEG A;  1B59 A;  3GUD A;  4UVA A;  5ILS A;  5JVT A;  1KA8 A;  2FNA A;  5FD5 A;  3KCC A;  1H0M A;  1ZRE A;  5J6X A;  4EV0 A;  3R0J A;  1D8K A;  3R4K A;  2OA4 A;  4IVN A;  2DO7 A;  1ZG3 A;  5DCM B;  1U5T A;  1IXR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...