1UHMA

Solution structure of the globular domain of linker histone homolog hho1p from s. cerevisiae
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
EASSKSYRELIIEGLTALKERKGSSRPALKKFIKENYPIVGSASNFDLYFNNAIKKGVEAGDFEQPKGPAGAVKLAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H1
publication title The linker histone homolog Hho1p from Saccharomyces cerevisiae represents a winged helix-turn-helix fold as determined by NMR spectroscopy.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 20
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2003-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1uhmA00
4P96A 4BHCA 3GZ6A 4GYGA 4CDGA 2OD5A 4BAYA 3IRRA 3O3KA 5CYVA 3M9AA 4A0YA 4HDVA 3K9TA 3V8JA 1D3YA 3MEXA 2PBIA 1TW2A 5E1ZB 1MDMA 1FYLA 1R1VA 4HZFA 4OINF 3SXYA 3EUHA 1U5TA 2NNNA 1IRGA 1KQ8A 2KIUA 2XKOA 2Z99A 4OIRF 1KYWA 2V1DA 3I4PA 4QWQA 3GYHX 4HYEA 1EH7A 3BZ6A 1KGSA 4GYIA 3BOQA 5LHIA 4AWXB 3T5XA 3CDHA 2C6YA 2NAZA 2BYVE 1PP8F 1B9MA 2LF7A 4HF2A 3E6MA 1ZLKA 3ISPA 3DKWA 1RIOH 3JTGA 3I54A 3ZMSA 3FMRA 3RTRA 4EJOA 1HSTA 4OMYA 2FNPA 4UHTA 3WU0A 4ZYDA 4AIJA 3RI4A 5D8KB 4EJTA 2O61A 4M9XA 3REOA 5D5UB 3TKYA 1BI3A 5FO5A 4KT5C 3ERED 3QRFF 4YIFA 3FWEA 1G3SA 3WTVC 3TQNA 4N9HA 4JQFA 3F8BA 4A6EA 5L3GA 2W84A 3ZMDA 4RGUA 4ZYEA 2MLKA 5KVRA 3L7WA 4MHGA 4R1HA 3SZPA 4YFXF 1HKTA 1IZ1A 1K78A 4YG2F 4L9NA 1YQAA 4KYWA 1EH8A 2DLLA 2ZNZA 3P9IA 5E18F 2Q8KA 2K86A 2L01A 2FU4A 4CHUA 2FMYA 1IN6A 4IHSA 1IXSB 2WWYA 1R5GA 3WG9A 2XAQA 2ISYA 3JSPA 3TDZC 1UHWA 3HUGA 2VBXA 4HX8A 1KQ9A 4OIQF 3K0LA 4M74A 3RPQA 4NQWA 1DPRA 1R36A 2HTSA 2ADUA 1L0OC 1I1SA 3M7GA 1A04A 2LKPA 3CUOA 1J2XA 2DK8A 1ULYA 4ESJA 3IWZA 3E6CC 1P2FA 2P6TA 5JI6A 2EB7A 2RC4A 4MTDA 4E70A 3TDUC 4QLCU 4I0BA 3J80Z 4ENJA 4HAMA 3ZMVA 1Z7UA 2HKOA 3RIRA 1ONVA 2L4MA 1QZYA 3WE3A 4PGGA 2F2EA 2IVMA 5BS6A 1S7AA 1BOAA 1MD0A 3J81K 4KMUX 4R79A 2OBPA 3TO7A 4KNYA 1D8KA 3V7RA 2HDCA 4IJAA 3QPTA 1QO0D 3WGIA 4U7DA 2JPCA 3CUQC 3LWFA 1SFUA 4HDUA 2HYFA 5FFZA 3V4GA 1HW1A 3ULQB 1GXPA 3HIFA 1YYVA 3DEUA 5LBQA 4EM1A 4ENMA 1SMTA 1OR7A 4Y17A 1FNNA 1R23A 4MGRA 2VT2A 3T1BA 1HQCA 3K69A 3ABUA 3MWMA 2JTVA 1FWZA 1ZLJA 3Q5FA 1YW9A 4D0PA 4L0YB 5D8LB 2H6BA 2PQ8A 2KKOA 1USTA 1K7AA 4LB6B 4UUVA 1XGNA 3DP7A 3WTXC 3GFIA 2DPUA 5DDGA 4HF1A 5CVIA 3KP4A 2HS5A 5E8IA 2TDXA 3GO5A 1NHAA 5H6QA 1D8JA 1SAXA 1BI1A 2IT0A 1ZAOA 3S2WA 3EETA 1P4WA 3P9KA 1U78A 2DO7A 4WXHA 2EFQA 2RQPA 3GLXA 4RS8A 4MNUA 1ODDA 4LLNA 1USSA 1QQIA 4XRFA 2WTEA 4S05A 5HLIA 2L4AA 2BGCA 3IKTA 4KFCA 1RZ4A 5BMZA 2F5DA 3WTZA 1ON1A 2ELHA 5JFRA 4LJZF 2ZO4A 2P7CB 3TGNA 1DPUA 3BPVA 4ZZLA 3EYYA 4B8XA 2A61A 2YU3A 3L09A 5J6XA 4LG0B 4RAZA 4BYYA 1FY7A 2QM3A 1PDNC 1KA8A 3BJAA 3P9CA 2HWVA 2AS5F 5ICGA 4BHPA 3E97A 4MQVA 2Y0MA 2XASA 1ZHFA 4KN7X 4WXCA 3VODA 3KLNA 3F72A 4IPAA 5J8CA 3H3ZA 3IHUA 1R7JA 3HSRA 1B9NA 1BJAA 4LB5A 3ZMTA 2A69F 1OYWA 1F9NA 1FSEA 4MEYF 4I0AA 1G3WA 2LSOA 2ZBKA 1K6OA 4BNCA 2K4BA 1CF7A 1R22A 2ZMEA 5H6RA 3FMSA 1FLIA 1XDSA 3LA7A 1MDMB 4UNOA 3GEZA 5L3CA 2ESHA 4L9VA 4WF2A 1U5TB 5K1YA 2DPDA 3LA3A 1XCBA 3MFKA 4ASNA 2P5LC 2ZFWA 3CJNA 5D6EA 2K02A 5LLQA 1O3TA 2CGPA 2DAOA 1ZG5A 4PZJA 1O3RA 2ISZA 1B1BA 5E20A 1RI7A 5ILUA 3C7JA 2FE3A 1T6SA 2DBBA 1PP7U 1ZGAA 4ETSA 1ZRDA 4RB2C 2MA3A 1MGTA 2QWWA 2A07F 3WTWC 1EH6A 2JZYA 3VOEA 2EJRA 3MCZA 3FXQA 3NQOA 3ZMUA 4BH9A 3HSEA 2V6CA 4JBAA 1O3SA 3RPUA 4TV7A 5DCFA 4XSZF 3B73A 3KP7A 1B59A 5J8FA 1W4MA 3JSOA 4P55A 1BM9A 1JGSA 2D2WA 4DQ2A 5D4SA 2VC1A 2GWRA 4WWCA 1FC3A 2M87A 3BROA 2XAJA 3RJPA 2HEOA 1ZG3A 1L3LA 4WK8F 4A6DA 1J0RA 5IT9K 1LEBA 4BHBA 4EM2A 3R0AA 1E17A 1FBUA 1K78B 2H09A 2W24A 3Q9SA 2W85A 1U3EM 3HRSA 1G4DA 4I98B 3RYRA 1Z05A 4L5JA 3HYIA 1Z1DA 3ML6A 4UV9A 5HS7A 5HS9A 2Z5UA 2P7VB 1LDKB 1WWXA 4G6QA 4CICA 2ZNYA 3W6JB 5F1RA 1P92A 3F6OA 3KEOA 4AIKA 1TTYA 3LQQA 3BWGA 3VFZA 2G7HA 3KFWX 2MH2A 3V8KA 3GZ5A 2DTRA 2Z9OA 3D5LA 3RKYA 3TO6A 5ICFA 2XAFA 4N0BA 2IW5A 5BQTA 2F5EA 4I09A 4MEXF 3LSTA 5K5RA 1KYZA 1XMAA 3HRMA 1BC8C 2R7FA 1PUEE 2L3DA 2LF8A 2Q0OA 2W57A 3FXRA 2PFBA 3BDDA 1WQ2A 1UHMA 5EEGA 4CYDA 1ZH5A 4Y15A 4G94A 3QU3A 1BIBA 1KU7A 1GXQA 2X0LA 2PMHA 4PDKA 2WV0A 1FPQA 1IXCA 1I1GA 1LEAA 2OZ6A 2FBKA 2KRFA 2VE8A 1LDJA 2DQLA 2J5OA 1RUNA 3BPXA 1OYIA 4Q4ZF 1WI9A 5LHHA 5ILVA 1BI0A 4ENKA 2A6HF 3G3ZA 2V79A 5HS8A 2UXXA 2P5KA 3T8RA 3RKXA 1R00A 5CVVA 4L0ZB 4HW0A 1H9TA 4XSXF 4Q48A 3VB2A 3COAC 1QZZA 2MD5A 3GWZA 1R58A 4G7HF 1W5TA 1HW2A 1YW7A 3IRQA 2F5CA 1LJ9A 4ZYHA 4IRGA 2FSWA 3KP3A 4M9SA 2A3SA 1YS6A 2E1NA 2CW0F 1XN7A 1O7LA 3CO6C 2X4HA 3E6BA 2HKXA 2G7UA 1P4AA 4GO1A 4KUMA 4NB5A 5ED4A 2MBFA 4I01A 4ZZDA 2VOOA 5HLGA 2FA5A 1ZG1A 1VTNC 4U0YA 1KU9A 4A0ZA 1XB4A 3WTSC 2DW4A 2EFPA 2Z3YA 3I59A 3WGHA 3WODF 1SFEA 1C0WA 4HV5A 2K27A 2DU9A 3HRTA 4ZYGA 5K5OA 4EJVA 3DF8A 4A0XA 4M72A 2QLZA 2J5PA 2EA2A 1WKMA 2PLYA 4DNCA 1AOYA 2BBYA 4EQQA 2KIMA 5FFXA 2VOPA 3M8FA 1T38A 2O03A 4M73A 5FLXK 3GFLA 2QBYA 1FYKA 2DK5A 3E6DA 1STZA 1V3FA 5A2QK 2FF4A 4I2OA 5AIPA 2XIGA 2OQRA 4JK1X 1H0MA 1AWCA 3PQKA 2UZKA 1RUOA 4OMZA 3SZTA 1KU3A 3L00A 2VODA 3R0JA 3JTHA 4EGYA 4I7HA 3K1NA 5E1XA 2RV8A 2A5YB 4IRIA 1O7FA 4UVAA 2PMUA 2D1HA 1CF7B 2ZMEB 2B0LA 3L2CA 3QP5A 2QQAA 1FX7A 1T39A 5FD5A 4L9JA 1ZARA 2R7DA 1V4RA 2EV6A 1DDNA 1YW8A 3FX3A 4YIIA 1Z9CA 5D5XB 4CO8A 1R1UA 1JHFA 4GGGA 3LA2A 3VEPA 1QNTA 5D5WB 5LRRA 4M6YA 2GA1A 1MJ9A 5FGMA 3FF5A 4HBLA 2MH9A 3DPTA 2ZXJA 1T0FA 1YLFA 4CZZA 4G6DA 1IN5A 1XSVA 3MAJA 2UWMA 4KDPA 3TO9A 3ABTA 3C18A 2CFXA 5LGUA 4OOIA 1OKRA 3Q9VA 1FSHA 4IRHA 3ECOA 1REPC 3LAPA 2XRNA 3OOPA 1B6AA 1Z6RA 2M30A 5HOOA 1O3QA 4UV8A 1IF1A 1KU2A 1XGOA 1HKQA 2CG4A 3IWFA 1MJBA 3G73A 1TQIA 1R1TA 2GA2A 4OIPF 4RGXA 1XD7A 4XBFA 4RB0A 3GF2A 5LHGA 3WE2A 4O3MA 2DT5A 1U5TC 1QGPA 3EQLF 2KIFA 3BJ6A 3AAFA 1DP7P 4BXUA 1G3TA 4Z2YA 5DD8A 2LDUA 1XSDA 1SD7A 1YO5C 3LFKA 2VBYA 2EV5A 2QQBA 4GXOA 3F23A 1HSJA 3I0TA 2EA4A 1HKSA 2YX7A 3CUQA 3F8NA 1W5SA 2E7WA 5D5VB 3KCCA 1JHHA 1FT9A 2QYOA 2H6CA 3F8CA 4LK0F 3I53A 2IPQX 1S29A 1W7PA 3LAJA 3WTUC 3ZP5A 2CYYA 2HYGD 4N9IA 3HHGA 1XCVA 3TOAA 2K4JA 1G3YA 3WTYC 2Q2EA 1BC7C 3JAMK 3W6KB 4CXFA 2XV4S 5CJ9A 1XGSA 2FMLA 3E5UA 5DUIA 1ZREA 3E3VA 4HF0A 4L9TA 1F4KA 5DV5A 1FBSA 1TBXA 2F5FA 4EMSA 1WRJA 4O5VA 4A2UA 2GAUA 1R5HA 1OYYA 3J81Z 3V8LA 3IC7A 1JE8A 1S3JA 4KIFA 4P5OA 5JHUA 3CLOA 2EFWA 1U6GA 3F6VA 1S8NA 3J80K 4FHTA 1IXRC 2O8XA 3NEUA 5BPIA 2IA0A 4XLNF 1I5ZA 4HLXA 5L3DA 4B09A 2NS0A 5TJJA 3FM5A 4EGZA 2E1CA 2V9VA 3O2PE 4UVCA 1J5YA 5L3FA 2VXZA 3B02A 1O57A 4LMYA 5ERIA 4G8XA 3RDIA 5TRDA 5LEJA 2FRHA 1XGMA 2HR3A 3KE2A 3T0YA 1YIOA 3H92A 2A68F 1FYMA 3DXJF 2ZCWA 2PI0A 4ZH4F 2RKHA 2RGVA 4HQEA 2DFIA 2QUFA 4O6JA 2M8EA 5E17F 2EFOA 5AONA 4L5IA 2Y75A 3ZPLA 1H9GA 3ZN1A 4Q47A 1T2KA 3F3XA 1TW3A 4K2EA 3OV8A 3M1EA 4OU0A 3FZVA 1HXDA 1FOKA 1YTYA 5HDGA 4AIHA 4Y13A 1GHCA 1ZRFA 2KJBA 1FP1D 3MZYA 1S7OA 4LD5A 5K5QA 3IL2A 2XAHA 3SQNA 2OU2A 2BV6A 1J75A 1CGPA 3CTAA 1UB9A 4P9FA 2H27A 4HX7A 1MZBA 2A6EF 5LRSA 3KZYA 2E7XA 5E1WA 1ON2A 2HOEA 4G9YA 5DUKA 2EWNA 4PCQA 5BOXA 1I6XA 5HDKA 4HLYA 4H0EA 3I59B 1HW5A 3F8MA 2R3SA 4IXAA 4LFUA 1J9IA 4L18B 4HA8A 2HQNA 3QP6A 2PN6A 1WSUA 1TNSA 1F5TA 2FEZA 1MJAA 1YS7A 5D4RA 4IHTA 1Z6TA 3WTTC 2JSCA 4HOBA 4EJUA 4LLLA 2QBYB 2ETHA 3F22A 1LDDA 3PFIA 4FX0A 4KMFA 3FM3A 5HDNA 1DUXC 2P8TA 2FXAA 1B4AA 2GQQA 2XGXA 4IVNA 5HVQC 2YR2A 4A5MA 5H20A 5D6FA 2O0YA 6PAXA 1LNWA 3MQ0A 5HLHA 5ILSA 4KA4A 2GZWA 4ON0A 3DFGA 2VE9A 1TQPA 2L02A 2M45A 3BP8A 3L9FA 4OIOF 2RNJA 5DD4A 1SMYF 3V7SA 3HTUA 1YG2A 4G7ZF 4HX4A 1W7PD 2DI3A 3JAMZ 2ESNA 2IA1A 2HTJA 1ZN2A 5AIQA 2CSOA 3KEQA 1RNLA 2RDPA 3GFMA 1KQ0A 3KLOA 3ZQ7A 4YFKF 5ICEA 4EJWA 2P4WA 2VBZA 3E5QA 3QAHA 1Q1HA 2JT1A 1MKMA 3F21A 1BI2A 3I71A 3K1PA 1XMKA 2O6GE 3H3UA 3KP5A 3LQRA 2COMA 5IT3A 2HGCA 2H94A 3TOBA 2GXGA 4LK1F 2CO5A 3IKVA 2QENA 3DV8A 5CVUA 3I5UA 2RVCA 4U0WA 2BE5F 4S04A 2VT3A 2YSRA 4U88A 3ELKA 2VC0A 2FNAA 2VONA 4HQMA 3DQVC 5LGTA 3SHFA 5CLSA 2M5WA 1FBQA 4BQAA 2EFNA 5IT9Z 2YX4A 4LLGF 2QQ9A 1FZPB 3QU6A 1LB2A 3R6SA 1BIAA 4EVIA 4RGRA 1ZRCA 2ZKZA 5DEQA 1ZGJA 2CQKA 4PGHA 1OPCA 4NHJA 2AXLA 2UXNA 4EM0B 3N97A 5BPDA 3ECHA 4RB1A 5JVTA 4KIBA 4WX9A 1IN4A 3FXUA 3V7CA 2FBHA 2ZJ2A 5DCMB 3R4KA 4UVBA 3HSFA 3MZHA 5DYMA 3GXOA 4R8HA 1E2XA 3CUQB 1ZYRF 2W25A 3GX4X 5L3BA 3C3WA 1SD6A 3CO7C 2IP2A 4ENNA 1Y0UA 2XHKA 3GUDA 3HHHA 2IJLA 1SFXA 4Q5SF 2IRFG 4LGWA 1UCRA 1W7PB 1TLHB 5CVJA 3HTSB 1BN5A 2XKPA 2G9WA 2V1UA 1QBJA 1G6NA 2HFHA 1SD4A 1Z91A 2V1XA 4UXNA 2P6SA 2NNYA 1IW7F 3SFZA 4RGSA 3R60A 3HOSA 2JRTA 1FP2A 3BJOA 3KETA 2EK5A 2WC2A 2P5VA 2FBIA 3WGGA 2LNBA 5JR3A 1J7KA 1S6LA 1U8RA 5LEKA 2KJCA 3WU1B 1I27A 4A5NA 2JPBA 3GW2A 2HZTA 4A12A 3FHZA 2QZ8A 1JXSA 2FOKA 3K2ZA 4KIGA 3ROUA 4FT8A 4AD9A 3GFJA 3RYPA 4YFNF 3N4MA 4G7OF 1TQMA 4WCGA 3U2RA 3I64A 3P7NA 1YFHA 5CVRA 4ESFA 1F1ZA 4MQ9F 3EYIA 2NRAC 1X3UA 2MC3A 2STTA 3HOTA 2XVCA 2DQRA 4M6XA 3ZN0A 3DPLC 3U1DA 1K79A 2GXBA 4EV0A 1U2WA 5DCMA 3KZZA 1IAWA 4ESBA 4U7BA 4F7ZA 5F6FA 1SD5A 2OA4A 1BBYA 3GVAA 1IN8A 2CWEA 4MTEA 3C1DA 1D5VA 1XSXA 3R61A 3E5XA 2GIVA 5L3EA 3RKWA 1T98A 2ACJA 2L54A 2NYXA 3M8EA 2XUBA 5EEHA 1IN7A 2XAGA 3QOPA 4GCVA 4M9ZA 4WXDA 2EV0A 2STWA 2FQ3A 3KP2A 2O3FA 4KICA 2RN7A 4RAYA 5E8GA 2K7LA 4IF4A 3K1MA 1J59A 2PG4A 1HBXG 2Y48A 4AVPA 4P9UA 2D1VA 1UFMA 2OQGA 3FMQA 3I58A 3BY6A 5KK1A 1P4XA 1QPMA 2MLGA 2M1BA 1IRFA 2BEOA 3PQJA 4XLPF 3QPHA 3O6BB 2HQRA 2D45A 3J7AO 1GVJA 3KP6A 4KN4X 4U0VA 1LQ1A 5FB2A 3D0SA 2OZUA 2YPRA 2VBWA 4LG0A 4CGZA 2XROA 2IA2A 2PJPA 1P6RA 1LVAA 5FLXZ 1TNTA 5F64A 3ZMZA 2Z33A 2OAZA 2PEXA 5A2QZ 1EV7A 3T8TA 2VN2A 5ICCA 3JW4A 1OMIA 3U9GA 1XDUA 4RB3C 4I02A 1IUYA 4FX4A 2QVOA 3F8FA 3NRVA 5LGNA 5FD6A 4M71A 4HV6A 3EDPA 3HRUA
chains in the Genus database with same CATH superfamily
2XDVA 4P96A 4BHCA 3GZ6A 3VYTB 4GYGA 1K4SA 1IJWC 4CDGA 2OD5A 1JUMA 4BAYA 3HB9A 2R0QC 4HSRA 5GPCA 3IRRA 3O3KA 5CYVA 3SFIA 3JR9A 2VQCA 3M9AA 4A0YA 4HDVA 3K9TA 3BTCA 3V8JA 1X2MA 1D3YA 3MEXA 2PBIA 1TW2A 5E1ZB 3NARA 3FIWA 2PJRB 1MDMA 1EF4A 1FYLA 2LH9A 4IHYA 1AU7A 1R1VA 3G4SI 4HZFA 4OINF 3SXYA 2M34A 3EUHA 1U5TA 2NNNA 1IRGA 1KQ8A 1HOMA 2KIUA 3Q3SA 2W1OA 1V5GA 2XKOA 2Z99A 3I4MJ 5FROA 2IS4A 1MMGA 2R7QA 4OIRF 4KISA 4A93J 4C3IJ 3ABKH 1S7EA 1KYWA 1Y0NA 2ECBA 2V1DA 1MBGA 3I4PA 4QWQA 3OR2C 2R7UA 3GYHX 4HYEA 1EH7A 3BZ6A 2I5UA 1KGSA 4GYIA 3BOQA 2JA8J 5LHIA 4AWXB 4MLOA 3T5XA 5K7HA 2KISA 3CDHA 3L2QA 2C6YA 2NAZA 2BYVE 1PP8F 4RMNA 1B9MA 2IS2A 1XTAA 2K9LA 2LF7A 4HF2A 4QIWN 4HEA2 3E6MA 3M07A 1ZLKA 1X4OA 4ZDLA 1PYVA 3E0JB 3ISPA 3ZQFA 2GBYA 1YX5A 1WJEA 3DKWA 1RIOH 2PMZA 3JTGA 3S8PA 3I54A 3FKJA 3ZMSA 3FMRA 3RTRA 2L7KA 3ASOH 1HSTA 4EJOA 3HOVJ 1R4MB 3PIPF 2XGCA 4OMYA 4XN0A 4A3FJ 2FNPA 3SEZA 4UHTA 3TP0A 4LITA 4E7JA 1JKRC 3WU0A 2BY0A 2FOWA 4ZYDA 4AIJA 1VQ8I 3RI4A 2DFHA 2KZVA 5D8KB 4B3XA 2JUCA 1ZQ3P 4EJTA 2O61A 5FJ8J 4M9XA 1RKWA 5DM6F 1DGWY 3REOA 5D5UB 4A3KJ 2JN6A 3TKYA 3A01A 2CS3A 1BI3A 2W48A 3ZQLA 3HPGA 3PO3J 5FO5A 2CQ7A 5EZGA 2OV7A 5E3OA 4KT5C 1P9QC 3ERED 3QRFF 1A35A 2DFEA 2DOFA 3W3CA 4YIFA 3A0BC 3FWEA 1OISA 1G3SA 3ZQIA 3WTVC 1ACIA 3DTIA 1AA7A 4E7SA 3K2AA 3LSIA 5J1UA 3H5NA 3TQNA 4N9HA 2CJJA 2LY1A 4JQFA 5EEAA 3HOWJ 5M5YJ 1JUPA 3F8BA 4A6EA 2B63J 5L3GA 2W84A 2VJ5A 3BG5A 1NK2P 2FQ4A 2VJ4A 3ZMDA 4RGUA 4BQNA 4ZYEA 4CYCA 2MLKA 2OPTA 2QQ8A 3SEQA 2TRTA 4BEHB 2IS1A 5KVRA 3L7WA 3VDXA 4MHGA 4R1HA 2VXDA 2JA7J 3SZPA 3IV5A 1T95A 4U87A 4YFXF 1IZ1A 1HKTA 2E35A 1K78A 4YG2F 3G1OA 1W36C 4L9NA 1I39A 1YQAA 4KYWA 2HQ5A 2NOGA 1MBJA 1EH8A 3IH2A 2DLLA 3FXKA 4NC8A 2ZNZA 2VJIA 3P9IA 5IYBJ 3AG2H 4RA2A 2JRMA 5E18F 2Q8KA 2K86A 2L01A 2FU4A 2V9PA 4CHUA 1V5FA 2FMYA 1IN6A 4IHSA 1IXSB 1LE8B 2HVRA 2WWYA 2ZC2A 1R5GA 3WG9A 2XAQA 2ISYA 4JOMA 3JSPA 3S3MA 2O5RA 3TDZC 1A6QA 4NC6A 4NNJA 5EGOA 1UHWA 1DU0A 2VL8A 3HUGA 2RAEA 1T0FC 1OCTC 2VBXA 4HX8A 2HOTA 1KQ9A 4OIQF 3K0LA 4PJNA 