1UJ0A

Crystal structure of stam2 sh3 domain in complex with a ubpy-derived peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
MARRVRALYDFEAVEDNELTFKHGELITVLDDSDANWWQGENHRGTGLFPSNFVTTDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into modest binding of a non-PXXP ligand to the signal transducing adaptor molecule-2 Src homology 3 domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/signaling protein
molecule keywords signal transducing adaptor molecule (SH3 domain and ITAM mot
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2003-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uj0A00
1J3TA 1IO6A 2CT4A 2EGAA 1WXTA 2SRCA 2F2VA 5FWBA 1K76A 3REBB 2YT6A 3EHQA 1WFWA 4A63B 1AWOA 2DL3A 1XOVA 2JT4A 2K79A 2KRSA 4M4ZA 2BTTA 2GGRA 4CC2A 3NGPA 3IQLA 2JTEA 3GBQA 2DYBA 2RPNA 2OJ2A 1WDXA 2JMAA 1OOTA 3M0RA 3SHWA 5IXBA 2ROTA 1SHGA 2JM8A 2DL8A 1AZGB 4LE9A 3M0TA 2BZ8A 2KR3A 2MOXA 3H0IA 2QDLA 2V1RA 1PWTA 2LJ0A 4JJDA 4J9DA 1VA7A 2W0ZA 4KRTA 4J9CA 1ZBJA 2D0NA 3VS3A 3THKA 2FPDA 2HCKA 3QWXX 3EG2A 1BB9A 1WA7A 1NYFA 1WIEA 2RMOA 1VYTA 1U3OA 1FMKA 2DM1A 4J9IA 1M3BA 5IHKA 2KT8A 1T0HA 3M0QA 1AZEA 2EQIA 2A08A 4CC4B 2LNHB 2J06A 3NHNA 2ABLA 2C0TA 2CSIA 4LNPA 3I9QA 1I07A 1NEBA 1JO8A 1GL5A 1ZLMA 1PHTA 4Z88A 4AFUC 2CH4A 3I5SA 1K0SA 1UJYA 3R6NA 1NM7A 2O9VA 1BBZA 5GJWB 4OMNA 2PZ1A 4IIOA 2AKKA 4LN2A 1ZX6A 3REAB 1KFZA 2LJ1A 5IHIA 1AWWA 2AZSA 1S1NA 5GJVB 1UDLA 1TUDA 3VRZA 1E6GA 2DLPA 3NMZC 2DJQA 1A0NB 5I11A 1NEGA 1VYUA 3M0SA 1M3CA 3RNJA 1RI9A 1X2QA 2RQUA 1NLPC 3RBBB 1G83A 2AZVA 1X43A 4F17A 4EIKA 4DEYA 3U23A 1W70A 2DMOA 3ZL7C 4OMMA 2EGCA 3EG0A 1JXOA 1QCFA 4F16A 1WLPB 4D8DA 2DF6A 4QT7A 1WYXA 2K7AA 1TUCA 2YDLA 2DL4A 3SEMA 2J6FA 1WI7A 4E6RA 1KIKA 1M3AA 2NUZA 2K3BA 1LCKA 3EGUA 1T3SA 3VRYA 2ED1A 1H8KA 2F2XA 1JU5C 4OMPA 4ZNXA 2KBTA 1I0CA 4RTYA 1YN8A 1X69A 2D8JA 3FJ5A 5IXFA 1SPKA 2DL7A 4RTVA 5FWCA 1TG0A 1UECA 2L3PA 2LP5A 5IHNA 1NLOC 3TSZA 2FG0A 1WXUA 2HDAA 1AEYA 1ZUKA 2EPDA 2GQIA 2L2PA 2CUBA 2A37A 4Z89A 1YCSB 1NYGA 4J9EA 4LUDA 2A36A 3H41A 4AFQC 3TSWA 1YWPA 1AVZC 1U06A 2J05A 4JJBA 2MCNA 2EBPA 4RTTA 3H0HA 1QKXA 1MV3A 3VS1A 1B07A 2D8HA 2HBWA 2JXBA 1SSHA 2LMJA 1RLPC 2RQRA 2M51A 2LJ3A 2JS2A 1KJWA 3UA6A 2RQVA 2NWMA 1GFDA 2KRNA 1UUEA 1W1FA 2M0YA 3VS4A 1X2KA 4ORZA 1PRMC 2O9SA 1I1JA 4HCKA 4JJCA 4J9FA 1AOJA 1PKSA 1E7OA 2DL5A 2DX1A 2DA9A 4WCIA 1HSQA 1E6HA 1JXMA 5IH2A 3CQTA 2EGEA 2KROA 1RUWA 2KXCA 1CKBA 1FYNA 2OI3A 2RNAA 3VS7A 1X27A 2DVJA 3ULRB 2X3XD 2V1QA 2EW3A 1K0XA 1QLYA 1G2BA 2DNUA 3UA7A 2GNCA 2P4RA 1UJ0A 4LUEA 1QKWA 2DE0X 1AD5A 3M0UA 2FPEA 2EVRA 2LQNA 2YUOA 2B86A