5IYCJ 4M74A 3RPQA 1QU3A 4NQWA 1FMVA 1Y8RB 1DPRA 1R36A 2HTSA 3FXMA 1DP3A 2ADUA 4UUSA 2LD5A 2X51A 3E7LA 1L0OC 2KLOA 1I1SA 3M7GA 1A04A 2LKPA 3CUOA 1UAAA 1J2XA 2IGMA 3IAM2 2DK8A 1ULYA 3SDGA 3RQIA 4ESJA 2MFZA 3IWZA 1HDPA 3E6CC 1P2FA 2GIZA 2L2OA 4YRVA 3ZRGA 2P81A 2P6TA 5JI6A 1QHHD 1GV2A 2V4JC 3OYDA 2EB7A 3BQYA 2RC4A 4MTDA 3H0DA 1Z0XA 4E70A 1UHSA 3TDUC 1D0ZA 4QLCU 5JHFA 2LFBA 4I0BA 4A69C 3J80Z 4ENJA 1Q1VA 2KRCA 1FIAA 4HAMA 4A3LJ 3ZMVA 1E3OC 1Z7UA 2HKOA 3RIRA 1ONVA 4C2MJ 4A3MJ 2ME6A 2L4MA 1LUJB 2EBIA 1ETQA 1HLVA 1QZYA 3WE3A 4PGGA 2F2EA 4Y4RA 2IVMA 3ABLH 5BS6A 2MGQA 2KDZA 3AG4H 1S7AA 1BOAA 1MD0A 4BXXJ 3J81K 4KMUX 1E3PA 4CCLA 1GVDA 5IOYA 5E3NA 3HC7A 4XKWA 4R79A 2OBPA 1HDDC 3TO7A 4RDUA 4KNYA 1D8KA 2XC7A 1D5YA 3V7RA 2HDCA 4IJAA 2RQQA 3QPTA 1X3WB 1QO0D 3H3VK 2M7AA 3WGIA 4U7DA 2JPCA 3CUQC 2FX0A 2HOSA 3HOZJ 2KL4A 3LWFA 3HOUJ 1TZLA 2EZKA 4HDUA 1SFUA 4NDLA 2HYFA 2QSFX 5FFZA 2LBFA 2GOXB 3V4GA 1HW1A 4HNUA 1T8IA 1JI8A 3ULQB 4BE2A 1GXPA 3HIFA 1YYVA 3W2AA 1JJ6C 3DEUA 1WFXA 5LBQA 2KP6A 4EM1A 4A3DJ 4ENMA 1SMTA 1OR7A 2DDAA 4Y17A 1FNNA 5FRMA 4FISA 1R23A 3G71I 4MGRA 2VT2A 3T1BA 1HQCA 1GLNA 3K69A 3V42A 1ZR4A 2HPMA 3OYHA 3JRCA 3ABUA 3MWMA 2K85A 2JTVA 1FWZA 1ZLJA 2R93J 3FISA 5JLWA 3Q5FA 1YW9A 3HBLA 4D0PA 2FUG2 3H9QA 4L0YB 5D8LB 2Y30A 2H6BA 2PQ8A 2KKOA 1USTA 3PSIA 4LB6B 4BU2A 2F48A 1K7AA 3A0HC 4UUVA 1XGNA 3DP7A 3WTXC 3SZGA 3GFIA 2DPUA 5DDGA 2QGUA 4HF1A 2QKLB 3K4MA 5CVIA 3KP4A 1TWFJ 2K9MA 2HS5A 1IV8A 5E8IA 2IGKA 2TDXA 4XKCA 1I3AA 5EF6A 3GO5A 5M5XJ 1OJLA 2WY8Q 1NHAA 3FDYA 5H6QA 1D8JA 1SAXA 1BI1A 2IT0A 2WAFA 4D1QA 1ZAOA 3S2WA 3EETA 1P4WA 2VKDA 3P9KA 1OCRH 1U78A 2DO7A 1TP4A 4JX4A 4WXHA 2EFQA 2RQPA 3GLXA 4FTHA 4RS8A 4MNUA 1ODDA 1BJZA 1RPWA 3OYMA 3DBLB 5FKLA 1WJ5A 2CV0A 1NTCA 1MSEC 1YX3A 4LLNA 1RC9A 1USSA 2KHMA 4B4CA 1QQIA 4XRFA 2WTEA 4S05A 3ERMA 2VIXA 2E2JJ 4V19K 2V9KA 5HLIA 2L4AA 3K7AJ 5EG0B 3LSPA 5F0CA 3H9GA 2BGCA 2PX9A 3IKTA 4BBSJ 1LVKA 4KFCA 1RZ4A 1B8IA 5BMZA 4RAFA 2DJIA 2F5DA 5LD2C 1MNEA 2FJ1A 3WTZA 1ON1A 2ELHA 5JFRA 4LJZF 2H1KA 2CUZA 2ZO4A 2P7CB 3TGNA 3VYSB 2K40A 1MH4A 3N05A 1DPUA 2QF7A 3BPVA 4CCOA 4ZZLA 4Y7NJ 1ETYA 2M0MA 2A61A 2HI3A 2YU3A 3EYYA 3L09A 4B8XA 5J6XA 4LG0B 1ZK8A 4RAZA 5JLXA 3JRAA 4BYYA 1FY7A 5J47A 2QM3A 2MYSA 1PDNC 3H5RA 1IV6A 1W0TA 3MKZA 1JKQC 4F52A 1KA8A 3K4KA 3M3YJ 3BJAA 3BLYA 3P9CA 2HWVA 1WH5A 2AS5F 5ICGA 4BHPA 4DYCA 3JRBA 3E97A 4MQVA 2Y0MA 2XASA 1ZHFA 3FXOA 1MMAA 4CA0A 2HOAA 4KN7X 4WXCA 3BC8A 3VODA 3KLNA 3F72A 4IPAA 1TWHJ 3EUHC 4F55A 5J8CA 4QSHA 3H3ZA 3IHUA 3A2KA 1R7JA 1QA6A 2K5CA 3HSRA 1B9NA 1BJAA 4LB5A 1UJ8A 3ZMTA 2A69F 1OYWA 1F9NA 1FSEA 2NXNB 4I0AA 1G3WA 4MEYF 4C9YA 2LSOA 2EZLA 2ZBKA 1K6OA 4BNCA 3S2HJ 4XRSA 2K4BA 2Y69H 4XICA 1FTZA 2L5QA 1O4XA 2DA1A 3D5RC 1CF7A 1R22A 2ZMEA 4BS9A 5H6RA 2X1EA 4QPOA 4A3JJ 2CQNA 3FMSA 1FLIA 1XDSA 3LA7A 1MDMB 4UNOA 4ZTJA 3GEZA 2D5VA 3CJTB 3F0CA 5L3CA 3S1RJ 2DMUA 4IOAF 2QSGX 2ESHA 4L5EA 3OIOA 4L9VA 4WF2A 4E4HA 4IOCF 3BQZA 1U5TB 5K1YA 2DPDA 2N8GA 3OY9A 3LA3A 1XCBA 4XNFA 2XPWA 4FE7A 3CCVI 1NH3A 3MFKA 1MH3A 4ASNA 2P5LC 2ZFWA 3CJNA 3I3LA 2GOMA 5D6EA 2VB6A 1GT0C 2K02A 4IQ4A 5LLQA 3FHNA 1O3TA 2KMUA 2YS9A 2CGPA 4DBQA 2X1CA 1ZGWA 4HSTA 2DAOA 4BXFA 5FLMJ 2WBMA 3FBNB 5GP9A 1ZG5A 4PZJA 1O3RA 2XF7A 3KPHA 2LRDA 2ISZA 1QHGA 1B1BA 5E20A 5GAEJ 2E36A 4BBRJ 4XK4A 4S0HB 2M8GX 1RI7A 5ILUA 2VI6A 5TGTA 3C7JA 2FE3A 1UZCA 1T6SA 3MD2A 5GADJ 2DBBA 1PP7U 1UG0A 1ZGAA 2JK3A 3H0GJ 4ETSA 3JRHA 1ZRDA 1SANA 4RB2C 2ZB9A 3DTKA 5HLTA 3KYLA 2MA3A 1MGTA 1ETOA 2E1MB 4CCKA 2KIQA 2QWWA 2XSDC 2DDBA 2A07F 1XPXA 2ICWG 2H8RA 3WTWC 1EH6A 2JZYA 4PJ0C 2HPIA 4X6AJ 3NWSA 3VOEA 2EJRA 4MO7A 3MCZA 3FXQA 3NQOA 2CUEA 3PUBA 3ZMUA 4BH9A 3HSEA 4PSWA 3HG9A 3A01B 2V6CA 3CCMI 4JBAA 2O9LA 1O3SA 3OYAA 2CU7A 1Z67A 2E34A 3RPUA 3ZQHA 4IHXA 5FKKA 4TV7A 5DCFA 4XSZF 3B73A 3KP7A 1B59A 5J8FA 1W4MA 4XIDA 3JSOA 4P55A 1IC8A 1BM9A 1JGSA 2D2WA 3K70D 4DQ2A 5D4SA 5JVGF 4HRIA 2VC1A 4LOCA 2QSHX 1D1BA 2GWRA 2TCTA 4WWCA 3BTIA 3FKIJ 3BR2A 3S32A 2HZDA 2X6XA 2M4KA 1FC3A 2M87A 3BROA 3DWLE 3FK7A 2XAJA 3JREA 3RJPA 2HEOA 1ZR2A 1ZG3A 3TMOA 1BR4A 4XRSG 1L3LA 4AIDA 1I6HJ 4NBQA 4CYCB 4WK8F 4A6DA 2ZFUA 1J0RA 5IT9K 3PSFA 3AG3H 1LEBA 4BHBA 3CCSI 4EM2A 4IO9F 1A5JA 1YJWI 1V5EA 3R0AA 4Y33A 1OCZH 1E17A 1FBUA 2DOEA 1K78B 3CC7I 3S3NA 4UB6C 2H09A 2W24A 3VSLA 5C4XJ 3Q9SA 2W85A 1VQ4I 1U3EM 3HRSA 1YOVB 2JA6J 1G4DA 2VPRA 1YIJI 4I98B 2Y31A 3RYRA 2JUGA 1Z05A 4L5JA 3HYIA 5FKMA 1MBHA 1Z1DA 3ML6A 4UV9A 2DFFA 3H36A 5HS7A 1YHQI 5HS9A 4A3CJ 3GTOJ 1X3ZB 3S2DJ 2Z5UA 4XLHA 2P7VB 2QCOA 1LDKB 1WWXA 4G6QA 2HYJA 4CICA 2ZNYA 3W6JB 5F1RA 1P92A 9ANTA 3F6OA 3KEOA 2X6OA 4AIKA 1TWAJ 1AHDP 1TTYA 2VKEA 1XC5A 2HDWA 3LQQA 5EGOB 3SJMA 3HUGB 2F4IA 3BWGA 3VFZA 2G7HA 1WJDA 4CCJA 2ZJQF 3KFWX 1OCPA 2MH2A 2RNGA 5CPRB 3V8KA 3JRGA 3GZ5A 2F6CA 2DTRA 4E7LA 2Z9OA 1NK3P 4NQWB 3D5LA 3O8GA 1FOWA 1VQ9I 2CQQA 3RKYA 1WPKA 3TO6A 2QKMB 5E3LA 5ICFA 2XAFA 1Z21A 2LY2A 4UUSB 4N0BA 3CESA 2IW5A 5BQTA 2UUZA 2F5EA 4E7IA 4I09A 1EKEA 4MEXF 5GPAA 1Y1WJ 3LSTA 5K5RA 1KYZA 1J09A 2KRHA 1XMAA 3HRMA 3IP4B 4YIRX 2R7FA 1BC8C 5IYDJ 1PUEE 2L3DA 1JT0A 2LF8A 2Q0OA 2K9NA 2W57A 1G59A 3FXRA 4BJ6C 2PFBA 1D0XA 1HF0A 3BDDA 1WQ2A 1UHMA 5EEGA 1WZ2A 4CYDA 1ZH5A 4Y15A 2X1DA 2X6YA 1VQLI 2OJED 3HEFA 4G94A 2OF7A 3QU3A 1BIBA 4J00A 1KU7A 1GXQA 2X0LA 4Y3OA 2PMHA 4PDKA 4DGWB 3PFYA 2WV0A 1FPQA 1JGGA 1IXCA 1PUFA 3UKGA 1I1GA 3H9JA 2DCEA 3QQAA 1LEAA 2ELJA 2OZ6A 2FBKA 1KONA 2KRFA 3TL4X 4B44A 1ERDA 2VE8A 3GTJJ 1LDJA 2DQLA 3C2BA 2J5OA 1V55H 1RUNA 3HOYJ 3BPXA 1OYIA 5F1JA 4Q4ZF 1WI9A 2HVSA 2JJ7A 1FOYA 3ZGKA 5LHHA 1WJBA 5ILVA 3LMMA 2XAUA 1QVTA 1BI0A 3GTKJ 4ENKA 2A6HF 3G3ZA 3DLAA 3RSNA 3G2BA 2V79A 3HGYA 5HS8A 3LL7A 2UXXA 2P5KA 3T8RA 3RKXA 5KNLA 1ORKA 1R00A 1B72A 3OR1C 5CVVA 2KDOA 5EDNA 2HDDA 3JRFA 4L0ZB 1WJAA 4JP0A 2LBFB 2DMNA 4HW0A 1H9TA 4XSXF 4D7NA 3S16J 4Q48A 3VB2A 5GAGJ 3COAC 3GTLJ 1QZZA 2NVUB 3SDBA 1R49A 2MD5A 3GWZA 1R58A 3ZQQA 4G7HF 2E2IJ 2H8WA 3QYFA 1QRYA 1W5TA 1WJFA 2DODA 4DIQA 1HW2A 1YW7A 2WB1N 3IRQA 2F5CA 1LJ9A 1FOXA 3I4NJ 4ZYHA 1CQTA 4EATA 4IRGA 1K61A 2R7ZJ 2GXAA 2EILH 4CCMA 2FSWA 3KP3A 4M9SA 4DZPA 2A3SA 3EUAA 4J19A 2E2HJ 2IS6A 3BR1A 1YS6A 2E1NA 3I9V2 5CQEA 2NS8A 2DA5A 2CW0F 4HG2A 1E3HA 2A6TA 1XN7A 1O7LA 3P5JA 4QTRA 2NVQJ 4AM3A 3CO6C 2M3AA 3W2VA 4AVZA 1DU6A 3CLQA 2X4HA 2L9RA 3E6BA 2HKXA 1I50J 1T08B 4FE4A 3OYKA 2G7UA 2W00A 1P4AA 4GO1A 4KUMA 5FKNA 5KHDA 4XRMA 4NB5A 5ED4A 2MBFA 4I01A 4M3BA 3O8HA 3CCRI 4ZZDA 2VOOA 5HLGA 2FA5A 4BJTA 1ZG1A 1VTNC 4U0YA 3AL0B 3CJQB 3G6EI 1XMXA 1ETWA 2H1LA 1KU9A 4A0ZA 1XB4A 2BY1A 3WTSC 2DW4A 4N4OB 5J1RA 2OTLI 2EFPA 2Z3YA 4B47A 3I59A 3WGHA 3DPUA 1VNDA 2CV1A 2WAQN 3WODF 1SFEA 1C0WA 4HV5A 2BY3A 2K27A 2DU9A 2X6WA 4PJMA 3F9KA 3HRTA 4ZYGA 2L7MP 5K5OA 3UNGC 1LKXA 4EJVA 3AKZA 3CCEI 3BG9A 2DJNA 2F5VA 3DF8A 2Z16A 4A0XA 2EIMH 3L2VA 4M72A 2QLZA 2J5PA 2R4GA 2EA2A 4A3IJ 1B8IB 1WJCA 1WKMA 2PLYA 2DT7B 4DNCA 1AOYA 2BBYA 1OQYA 2XRLA 4N4NB 2DA7A 1T56A 2O8KA 4EQQA 2KIMA 5FFXA 2XF6A 3RPUD 3M8FA 2VOPA 1IGNA 3CDIA 5EJCA 4FCYA 2O03A 4M73A 1T38A 5FLXK 4BQQA 3GFLA 4GFBA 2QBYA 3B6AA 1FYKA 2DK5A 1IDZA 3E6DA 1STZA 4A3EJ 1BR2A 3CP8A 2JQ7A 1V3FA 5A2QK 2WA0A 2FF4A 4I2OA 1ZTRA 5AIPA 2XIGA 2OQRA 4JK1X 1QZEA 1H0MA 2VPLA 2ID3A 5C3EJ 1AWCA 3H35A 4BY7J 3HGGA 4CSWA 3PQKA 3MN2A 2UZKA 2DMTA 1RUOA 1VQKI 4OMZA 2W82A 3PNTA 3SZTA 1KU3A 3L00A 2VODA 4IZZA 3R0JA 3JTHA 5E3MA 4EGYA 4I7HA 3K1NA 3KYDB 5E1XA 1A31A 5IY5H 4MFEA 2L0KA 5FRNA 1D1AA 2A5YB 2RV8A 3UR3C 4F91B 4IRIA 1O7FA 4UVAA 1QPIA 3L1PA 2PMUA 3I56I 3L2RA 2IGOA 2XB0X 4C2TA 5F0HA 2D1HA 3KZIC 3CCQI 1WH7A 2B7EA 4C2UA 2O7OA 3MZ8A 2VKVA 3JCUC 3OL3A 2ZMEB 1CF7B 2B0LA 2M2EA 3L2CA 1ITYA 2M9HA 3QP5A 5BNGA 1MBEA 2QQAA 1FX7A 1T39A 5FD5A 4L9JA 1D1CA 1ZARA 4YELA 2R7DA 4II3A 3OSFA 4G6TB 1V4RA 2EV6A 1DDNA 1YW8A 3FX3A 4AU7A 4YIIA 1MSFC 1Z9CA 3CP2A 5D5XB 1OFCX 4CO8A 3VWBA 1R1UA 4HNVA 2WADA 1JHFA 2AXTC 4GGGA 3LA2A 5GTIC 4ZDOA 4BY1J 4NC7A 5C44J 3VEPA 1QNTA 3S17J 5D5WB 3DEEA 4M6YA 5LRRA 1WCMJ 2GA1A 1JUSA 1MJ9A 5FGMA 1YI2I 2CMPA 3FF5A 2X85A 4HBLA 2MH9A 4RLQA 3DPTA 2ZXJA 2E5ZA 2ZXWH 2R5YA 1S72I 2OCCH 1T0FA 2JA2A 3CC4I 2LP0A 1YLFA 4CZZA 5M3MJ 2MC4A 2VQHA 4G6DA 2NS7A 1IN5A 1XSVA 3MAJA 1GUUA 2UWMA 4KDPA 3TO9A 1U0JA 2IXSA 3ABTA 3C18A 2CFXA 5LGUA 4OOIA 1OKRA 1S9HA 1H8AC 3Q9VA 1FSHA 4IRHA 2JMWA 3QOEA 3ECOA 1REPC 1JT6A 1ZELA 3LAPA 2XRNA 3OOPA 1B6AA 1Z6RA 1K83J 2M30A 3BZKA 2M0CA 3TEDA 3CJRB 5B3SH 2DYRH 4RM3A 2LVSA 5HOOA 1O3QA 1SVLA 5K7FA 4A3BJ 2Z2SB 4UV8A 1IF1A 1KU2A 4XOPA 3KIOA 4XM3A 1XGOA 1HKQA 3C2GA 2CG4A 3IWFA 3K6GA 1MJBA 1OCOH 3G73A 1TQIA 3CMAI 1R1TA 3BR3A 2GA2A 2WV1A 4OIPF 3GLLA 4RGXA 1XD7A 4XBFA 4RB0A 3GF2A 5LHGA 3PUFA 3WE2A 4O3MA 2DT5A 1U5TC 1QGPA 1X1AA 3EQLF 2KIFA 3BJ6A 4RBOA 3VYUB 3AAFA 3MVPA 4UY8I 2EINH 1DP7P 4M6VA 2WAEA 4BXUA 1G3TA 5B5EC 2JA5J 4E6KG 4Z2YA 5HODA 5DD8A 2XB5A 2E19A 4DYRA 2LDUA 2MD0A 3OYGA 3D1NI 1SD7A 2P0WA 1XSDA 1YO5C 3LFKA 2VBYA 3U1KA 3IH3A 4OAZA 5J3LA 2EV5A 3VYRB 4IKFA 1BL0A 5TISC 2QQBA 4GXOA 1X19A 3VSKA 3F23A 2XPUA 3AG1H 1HSJA 3I0TA 2Y9YA 2EA4A 2HNHA 1HKSA 2YX7A 3CUQA 3F8NA 1W5SA 2V26A 3G1LA 2A05A 2E7WA 2LY9A 2B9SA 5D5VB 1ZKGA 3KCCA 1A6IA 1JHHA 1FT9A 4GDFA 2R92J 4RLFA 2QYOA 3GZNB 3ZR8X 2H6CA 3F8CA 3KX2A 3LSKA 4LK0F 1UELB 3ZXSA 3I53A 1XG1A 4F92B 2IPQX 5GTHC 5HNHA 2E1MC 4X0GA 2IBDA 3M1CA 1S29A 1W7PA 1VFCA 3LAJA 3WTUC 3ZP5A 2CYYA 2EIKH 2JVGA 2HYGD 4N9IA 3PIOF 1JKPC 3HHGA 1XCVA 3TOAA 3PJRA 4AC0A 4PJJA 3WHCA 1Y8QB 1G3YA 2K4JA 1VF9A 3FBIB 3WTYC 5EYRA 2Q2EA 1BC7C 3OYEA 3JAMK 1T33A 3W6KB 1X4PA 4CXFA 3FXJA 3U21A 2XV4S 2LYCA 2W4SA 1N75A 5CJ9A 3ASNH 1XGSA 3CZ6A 1N78A 3HPHA 2MW8A 2FMLA 3E5UA 5DUIA 1ZREA 3SYTA 3E3VA 4HF0A 4L9TA 2DT6A 1F4KA 4CH7A 5DV5A 2EIJH 2E5NA 1FBSA 1TBXA 2F5FA 4EMSA 4BE1A 3PM1A 2DA4A 1WRJA 4O5VA 3LSMA 4JX5A 4A2UA 2GAUA 1R5HA 1OYYA 3OOUA 3J81Z 2VASA 4LG3A 3V8LA 3IC7A 1JE8A 3TW6A 1S3JA 1WGXA 4KIFA 4P5OA 5JHUA 3CLOA 2EFWA 2LK2A 4XMYA 1GV5A 1U6GA 1P7JA 1HCRA 3F6VA 1S8NA 4F3QA 3J80K 4FHTA 1IDYA 3K4NA 1MBFA 1IXRC 1PUFB 2O8XA 3NEUA 1JTYA 3OYIA 3OS1A 1N77A 5BPIA 3Q0WA 1OLTA 3GMEA 2IA0A 3LFUA 4XLNF 4CZCA 2V1NA 1I5ZA 4M3GA 1EA3A 5J40A 3EUKL 3WU2C 1RETA 5E79C 1SEUA 4HLXA 1SFKA 5L3DA 2EZIA 4B09A 3BT9A 2Z1DA 2NS0A 3OMYA 3QYEA 2L9NA 2BXZA 3OIQA 1MW7A 5B1AH 5TJJA 3FM5A 4EGZA 2E1CA 2V9VA 2AHQA 1M1EB 4MFDA 3O2PE 2K9SA 2CV2A 4UVCA 1J5YA 5L3FA 1W5CC 2YU9J 3LSJA 2VXZA 3B02A 1O57A 4LMYA 5ERIA 1B72B 5HNFA 4G8XA 3RDIA 5TRDA 5LEJA 2CW8A 2FRHA 1XGMA 2HR3A 3KE2A 4Z6YA 3T0YA 4PFOA 3OYBA 4DYQA 1YIOA 4QPQA 3H92A 3K4LA 2A68F 1FYMA 2LLKA 3DXJF 2DA6A 3L2UA 2ZCWA 2AO9A 2R7TA 2AQFA 2ELKA 2PI0A 3A03A 2EQRA 4ZH4F 2RKHA 2L7ZA 2RGVA 3DBHB 4W97A 2DFIA 3MMYB 4XORA 2QUFA 4IX7A 4HQEA 1RR7A 1RKTA 3TW7A 4O6JA 3OS2A 2M8EA 2XSJC 4BDYA 3ZQCA 5E17F 5H2FC 2EFOA 5AONA 4I6ZA 1Y6IA 2EPFA 4L5IA 1H88C 5K7ZA 2Y75A 3BR5A 1H9GA 1TT0A 5C4JJ 3OL4A 1W36D 3ZPLA 3ZN1A 4EEFG 4Q47A 1VQPI 4IQJA 1T2KA 2GM4A 3DKXA 2DXIA 3F3XA 1TW3A 4K2EA 5IP6A 4I76A 1PVEA 3OV8A 3M1EA 4OU0A 3FZVA 1F36A 1HXDA 1FOKA 1YTYA 5HDGA 4AIHA 2EZHA 2KFDA 4Y13A 1GHCA 4XLAA 1ZRFA 2KJBA 1FP1D 3MZYA 4IEJA 1S7OA 4M3DA 2R7WA 2BW3A 4HPQA 2MSYA 2CFOA 4LD5A 5K5QA 3IL2A 2XAHA 3SQNA 2OU2A 2BV6A 2LMDA 1J75A 4AYBN 1CGPA 4BE0A 3CTAA 1UB9A 3QWLA 3CCYA 4P9FA 2H27A 1R71A 3M8JA 4HX7A 1MZBA 1IRZA 1G8XA 2A6EF 5LRSA 1ETXA 2R7VA 3KZYA 2LC2A 4CUGA 4HNTA 1Z77A 2E7XA 4IL6C 5E1WA 1ON2A 3K70C 2HOEA 4G9YA 5DUKA 2DN0A 3PO2J 1LFPA 3LOCA 4KJZA 4XOTA 2EWNA 4OAYA 4PCQA 3QODA 3DBRB 1DQUA 5BOXA 1I6XA 2Q1ZB 4M3EA 5HDKA 4HLYA 4H0EA 3I59B 4NUBA 2EH3A 1HW5A 1AKHA 3WHBA 2BOLA 4BGDA 2V6EA 4F93B 3F8MA 4ZYAA 2CUFA 4DBRA 1MMDA 1ETVA 2R3SA 2BHZA 4IXAA 4LFUA 3JRDA 1J9IA 4L18B 4HA8A 2HQNA 3QP6A 1OR7C 1R4NB 2PN6A 4P1WA 1WSUA 1TNSA 3CF2A 4RAGA 1F5TA 4DOZA 3S14J 1XS9A 2FEZA 1MJAA 1YJ9I 3LSRA 1YS7A 5D4RA 2BVMA 2OC6A 3TP3A 4IHTA 1Z6TA 3WTTC 2JSCA 1IUFA 3HJEA 3NAUA 4HOBA 4EJUA 4LLLA 3GTGJ 1UG2A 1VQ6I 3BTLA 1WVRA 2XGDA 1X1BA 2QBYB 2ETHA 3F22A 1LDDA 3LSHA 2E71A 2HXOA 3PFIA 4FX0A 2LOOA 1FEXA 4KMFA 2JVHA 3FM3A 5HDNA 1DUXC 2P8TA 2PJRA 4BUPA 3X2QH 1APLC 2ZXIA 2FXAA 1B4AA 2GQQA 2XGXA 4IVNA 5HVQC 1LPQA 2YR2A 3KEYA 4A5MA 2VLAA 2COBA 4ZJZA 1FJLA 3ESWB 5H20A 3S93A 4ZTFA 5D6FA 2O0YA 1WI3A 6PAXA 2IEKA 1LNWA 2L7FP 3AL0C 3MQ0A 5DM7F 5HLHA 1VQOI 1QVUA 5ILSA 3CC2I 4XKBA 4KA4A 2GZWA 4ON0A 3DFGA 1S5LC 2VE9A 2DYSH 1BOBA 1TQPA 2L02A 4JX6A 2M45A 3W2WA 3BP8A 1JJ8C 2KPMA 3L9FA 4OIOF 3BR6A 2RNJA 3L2WA 2A5WA 5DD4A 1SMYF 4C30A 3OS0A 4D5FA 2VQLA 5IOZA 3V7SA 3HTUA 1YG2A 4G7ZF 4HX4A 1W7PD 3A4CA 2DI3A 3JAMZ 2ESNA 2IA1A 2HTJA 1ZN2A 5AIQA 2E60A 1VQ7I 1MNMC 2QEXI 2CSOA 3KEQA 1RNLA 3HKZN 1BR1A 2RDPA 1KQ0A 3GFMA 3KLOA 3ZQ7A 3K4CA 4YFKF 5ICEA 1RRJA 2DOAA 2MG4A 2DA3A 4EJWA 3Q0UA 2P4WA 2VBZA 3E5QA 4G12A 1TL8A 3QAHA 1KZHA 1Q1HA 2OUMA 4Y52J 2JT1A 2K9QA 1MKMA 1MMSA 1K6YA 4XN3A 4AYBA 3F21A 4XKVA 1SC7A 1BI2A 3LSGA 3HM5A 3I71A 5M3FJ 4I99C 3K1PA 1U8BA 2VKHA 4BACA 4B48A 4X1EA 1XMKA 1NG7A 3Q0VA 2O6GE 3H3UA 3KP5A 1D0YA 3LQRA 2R5YB 2COMA 3ONQA 4ANJA 5IT3A 2HGCA 4BL0B 1JKOC 5KCMA 2H94A 3TOBA 3A1YA 3FXLA 1GDTA 2GXGA 3IUOA 4LK1F 5CQGA 2CO5A 3IKVA 2QENA 5EZHA 3S1NJ 1IG7A 3DV8A 3KYCB 5CVUA 2LTPA 3I5UA 2RVCA 1R9TJ 3DU6A 3CQZJ 1W1WE 4U0WA 4C3JJ 2BE5F 2LG4A 3BG7A 3BR0A 2VUMJ 1WHUA 3H5AA 4S04A 4ZDPA 4II2A 2VT3A 2YSRA 1X2NA 3AFHA 3GBGA 4U88A 4BDZA 3ELKA 3C2HA 2VC0A 3CD6I 3HDDA 2FNAA 2VONA 4HQMA 3DQVC 5LGTA 2KZGA 3S1QJ 3SHFA 4BEHA 5KAIC 4H4KC 5CLSA 2M5WA 1FBQA 2JSPA 4BQAA 2EFNA 5IT9Z 2YX4A 4LLGF 5F27A 3ZQGA 1PJRA 2QQ9A 2ZMEC 3OWTA 1FZPB 1NG6A 4E7ZA 4XL9A 3QU6A 1LB2A 5IPAA 3R6SA 3RKQA 1F43A 5M5WJ 1BIAA 4EVIA 2JWTA 3LNQA 3WG7H 4W1UA 4FASD 3OYFA 4RGRA 3RQ4A 1ZRCA 3GTMJ 2ZKZA 5F04A 4ZC3A 5DEQA 4KITB 1ZGJA 3OYJA 2CQKA 1A36A 5J4VA 4PGHA 1OPCA 4UUTA 4NHJA 2AXLA 2UXNA 4XLFA 3JRIA 1LE8A 4EM0B 2HU9A 2RREA 3N97A 5IP9J 3ECHA 4XLCA 5BPDA 4RB1A 3OYCA 5JVTA 4KIBA 2K3FA 2WB1A 4WX9A 1IN4A 1X58A 3FXUA 3V7CA 1R6RA 2FBHA 2ZJ2A 2CH0A 4V2GA 5DCMB 3R4KA 4UVBA 4YEJA 1BW5A 3HSFA 2R7SA 2LKSA 4DW6A 3MZHA 1MBKA 2XPVA 5DYMA 3GTPJ 3GXOA 1Y56A 4R8HA 2Y0SN 1E2XA 3H1CA 3CUQB 1ZYRF 2W25A 3GX4X 2MABA 2WY7Q 3CMMA 2M7BA 5L3BA 3C3WA 4FQGA 1SD6A 3RZOJ 4D7MA 2BZTA 3CO7C 2IP2A 4ENNA 1Y0UA 2XHKA 2ECCA 1IRXA 2KT0A 3D5SC 2UV1A 3GUDA 3HHHA 1MIJA 2IJLA 1SFXA 1UMQA 3PNYA 4Q5SF 2IRFG 4LGWA 1UCRA 2BHYA 1W7PB 1Z3XA 1TLHB 3B6CA 5CVJA 1K4TA 3HTSB 3HKZA 1R5ID 1BN5A 2XKPA 2G9WA 4AUXA 3RCOA 2V1UA 1QBJA 3HL2A 1G6NA 2LREA 2HFHA 1SD4A 1Z91A 1LFBA 5B1BH 2V1XA 4UXNA 1OCCH 2Q2EB 1U9OA 3DU5A 2P6SA 5FLVA 5DS9A 2NNYA 3DCFA 1IW7F 3VPRA 2HXIA 3CMYA 3SFZA 2BXYA 4IHVA 3E1SA 4RGSA 4PJLA 5B66C 2ID6A 3R60A 3HOSA 5J1YA 2JRTA 1FP2A 1MNDA 1LFUP 3BJOA 3KETA 2WAQA 2EK5A 2P5VA 2WC2A 2FBIA 2R5ZB 3WGGA 4FETA 2LNBA 2YUSA 5JR3A 1J7KA 1S6LA 3S1MJ 2ZSIB 1U8RA 2L9VA 2CQXA 2VQGA 2KJCA 5LEKA 3WU1B 5F08A 1I27A 4A5NA 3OYLA 3CCUI 3RZDJ 2F4OB 1TWCJ 3J7AY 2JPBA 3GW2A 1TC3C 5DTDA 4D5CA 2HZTA 5J4YA 2M4GA 1JTXA 4A12A 4V2FA 2QZ8A 3K4BA 3FHZA 1JXSA 2DA2A 2R7OA 2FOKA 2DMQA 1V54H 3K2ZA 4E7HA 4KIGA 4J01A 3ROUA 1VZ0A 1POGA 4FT8A 1BW6A 4AD9A 2CW7A 3GFJA 3RYPA 3HZJA 4YFNF 1YITI 1SVMA 1ETKA 2L9SA 1RESA 1SVOA 2LR8A 4KT6A 3OSGA 3N4MA 4G7OF 1TQMA 2CRGA 2KQRA 1YE9A 4WCGA 2R7RA 2XGEA 3U2RA 3I64A 3P7NA 1YFHA 5CVRA 4ESFA 3M4OJ 1F1ZA 4MQ9F 3EYIA 4PUSA 3DLLF 2NRAC 1X3UA 3J7YJ 2MC3A 2NVYJ 2STTA 3HOTA 2BVLA 2XVCA 2DQRA 4M6XA 4OWRB 3DPLC 3U1DA 3ZN0A 2QA4I 2XF5A 1K79A 1VQ5I 2GXBA 2I8DA 4EV0A 1H89C 1YJNI 1U2WA 2E1OA 3KZZA 5DCMA 2HQAA 2BY2A 1IAWA 4ESBA 3IAS2 4U7BA 3CCLI 3J7ZI 4F7ZA 1Y39A 2Y2ZA 5F6FA 3S3OA 2Y9ZA 1YRNB 1N25A 2FD5A 2ME0A 1SD5A 4GRIA 2V7FA 3OYNA 2OA4A 4IHWA 1BBYA 5GAHJ 1FMWA 3GVAA 1IN8A 2CUJA 2CWEA 3PNVA 4BQOA 4DJAA 2W7NA 2NVXJ 5IP7J 4LIVA 4MTEA 3S15J 3C1DA 1XX5A 1D5VA 4BKXA 1XSXA 3QYBA 3GCMA 3K4JA 3QPSA 3R61A 4BJ5C 3E5XA 4ITVA 5KAFC 1HA8A 2GIVA 4B3AA 5L3EA 2F4MB 2G0EA 3RKWA 1T98A 3MKYB 2ACJA 1E0EA 2Y0SA 2L54A 2NYXA 3M8EA 1TWGJ 2OCEA 2R7XA 1EJ9A 1Y1VJ 2XUBA 2ZJPF 5EEHA 1IN7A 2ZXHA 1U9NA 2X9DA 2DMPA 2LKXA 4E7KA 2XAGA 3G1MA 4PFPA 3QOPA 3HXLA 4GCVA 1W0UA 1HC8A 4M9ZA 5F0FA 1TT5B 4WXDA 1BA5A 2EV0A 2STWA 3BG6A 1VQNI 2OTJI 2HVQA 1X1CA 2FQ3A 2DTZA 3DEWA 3KP2A 1X1PA 2O3FA 1FTTA 4KICA 2RN7A 4RAYA 5E8GA 1Z3YA 2K7LA 3DKYA 4IF4A 2R5ZA 3BG3A 3K1MA 4C3HJ 2PMZN 3EPZA 4XLEA 1J59A 4PK4A 2I10A 2PG4A 1RR8C 1HBXG 2Y48A 3ZOBA 2GLOA 4DZJA 4AVPA 5EG0A 3OIPA 4P9UA 2D1VA 4MIMA 1UFMA 2OQGA 4B1RA 3QPLA 2IGNA 3CDLA 3FMQA 3I58A 2NOJB 3DTEA 3BY6A 3CMEI 2AQEA 2K3PA 2BW3B 1P4XA 1QPMA 2MLGA 3NWTA 2M1BA 4JYKA 5KK1A 4ABZA 1IRFA 2BEOA 1VQMI 3PQJA 1Z7LA 1I3QJ 4XLPF 3IH4A 1SAUA 3QPHA 1SFOJ 4CCNA 4B43A 3O6BB 3CF5F 4M3FA 5FKOA 2HQRA 1X1DA 3PL8A 2D45A 1VI0A 2NVTJ 3J7AO 1GVJA 3KP6A 4KN4X 4U0VA 1LQ1A 5FB2A 3D0SA 2OZUA 2YPRA 2VBWA 3GTQJ 4XONA 4LG0A 4CGZA 5CKTA 1DGRM 4UB8C 2IA2A 2XROA 2ZJRF 2X48A 2PJPA 1P6RA 1FIPA 1LVAA 5FLXZ 1TNTA 4XR6A 5LFAA 3BCBA 5F64A 3FK6A 4RM2A 3ZMZA 2Z33A 1P7IA 2OAZA 2PEXA 4LIUA 5A2QZ 1EV7A 3ABMH 3BTJA 3K10A 3T8TA 1AKHB 1IO2A 1G2HA 2VN2A 5ICCA 3JW4A 3I55I 1OMIA 1MMNA 3BCAA 3A02A 3U9GA 1XDUA 4D9JA 4XQFA 4RB3C 4I02A 3ZCOA 1IUYA 4FX4A 2QVOA 3F8FA 3BZCA 3NRVA 5LGNA 3W6VA 2IAIA 4PSXA 3MKWB 5FD6A 2VJJA 4M71A 4HV6A 2ZSHB 3EDPA 1ENHA 3HRUA 3HOXJ 3MKLA 3CCJI 4A3GJ 1YRNA 3TBIA
chains in the Genus database with same CATH topology
4P96A 4BHCA 3GZ6A 4GYGA 4CDGA 2OD5A 4BAYA 3IRRA 3O3KA 5CYVA 3M9AA 4A0YA 4HDVA 3K9TA 3V8JA 1D3YA 3MEXA 2PBIA 1TW2A 5E1ZB 1MDMA 1FYLA 1R1VA 4HZFA 4OINF 3SXYA 3EUHA 1U5TA 2NNNA 1IRGA 1KQ8A 2KIUA 2XKOA 2Z99A 4OIRF 1KYWA 2V1DA 3I4PA 4QWQA 3GYHX 4HYEA 1EH7A 3BZ6A 1KGSA 4GYIA 3BOQA 5LHIA 4AWXB 3T5XA 3CDHA 2C6YA 2NAZA 2BYVE 1PP8F 1B9MA 2LF7A 4HF2A 3E6MA 1ZLKA 3ISPA 3DKWA 1RIOH 3JTGA 3I54A 3ZMSA 3FMRA 3RTRA 4EJOA 1HSTA 4OMYA 2FNPA 4UHTA 3WU0A 4ZYDA 4AIJA 3RI4A 5D8KB 4EJTA 2O61A 4M9XA 3REOA 5D5UB 3TKYA 1BI3A 5FO5A 4KT5C 3ERED 3QRFF 4YIFA 3FWEA 1G3SA 3WTVC 3TQNA 4N9HA 4JQFA 3F8BA 4A6EA 5L3GA 2W84A 3ZMDA 4RGUA 4ZYEA 2MLKA 5KVRA 3L7WA 4MHGA 4R1HA 3SZPA 4YFXF 1HKTA 1IZ1A 1K78A 4YG2F 4L9NA 1YQAA 4KYWA 1EH8A 2DLLA 2ZNZA 3P9IA 5E18F 2Q8KA 2K86A 2L01A 2FU4A 4CHUA 2FMYA 1IN6A 4IHSA 1IXSB 2WWYA 1R5GA 3WG9A 2XAQA 2ISYA 3JSPA 3TDZC 1UHWA 3HUGA 2VBXA 4HX8A 1KQ9A 4OIQF 3K0LA 4M74A 3RPQA 4NQWA 1DPRA 1R36A 2HTSA 2ADUA 1L0OC 1I1SA 3M7GA 1A04A 2LKPA 3CUOA 1J2XA 2DK8A 1ULYA 4ESJA 3IWZA 3E6CC 1P2FA 2P6TA 5JI6A 2EB7A 2RC4A 4MTDA 4E70A 3TDUC 4QLCU 4I0BA 3J80Z 4ENJA 4HAMA 3ZMVA 1Z7UA 2HKOA 3RIRA 1ONVA 2L4MA 1QZYA 3WE3A 4PGGA 2F2EA 2IVMA 5BS6A 1S7AA 1BOAA 1MD0A 3J81K 4KMUX 4R79A 2OBPA 3TO7A 4KNYA 1D8KA 3V7RA 2HDCA 4IJAA 3QPTA 1QO0D 3WGIA 4U7DA 2JPCA 3CUQC 3LWFA 1SFUA 4HDUA 2HYFA 5FFZA 3V4GA 1HW1A 3ULQB 1GXPA 3HIFA 1YYVA 3DEUA 5LBQA 4EM1A 4ENMA 1SMTA 1OR7A 4Y17A 1FNNA 1R23A 4MGRA 2VT2A 3T1BA 1HQCA 3K69A 3ABUA 3MWMA 2JTVA 1FWZA 1ZLJA 3Q5FA 1YW9A 4D0PA 4L0YB 5D8LB 2H6BA 2PQ8A 2KKOA 1USTA 1K7AA 4LB6B 4UUVA 1XGNA 3DP7A 3WTXC 3GFIA 2DPUA 5DDGA 4HF1A 5CVIA 3KP4A 2HS5A 5E8IA 2TDXA 3GO5A 1NHAA 5H6QA 1D8JA 1SAXA 1BI1A 2IT0A 1ZAOA 3S2WA 3EETA 1P4WA 3P9KA 1U78A 2DO7A 4WXHA 2EFQA 2RQPA 3GLXA 4RS8A 4MNUA 1ODDA 4LLNA 1USSA 1QQIA 4XRFA 2WTEA 4S05A 5HLIA 2L4AA 2BGCA 3IKTA 4KFCA 1RZ4A 5BMZA 2F5DA 3WTZA 1ON1A 2ELHA 5JFRA 4LJZF 2ZO4A 2P7CB 3TGNA 1DPUA 3BPVA 4ZZLA 3EYYA 4B8XA 2A61A 2YU3A 3L09A 5J6XA 4LG0B 4RAZA 4BYYA 1FY7A 2QM3A 1PDNC 1KA8A 3BJAA 3P9CA 2HWVA 2AS5F 5ICGA 4BHPA 3E97A 4MQVA 2Y0MA 2XASA 1ZHFA 4KN7X 4WXCA 3VODA 3KLNA 3F72A 4IPAA 5J8CA 3H3ZA 3IHUA 1R7JA 3HSRA 1B9NA 1BJAA 4LB5A 3ZMTA 2A69F 1OYWA 1F9NA 1FSEA 4MEYF 4I0AA 1G3WA 2LSOA 2ZBKA 1K6OA 4BNCA 2K4BA 1CF7A 1R22A 2ZMEA 5H6RA 3FMSA 1FLIA 1XDSA 3LA7A 1MDMB 4UNOA 3GEZA 5L3CA 2ESHA 4L9VA 4WF2A 1U5TB 5K1YA 2DPDA 3LA3A 1XCBA 3MFKA 4ASNA 2P5LC 2ZFWA 3CJNA 5D6EA 2K02A 5LLQA 1O3TA 2CGPA 2DAOA 1ZG5A 4PZJA 1O3RA 2ISZA 1B1BA 5E20A 1RI7A 5ILUA 3C7JA 2FE3A 1T6SA 2DBBA 1PP7U 1ZGAA 4ETSA 1ZRDA 4RB2C 2MA3A 1MGTA 2QWWA 2A07F 3WTWC 1EH6A 2JZYA 3VOEA 2EJRA 3MCZA 3FXQA 3NQOA 3ZMUA 4BH9A 3HSEA 2V6CA 4JBAA 1O3SA 3RPUA 4TV7A 5DCFA 4XSZF 3B73A 3KP7A 1B59A 5J8FA 1W4MA 3JSOA 4P55A 1BM9A 1JGSA 2D2WA 4DQ2A 5D4SA 2VC1A 2GWRA 4WWCA 1FC3A 2M87A 3BROA 2XAJA 3RJPA 2HEOA 1ZG3A 1L3LA 4WK8F 4A6DA 1J0RA 5IT9K 1LEBA 4BHBA 4EM2A 3R0AA 1E17A 1FBUA 1K78B 2H09A 2W24A 3Q9SA 2W85A 1U3EM 3HRSA 1G4DA 4I98B 3RYRA 1Z05A 4L5JA 3HYIA 1Z1DA 3ML6A 4UV9A 5HS7A 5HS9A 2Z5UA 2P7VB 1LDKB 1WWXA 4G6QA 4CICA 2ZNYA 3W6JB 5F1RA 1P92A 3F6OA 3KEOA 4AIKA 1TTYA 3LQQA 3BWGA 3VFZA 2G7HA 3KFWX 2MH2A 3V8KA 3GZ5A 2DTRA 2Z9OA 3D5LA 3RKYA 3TO6A 5ICFA 2XAFA 4N0BA 2IW5A 5BQTA 2F5EA 4I09A 4MEXF 3LSTA 5K5RA 1KYZA 1XMAA 3HRMA 1BC8C 2R7FA 1PUEE 2L3DA 2LF8A 2Q0OA 2W57A 3FXRA 2PFBA 3BDDA 1WQ2A 1UHMA 5EEGA 4CYDA 1ZH5A 4Y15A 4G94A 3QU3A 1BIBA 1KU7A 1GXQA 2X0LA 2PMHA 4PDKA 2WV0A 1FPQA 1IXCA 1I1GA 1LEAA 2OZ6A 2FBKA 2KRFA 2VE8A 1LDJA 2DQLA 2J5OA 1RUNA 3BPXA 1OYIA 4Q4ZF 1WI9A 5LHHA 5ILVA 1BI0A 4ENKA 2A6HF 3G3ZA 2V79A 5HS8A 2UXXA 2P5KA 3T8RA 3RKXA 1R00A 5CVVA 4L0ZB 4HW0A 1H9TA 4XSXF 4Q48A 3VB2A 3COAC 1QZZA 2MD5A 3GWZA 1R58A 4G7HF 1W5TA 1HW2A 1YW7A 3IRQA 2F5CA 1LJ9A 4ZYHA 4IRGA 2FSWA 3KP3A 4M9SA 2A3SA 1YS6A 2E1NA 2CW0F 1XN7A 1O7LA 3CO6C 2X4HA 3E6BA 2HKXA 2G7UA 1P4AA 4GO1A 4KUMA 4NB5A 5ED4A 2MBFA 4I01A 4ZZDA 2VOOA 5HLGA 2FA5A 1ZG1A 1VTNC 4U0YA 1KU9A 4A0ZA 1XB4A 3WTSC 2DW4A 2EFPA 2Z3YA 3I59A 3WGHA 3WODF 1SFEA 1C0WA 4HV5A 2K27A 2DU9A 3HRTA 4ZYGA 5K5OA 4EJVA 3DF8A 4A0XA 4M72A 2QLZA 2J5PA 2EA2A 1WKMA 2PLYA 4DNCA 1AOYA 2BBYA 4EQQA 2KIMA 5FFXA 2VOPA 3M8FA 1T38A 2O03A 4M73A 5FLXK 3GFLA 2QBYA 1FYKA 2DK5A 3E6DA 1STZA 1V3FA 5A2QK 2FF4A 4I2OA 5AIPA 2XIGA 2OQRA 4JK1X 1H0MA 1AWCA 3PQKA 2UZKA 1RUOA 4OMZA 3SZTA 1KU3A 3L00A 2VODA 3R0JA 3JTHA 4EGYA 4I7HA 3K1NA 5E1XA 2RV8A 2A5YB 4IRIA 1O7FA 4UVAA 2PMUA 2D1HA 1CF7B 2ZMEB 2B0LA 3L2CA 3QP5A 2QQAA 1FX7A 1T39A 5FD5A 4L9JA 1ZARA 2R7DA 1V4RA 2EV6A 1DDNA 1YW8A 3FX3A 4YIIA 1Z9CA 5D5XB 4CO8A 1R1UA 1JHFA 4GGGA 3LA2A 3VEPA 1QNTA 5D5WB 5LRRA 4M6YA 2GA1A 1MJ9A 5FGMA 3FF5A 4HBLA 2MH9A 3DPTA 2ZXJA 1T0FA 1YLFA 4CZZA 4G6DA 1IN5A 1XSVA 3MAJA 2UWMA 4KDPA 3TO9A 3ABTA 3C18A 2CFXA 5LGUA 4OOIA 1OKRA 3Q9VA 1FSHA 4IRHA 3ECOA 1REPC 3LAPA 2XRNA 3OOPA 1B6AA 1Z6RA 2M30A 5HOOA 1O3QA 4UV8A 1IF1A 1KU2A 1XGOA 1HKQA 2CG4A 3IWFA 1MJBA 3G73A 1TQIA 1R1TA 2GA2A 4OIPF 4RGXA 1XD7A 4XBFA 4RB0A 3GF2A 5LHGA 3WE2A 4O3MA 2DT5A 1U5TC 1QGPA 3EQLF 2KIFA 3BJ6A 3AAFA 1DP7P 4BXUA 1G3TA 4Z2YA 5DD8A 2LDUA 1XSDA 1SD7A 1YO5C 3LFKA 2VBYA 2EV5A 2QQBA 4GXOA 3F23A 1HSJA 3I0TA 2EA4A 1HKSA 2YX7A 3CUQA 3F8NA 1W5SA 2E7WA 5D5VB 3KCCA 1JHHA 1FT9A 2QYOA 2H6CA 3F8CA 4LK0F 3I53A 2IPQX 1S29A 1W7PA 3LAJA 3WTUC 3ZP5A 2CYYA 2HYGD 4N9IA 3HHGA 1XCVA 3TOAA 2K4JA 1G3YA 3WTYC 2Q2EA 1BC7C 3JAMK 3W6KB 4CXFA 2XV4S 5CJ9A 1XGSA 2FMLA 3E5UA 5DUIA 1ZREA 3E3VA 4HF0A 4L9TA 1F4KA 5DV5A 1FBSA 1TBXA 2F5FA 4EMSA 1WRJA 4O5VA 4A2UA 2GAUA 1R5HA 1OYYA 3J81Z 3V8LA 3IC7A 1JE8A 1S3JA 4KIFA 4P5OA 5JHUA 3CLOA 2EFWA 1U6GA 3F6VA 1S8NA 3J80K 4FHTA 1IXRC 2O8XA 3NEUA 5BPIA 2IA0A 4XLNF 1I5ZA 4HLXA 5L3DA 4B09A 2NS0A 5TJJA 3FM5A 4EGZA 2E1CA 2V9VA 3O2PE 4UVCA 1J5YA 5L3FA 2VXZA 3B02A 1O57A 4LMYA 5ERIA 4G8XA 3RDIA 5TRDA 5LEJA 2FRHA 1XGMA 2HR3A 3KE2A 3T0YA 1YIOA 3H92A 2A68F 1FYMA 3DXJF 2ZCWA 2PI0A 4ZH4F 2RKHA 2RGVA 4HQEA 2DFIA 2QUFA 4O6JA 2M8EA 5E17F 2EFOA 5AONA 4L5IA 2Y75A 3ZPLA 1H9GA 3ZN1A 4Q47A 1T2KA 3F3XA 1TW3A 4K2EA 3OV8A 3M1EA 4OU0A 3FZVA 1HXDA 1FOKA 1YTYA 5HDGA 4AIHA 4Y13A 1GHCA 1ZRFA 2KJBA 1FP1D 3MZYA 1S7OA 4LD5A 5K5QA 3IL2A 2XAHA 3SQNA 2OU2A 2BV6A 1J75A 1CGPA 3CTAA 1UB9A 4P9FA 2H27A 4HX7A 1MZBA 2A6EF 5LRSA 3KZYA 2E7XA 5E1WA 1ON2A 2HOEA 4G9YA 5DUKA 2EWNA 4PCQA 5BOXA 1I6XA 5HDKA 4HLYA 4H0EA 3I59B 1HW5A 3F8MA 2R3SA 4IXAA 4LFUA 1J9IA 4L18B 4HA8A 2HQNA 3QP6A 2PN6A 1WSUA 1TNSA 1F5TA 2FEZA 1MJAA 1YS7A 5D4RA 4IHTA 1Z6TA 3WTTC 2JSCA 4HOBA 4EJUA 4LLLA 2QBYB 2ETHA 3F22A 1LDDA 3PFIA 4FX0A 4KMFA 3FM3A 5HDNA 1DUXC 2P8TA 2FXAA 1B4AA 2GQQA 2XGXA 4IVNA 5HVQC 2YR2A 4A5MA 5H20A 5D6FA 2O0YA 6PAXA 1LNWA 3MQ0A 5HLHA 5ILSA 4KA4A 2GZWA 4ON0A 3DFGA 2VE9A 1TQPA 2L02A 2M45A 3BP8A 3L9FA 4OIOF 2RNJA 5DD4A 1SMYF 3V7SA 3HTUA 1YG2A 4G7ZF 4HX4A 1W7PD 2DI3A 3JAMZ 2ESNA 2IA1A 2HTJA 1ZN2A 5AIQA 2CSOA 3KEQA 1RNLA 2RDPA 3GFMA 1KQ0A 3KLOA 3ZQ7A 4YFKF 5ICEA 4EJWA 2P4WA 2VBZA 3E5QA 3QAHA 1Q1HA 2JT1A 1MKMA 3F21A 1BI2A 3I71A 3K1PA 1XMKA 2O6GE 3H3UA 3KP5A 3LQRA 2COMA 5IT3A 2HGCA 2H94A 3TOBA 2GXGA 4LK1F 2CO5A 3IKVA 2QENA 3DV8A 5CVUA 3I5UA 2RVCA 4U0WA 2BE5F 4S04A 2VT3A 2YSRA 4U88A 3ELKA 2VC0A 2FNAA 2VONA 4HQMA 3DQVC 5LGTA 3SHFA 5CLSA 2M5WA 1FBQA 4BQAA 2EFNA 5IT9Z 2YX4A 4LLGF 2QQ9A 1FZPB 3QU6A 1LB2A 3R6SA 1BIAA 4EVIA 4RGRA 1ZRCA 2ZKZA 5DEQA 1ZGJA 2CQKA 4PGHA 1OPCA 4NHJA 2AXLA 2UXNA 4EM0B 3N97A 5BPDA 3ECHA 4RB1A 5JVTA 4KIBA 4WX9A 1IN4A 3FXUA 3V7CA 2FBHA 2ZJ2A 5DCMB 3R4KA 4UVBA 3HSFA 3MZHA 5DYMA 3GXOA 4R8HA 1E2XA 3CUQB 1ZYRF 2W25A 3GX4X 5L3BA 3C3WA 1SD6A 3CO7C 2IP2A 4ENNA 1Y0UA 2XHKA 3GUDA 3HHHA 2IJLA 1SFXA 4Q5SF 2IRFG 4LGWA 1UCRA 1W7PB 1TLHB 5CVJA 3HTSB 1BN5A 2XKPA 2G9WA 2V1UA 1QBJA 1G6NA 2HFHA 1SD4A 1Z91A 2V1XA 4UXNA 2P6SA 2NNYA 1IW7F 3SFZA 4RGSA 3R60A 3HOSA 2JRTA 1FP2A 3BJOA 3KETA 2EK5A 2WC2A 2P5VA 2FBIA 3WGGA 2LNBA 5JR3A 1J7KA 1S6LA 1U8RA 5LEKA 2KJCA 3WU1B 1I27A 4A5NA 2JPBA 3GW2A 2HZTA 4A12A 3FHZA 2QZ8A 1JXSA 2FOKA 3K2ZA 4KIGA 3ROUA 4FT8A 4AD9A 3GFJA 3RYPA 4YFNF 3N4MA 4G7OF 1TQMA 4WCGA 3U2RA 3I64A 3P7NA 1YFHA 5CVRA 4ESFA 1F1ZA 4MQ9F 3EYIA 2NRAC 1X3UA 2MC3A 2STTA 3HOTA 2XVCA 2DQRA 4M6XA 3ZN0A 3DPLC 3U1DA 1K79A 2GXBA 4EV0A 1U2WA 5DCMA 3KZZA 1IAWA 4ESBA 4U7BA 4F7ZA 5F6FA 1SD5A 2OA4A 1BBYA 3GVAA 1IN8A 2CWEA 4MTEA 3C1DA 1D5VA 1XSXA 3R61A 3E5XA 2GIVA 5L3EA 3RKWA 1T98A 2ACJA 2L54A 2NYXA 3M8EA 2XUBA 5EEHA 1IN7A 2XAGA 3QOPA 4GCVA 4M9ZA 4WXDA 2EV0A 2STWA 2FQ3A 3KP2A 2O3FA 4KICA 2RN7A 4RAYA 5E8GA 2K7LA 4IF4A 3K1MA 1J59A 2PG4A 1HBXG 2Y48A 4AVPA 4P9UA 2D1VA 1UFMA 2OQGA 3FMQA 3I58A 3BY6A 5KK1A 1P4XA 1QPMA 2MLGA 2M1BA 1IRFA 2BEOA 3PQJA 4XLPF 3QPHA 3O6BB 2HQRA 2D45A 3J7AO 1GVJA 3KP6A 4KN4X 4U0VA 1LQ1A 5FB2A 3D0SA 2OZUA 2YPRA 2VBWA 4LG0A 4CGZA 2XROA 2IA2A 2PJPA 1P6RA 1LVAA 5FLXZ 1TNTA 5F64A 3ZMZA 2Z33A 2OAZA 2PEXA 5A2QZ 1EV7A 3T8TA 2VN2A 5ICCA 3JW4A 1OMIA 3U9GA 1XDUA 4RB3C 4I02A 1IUYA 4FX4A 2QVOA 3F8FA 3NRVA 5LGNA 5FD6A 4M71A 4HV6A 3EDPA 3HRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P96 A;  4BHC A;  3GZ6 A;  4GYG A;  4CDG A;  2OD5 A;  4BAY A;  3IRR A;  3O3K A;  5CYV A;  3M9A A;  4A0Y A;  4HDV A;  3K9T A;  3V8J A;  1D3Y A;  3MEX A;  2PBI A;  1TW2 A;  5E1Z B;  1MDM A;  1FYL A;  1R1V A;  4HZF A;  4OIN F;  3SXY A;  3EUH A;  1U5T A;  2NNN A;  1IRG A;  1KQ8 A;  2KIU A;  2XKO A;  2Z99 A;  4OIR F;  1KYW A;  2V1D A;  3I4P A;  4QWQ A;  3GYH X;  4HYE A;  1EH7 A;  3BZ6 A;  1KGS A;  4GYI A;  3BOQ A;  5LHI A;  4AWX B;  3T5X A;  3CDH A;  2C6Y A;  2NAZ A;  2BYV E;  1PP8 F;  1B9M A;  2LF7 A;  4HF2 A;  3E6M A;  1ZLK A;  3ISP A;  3DKW A;  1RIO H;  3JTG A;  3I54 A;  3ZMS A;  3FMR A;  3RTR A;  4EJO A;  1HST A;  4OMY A;  2FNP A;  4UHT A;  3WU0 A;  4ZYD A;  4AIJ A;  3RI4 A;  5D8K B;  4EJT A;  2O61 A;  4M9X A;  3REO A;  5D5U B;  3TKY A;  1BI3 A;  5FO5 A;  4KT5 C;  3ERE D;  3QRF F;  4YIF A;  3FWE A;  1G3S A;  3WTV C;  3TQN A;  4N9H A;  4JQF A;  3F8B A;  4A6E A;  5L3G A;  2W84 A;  3ZMD A;  4RGU A;  4ZYE A;  2MLK A;  5KVR A;  3L7W A;  4MHG A;  4R1H A;  3SZP A;  4YFX F;  1HKT A;  1IZ1 A;  1K78 A;  4YG2 F;  4L9N A;  1YQA A;  4KYW A;  1EH8 A;  2DLL A;  2ZNZ A;  3P9I A;  5E18 F;  2Q8K A;  2K86 A;  2L01 A;  2FU4 A;  4CHU A;  2FMY A;  1IN6 A;  4IHS A;  1IXS B;  2WWY A;  1R5G A;  3WG9 A;  2XAQ A;  2ISY A;  3JSP A;  3TDZ C;  1UHW A;  3HUG A;  2VBX A;  4HX8 A;  1KQ9 A;  4OIQ F;  3K0L A;  4M74 A;  3RPQ A;  4NQW A;  1DPR A;  1R36 A;  2HTS A;  2ADU A;  1L0O C;  1I1S A;  3M7G A;  1A04 A;  2LKP A;  3CUO A;  1J2X A;  2DK8 A;  1ULY A;  4ESJ A;  3IWZ A;  3E6C C;  1P2F A;  2P6T A;  5JI6 A;  2EB7 A;  2RC4 A;  4MTD A;  4E70 A;  3TDU C;  4QLC U;  4I0B A;  3J80 Z;  4ENJ A;  4HAM A;  3ZMV A;  1Z7U A;  2HKO A;  3RIR A;  1ONV A;  2L4M A;  1QZY A;  3WE3 A;  4PGG A;  2F2E A;  2IVM A;  5BS6 A;  1S7A A;  1BOA A;  1MD0 A;  3J81 K;  4KMU X;  4R79 A;  2OBP A;  3TO7 A;  4KNY A;  1D8K A;  3V7R A;  2HDC A;  4IJA A;  3QPT A;  1QO0 D;  3WGI A;  4U7D A;  2JPC A;  3CUQ C;  3LWF A;  1SFU A;  4HDU A;  2HYF A;  5FFZ A;  3V4G A;  1HW1 A;  3ULQ B;  1GXP A;  3HIF A;  1YYV A;  3DEU A;  5LBQ A;  4EM1 A;  4ENM A;  1SMT A;  1OR7 A;  4Y17 A;  1FNN A;  1R23 A;  4MGR A;  2VT2 A;  3T1B A;  1HQC A;  3K69 A;  3ABU A;  3MWM A;  2JTV A;  1FWZ A;  1ZLJ A;  3Q5F A;  1YW9 A;  4D0P A;  4L0Y B;  5D8L B;  2H6B A;  2PQ8 A;  2KKO A;  1UST A;  1K7A A;  4LB6 B;  4UUV A;  1XGN A;  3DP7 A;  3WTX C;  3GFI A;  2DPU A;  5DDG A;  4HF1 A;  5CVI A;  3KP4 A;  2HS5 A;  5E8I A;  2TDX A;  3GO5 A;  1NHA A;  5H6Q A;  1D8J A;  1SAX A;  1BI1 A;  2IT0 A;  1ZAO A;  3S2W A;  3EET A;  1P4W A;  3P9K A;  1U78 A;  2DO7 A;  4WXH A;  2EFQ A;  2RQP A;  3GLX A;  4RS8 A;  4MNU A;  1ODD A;  4LLN A;  1USS A;  1QQI A;  4XRF A;  2WTE A;  4S05 A;  5HLI A;  2L4A A;  2BGC A;  3IKT A;  4KFC A;  1RZ4 A;  5BMZ A;  2F5D A;  3WTZ A;  1ON1 A;  2ELH A;  5JFR A;  4LJZ F;  2ZO4 A;  2P7C B;  3TGN A;  1DPU A;  3BPV A;  4ZZL A;  3EYY A;  4B8X A;  2A61 A;  2YU3 A;  3L09 A;  5J6X A;  4LG0 B;  4RAZ A;  4BYY A;  1FY7 A;  2QM3 A;  1PDN C;  1KA8 A;  3BJA A;  3P9C A;  2HWV A;  2AS5 F;  5ICG A;  4BHP A;  3E97 A;  4MQV A;  2Y0M A;  2XAS A;  1ZHF A;  4KN7 X;  4WXC A;  3VOD A;  3KLN A;  3F72 A;  4IPA A;  5J8C A;  3H3Z A;  3IHU A;  1R7J A;  3HSR A;  1B9N A;  1BJA A;  4LB5 A;  3ZMT A;  2A69 F;  1OYW A;  1F9N A;  1FSE A;  4MEY F;  4I0A A;  1G3W A;  2LSO A;  2ZBK A;  1K6O A;  4BNC A;  2K4B A;  1CF7 A;  1R22 A;  2ZME A;  5H6R A;  3FMS A;  1FLI A;  1XDS A;  3LA7 A;  1MDM B;  4UNO A;  3GEZ A;  5L3C A;  2ESH A;  4L9V A;  4WF2 A;  1U5T B;  5K1Y A;  2DPD A;  3LA3 A;  1XCB A;  3MFK A;  4ASN A;  2P5L C;  2ZFW A;  3CJN A;  5D6E A;  2K02 A;  5LLQ A;  1O3T A;  2CGP A;  2DAO A;  1ZG5 A;  4PZJ A;  1O3R A;  2ISZ A;  1B1B A;  5E20 A;  1RI7 A;  5ILU A;  3C7J A;  2FE3 A;  1T6S A;  2DBB A;  1PP7 U;  1ZGA A;  4ETS A;  1ZRD A;  4RB2 C;  2MA3 A;  1MGT A;  2QWW A;  2A07 F;  3WTW C;  1EH6 A;  2JZY A;  3VOE A;  2EJR A;  3MCZ A;  3FXQ A;  3NQO A;  3ZMU A;  4BH9 A;  3HSE A;  2V6C A;  4JBA A;  1O3S A;  3RPU A;  4TV7 A;  5DCF A;  4XSZ F;  3B73 A;  3KP7 A;  1B59 A;  5J8F A;  1W4M A;  3JSO A;  4P55 A;  1BM9 A;  1JGS A;  2D2W A;  4DQ2 A;  5D4S A;  2VC1 A;  2GWR A;  4WWC A;  1FC3 A;  2M87 A;  3BRO A;  2XAJ A;  3RJP A;  2HEO A;  1ZG3 A;  1L3L A;  4WK8 F;  4A6D A;  1J0R A;  5IT9 K;  1LEB A;  4BHB A;  4EM2 A;  3R0A A;  1E17 A;  1FBU A;  1K78 B;  2H09 A;  2W24 A;  3Q9S A;  2W85 A;  1U3E M;  3HRS A;  1G4D A;  4I98 B;  3RYR A;  1Z05 A;  4L5J A;  3HYI A;  1Z1D A;  3ML6 A;  4UV9 A;  5HS7 A;  5HS9 A;  2Z5U A;  2P7V B;  1LDK B;  1WWX A;  4G6Q A;  4CIC A;  2ZNY A;  3W6J B;  5F1R A;  1P92 A;  3F6O A;  3KEO A;  4AIK A;  1TTY A;  3LQQ A;  3BWG A;  3VFZ A;  2G7H A;  3KFW X;  2MH2 A;  3V8K A;  3GZ5 A;  2DTR A;  2Z9O A;  3D5L A;  3RKY A;  3TO6 A;  5ICF A;  2XAF A;  4N0B A;  2IW5 A;  5BQT A;  2F5E A;  4I09 A;  4MEX F;  3LST A;  5K5R A;  1KYZ A;  1XMA A;  3HRM A;  1BC8 C;  2R7F A;  1PUE E;  2L3D A;  2LF8 A;  2Q0O A;  2W57 A;  3FXR A;  2PFB A;  3BDD A;  1WQ2 A;  1UHM A;  5EEG A;  4CYD A;  1ZH5 A;  4Y15 A;  4G94 A;  3QU3 A;  1BIB A;  1KU7 A;  1GXQ A;  2X0L A;  2PMH A;  4PDK A;  2WV0 A;  1FPQ A;  1IXC A;  1I1G A;  1LEA A;  2OZ6 A;  2FBK A;  2KRF A;  2VE8 A;  1LDJ A;  2DQL A;  2J5O A;  1RUN A;  3BPX A;  1OYI A;  4Q4Z F;  1WI9 A;  5LHH A;  5ILV A;  1BI0 A;  4ENK A;  2A6H F;  3G3Z A;  2V79 A;  5HS8 A;  2UXX A;  2P5K A;  3T8R A;  3RKX A;  1R00 A;  5CVV A;  4L0Z B;  4HW0 A;  1H9T A;  4XSX F;  4Q48 A;  3VB2 A;  3COA C;  1QZZ A;  2MD5 A;  3GWZ A;  1R58 A;  4G7H F;  1W5T A;  1HW2 A;  1YW7 A;  3IRQ A;  2F5C A;  1LJ9 A;  4ZYH A;  4IRG A;  2FSW A;  3KP3 A;  4M9S A;  2A3S A;  1YS6 A;  2E1N A;  2CW0 F;  1XN7 A;  1O7L A;  3CO6 C;  2X4H A;  3E6B A;  2HKX A;  2G7U A;  1P4A A;  4GO1 A;  4KUM A;  4NB5 A;  5ED4 A;  2MBF A;  4I01 A;  4ZZD A;  2VOO A;  5HLG A;  2FA5 A;  1ZG1 A;  1VTN C;  4U0Y A;  1KU9 A;  4A0Z A;  1XB4 A;  3WTS C;  2DW4 A;  2EFP A;  2Z3Y A;  3I59 A;  3WGH A;  3WOD F;  1SFE A;  1C0W A;  4HV5 A;  2K27 A;  2DU9 A;  3HRT A;  4ZYG A;  5K5O A;  4EJV A;  3DF8 A;  4A0X A;  4M72 A;  2QLZ A;  2J5P A;  2EA2 A;  1WKM A;  2PLY A;  4DNC A;  1AOY A;  2BBY A;  4EQQ A;  2KIM A;  5FFX A;  2VOP A;  3M8F A;  1T38 A;  2O03 A;  4M73 A;  5FLX K;  3GFL A;  2QBY A;  1FYK A;  2DK5 A;  3E6D A;  1STZ A;  1V3F A;  5A2Q K;  2FF4 A;  4I2O A;  5AIP A;  2XIG A;  2OQR A;  4JK1 X;  1H0M A;  1AWC A;  3PQK A;  2UZK A;  1RUO A;  4OMZ A;  3SZT A;  1KU3 A;  3L00 A;  2VOD A;  3R0J A;  3JTH A;  4EGY A;  4I7H A;  3K1N A;  5E1X A;  2RV8 A;  2A5Y B;  4IRI A;  1O7F A;  4UVA A;  2PMU A;  2D1H A;  1CF7 B;  2ZME B;  2B0L A;  3L2C A;  3QP5 A;  2QQA A;  1FX7 A;  1T39 A;  5FD5 A;  4L9J A;  1ZAR A;  2R7D A;  1V4R A;  2EV6 A;  1DDN A;  1YW8 A;  3FX3 A;  4YII A;  1Z9C A;  5D5X B;  4CO8 A;  1R1U A;  1JHF A;  4GGG A;  3LA2 A;  3VEP A;  1QNT A;  5D5W B;  5LRR A;  4M6Y A;  2GA1 A;  1MJ9 A;  5FGM A;  3FF5 A;  4HBL A;  2MH9 A;  3DPT A;  2ZXJ A;  1T0F A;  1YLF A;  4CZZ A;  4G6D A;  1IN5 A;  1XSV A;  3MAJ A;  2UWM A;  4KDP A;  3TO9 A;  3ABT A;  3C18 A;  2CFX A;  5LGU A;  4OOI A;  1OKR A;  3Q9V A;  1FSH A;  4IRH A;  3ECO A;  1REP C;  3LAP A;  2XRN A;  3OOP A;  1B6A A;  1Z6R A;  2M30 A;  5HOO A;  1O3Q A;  4UV8 A;  1IF1 A;  1KU2 A;  1XGO A;  1HKQ A;  2CG4 A;  3IWF A;  1MJB A;  3G73 A;  1TQI A;  1R1T A;  2GA2 A;  4OIP F;  4RGX A;  1XD7 A;  4XBF A;  4RB0 A;  3GF2 A;  5LHG A;  3WE2 A;  4O3M A;  2DT5 A;  1U5T C;  1QGP A;  3EQL F;  2KIF A;  3BJ6 A;  3AAF A;  1DP7 P;  4BXU A;  1G3T A;  4Z2Y A;  5DD8 A;  2LDU A;  1XSD A;  1SD7 A;  1YO5 C;  3LFK A;  2VBY A;  2EV5 A;  2QQB A;  4GXO A;  3F23 A;  1HSJ A;  3I0T A;  2EA4 A;  1HKS A;  2YX7 A;  3CUQ A;  3F8N A;  1W5S A;  2E7W A;  5D5V B;  3KCC A;  1JHH A;  1FT9 A;  2QYO A;  2H6C A;  3F8C A;  4LK0 F;  3I53 A;  2IPQ X;  1S29 A;  1W7P A;  3LAJ A;  3WTU C;  3ZP5 A;  2CYY A;  2HYG D;  4N9I A;  3HHG A;  1XCV A;  3TOA A;  2K4J A;  1G3Y A;  3WTY C;  2Q2E A;  1BC7 C;  3JAM K;  3W6K B;  4CXF A;  2XV4 S;  5CJ9 A;  1XGS A;  2FML A;  3E5U A;  5DUI A;  1ZRE A;  3E3V A;  4HF0 A;  4L9T A;  1F4K A;  5DV5 A;  1FBS A;  1TBX A;  2F5F A;  4EMS A;  1WRJ A;  4O5V A;  4A2U A;  2GAU A;  1R5H A;  1OYY A;  3J81 Z;  3V8L A;  3IC7 A;  1JE8 A;  1S3J A;  4KIF A;  4P5O A;  5JHU A;  3CLO A;  2EFW A;  1U6G A;  3F6V A;  1S8N A;  3J80 K;  4FHT A;  1IXR C;  2O8X A;  3NEU A;  5BPI A;  2IA0 A;  4XLN F;  1I5Z A;  4HLX A;  5L3D A;  4B09 A;  2NS0 A;  5TJJ A;  3FM5 A;  4EGZ A;  2E1C A;  2V9V A;  3O2P E;  4UVC A;  1J5Y A;  5L3F A;  2VXZ A;  3B02 A;  1O57 A;  4LMY A;  5ERI A;  4G8X A;  3RDI A;  5TRD A;  5LEJ A;  2FRH A;  1XGM A;  2HR3 A;  3KE2 A;  3T0Y A;  1YIO A;  3H92 A;  2A68 F;  1FYM A;  3DXJ F;  2ZCW A;  2PI0 A;  4ZH4 F;  2RKH A;  2RGV A;  4HQE A;  2DFI A;  2QUF A;  4O6J A;  2M8E A;  5E17 F;  2EFO A;  5AON A;  4L5I A;  2Y75 A;  3ZPL A;  1H9G A;  3ZN1 A;  4Q47 A;  1T2K A;  3F3X A;  1TW3 A;  4K2E A;  3OV8 A;  3M1E A;  4OU0 A;  3FZV A;  1HXD A;  1FOK A;  1YTY A;  5HDG A;  4AIH A;  4Y13 A;  1GHC A;  1ZRF A;  2KJB A;  1FP1 D;  3MZY A;  1S7O A;  4LD5 A;  5K5Q A;  3IL2 A;  2XAH A;  3SQN A;  2OU2 A;  2BV6 A;  1J75 A;  1CGP A;  3CTA A;  1UB9 A;  4P9F A;  2H27 A;  4HX7 A;  1MZB A;  2A6E F;  5LRS A;  3KZY A;  2E7X A;  5E1W A;  1ON2 A;  2HOE A;  4G9Y A;  5DUK A;  2EWN A;  4PCQ A;  5BOX A;  1I6X A;  5HDK A;  4HLY A;  4H0E A;  3I59 B;  1HW5 A;  3F8M A;  2R3S A;  4IXA A;  4LFU A;  1J9I A;  4L18 B;  4HA8 A;  2HQN A;  3QP6 A;  2PN6 A;  1WSU A;  1TNS A;  1F5T A;  2FEZ A;  1MJA A;  1YS7 A;  5D4R A;  4IHT A;  1Z6T A;  3WTT C;  2JSC A;  4HOB A;  4EJU A;  4LLL A;  2QBY B;  2ETH A;  3F22 A;  1LDD A;  3PFI A;  4FX0 A;  4KMF A;  3FM3 A;  5HDN A;  1DUX C;  2P8T A;  2FXA A;  1B4A A;  2GQQ A;  2XGX A;  4IVN A;  5HVQ C;  2YR2 A;  4A5M A;  5H20 A;  5D6F A;  2O0Y A;  6PAX A;  1LNW A;  3MQ0 A;  5HLH A;  5ILS A;  4KA4 A;  2GZW A;  4ON0 A;  3DFG A;  2VE9 A;  1TQP A;  2L02 A;  2M45 A;  3BP8 A;  3L9F A;  4OIO F;  2RNJ A;  5DD4 A;  1SMY F;  3V7S A;  3HTU A;  1YG2 A;  4G7Z F;  4HX4 A;  1W7P D;  2DI3 A;  3JAM Z;  2ESN A;  2IA1 A;  2HTJ A;  1ZN2 A;  5AIQ A;  2CSO A;  3KEQ A;  1RNL A;  2RDP A;  3GFM A;  1KQ0 A;  3KLO A;  3ZQ7 A;  4YFK F;  5ICE A;  4EJW A;  2P4W A;  2VBZ A;  3E5Q A;  3QAH A;  1Q1H A;  2JT1 A;  1MKM A;  3F21 A;  1BI2 A;  3I71 A;  3K1P A;  1XMK A;  2O6G E;  3H3U A;  3KP5 A;  3LQR A;  2COM A;  5IT3 A;  2HGC A;  2H94 A;  3TOB A;  2GXG A;  4LK1 F;  2CO5 A;  3IKV A;  2QEN A;  3DV8 A;  5CVU A;  3I5U A;  2RVC A;  4U0W A;  2BE5 F;  4S04 A;  2VT3 A;  2YSR A;  4U88 A;  3ELK A;  2VC0 A;  2FNA A;  2VON A;  4HQM A;  3DQV C;  5LGT A;  3SHF A;  5CLS A;  2M5W A;  1FBQ A;  4BQA A;  2EFN A;  5IT9 Z;  2YX4 A;  4LLG F;  2QQ9 A;  1FZP B;  3QU6 A;  1LB2 A;  3R6S A;  1BIA A;  4EVI A;  4RGR A;  1ZRC A;  2ZKZ A;  5DEQ A;  1ZGJ A;  2CQK A;  4PGH A;  1OPC A;  4NHJ A;  2AXL A;  2UXN A;  4EM0 B;  3N97 A;  5BPD A;  3ECH A;  4RB1 A;  5JVT A;  4KIB A;  4WX9 A;  1IN4 A;  3FXU A;  3V7C A;  2FBH A;  2ZJ2 A;  5DCM B;  3R4K A;  4UVB A;  3HSF A;  3MZH A;  5DYM A;  3GXO A;  4R8H A;  1E2X A;  3CUQ B;  1ZYR F;  2W25 A;  3GX4 X;  5L3B A;  3C3W A;  1SD6 A;  3CO7 C;  2IP2 A;  4ENN A;  1Y0U A;  2XHK A;  3GUD A;  3HHH A;  2IJL A;  1SFX A;  4Q5S F;  2IRF G;  4LGW A;  1UCR A;  1W7P B;  1TLH B;  5CVJ A;  3HTS B;  1BN5 A;  2XKP A;  2G9W A;  2V1U A;  1QBJ A;  1G6N A;  2HFH A;  1SD4 A;  1Z91 A;  2V1X A;  4UXN A;  2P6S A;  2NNY A;  1IW7 F;  3SFZ A;  4RGS A;  3R60 A;  3HOS A;  2JRT A;  1FP2 A;  3BJO A;  3KET A;  2EK5 A;  2WC2 A;  2P5V A;  2FBI A;  3WGG A;  2LNB A;  5JR3 A;  1J7K A;  1S6L A;  1U8R A;  5LEK A;  2KJC A;  3WU1 B;  1I27 A;  4A5N A;  2JPB A;  3GW2 A;  2HZT A;  4A12 A;  3FHZ A;  2QZ8 A;  1JXS A;  2FOK A;  3K2Z A;  4KIG A;  3ROU A;  4FT8 A;  4AD9 A;  3GFJ A;  3RYP A;  4YFN F;  3N4M A;  4G7O F;  1TQM A;  4WCG A;  3U2R A;  3I64 A;  3P7N A;  1YFH A;  5CVR A;  4ESF A;  1F1Z A;  4MQ9 F;  3EYI A;  2NRA C;  1X3U A;  2MC3 A;  2STT A;  3HOT A;  2XVC A;  2DQR A;  4M6X A;  3ZN0 A;  3DPL C;  3U1D A;  1K79 A;  2GXB A;  4EV0 A;  1U2W A;  5DCM A;  3KZZ A;  1IAW A;  4ESB A;  4U7B A;  4F7Z A;  5F6F A;  1SD5 A;  2OA4 A;  1BBY A;  3GVA A;  1IN8 A;  2CWE A;  4MTE A;  3C1D A;  1D5V A;  1XSX A;  3R61 A;  3E5X A;  2GIV A;  5L3E A;  3RKW A;  1T98 A;  2ACJ A;  2L54 A;  2NYX A;  3M8E A;  2XUB A;  5EEH A;  1IN7 A;  2XAG A;  3QOP A;  4GCV A;  4M9Z A;  4WXD A;  2EV0 A;  2STW A;  2FQ3 A;  3KP2 A;  2O3F A;  4KIC A;  2RN7 A;  4RAY A;  5E8G A;  2K7L A;  4IF4 A;  3K1M A;  1J59 A;  2PG4 A;  1HBX G;  2Y48 A;  4AVP A;  4P9U A;  2D1V A;  1UFM A;  2OQG A;  3FMQ A;  3I58 A;  3BY6 A;  5KK1 A;  1P4X A;  1QPM A;  2MLG A;  2M1B A;  1IRF A;  2BEO A;  3PQJ A;  4XLP F;  3QPH A;  3O6B B;  2HQR A;  2D45 A;  3J7A O;  1GVJ A;  3KP6 A;  4KN4 X;  4U0V A;  1LQ1 A;  5FB2 A;  3D0S A;  2OZU A;  2YPR A;  2VBW A;  4LG0 A;  4CGZ A;  2XRO A;  2IA2 A;  2PJP A;  1P6R A;  1LVA A;  5FLX Z;  1TNT A;  5F64 A;  3ZMZ A;  2Z33 A;  2OAZ A;  2PEX A;  5A2Q Z;  1EV7 A;  3T8T A;  2VN2 A;  5ICC A;  3JW4 A;  1OMI A;  3U9G A;  1XDU A;  4RB3 C;  4I02 A;  1IUY A;  4FX4 A;  2QVO A;  3F8F A;  3NRV A;  5LGN A;  5FD6 A;  4M71 A;  4HV6 A;  3EDP A;  3HRU A; 
#chains in the Genus database with same CATH topology
 2XDV A;  4P96 A;  4BHC A;  3GZ6 A;  3VYT B;  4GYG A;  1K4S A;  1IJW C;  4CDG A;  2OD5 A;  1JUM A;  4BAY A;  3HB9 A;  2R0Q C;  4HSR A;  5GPC A;  3IRR A;  3O3K A;  5CYV A;  3SFI A;  3JR9 A;  2VQC A;  3M9A A;  4A0Y A;  4HDV A;  3K9T A;  3BTC A;  3V8J A;  1X2M A;  1D3Y A;  3MEX A;  2PBI A;  1TW2 A;  5E1Z B;  3NAR A;  3FIW A;  2PJR B;  1MDM A;  1EF4 A;  1FYL A;  2LH9 A;  4IHY A;  1AU7 A;  1R1V A;  3G4S I;  4HZF A;  4OIN F;  3SXY A;  2M34 A;  3EUH A;  1U5T A;  2NNN A;  1IRG A;  1KQ8 A;  1HOM A;  2KIU A;  3Q3S A;  2W1O A;  1V5G A;  2XKO A;  2Z99 A;  3I4M J;  5FRO A;  2IS4 A;  1MMG A;  2R7Q A;  4OIR F;  4KIS A;  4A93 J;  4C3I J;  3ABK H;  1S7E A;  1KYW A;  1Y0N A;  2ECB A;  2V1D A;  1MBG A;  3I4P A;  4QWQ A;  3OR2 C;  2R7U A;  3GYH X;  4HYE A;  1EH7 A;  3BZ6 A;  2I5U A;  1KGS A;  4GYI A;  3BOQ A;  2JA8 J;  5LHI A;  4AWX B;  4MLO A;  3T5X A;  5K7H A;  2KIS A;  3CDH A;  3L2Q A;  2C6Y A;  2NAZ A;  2BYV E;  1PP8 F;  4RMN A;  1B9M A;  2IS2 A;  1XTA A;  2K9L A;  2LF7 A;  4HF2 A;  4QIW N;  4HEA 2;  3E6M A;  3M07 A;  1ZLK A;  1X4O A;  4ZDL A;  1PYV A;  3E0J B;  3ISP A;  3ZQF A;  2GBY A;  1YX5 A;  1WJE A;  3DKW A;  1RIO H;  2PMZ A;  3JTG A;  3S8P A;  3I54 A;  3FKJ A;  3ZMS A;  3FMR A;  3RTR A;  2L7K A;  3ASO H;  1HST A;  4EJO A;  3HOV J;  1R4M B;  3PIP F;  2XGC A;  4OMY A;  4XN0 A;  4A3F J;  2FNP A;  3SEZ A;  4UHT A;  3TP0 A;  4LIT A;  4E7J A;  1JKR C;  3WU0 A;  2BY0 A;  2FOW A;  4ZYD A;  4AIJ A;  1VQ8 I;  3RI4 A;  2DFH A;  2KZV A;  5D8K B;  4B3X A;  2JUC A;  1ZQ3 P;  4EJT A;  2O61 A;  5FJ8 J;  4M9X A;  1RKW A;  5DM6 F;  1DGW Y;  3REO A;  5D5U B;  4A3K J;  2JN6 A;  3TKY A;  3A01 A;  2CS3 A;  1BI3 A;  2W48 A;  3ZQL A;  3HPG A;  3PO3 J;  5FO5 A;  2CQ7 A;  5EZG A;  2OV7 A;  5E3O A;  4KT5 C;  1P9Q C;  3ERE D;  3QRF F;  1A35 A;  2DFE A;  2DOF A;  3W3C A;  4YIF A;  3A0B C;  3FWE A;  1OIS A;  1G3S A;  3ZQI A;  3WTV C;  1ACI A;  3DTI A;  1AA7 A;  4E7S A;  3K2A A;  3LSI A;  5J1U A;  3H5N A;  3TQN A;  4N9H A;  2CJJ A;  2LY1 A;  4JQF A;  5EEA A;  3HOW J;  5M5Y J;  1JUP A;  3F8B A;  4A6E A;  2B63 J;  5L3G A;  2W84 A;  2VJ5 A;  3BG5 A;  1NK2 P;  2FQ4 A;  2VJ4 A;  3ZMD A;  4RGU A;  4BQN A;  4ZYE A;  4CYC A;  2MLK A;  2OPT A;  2QQ8 A;  3SEQ A;  2TRT A;  4BEH B;  2IS1 A;  5KVR A;  3L7W A;  3VDX A;  4MHG A;  4R1H A;  2VXD A;  2JA7 J;  3SZP A;  3IV5 A;  1T95 A;  4U87 A;  4YFX F;  1IZ1 A;  1HKT A;  2E35 A;  1K78 A;  4YG2 F;  3G1O A;  1W36 C;  4L9N A;  1I39 A;  1YQA A;  4KYW A;  2HQ5 A;  2NOG A;  1MBJ A;  1EH8 A;  3IH2 A;  2DLL A;  3FXK A;  4NC8 A;  2ZNZ A;  2VJI A;  3P9I A;  5IYB J;  3AG2 H;  4RA2 A;  2JRM A;  5E18 F;  2Q8K A;  2K86 A;  2L01 A;  2FU4 A;  2V9P A;  4CHU A;  1V5F A;  2FMY A;  1IN6 A;  4IHS A;  1IXS B;  1LE8 B;  2HVR A;  2WWY A;  2ZC2 A;  1R5G A;  3WG9 A;  2XAQ A;  2ISY A;  4JOM A;  3JSP A;  3S3M A;  2O5R A;  3TDZ C;  1A6Q A;  4NC6 A;  4NNJ A;  5EGO A;  1UHW A;  1DU0 A;  2VL8 A;  3HUG A;  2RAE A;  1T0F C;  1OCT C;  2VBX A;  4HX8 A;  2HOT A;  1KQ9 A;  4OIQ F;  3K0L A;  4PJN A;  5IYC J;  4M74 A;  3RPQ A;  1QU3 A;  4NQW A;  1FMV A;  1Y8R B;  1DPR A;  1R36 A;  2HTS A;  3FXM A;  1DP3 A;  2ADU A;  4UUS A;  2LD5 A;  2X51 A;  3E7L A;  1L0O C;  2KLO A;  1I1S A;  3M7G A;  1A04 A;  2LKP A;  3CUO A;  1UAA A;  1J2X A;  2IGM A;  3IAM 2;  2DK8 A;  1ULY A;  3SDG A;  3RQI A;  4ESJ A;  2MFZ A;  3IWZ A;  1HDP A;  3E6C C;  1P2F A;  2GIZ A;  2L2O A;  4YRV A;  3ZRG A;  2P81 A;  2P6T A;  5JI6 A;  1QHH D;  1GV2 A;  2V4J C;  3OYD A;  2EB7 A;  3BQY A;  2RC4 A;  4MTD A;  3H0D A;  1Z0X A;  4E70 A;  1UHS A;  3TDU C;  1D0Z A;  4QLC U;  5JHF A;  2LFB A;  4I0B A;  4A69 C;  3J80 Z;  4ENJ A;  1Q1V A;  2KRC A;  1FIA A;  4HAM A;  4A3L J;  3ZMV A;  1E3O C;  1Z7U A;  2HKO A;  3RIR A;  1ONV A;  4C2M J;  4A3M J;  2ME6 A;  2L4M A;  1LUJ B;  2EBI A;  1ETQ A;  1HLV A;  1QZY A;  3WE3 A;  4PGG A;  2F2E A;  4Y4R A;  2IVM A;  3ABL H;  5BS6 A;  2MGQ A;  2KDZ A;  3AG4 H;  1S7A A;  1BOA A;  1MD0 A;  4BXX J;  3J81 K;  4KMU X;  1E3P A;  4CCL A;  1GVD A;  5IOY A;  5E3N A;  3HC7 A;  4XKW A;  4R79 A;  2OBP A;  1HDD C;  3TO7 A;  4RDU A;  4KNY A;  1D8K A;  2XC7 A;  1D5Y A;  3V7R A;  2HDC A;  4IJA A;  2RQQ A;  3QPT A;  1X3W B;  1QO0 D;  3H3V K;  2M7A A;  3WGI A;  4U7D A;  2JPC A;  3CUQ C;  2FX0 A;  2HOS A;  3HOZ J;  2KL4 A;  3LWF A;  3HOU J;  1TZL A;  2EZK A;  4HDU A;  1SFU A;  4NDL A;  2HYF A;  2QSF X;  5FFZ A;  2LBF A;  2GOX B;  3V4G A;  1HW1 A;  4HNU A;  1T8I A;  1JI8 A;  3ULQ B;  4BE2 A;  1GXP A;  3HIF A;  1YYV A;  3W2A A;  1JJ6 C;  3DEU A;  1WFX A;  5LBQ A;  2KP6 A;  4EM1 A;  4A3D J;  4ENM A;  1SMT A;  1OR7 A;  2DDA A;  4Y17 A;  1FNN A;  5FRM A;  4FIS A;  1R23 A;  3G71 I;  4MGR A;  2VT2 A;  3T1B A;  1HQC A;  1GLN A;  3K69 A;  3V42 A;  1ZR4 A;  2HPM A;  3OYH A;  3JRC A;  3ABU A;  3MWM A;  2K85 A;  2JTV A;  1FWZ A;  1ZLJ A;  2R93 J;  3FIS A;  5JLW A;  3Q5F A;  1YW9 A;  3HBL A;  4D0P A;  2FUG 2;  3H9Q A;  4L0Y B;  5D8L B;  2Y30 A;  2H6B A;  2PQ8 A;  2KKO A;  1UST A;  3PSI A;  4LB6 B;  4BU2 A;  2F48 A;  1K7A A;  3A0H C;  4UUV A;  1XGN A;  3DP7 A;  3WTX C;  3SZG A;  3GFI A;  2DPU A;  5DDG A;  2QGU A;  4HF1 A;  2QKL B;  3K4M A;  5CVI A;  3KP4 A;  1TWF J;  2K9M A;  2HS5 A;  1IV8 A;  5E8I A;  2IGK A;  2TDX A;  4XKC A;  1I3A A;  5EF6 A;  3GO5 A;  5M5X J;  1OJL A;  2WY8 Q;  1NHA A;  3FDY A;  5H6Q A;  1D8J A;  1SAX A;  1BI1 A;  2IT0 A;  2WAF A;  4D1Q A;  1ZAO A;  3S2W A;  3EET A;  1P4W A;  2VKD A;  3P9K A;  1OCR H;  1U78 A;  2DO7 A;  1TP4 A;  4JX4 A;  4WXH A;  2EFQ A;  2RQP A;  3GLX A;  4FTH A;  4RS8 A;  4MNU A;  1ODD A;  1BJZ A;  1RPW A;  3OYM A;  3DBL B;  5FKL A;  1WJ5 A;  2CV0 A;  1NTC A;  1MSE C;  1YX3 A;  4LLN A;  1RC9 A;  1USS A;  2KHM A;  4B4C A;  1QQI A;  4XRF A;  2WTE A;  4S05 A;  3ERM A;  2VIX A;  2E2J J;  4V19 K;  2V9K A;  5HLI A;  2L4A A;  3K7A J;  5EG0 B;  3LSP A;  5F0C A;  3H9G A;  2BGC A;  2PX9 A;  3IKT A;  4BBS J;  1LVK A;  4KFC A;  1RZ4 A;  1B8I A;  5BMZ A;  4RAF A;  2DJI A;  2F5D A;  5LD2 C;  1MNE A;  2FJ1 A;  3WTZ A;  1ON1 A;  2ELH A;  5JFR A;  4LJZ F;  2H1K A;  2CUZ A;  2ZO4 A;  2P7C B;  3TGN A;  3VYS B;  2K40 A;  1MH4 A;  3N05 A;  1DPU A;  2QF7 A;  3BPV A;  4CCO A;  4ZZL A;  4Y7N J;  1ETY A;  2M0M A;  2A61 A;  2HI3 A;  2YU3 A;  3EYY A;  3L09 A;  4B8X A;  5J6X A;  4LG0 B;  1ZK8 A;  4RAZ A;  5JLX A;  3JRA A;  4BYY A;  1FY7 A;  5J47 A;  2QM3 A;  2MYS A;  1PDN C;  3H5R A;  1IV6 A;  1W0T A;  3MKZ A;  1JKQ C;  4F52 A;  1KA8 A;  3K4K A;  3M3Y J;  3BJA A;  3BLY A;  3P9C A;  2HWV A;  1WH5 A;  2AS5 F;  5ICG A;  4BHP A;  4DYC A;  3JRB A;  3E97 A;  4MQV A;  2Y0M A;  2XAS A;  1ZHF A;  3FXO A;  1MMA A;  4CA0 A;  2HOA A;  4KN7 X;  4WXC A;  3BC8 A;  3VOD A;  3KLN A;  3F72 A;  4IPA A;  1TWH J;  3EUH C;  4F55 A;  5J8C A;  4QSH A;  3H3Z A;  3IHU A;  3A2K A;  1R7J A;  1QA6 A;  2K5C A;  3HSR A;  1B9N A;  1BJA A;  4LB5 A;  1UJ8 A;  3ZMT A;  2A69 F;  1OYW A;  1F9N A;  1FSE A;  2NXN B;  4I0A A;  1G3W A;  4MEY F;  4C9Y A;  2LSO A;  2EZL A;  2ZBK A;  1K6O A;  4BNC A;  3S2H J;  4XRS A;  2K4B A;  2Y69 H;  4XIC A;  1FTZ A;  2L5Q A;  1O4X A;  2DA1 A;  3D5R C;  1CF7 A;  1R22 A;  2ZME A;  4BS9 A;  5H6R A;  2X1E A;  4QPO A;  4A3J J;  2CQN A;  3FMS A;  1FLI A;  1XDS A;  3LA7 A;  1MDM B;  4UNO A;  4ZTJ A;  3GEZ A;  2D5V A;  3CJT B;  3F0C A;  5L3C A;  3S1R J;  2DMU A;  4IOA F;  2QSG X;  2ESH A;  4L5E A;  3OIO A;  4L9V A;  4WF2 A;  4E4H A;  4IOC F;  3BQZ A;  1U5T B;  5K1Y A;  2DPD A;  2N8G A;  3OY9 A;  3LA3 A;  1XCB A;  4XNF A;  2XPW A;  4FE7 A;  3CCV I;  1NH3 A;  3MFK A;  1MH3 A;  4ASN A;  2P5L C;  2ZFW A;  3CJN A;  3I3L A;  2GOM A;  5D6E A;  2VB6 A;  1GT0 C;  2K02 A;  4IQ4 A;  5LLQ A;  3FHN A;  1O3T A;  2KMU A;  2YS9 A;  2CGP A;  4DBQ A;  2X1C A;  1ZGW A;  4HST A;  2DAO A;  4BXF A;  5FLM J;  2WBM A;  3FBN B;  5GP9 A;  1ZG5 A;  4PZJ A;  1O3R A;  2XF7 A;  3KPH A;  2LRD A;  2ISZ A;  1QHG A;  1B1B A;  5E20 A;  5GAE J;  2E36 A;  4BBR J;  4XK4 A;  4S0H B;  2M8G X;  1RI7 A;  5ILU A;  2VI6 A;  5TGT A;  3C7J A;  2FE3 A;  1UZC A;  1T6S A;  3MD2 A;  5GAD J;  2DBB A;  1PP7 U;  1UG0 A;  1ZGA A;  2JK3 A;  3H0G J;  4ETS A;  3JRH A;  1ZRD A;  1SAN A;  4RB2 C;  2ZB9 A;  3DTK A;  5HLT A;  3KYL A;  2MA3 A;  1MGT A;  1ETO A;  2E1M B;  4CCK A;  2KIQ A;  2QWW A;  2XSD C;  2DDB A;  2A07 F;  1XPX A;  2ICW G;  2H8R A;  3WTW C;  1EH6 A;  2JZY A;  4PJ0 C;  2HPI A;  4X6A J;  3NWS A;  3VOE A;  2EJR A;  4MO7 A;  3MCZ A;  3FXQ A;  3NQO A;  2CUE A;  3PUB A;  3ZMU A;  4BH9 A;  3HSE A;  4PSW A;  3HG9 A;  3A01 B;  2V6C A;  3CCM I;  4JBA A;  2O9L A;  1O3S A;  3OYA A;  2CU7 A;  1Z67 A;  2E34 A;  3RPU A;  3ZQH A;  4IHX A;  5FKK A;  4TV7 A;  5DCF A;  4XSZ F;  3B73 A;  3KP7 A;  1B59 A;  5J8F A;  1W4M A;  4XID A;  3JSO A;  4P55 A;  1IC8 A;  1BM9 A;  1JGS A;  2D2W A;  3K70 D;  4DQ2 A;  5D4S A;  5JVG F;  4HRI A;  2VC1 A;  4LOC A;  2QSH X;  1D1B A;  2GWR A;  2TCT A;  4WWC A;  3BTI A;  3FKI J;  3BR2 A;  3S32 A;  2HZD A;  2X6X A;  2M4K A;  1FC3 A;  2M87 A;  3BRO A;  3DWL E;  3FK7 A;  2XAJ A;  3JRE A;  3RJP A;  2HEO A;  1ZR2 A;  1ZG3 A;  3TMO A;  1BR4 A;  4XRS G;  1L3L A;  4AID A;  1I6H J;  4NBQ A;  4CYC B;  4WK8 F;  4A6D A;  2ZFU A;  1J0R A;  5IT9 K;  3PSF A;  3AG3 H;  1LEB A;  4BHB A;  3CCS I;  4EM2 A;  4IO9 F;  1A5J A;  1YJW I;  1V5E A;  3R0A A;  4Y33 A;  1OCZ H;  1E17 A;  1FBU A;  2DOE A;  1K78 B;  3CC7 I;  3S3N A;  4UB6 C;  2H09 A;  2W24 A;  3VSL A;  5C4X J;  3Q9S A;  2W85 A;  1VQ4 I;  1U3E M;  3HRS A;  1YOV B;  2JA6 J;  1G4D A;  2VPR A;  1YIJ I;  4I98 B;  2Y31 A;  3RYR A;  2JUG A;  1Z05 A;  4L5J A;  3HYI A;  5FKM A;  1MBH A;  1Z1D A;  3ML6 A;  4UV9 A;  2DFF A;  3H36 A;  5HS7 A;  1YHQ I;  5HS9 A;  4A3C J;  3GTO J;  1X3Z B;  3S2D J;  2Z5U A;  4XLH A;  2P7V B;  2QCO A;  1LDK B;  1WWX A;  4G6Q A;  2HYJ A;  4CIC A;  2ZNY A;  3W6J B;  5F1R A;  1P92 A;  9ANT A;  3F6O A;  3KEO A;  2X6O A;  4AIK A;  1TWA J;  1AHD P;  1TTY A;  2VKE A;  1XC5 A;  2HDW A;  3LQQ A;  5EGO B;  3SJM A;  3HUG B;  2F4I A;  3BWG A;  3VFZ A;  2G7H A;  1WJD A;  4CCJ A;  2ZJQ F;  3KFW X;  1OCP A;  2MH2 A;  2RNG A;  5CPR B;  3V8K A;  3JRG A;  3GZ5 A;  2F6C A;  2DTR A;  4E7L A;  2Z9O A;  1NK3 P;  4NQW B;  3D5L A;  3O8G A;  1FOW A;  1VQ9 I;  2CQQ A;  3RKY A;  1WPK A;  3TO6 A;  2QKM B;  5E3L A;  5ICF A;  2XAF A;  1Z21 A;  2LY2 A;  4UUS B;  4N0B A;  3CES A;  2IW5 A;  5BQT A;  2UUZ A;  2F5E A;  4E7I A;  4I09 A;  1EKE A;  4MEX F;  5GPA A;  1Y1W J;  3LST A;  5K5R A;  1KYZ A;  1J09 A;  2KRH A;  1XMA A;  3HRM A;  3IP4 B;  4YIR X;  2R7F A;  1BC8 C;  5IYD J;  1PUE E;  2L3D A;  1JT0 A;  2LF8 A;  2Q0O A;  2K9N A;  2W57 A;  1G59 A;  3FXR A;  4BJ6 C;  2PFB A;  1D0X A;  1HF0 A;  3BDD A;  1WQ2 A;  1UHM A;  5EEG A;  1WZ2 A;  4CYD A;  1ZH5 A;  4Y15 A;  2X1D A;  2X6Y A;  1VQL I;  2OJE D;  3HEF A;  4G94 A;  2OF7 A;  3QU3 A;  1BIB A;  4J00 A;  1KU7 A;  1GXQ A;  2X0L A;  4Y3O A;  2PMH A;  4PDK A;  4DGW B;  3PFY A;  2WV0 A;  1FPQ A;  1JGG A;  1IXC A;  1PUF A;  3UKG A;  1I1G A;  3H9J A;  2DCE A;  3QQA A;  1LEA A;  2ELJ A;  2OZ6 A;  2FBK A;  1KON A;  2KRF A;  3TL4 X;  4B44 A;  1ERD A;  2VE8 A;  3GTJ J;  1LDJ A;  2DQL A;  3C2B A;  2J5O A;  1V55 H;  1RUN A;  3HOY J;  3BPX A;  1OYI A;  5F1J A;  4Q4Z F;  1WI9 A;  2HVS A;  2JJ7 A;  1FOY A;  3ZGK A;  5LHH A;  1WJB A;  5ILV A;  3LMM A;  2XAU A;  1QVT A;  1BI0 A;  3GTK J;  4ENK A;  2A6H F;  3G3Z A;  3DLA A;  3RSN A;  3G2B A;  2V79 A;  3HGY A;  5HS8 A;  3LL7 A;  2UXX A;  2P5K A;  3T8R A;  3RKX A;  5KNL A;  1ORK A;  1R00 A;  1B72 A;  3OR1 C;  5CVV A;  2KDO A;  5EDN A;  2HDD A;  3JRF A;  4L0Z B;  1WJA A;  4JP0 A;  2LBF B;  2DMN A;  4HW0 A;  1H9T A;  4XSX F;  4D7N A;  3S16 J;  4Q48 A;  3VB2 A;  5GAG J;  3COA C;  3GTL J;  1QZZ A;  2NVU B;  3SDB A;  1R49 A;  2MD5 A;  3GWZ A;  1R58 A;  3ZQQ A;  4G7H F;  2E2I J;  2H8W A;  3QYF A;  1QRY A;  1W5T A;  1WJF A;  2DOD A;  4DIQ A;  1HW2 A;  1YW7 A;  2WB1 N;  3IRQ A;  2F5C A;  1LJ9 A;  1FOX A;  3I4N J;  4ZYH A;  1CQT A;  4EAT A;  4IRG A;  1K61 A;  2R7Z J;  2GXA A;  2EIL H;  4CCM A;  2FSW A;  3KP3 A;  4M9S A;  4DZP A;  2A3S A;  3EUA A;  4J19 A;  2E2H J;  2IS6 A;  3BR1 A;  1YS6 A;  2E1N A;  3I9V 2;  5CQE A;  2NS8 A;  2DA5 A;  2CW0 F;  4HG2 A;  1E3H A;  2A6T A;  1XN7 A;  1O7L A;  3P5J A;  4QTR A;  2NVQ J;  4AM3 A;  3CO6 C;  2M3A A;  3W2V A;  4AVZ A;  1DU6 A;  3CLQ A;  2X4H A;  2L9R A;  3E6B A;  2HKX A;  1I50 J;  1T08 B;  4FE4 A;  3OYK A;  2G7U A;  2W00 A;  1P4A A;  4GO1 A;  4KUM A;  5FKN A;  5KHD A;  4XRM A;  4NB5 A;  5ED4 A;  2MBF A;  4I01 A;  4M3B A;  3O8H A;  3CCR I;  4ZZD A;  2VOO A;  5HLG A;  2FA5 A;  4BJT A;  1ZG1 A;  1VTN C;  4U0Y A;  3AL0 B;  3CJQ B;  3G6E I;  1XMX A;  1ETW A;  2H1L A;  1KU9 A;  4A0Z A;  1XB4 A;  2BY1 A;  3WTS C;  2DW4 A;  4N4O B;  5J1R A;  2OTL I;  2EFP A;  2Z3Y A;  4B47 A;  3I59 A;  3WGH A;  3DPU A;  1VND A;  2CV1 A;  2WAQ N;  3WOD F;  1SFE A;  1C0W A;  4HV5 A;  2BY3 A;  2K27 A;  2DU9 A;  2X6W A;  4PJM A;  3F9K A;  3HRT A;  4ZYG A;  2L7M P;  5K5O A;  3UNG C;  1LKX A;  4EJV A;  3AKZ A;  3CCE I;  3BG9 A;  2DJN A;  2F5V A;  3DF8 A;  2Z16 A;  4A0X A;  2EIM H;  3L2V A;  4M72 A;  2QLZ A;  2J5P A;  2R4G A;  2EA2 A;  4A3I J;  1B8I B;  1WJC A;  1WKM A;  2PLY A;  2DT7 B;  4DNC A;  1AOY A;  2BBY A;  1OQY A;  2XRL A;  4N4N B;  2DA7 A;  1T56 A;  2O8K A;  4EQQ A;  2KIM A;  5FFX A;  2XF6 A;  3RPU D;  3M8F A;  2VOP A;  1IGN A;  3CDI A;  5EJC A;  4FCY A;  2O03 A;  4M73 A;  1T38 A;  5FLX K;  4BQQ A;  3GFL A;  4GFB A;  2QBY A;  3B6A A;  1FYK A;  2DK5 A;  1IDZ A;  3E6D A;  1STZ A;  4A3E J;  1BR2 A;  3CP8 A;  2JQ7 A;  1V3F A;  5A2Q K;  2WA0 A;  2FF4 A;  4I2O A;  1ZTR A;  5AIP A;  2XIG A;  2OQR A;  4JK1 X;  1QZE A;  1H0M A;  2VPL A;  2ID3 A;  5C3E J;  1AWC A;  3H35 A;  4BY7 J;  3HGG A;  4CSW A;  3PQK A;  3MN2 A;  2UZK A;  2DMT A;  1RUO A;  1VQK I;  4OMZ A;  2W82 A;  3PNT A;  3SZT A;  1KU3 A;  3L00 A;  2VOD A;  4IZZ A;  3R0J A;  3JTH A;  5E3M A;  4EGY A;  4I7H A;  3K1N A;  3KYD B;  5E1X A;  1A31 A;  5IY5 H;  4MFE A;  2L0K A;  5FRN A;  1D1A A;  2A5Y B;  2RV8 A;  3UR3 C;  4F91 B;  4IRI A;  1O7F A;  4UVA A;  1QPI A;  3L1P A;  2PMU A;  3I56 I;  3L2R A;  2IGO A;  2XB0 X;  4C2T A;  5F0H A;  2D1H A;  3KZI C;  3CCQ I;  1WH7 A;  2B7E A;  4C2U A;  2O7O A;  3MZ8 A;  2VKV A;  3JCU C;  3OL3 A;  2ZME B;  1CF7 B;  2B0L A;  2M2E A;  3L2C A;  1ITY A;  2M9H A;  3QP5 A;  5BNG A;  1MBE A;  2QQA A;  1FX7 A;  1T39 A;  5FD5 A;  4L9J A;  1D1C A;  1ZAR A;  4YEL A;  2R7D A;  4II3 A;  3OSF A;  4G6T B;  1V4R A;  2EV6 A;  1DDN A;  1YW8 A;  3FX3 A;  4AU7 A;  4YII A;  1MSF C;  1Z9C A;  3CP2 A;  5D5X B;  1OFC X;  4CO8 A;  3VWB A;  1R1U A;  4HNV A;  2WAD A;  1JHF A;  2AXT C;  4GGG A;  3LA2 A;  5GTI C;  4ZDO A;  4BY1 J;  4NC7 A;  5C44 J;  3VEP A;  1QNT A;  3S17 J;  5D5W B;  3DEE A;  4M6Y A;  5LRR A;  1WCM J;  2GA1 A;  1JUS A;  1MJ9 A;  5FGM A;  1YI2 I;  2CMP A;  3FF5 A;  2X85 A;  4HBL A;  2MH9 A;  4RLQ A;  3DPT A;  2ZXJ A;  2E5Z A;  2ZXW H;  2R5Y A;  1S72 I;  2OCC H;  1T0F A;  2JA2 A;  3CC4 I;  2LP0 A;  1YLF A;  4CZZ A;  5M3M J;  2MC4 A;  2VQH A;  4G6D A;  2NS7 A;  1IN5 A;  1XSV A;  3MAJ A;  1GUU A;  2UWM A;  4KDP A;  3TO9 A;  1U0J A;  2IXS A;  3ABT A;  3C18 A;  2CFX A;  5LGU A;  4OOI A;  1OKR A;  1S9H A;  1H8A C;  3Q9V A;  1FSH A;  4IRH A;  2JMW A;  3QOE A;  3ECO A;  1REP C;  1JT6 A;  1ZEL A;  3LAP A;  2XRN A;  3OOP A;  1B6A A;  1Z6R A;  1K83 J;  2M30 A;  3BZK A;  2M0C A;  3TED A;  3CJR B;  5B3S H;  2DYR H;  4RM3 A;  2LVS A;  5HOO A;  1O3Q A;  1SVL A;  5K7F A;  4A3B J;  2Z2S B;  4UV8 A;  1IF1 A;  1KU2 A;  4XOP A;  3KIO A;  4XM3 A;  1XGO A;  1HKQ A;  3C2G A;  2CG4 A;  3IWF A;  3K6G A;  1MJB A;  1OCO H;  3G73 A;  1TQI A;  3CMA I;  1R1T A;  3BR3 A;  2GA2 A;  2WV1 A;  4OIP F;  3GLL A;  4RGX A;  1XD7 A;  4XBF A;  4RB0 A;  3GF2 A;  5LHG A;  3PUF A;  3WE2 A;  4O3M A;  2DT5 A;  1U5T C;  1QGP A;  1X1A A;  3EQL F;  2KIF A;  3BJ6 A;  4RBO A;  3VYU B;  3AAF A;  3MVP A;  4UY8 I;  2EIN H;  1DP7 P;  4M6V A;  2WAE A;  4BXU A;  1G3T A;  5B5E C;  2JA5 J;  4E6K G;  4Z2Y A;  5HOD A;  5DD8 A;  2XB5 A;  2E19 A;  4DYR A;  2LDU A;  2MD0 A;  3OYG A;  3D1N I;  1SD7 A;  2P0W A;  1XSD A;  1YO5 C;  3LFK A;  2VBY A;  3U1K A;  3IH3 A;  4OAZ A;  5J3L A;  2EV5 A;  3VYR B;  4IKF A;  1BL0 A;  5TIS C;  2QQB A;  4GXO A;  1X19 A;  3VSK A;  3F23 A;  2XPU A;  3AG1 H;  1HSJ A;  3I0T A;  2Y9Y A;  2EA4 A;  2HNH A;  1HKS A;  2YX7 A;  3CUQ A;  3F8N A;  1W5S A;  2V26 A;  3G1L A;  2A05 A;  2E7W A;  2LY9 A;  2B9S A;  5D5V B;  1ZKG A;  3KCC A;  1A6I A;  1JHH A;  1FT9 A;  4GDF A;  2R92 J;  4RLF A;  2QYO A;  3GZN B;  3ZR8 X;  2H6C A;  3F8C A;  3KX2 A;  3LSK A;  4LK0 F;  1UEL B;  3ZXS A;  3I53 A;  1XG1 A;  4F92 B;  2IPQ X;  5GTH C;  5HNH A;  2E1M C;  4X0G A;  2IBD A;  3M1C A;  1S29 A;  1W7P A;  1VFC A;  3LAJ A;  3WTU C;  3ZP5 A;  2CYY A;  2EIK H;  2JVG A;  2HYG D;  4N9I A;  3PIO F;  1JKP C;  3HHG A;  1XCV A;  3TOA A;  3PJR A;  4AC0 A;  4PJJ A;  3WHC A;  1Y8Q B;  1G3Y A;  2K4J A;  1VF9 A;  3FBI B;  3WTY C;  5EYR A;  2Q2E A;  1BC7 C;  3OYE A;  3JAM K;  1T33 A;  3W6K B;  1X4P A;  4CXF A;  3FXJ A;  3U21 A;  2XV4 S;  2LYC A;  2W4S A;  1N75 A;  5CJ9 A;  3ASN H;  1XGS A;  3CZ6 A;  1N78 A;  3HPH A;  2MW8 A;  2FML A;  3E5U A;  5DUI A;  1ZRE A;  3SYT A;  3E3V A;  4HF0 A;  4L9T A;  2DT6 A;  1F4K A;  4CH7 A;  5DV5 A;  2EIJ H;  2E5N A;  1FBS A;  1TBX A;  2F5F A;  4EMS A;  4BE1 A;  3PM1 A;  2DA4 A;  1WRJ A;  4O5V A;  3LSM A;  4JX5 A;  4A2U A;  2GAU A;  1R5H A;  1OYY A;  3OOU A;  3J81 Z;  2VAS A;  4LG3 A;  3V8L A;  3IC7 A;  1JE8 A;  3TW6 A;  1S3J A;  1WGX A;  4KIF A;  4P5O A;  5JHU A;  3CLO A;  2EFW A;  2LK2 A;  4XMY A;  1GV5 A;  1U6G A;  1P7J A;  1HCR A;  3F6V A;  1S8N A;  4F3Q A;  3J80 K;  4FHT A;  1IDY A;  3K4N A;  1MBF A;  1IXR C;  1PUF B;  2O8X A;  3NEU A;  1JTY A;  3OYI A;  3OS1 A;  1N77 A;  5BPI A;  3Q0W A;  1OLT A;  3GME A;  2IA0 A;  3LFU A;  4XLN F;  4CZC A;  2V1N A;  1I5Z A;  4M3G A;  1EA3 A;  5J40 A;  3EUK L;  3WU2 C;  1RET A;  5E79 C;  1SEU A;  4HLX A;  1SFK A;  5L3D A;  2EZI A;  4B09 A;  3BT9 A;  2Z1D A;  2NS0 A;  3OMY A;  3QYE A;  2L9N A;  2BXZ A;  3OIQ A;  1MW7 A;  5B1A H;  5TJJ A;  3FM5 A;  4EGZ A;  2E1C A;  2V9V A;  2AHQ A;  1M1E B;  4MFD A;  3O2P E;  2K9S A;  2CV2 A;  4UVC A;  1J5Y A;  5L3F A;  1W5C C;  2YU9 J;  3LSJ A;  2VXZ A;  3B02 A;  1O57 A;  4LMY A;  5ERI A;  1B72 B;  5HNF A;  4G8X A;  3RDI A;  5TRD A;  5LEJ A;  2CW8 A;  2FRH A;  1XGM A;  2HR3 A;  3KE2 A;  4Z6Y A;  3T0Y A;  4PFO A;  3OYB A;  4DYQ A;  1YIO A;  4QPQ A;  3H92 A;  3K4L A;  2A68 F;  1FYM A;  2LLK A;  3DXJ F;  2DA6 A;  3L2U A;  2ZCW A;  2AO9 A;  2R7T A;  2AQF A;  2ELK A;  2PI0 A;  3A03 A;  2EQR A;  4ZH4 F;  2RKH A;  2L7Z A;  2RGV A;  3DBH B;  4W97 A;  2DFI A;  3MMY B;  4XOR A;  2QUF A;  4IX7 A;  4HQE A;  1RR7 A;  1RKT A;  3TW7 A;  4O6J A;  3OS2 A;  2M8E A;  2XSJ C;  4BDY A;  3ZQC A;  5E17 F;  5H2F C;  2EFO A;  5AON A;  4I6Z A;  1Y6I A;  2EPF A;  4L5I A;  1H88 C;  5K7Z A;  2Y75 A;  3BR5 A;  1H9G A;  1TT0 A;  5C4J J;  3OL4 A;  1W36 D;  3ZPL A;  3ZN1 A;  4EEF G;  4Q47 A;  1VQP I;  4IQJ A;  1T2K A;  2GM4 A;  3DKX A;  2DXI A;  3F3X A;  1TW3 A;  4K2E A;  5IP6 A;  4I76 A;  1PVE A;  3OV8 A;  3M1E A;  4OU0 A;  3FZV A;  1F36 A;  1HXD A;  1FOK A;  1YTY A;  5HDG A;  4AIH A;  2EZH A;  2KFD A;  4Y13 A;  1GHC A;  4XLA A;  1ZRF A;  2KJB A;  1FP1 D;  3MZY A;  4IEJ A;  1S7O A;  4M3D A;  2R7W A;  2BW3 A;  4HPQ A;  2MSY A;  2CFO A;  4LD5 A;  5K5Q A;  3IL2 A;  2XAH A;  3SQN A;  2OU2 A;  2BV6 A;  2LMD A;  1J75 A;  4AYB N;  1CGP A;  4BE0 A;  3CTA A;  1UB9 A;  3QWL A;  3CCY A;  4P9F A;  2H27 A;  1R71 A;  3M8J A;  4HX7 A;  1MZB A;  1IRZ A;  1G8X A;  2A6E F;  5LRS A;  1ETX A;  2R7V A;  3KZY A;  2LC2 A;  4CUG A;  4HNT A;  1Z77 A;  2E7X A;  4IL6 C;  5E1W A;  1ON2 A;  3K70 C;  2HOE A;  4G9Y A;  5DUK A;  2DN0 A;  3PO2 J;  1LFP A;  3LOC A;  4KJZ A;  4XOT A;  2EWN A;  4OAY A;  4PCQ A;  3QOD A;  3DBR B;  1DQU A;  5BOX A;  1I6X A;  2Q1Z B;  4M3E A;  5HDK A;  4HLY A;  4H0E A;  3I59 B;  4NUB A;  2EH3 A;  1HW5 A;  1AKH A;  3WHB A;  2BOL A;  4BGD A;  2V6E A;  4F93 B;  3F8M A;  4ZYA A;  2CUF A;  4DBR A;  1MMD A;  1ETV A;  2R3S A;  2BHZ A;  4IXA A;  4LFU A;  3JRD A;  1J9I A;  4L18 B;  4HA8 A;  2HQN A;  3QP6 A;  1OR7 C;  1R4N B;  2PN6 A;  4P1W A;  1WSU A;  1TNS A;  3CF2 A;  4RAG A;  1F5T A;  4DOZ A;  3S14 J;  1XS9 A;  2FEZ A;  1MJA A;  1YJ9 I;  3LSR A;  1YS7 A;  5D4R A;  2BVM A;  2OC6 A;  3TP3 A;  4IHT A;  1Z6T A;  3WTT C;  2JSC A;  1IUF A;  3HJE A;  3NAU A;  4HOB A;  4EJU A;  4LLL A;  3GTG J;  1UG2 A;  1VQ6 I;  3BTL A;  1WVR A;  2XGD A;  1X1B A;  2QBY B;  2ETH A;  3F22 A;  1LDD A;  3LSH A;  2E71 A;  2HXO A;  3PFI A;  4FX0 A;  2LOO A;  1FEX A;  4KMF A;  2JVH A;  3FM3 A;  5HDN A;  1DUX C;  2P8T A;  2PJR A;  4BUP A;  3X2Q H;  1APL C;  2ZXI A;  2FXA A;  1B4A A;  2GQQ A;  2XGX A;  4IVN A;  5HVQ C;  1LPQ A;  2YR2 A;  3KEY A;  4A5M A;  2VLA A;  2COB A;  4ZJZ A;  1FJL A;  3ESW B;  5H20 A;  3S93 A;  4ZTF A;  5D6F A;  2O0Y A;  1WI3 A;  6PAX A;  2IEK A;  1LNW A;  2L7F P;  3AL0 C;  3MQ0 A;  5DM7 F;  5HLH A;  1VQO I;  1QVU A;  5ILS A;  3CC2 I;  4XKB A;  4KA4 A;  2GZW A;  4ON0 A;  3DFG A;  1S5L C;  2VE9 A;  2DYS H;  1BOB A;  1TQP A;  2L02 A;  4JX6 A;  2M45 A;  3W2W A;  3BP8 A;  1JJ8 C;  2KPM A;  3L9F A;  4OIO F;  3BR6 A;  2RNJ A;  3L2W A;  2A5W A;  5DD4 A;  1SMY F;  4C30 A;  3OS0 A;  4D5F A;  2VQL A;  5IOZ A;  3V7S A;  3HTU A;  1YG2 A;  4G7Z F;  4HX4 A;  1W7P D;  3A4C A;  2DI3 A;  3JAM Z;  2ESN A;  2IA1 A;  2HTJ A;  1ZN2 A;  5AIQ A;  2E60 A;  1VQ7 I;  1MNM C;  2QEX I;  2CSO A;  3KEQ A;  1RNL A;  3HKZ N;  1BR1 A;  2RDP A;  1KQ0 A;  3GFM A;  3KLO A;  3ZQ7 A;  3K4C A;  4YFK F;  5ICE A;  1RRJ A;  2DOA A;  2MG4 A;  2DA3 A;  4EJW A;  3Q0U A;  2P4W A;  2VBZ A;  3E5Q A;  4G12 A;  1TL8 A;  3QAH A;  1KZH A;  1Q1H A;  2OUM A;  4Y52 J;  2JT1 A;  2K9Q A;  1MKM A;  1MMS A;  1K6Y A;  4XN3 A;  4AYB A;  3F21 A;  4XKV A;  1SC7 A;  1BI2 A;  3LSG A;  3HM5 A;  3I71 A;  5M3F J;  4I99 C;  3K1P A;  1U8B A;  2VKH A;  4BAC A;  4B48 A;  4X1E A;  1XMK A;  1NG7 A;  3Q0V A;  2O6G E;  3H3U A;  3KP5 A;  1D0Y A;  3LQR A;  2R5Y B;  2COM A;  3ONQ A;  4ANJ A;  5IT3 A;  2HGC A;  4BL0 B;  1JKO C;  5KCM A;  2H94 A;  3TOB A;  3A1Y A;  3FXL A;  1GDT A;  2GXG A;  3IUO A;  4LK1 F;  5CQG A;  2CO5 A;  3IKV A;  2QEN A;  5EZH A;  3S1N J;  1IG7 A;  3DV8 A;  3KYC B;  5CVU A;  2LTP A;  3I5U A;  2RVC A;  1R9T J;  3DU6 A;  3CQZ J;  1W1W E;  4U0W A;  4C3J J;  2BE5 F;  2LG4 A;  3BG7 A;  3BR0 A;  2VUM J;  1WHU A;  3H5A A;  4S04 A;  4ZDP A;  4II2 A;  2VT3 A;  2YSR A;  1X2N A;  3AFH A;  3GBG A;  4U88 A;  4BDZ A;  3ELK A;  3C2H A;  2VC0 A;  3CD6 I;  3HDD A;  2FNA A;  2VON A;  4HQM A;  3DQV C;  5LGT A;  2KZG A;  3S1Q J;  3SHF A;  4BEH A;  5KAI C;  4H4K C;  5CLS A;  2M5W A;  1FBQ A;  2JSP A;  4BQA A;  2EFN A;  5IT9 Z;  2YX4 A;  4LLG F;  5F27 A;  3ZQG A;  1PJR A;  2QQ9 A;  2ZME C;  3OWT A;  1FZP B;  1NG6 A;  4E7Z A;  4XL9 A;  3QU6 A;  1LB2 A;  5IPA A;  3R6S A;  3RKQ A;  1F43 A;  5M5W J;  1BIA A;  4EVI A;  2JWT A;  3LNQ A;  3WG7 H;  4W1U A;  4FAS D;  3OYF A;  4RGR A;  3RQ4 A;  1ZRC A;  3GTM J;  2ZKZ A;  5F04 A;  4ZC3 A;  5DEQ A;  4KIT B;  1ZGJ A;  3OYJ A;  2CQK A;  1A36 A;  5J4V A;  4PGH A;  1OPC A;  4UUT A;  4NHJ A;  2AXL A;  2UXN A;  4XLF A;  3JRI A;  1LE8 A;  4EM0 B;  2HU9 A;  2RRE A;  3N97 A;  5IP9 J;  3ECH A;  4XLC A;  5BPD A;  4RB1 A;  3OYC A;  5JVT A;  4KIB A;  2K3F A;  2WB1 A;  4WX9 A;  1IN4 A;  1X58 A;  3FXU A;  3V7C A;  1R6R A;  2FBH A;  2ZJ2 A;  2CH0 A;  4V2G A;  5DCM B;  3R4K A;  4UVB A;  4YEJ A;  1BW5 A;  3HSF A;  2R7S A;  2LKS A;  4DW6 A;  3MZH A;  1MBK A;  2XPV A;  5DYM A;  3GTP J;  3GXO A;  1Y56 A;  4R8H A;  2Y0S N;  1E2X A;  3H1C A;  3CUQ B;  1ZYR F;  2W25 A;  3GX4 X;  2MAB A;  2WY7 Q;  3CMM A;  2M7B A;  5L3B A;  3C3W A;  4FQG A;  1SD6 A;  3RZO J;  4D7M A;  2BZT A;  3CO7 C;  2IP2 A;  4ENN A;  1Y0U A;  2XHK A;  2ECC A;  1IRX A;  2KT0 A;  3D5S C;  2UV1 A;  3GUD A;  3HHH A;  1MIJ A;  2IJL A;  1SFX A;  1UMQ A;  3PNY A;  4Q5S F;  2IRF G;  4LGW A;  1UCR A;  2BHY A;  1W7P B;  1Z3X A;  1TLH B;  3B6C A;  5CVJ A;  1K4T A;  3HTS B;  3HKZ A;  1R5I D;  1BN5 A;  2XKP A;  2G9W A;  4AUX A;  3RCO A;  2V1U A;  1QBJ A;  3HL2 A;  1G6N A;  2LRE A;  2HFH A;  1SD4 A;  1Z91 A;  1LFB A;  5B1B H;  2V1X A;  4UXN A;  1OCC H;  2Q2E B;  1U9O A;  3DU5 A;  2P6S A;  5FLV A;  5DS9 A;  2NNY A;  3DCF A;  1IW7 F;  3VPR A;  2HXI A;  3CMY A;  3SFZ A;  2BXY A;  4IHV A;  3E1S A;  4RGS A;  4PJL A;  5B66 C;  2ID6 A;  3R60 A;  3HOS A;  5J1Y A;  2JRT A;  1FP2 A;  1MND A;  1LFU P;  3BJO A;  3KET A;  2WAQ A;  2EK5 A;  2P5V A;  2WC2 A;  2FBI A;  2R5Z B;  3WGG A;  4FET A;  2LNB A;  2YUS A;  5JR3 A;  1J7K A;  1S6L A;  3S1M J;  2ZSI B;  1U8R A;  2L9V A;  2CQX A;  2VQG A;  2KJC A;  5LEK A;  3WU1 B;  5F08 A;  1I27 A;  4A5N A;  3OYL A;  3CCU I;  3RZD J;  2F4O B;  1TWC J;  3J7A Y;  2JPB A;  3GW2 A;  1TC3 C;  5DTD A;  4D5C A;  2HZT A;  5J4Y A;  2M4G A;  1JTX A;  4A12 A;  4V2F A;  2QZ8 A;  3K4B A;  3FHZ A;  1JXS A;  2DA2 A;  2R7O A;  2FOK A;  2DMQ A;  1V54 H;  3K2Z A;  4E7H A;  4KIG A;  4J01 A;  3ROU A;  1VZ0 A;  1POG A;  4FT8 A;  1BW6 A;  4AD9 A;  2CW7 A;  3GFJ A;  3RYP A;  3HZJ A;  4YFN F;  1YIT I;  1SVM A;  1ETK A;  2L9S A;  1RES A;  1SVO A;  2LR8 A;  4KT6 A;  3OSG A;  3N4M A;  4G7O F;  1TQM A;  2CRG A;  2KQR A;  1YE9 A;  4WCG A;  2R7R A;  2XGE A;  3U2R A;  3I64 A;  3P7N A;  1YFH A;  5CVR A;  4ESF A;  3M4O J;  1F1Z A;  4MQ9 F;  3EYI A;  4PUS A;  3DLL F;  2NRA C;  1X3U A;  3J7Y J;  2MC3 A;  2NVY J;  2STT A;  3HOT A;  2BVL A;  2XVC A;  2DQR A;  4M6X A;  4OWR B;  3DPL C;  3U1D A;  3ZN0 A;  2QA4 I;  2XF5 A;  1K79 A;  1VQ5 I;  2GXB A;  2I8D A;  4EV0 A;  1H89 C;  1YJN I;  1U2W A;  2E1O A;  3KZZ A;  5DCM A;  2HQA A;  2BY2 A;  1IAW A;  4ESB A;  3IAS 2;  4U7B A;  3CCL I;  3J7Z I;  4F7Z A;  1Y39 A;  2Y2Z A;  5F6F A;  3S3O A;  2Y9Z A;  1YRN B;  1N25 A;  2FD5 A;  2ME0 A;  1SD5 A;  4GRI A;  2V7F A;  3OYN A;  2OA4 A;  4IHW A;  1BBY A;  5GAH J;  1FMW A;  3GVA A;  1IN8 A;  2CUJ A;  2CWE A;  3PNV A;  4BQO A;  4DJA A;  2W7N A;  2NVX J;  5IP7 J;  4LIV A;  4MTE A;  3S15 J;  3C1D A;  1XX5 A;  1D5V A;  4BKX A;  1XSX A;  3QYB A;  3GCM A;  3K4J A;  3QPS A;  3R61 A;  4BJ5 C;  3E5X A;  4ITV A;  5KAF C;  1HA8 A;  2GIV A;  4B3A A;  5L3E A;  2F4M B;  2G0E A;  3RKW A;  1T98 A;  3MKY B;  2ACJ A;  1E0E A;  2Y0S A;  2L54 A;  2NYX A;  3M8E A;  1TWG J;  2OCE A;  2R7X A;  1EJ9 A;  1Y1V J;  2XUB A;  2ZJP F;  5EEH A;  1IN7 A;  2ZXH A;  1U9N A;  2X9D A;  2DMP A;  2LKX A;  4E7K A;  2XAG A;  3G1M A;  4PFP A;  3QOP A;  3HXL A;  4GCV A;  1W0U A;  1HC8 A;  4M9Z A;  5F0F A;  1TT5 B;  4WXD A;  1BA5 A;  2EV0 A;  2STW A;  3BG6 A;  1VQN I;  2OTJ I;  2HVQ A;  1X1C A;  2FQ3 A;  2DTZ A;  3DEW A;  3KP2 A;  1X1P A;  2O3F A;  1FTT A;  4KIC A;  2RN7 A;  4RAY A;  5E8G A;  1Z3Y A;  2K7L A;  3DKY A;  4IF4 A;  2R5Z A;  3BG3 A;  3K1M A;  4C3H J;  2PMZ N;  3EPZ A;  4XLE A;  1J59 A;  4PK4 A;  2I10 A;  2PG4 A;  1RR8 C;  1HBX G;  2Y48 A;  3ZOB A;  2GLO A;  4DZJ A;  4AVP A;  5EG0 A;  3OIP A;  4P9U A;  2D1V A;  4MIM A;  1UFM A;  2OQG A;  4B1R A;  3QPL A;  2IGN A;  3CDL A;  3FMQ A;  3I58 A;  2NOJ B;  3DTE A;  3BY6 A;  3CME I;  2AQE A;  2K3P A;  2BW3 B;  1P4X A;  1QPM A;  2MLG A;  3NWT A;  2M1B A;  4JYK A;  5KK1 A;  4ABZ A;  1IRF A;  2BEO A;  1VQM I;  3PQJ A;  1Z7L A;  1I3Q J;  4XLP F;  3IH4 A;  1SAU A;  3QPH A;  1SFO J;  4CCN A;  4B43 A;  3O6B B;  3CF5 F;  4M3F A;  5FKO A;  2HQR A;  1X1D A;  3PL8 A;  2D45 A;  1VI0 A;  2NVT J;  3J7A O;  1GVJ A;  3KP6 A;  4KN4 X;  4U0V A;  1LQ1 A;  5FB2 A;  3D0S A;  2OZU A;  2YPR A;  2VBW A;  3GTQ J;  4XON A;  4LG0 A;  4CGZ A;  5CKT A;  1DGR M;  4UB8 C;  2IA2 A;  2XRO A;  2ZJR F;  2X48 A;  2PJP A;  1P6R A;  1FIP A;  1LVA A;  5FLX Z;  1TNT A;  4XR6 A;  5LFA A;  3BCB A;  5F64 A;  3FK6 A;  4RM2 A;  3ZMZ A;  2Z33 A;  1P7I A;  2OAZ A;  2PEX A;  4LIU A;  5A2Q Z;  1EV7 A;  3ABM H;  3BTJ A;  3K10 A;  3T8T A;  1AKH B;  1IO2 A;  1G2H A;  2VN2 A;  5ICC A;  3JW4 A;  3I55 I;  1OMI A;  1MMN A;  3BCA A;  3A02 A;  3U9G A;  1XDU A;  4D9J A;  4XQF A;  4RB3 C;  4I02 A;  3ZCO A;  1IUY A;  4FX4 A;  2QVO A;  3F8F A;  3BZC A;  3NRV A;  5LGN A;  3W6V A;  2IAI A;  4PSX A;  3MKW B;  5FD6 A;  2VJJ A;  4M71 A;  4HV6 A;  2ZSH B;  3EDP A;  1ENH A;  3HRU A;  3HOX J;  3MKL A;  3CCJ I;  4A3G J;  1YRN A;  3TBI A; 
#chains in the Genus database with same CATH homology
 4P96 A;  4BHC A;  3GZ6 A;  4GYG A;  4CDG A;  2OD5 A;  4BAY A;  3IRR A;  3O3K A;  5CYV A;  3M9A A;  4A0Y A;  4HDV A;  3K9T A;  3V8J A;  1D3Y A;  3MEX A;  2PBI A;  1TW2 A;  5E1Z B;  1MDM A;  1FYL A;  1R1V A;  4HZF A;  4OIN F;  3SXY A;  3EUH A;  1U5T A;  2NNN A;  1IRG A;  1KQ8 A;  2KIU A;  2XKO A;  2Z99 A;  4OIR F;  1KYW A;  2V1D A;  3I4P A;  4QWQ A;  3GYH X;  4HYE A;  1EH7 A;  3BZ6 A;  1KGS A;  4GYI A;  3BOQ A;  5LHI A;  4AWX B;  3T5X A;  3CDH A;  2C6Y A;  2NAZ A;  2BYV E;  1PP8 F;  1B9M A;  2LF7 A;  4HF2 A;  3E6M A;  1ZLK A;  3ISP A;  3DKW A;  1RIO H;  3JTG A;  3I54 A;  3ZMS A;  3FMR A;  3RTR A;  4EJO A;  1HST A;  4OMY A;  2FNP A;  4UHT A;  3WU0 A;  4ZYD A;  4AIJ A;  3RI4 A;  5D8K B;  4EJT A;  2O61 A;  4M9X A;  3REO A;  5D5U B;  3TKY A;  1BI3 A;  5FO5 A;  4KT5 C;  3ERE D;  3QRF F;  4YIF A;  3FWE A;  1G3S A;  3WTV C;  3TQN A;  4N9H A;  4JQF A;  3F8B A;  4A6E A;  5L3G A;  2W84 A;  3ZMD A;  4RGU A;  4ZYE A;  2MLK A;  5KVR A;  3L7W A;  4MHG A;  4R1H A;  3SZP A;  4YFX F;  1HKT A;  1IZ1 A;  1K78 A;  4YG2 F;  4L9N A;  1YQA A;  4KYW A;  1EH8 A;  2DLL A;  2ZNZ A;  3P9I A;  5E18 F;  2Q8K A;  2K86 A;  2L01 A;  2FU4 A;  4CHU A;  2FMY A;  1IN6 A;  4IHS A;  1IXS B;  2WWY A;  1R5G A;  3WG9 A;  2XAQ A;  2ISY A;  3JSP A;  3TDZ C;  1UHW A;  3HUG A;  2VBX A;  4HX8 A;  1KQ9 A;  4OIQ F;  3K0L A;  4M74 A;  3RPQ A;  4NQW A;  1DPR A;  1R36 A;  2HTS A;  2ADU A;  1L0O C;  1I1S A;  3M7G A;  1A04 A;  2LKP A;  3CUO A;  1J2X A;  2DK8 A;  1ULY A;  4ESJ A;  3IWZ A;  3E6C C;  1P2F A;  2P6T A;  5JI6 A;  2EB7 A;  2RC4 A;  4MTD A;  4E70 A;  3TDU C;  4QLC U;  4I0B A;  3J80 Z;  4ENJ A;  4HAM A;  3ZMV A;  1Z7U A;  2HKO A;  3RIR A;  1ONV A;  2L4M A;  1QZY A;  3WE3 A;  4PGG A;  2F2E A;  2IVM A;  5BS6 A;  1S7A A;  1BOA A;  1MD0 A;  3J81 K;  4KMU X;  4R79 A;  2OBP A;  3TO7 A;  4KNY A;  1D8K A;  3V7R A;  2HDC A;  4IJA A;  3QPT A;  1QO0 D;  3WGI A;  4U7D A;  2JPC A;  3CUQ C;  3LWF A;  1SFU A;  4HDU A;  2HYF A;  5FFZ A;  3V4G A;  1HW1 A;  3ULQ B;  1GXP A;  3HIF A;  1YYV A;  3DEU A;  5LBQ A;  4EM1 A;  4ENM A;  1SMT A;  1OR7 A;  4Y17 A;  1FNN A;  1R23 A;  4MGR A;  2VT2 A;  3T1B A;  1HQC A;  3K69 A;  3ABU A;  3MWM A;  2JTV A;  1FWZ A;  1ZLJ A;  3Q5F A;  1YW9 A;  4D0P A;  4L0Y B;  5D8L B;  2H6B A;  2PQ8 A;  2KKO A;  1UST A;  1K7A A;  4LB6 B;  4UUV A;  1XGN A;  3DP7 A;  3WTX C;  3GFI A;  2DPU A;  5DDG A;  4HF1 A;  5CVI A;  3KP4 A;  2HS5 A;  5E8I A;  2TDX A;  3GO5 A;  1NHA A;  5H6Q A;  1D8J A;  1SAX A;  1BI1 A;  2IT0 A;  1ZAO A;  3S2W A;  3EET A;  1P4W A;  3P9K A;  1U78 A;  2DO7 A;  4WXH A;  2EFQ A;  2RQP A;  3GLX A;  4RS8 A;  4MNU A;  1ODD A;  4LLN A;  1USS A;  1QQI A;  4XRF A;  2WTE A;  4S05 A;  5HLI A;  2L4A A;  2BGC A;  3IKT A;  4KFC A;  1RZ4 A;  5BMZ A;  2F5D A;  3WTZ A;  1ON1 A;  2ELH A;  5JFR A;  4LJZ F;  2ZO4 A;  2P7C B;  3TGN A;  1DPU A;  3BPV A;  4ZZL A;  3EYY A;  4B8X A;  2A61 A;  2YU3 A;  3L09 A;  5J6X A;  4LG0 B;  4RAZ A;  4BYY A;  1FY7 A;  2QM3 A;  1PDN C;  1KA8 A;  3BJA A;  3P9C A;  2HWV A;  2AS5 F;  5ICG A;  4BHP A;  3E97 A;  4MQV A;  2Y0M A;  2XAS A;  1ZHF A;  4KN7 X;  4WXC A;  3VOD A;  3KLN A;  3F72 A;  4IPA A;  5J8C A;  3H3Z A;  3IHU A;  1R7J A;  3HSR A;  1B9N A;  1BJA A;  4LB5 A;  3ZMT A;  2A69 F;  1OYW A;  1F9N A;  1FSE A;  4MEY F;  4I0A A;  1G3W A;  2LSO A;  2ZBK A;  1K6O A;  4BNC A;  2K4B A;  1CF7 A;  1R22 A;  2ZME A;  5H6R A;  3FMS A;  1FLI A;  1XDS A;  3LA7 A;  1MDM B;  4UNO A;  3GEZ A;  5L3C A;  2ESH A;  4L9V A;  4WF2 A;  1U5T B;  5K1Y A;  2DPD A;  3LA3 A;  1XCB A;  3MFK A;  4ASN A;  2P5L C;  2ZFW A;  3CJN A;  5D6E A;  2K02 A;  5LLQ A;  1O3T A;  2CGP A;  2DAO A;  1ZG5 A;  4PZJ A;  1O3R A;  2ISZ A;  1B1B A;  5E20 A;  1RI7 A;  5ILU A;  3C7J A;  2FE3 A;  1T6S A;  2DBB A;  1PP7 U;  1ZGA A;  4ETS A;  1ZRD A;  4RB2 C;  2MA3 A;  1MGT A;  2QWW A;  2A07 F;  3WTW C;  1EH6 A;  2JZY A;  3VOE A;  2EJR A;  3MCZ A;  3FXQ A;  3NQO A;  3ZMU A;  4BH9 A;  3HSE A;  2V6C A;  4JBA A;  1O3S A;  3RPU A;  4TV7 A;  5DCF A;  4XSZ F;  3B73 A;  3KP7 A;  1B59 A;  5J8F A;  1W4M A;  3JSO A;  4P55 A;  1BM9 A;  1JGS A;  2D2W A;  4DQ2 A;  5D4S A;  2VC1 A;  2GWR A;  4WWC A;  1FC3 A;  2M87 A;  3BRO A;  2XAJ A;  3RJP A;  2HEO A;  1ZG3 A;  1L3L A;  4WK8 F;  4A6D A;  1J0R A;  5IT9 K;  1LEB A;  4BHB A;  4EM2 A;  3R0A A;  1E17 A;  1FBU A;  1K78 B;  2H09 A;  2W24 A;  3Q9S A;  2W85 A;  1U3E M;  3HRS A;  1G4D A;  4I98 B;  3RYR A;  1Z05 A;  4L5J A;  3HYI A;  1Z1D A;  3ML6 A;  4UV9 A;  5HS7 A;  5HS9 A;  2Z5U A;  2P7V B;  1LDK B;  1WWX A;  4G6Q A;  4CIC A;  2ZNY A;  3W6J B;  5F1R A;  1P92 A;  3F6O A;  3KEO A;  4AIK A;  1TTY A;  3LQQ A;  3BWG A;  3VFZ A;  2G7H A;  3KFW X;  2MH2 A;  3V8K A;  3GZ5 A;  2DTR A;  2Z9O A;  3D5L A;  3RKY A;  3TO6 A;  5ICF A;  2XAF A;  4N0B A;  2IW5 A;  5BQT A;  2F5E A;  4I09 A;  4MEX F;  3LST A;  5K5R A;  1KYZ A;  1XMA A;  3HRM A;  1BC8 C;  2R7F A;  1PUE E;  2L3D A;  2LF8 A;  2Q0O A;  2W57 A;  3FXR A;  2PFB A;  3BDD A;  1WQ2 A;  1UHM A;  5EEG A;  4CYD A;  1ZH5 A;  4Y15 A;  4G94 A;  3QU3 A;  1BIB A;  1KU7 A;  1GXQ A;  2X0L A;  2PMH A;  4PDK A;  2WV0 A;  1FPQ A;  1IXC A;  1I1G A;  1LEA A;  2OZ6 A;  2FBK A;  2KRF A;  2VE8 A;  1LDJ A;  2DQL A;  2J5O A;  1RUN A;  3BPX A;  1OYI A;  4Q4Z F;  1WI9 A;  5LHH A;  5ILV A;  1BI0 A;  4ENK A;  2A6H F;  3G3Z A;  2V79 A;  5HS8 A;  2UXX A;  2P5K A;  3T8R A;  3RKX A;  1R00 A;  5CVV A;  4L0Z B;  4HW0 A;  1H9T A;  4XSX F;  4Q48 A;  3VB2 A;  3COA C;  1QZZ A;  2MD5 A;  3GWZ A;  1R58 A;  4G7H F;  1W5T A;  1HW2 A;  1YW7 A;  3IRQ A;  2F5C A;  1LJ9 A;  4ZYH A;  4IRG A;  2FSW A;  3KP3 A;  4M9S A;  2A3S A;  1YS6 A;  2E1N A;  2CW0 F;  1XN7 A;  1O7L A;  3CO6 C;  2X4H A;  3E6B A;  2HKX A;  2G7U A;  1P4A A;  4GO1 A;  4KUM A;  4NB5 A;  5ED4 A;  2MBF A;  4I01 A;  4ZZD A;  2VOO A;  5HLG A;  2FA5 A;  1ZG1 A;  1VTN C;  4U0Y A;  1KU9 A;  4A0Z A;  1XB4 A;  3WTS C;  2DW4 A;  2EFP A;  2Z3Y A;  3I59 A;  3WGH A;  3WOD F;  1SFE A;  1C0W A;  4HV5 A;  2K27 A;  2DU9 A;  3HRT A;  4ZYG A;  5K5O A;  4EJV A;  3DF8 A;  4A0X A;  4M72 A;  2QLZ A;  2J5P A;  2EA2 A;  1WKM A;  2PLY A;  4DNC A;  1AOY A;  2BBY A;  4EQQ A;  2KIM A;  5FFX A;  2VOP A;  3M8F A;  1T38 A;  2O03 A;  4M73 A;  5FLX K;  3GFL A;  2QBY A;  1FYK A;  2DK5 A;  3E6D A;  1STZ A;  1V3F A;  5A2Q K;  2FF4 A;  4I2O A;  5AIP A;  2XIG A;  2OQR A;  4JK1 X;  1H0M A;  1AWC A;  3PQK A;  2UZK A;  1RUO A;  4OMZ A;  3SZT A;  1KU3 A;  3L00 A;  2VOD A;  3R0J A;  3JTH A;  4EGY A;  4I7H A;  3K1N A;  5E1X A;  2RV8 A;  2A5Y B;  4IRI A;  1O7F A;  4UVA A;  2PMU A;  2D1H A;  1CF7 B;  2ZME B;  2B0L A;  3L2C A;  3QP5 A;  2QQA A;  1FX7 A;  1T39 A;  5FD5 A;  4L9J A;  1ZAR A;  2R7D A;  1V4R A;  2EV6 A;  1DDN A;  1YW8 A;  3FX3 A;  4YII A;  1Z9C A;  5D5X B;  4CO8 A;  1R1U A;  1JHF A;  4GGG A;  3LA2 A;  3VEP A;  1QNT A;  5D5W B;  5LRR A;  4M6Y A;  2GA1 A;  1MJ9 A;  5FGM A;  3FF5 A;  4HBL A;  2MH9 A;  3DPT A;  2ZXJ A;  1T0F A;  1YLF A;  4CZZ A;  4G6D A;  1IN5 A;  1XSV A;  3MAJ A;  2UWM A;  4KDP A;  3TO9 A;  3ABT A;  3C18 A;  2CFX A;  5LGU A;  4OOI A;  1OKR A;  3Q9V A;  1FSH A;  4IRH A;  3ECO A;  1REP C;  3LAP A;  2XRN A;  3OOP A;  1B6A A;  1Z6R A;  2M30 A;  5HOO A;  1O3Q A;  4UV8 A;  1IF1 A;  1KU2 A;  1XGO A;  1HKQ A;  2CG4 A;  3IWF A;  1MJB A;  3G73 A;  1TQI A;  1R1T A;  2GA2 A;  4OIP F;  4RGX A;  1XD7 A;  4XBF A;  4RB0 A;  3GF2 A;  5LHG A;  3WE2 A;  4O3M A;  2DT5 A;  1U5T C;  1QGP A;  3EQL F;  2KIF A;  3BJ6 A;  3AAF A;  1DP7 P;  4BXU A;  1G3T A;  4Z2Y A;  5DD8 A;  2LDU A;  1XSD A;  1SD7 A;  1YO5 C;  3LFK A;  2VBY A;  2EV5 A;  2QQB A;  4GXO A;  3F23 A;  1HSJ A;  3I0T A;  2EA4 A;  1HKS A;  2YX7 A;  3CUQ A;  3F8N A;  1W5S A;  2E7W A;  5D5V B;  3KCC A;  1JHH A;  1FT9 A;  2QYO A;  2H6C A;  3F8C A;  4LK0 F;  3I53 A;  2IPQ X;  1S29 A;  1W7P A;  3LAJ A;  3WTU C;  3ZP5 A;  2CYY A;  2HYG D;  4N9I A;  3HHG A;  1XCV A;  3TOA A;  2K4J A;  1G3Y A;  3WTY C;  2Q2E A;  1BC7 C;  3JAM K;  3W6K B;  4CXF A;  2XV4 S;  5CJ9 A;  1XGS A;  2FML A;  3E5U A;  5DUI A;  1ZRE A;  3E3V A;  4HF0 A;  4L9T A;  1F4K A;  5DV5 A;  1FBS A;  1TBX A;  2F5F A;  4EMS A;  1WRJ A;  4O5V A;  4A2U A;  2GAU A;  1R5H A;  1OYY A;  3J81 Z;  3V8L A;  3IC7 A;  1JE8 A;  1S3J A;  4KIF A;  4P5O A;  5JHU A;  3CLO A;  2EFW A;  1U6G A;  3F6V A;  1S8N A;  3J80 K;  4FHT A;  1IXR C;  2O8X A;  3NEU A;  5BPI A;  2IA0 A;  4XLN F;  1I5Z A;  4HLX A;  5L3D A;  4B09 A;  2NS0 A;  5TJJ A;  3FM5 A;  4EGZ A;  2E1C A;  2V9V A;  3O2P E;  4UVC A;  1J5Y A;  5L3F A;  2VXZ A;  3B02 A;  1O57 A;  4LMY A;  5ERI A;  4G8X A;  3RDI A;  5TRD A;  5LEJ A;  2FRH A;  1XGM A;  2HR3 A;  3KE2 A;  3T0Y A;  1YIO A;  3H92 A;  2A68 F;  1FYM A;  3DXJ F;  2ZCW A;  2PI0 A;  4ZH4 F;  2RKH A;  2RGV A;  4HQE A;  2DFI A;  2QUF A;  4O6J A;  2M8E A;  5E17 F;  2EFO A;  5AON A;  4L5I A;  2Y75 A;  3ZPL A;  1H9G A;  3ZN1 A;  4Q47 A;  1T2K A;  3F3X A;  1TW3 A;  4K2E A;  3OV8 A;  3M1E A;  4OU0 A;  3FZV A;  1HXD A;  1FOK A;  1YTY A;  5HDG A;  4AIH A;  4Y13 A;  1GHC A;  1ZRF A;  2KJB A;  1FP1 D;  3MZY A;  1S7O A;  4LD5 A;  5K5Q A;  3IL2 A;  2XAH A;  3SQN A;  2OU2 A;  2BV6 A;  1J75 A;  1CGP A;  3CTA A;  1UB9 A;  4P9F A;  2H27 A;  4HX7 A;  1MZB A;  2A6E F;  5LRS A;  3KZY A;  2E7X A;  5E1W A;  1ON2 A;  2HOE A;  4G9Y A;  5DUK A;  2EWN A;  4PCQ A;  5BOX A;  1I6X A;  5HDK A;  4HLY A;  4H0E A;  3I59 B;  1HW5 A;  3F8M A;  2R3S A;  4IXA A;  4LFU A;  1J9I A;  4L18 B;  4HA8 A;  2HQN A;  3QP6 A;  2PN6 A;  1WSU A;  1TNS A;  1F5T A;  2FEZ A;  1MJA A;  1YS7 A;  5D4R A;  4IHT A;  1Z6T A;  3WTT C;  2JSC A;  4HOB A;  4EJU A;  4LLL A;  2QBY B;  2ETH A;  3F22 A;  1LDD A;  3PFI A;  4FX0 A;  4KMF A;  3FM3 A;  5HDN A;  1DUX C;  2P8T A;  2FXA A;  1B4A A;  2GQQ A;  2XGX A;  4IVN A;  5HVQ C;  2YR2 A;  4A5M A;  5H20 A;  5D6F A;  2O0Y A;  6PAX A;  1LNW A;  3MQ0 A;  5HLH A;  5ILS A;  4KA4 A;  2GZW A;  4ON0 A;  3DFG A;  2VE9 A;  1TQP A;  2L02 A;  2M45 A;  3BP8 A;  3L9F A;  4OIO F;  2RNJ A;  5DD4 A;  1SMY F;  3V7S A;  3HTU A;  1YG2 A;  4G7Z F;  4HX4 A;  1W7P D;  2DI3 A;  3JAM Z;  2ESN A;  2IA1 A;  2HTJ A;  1ZN2 A;  5AIQ A;  2CSO A;  3KEQ A;  1RNL A;  2RDP A;  3GFM A;  1KQ0 A;  3KLO A;  3ZQ7 A;  4YFK F;  5ICE A;  4EJW A;  2P4W A;  2VBZ A;  3E5Q A;  3QAH A;  1Q1H A;  2JT1 A;  1MKM A;  3F21 A;  1BI2 A;  3I71 A;  3K1P A;  1XMK A;  2O6G E;  3H3U A;  3KP5 A;  3LQR A;  2COM A;  5IT3 A;  2HGC A;  2H94 A;  3TOB A;  2GXG A;  4LK1 F;  2CO5 A;  3IKV A;  2QEN A;  3DV8 A;  5CVU A;  3I5U A;  2RVC A;  4U0W A;  2BE5 F;  4S04 A;  2VT3 A;  2YSR A;  4U88 A;  3ELK A;  2VC0 A;  2FNA A;  2VON A;  4HQM A;  3DQV C;  5LGT A;  3SHF A;  5CLS A;  2M5W A;  1FBQ A;  4BQA A;  2EFN A;  5IT9 Z;  2YX4 A;  4LLG F;  2QQ9 A;  1FZP B;  3QU6 A;  1LB2 A;  3R6S A;  1BIA A;  4EVI A;  4RGR A;  1ZRC A;  2ZKZ A;  5DEQ A;  1ZGJ A;  2CQK A;  4PGH A;  1OPC A;  4NHJ A;  2AXL A;  2UXN A;  4EM0 B;  3N97 A;  5BPD A;  3ECH A;  4RB1 A;  5JVT A;  4KIB A;  4WX9 A;  1IN4 A;  3FXU A;  3V7C A;  2FBH A;  2ZJ2 A;  5DCM B;  3R4K A;  4UVB A;  3HSF A;  3MZH A;  5DYM A;  3GXO A;  4R8H A;  1E2X A;  3CUQ B;  1ZYR F;  2W25 A;  3GX4 X;  5L3B A;  3C3W A;  1SD6 A;  3CO7 C;  2IP2 A;  4ENN A;  1Y0U A;  2XHK A;  3GUD A;  3HHH A;  2IJL A;  1SFX A;  4Q5S F;  2IRF G;  4LGW A;  1UCR A;  1W7P B;  1TLH B;  5CVJ A;  3HTS B;  1BN5 A;  2XKP A;  2G9W A;  2V1U A;  1QBJ A;  1G6N A;  2HFH A;  1SD4 A;  1Z91 A;  2V1X A;  4UXN A;  2P6S A;  2NNY A;  1IW7 F;  3SFZ A;  4RGS A;  3R60 A;  3HOS A;  2JRT A;  1FP2 A;  3BJO A;  3KET A;  2EK5 A;  2WC2 A;  2P5V A;  2FBI A;  3WGG A;  2LNB A;  5JR3 A;  1J7K A;  1S6L A;  1U8R A;  5LEK A;  2KJC A;  3WU1 B;  1I27 A;  4A5N A;  2JPB A;  3GW2 A;  2HZT A;  4A12 A;  3FHZ A;  2QZ8 A;  1JXS A;  2FOK A;  3K2Z A;  4KIG A;  3ROU A;  4FT8 A;  4AD9 A;  3GFJ A;  3RYP A;  4YFN F;  3N4M A;  4G7O F;  1TQM A;  4WCG A;  3U2R A;  3I64 A;  3P7N A;  1YFH A;  5CVR A;  4ESF A;  1F1Z A;  4MQ9 F;  3EYI A;  2NRA C;  1X3U A;  2MC3 A;  2STT A;  3HOT A;  2XVC A;  2DQR A;  4M6X A;  3ZN0 A;  3DPL C;  3U1D A;  1K79 A;  2GXB A;  4EV0 A;  1U2W A;  5DCM A;  3KZZ A;  1IAW A;  4ESB A;  4U7B A;  4F7Z A;  5F6F A;  1SD5 A;  2OA4 A;  1BBY A;  3GVA A;  1IN8 A;  2CWE A;  4MTE A;  3C1D A;  1D5V A;  1XSX A;  3R61 A;  3E5X A;  2GIV A;  5L3E A;  3RKW A;  1T98 A;  2ACJ A;  2L54 A;  2NYX A;  3M8E A;  2XUB A;  5EEH A;  1IN7 A;  2XAG A;  3QOP A;  4GCV A;  4M9Z A;  4WXD A;  2EV0 A;  2STW A;  2FQ3 A;  3KP2 A;  2O3F A;  4KIC A;  2RN7 A;  4RAY A;  5E8G A;  2K7L A;  4IF4 A;  3K1M A;  1J59 A;  2PG4 A;  1HBX G;  2Y48 A;  4AVP A;  4P9U A;  2D1V A;  1UFM A;  2OQG A;  3FMQ A;  3I58 A;  3BY6 A;  5KK1 A;  1P4X A;  1QPM A;  2MLG A;  2M1B A;  1IRF A;  2BEO A;  3PQJ A;  4XLP F;  3QPH A;  3O6B B;  2HQR A;  2D45 A;  3J7A O;  1GVJ A;  3KP6 A;  4KN4 X;  4U0V A;  1LQ1 A;  5FB2 A;  3D0S A;  2OZU A;  2YPR A;  2VBW A;  4LG0 A;  4CGZ A;  2XRO A;  2IA2 A;  2PJP A;  1P6R A;  1LVA A;  5FLX Z;  1TNT A;  5F64 A;  3ZMZ A;  2Z33 A;  2OAZ A;  2PEX A;  5A2Q Z;  1EV7 A;  3T8T A;  2VN2 A;  5ICC A;  3JW4 A;  1OMI A;  3U9G A;  1XDU A;  4RB3 C;  4I02 A;  1IUY A;  4FX4 A;  2QVO A;  3F8F A;  3NRV A;  5LGN A;  5FD6 A;  4M71 A;  4HV6 A;  3EDP A;  3HRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...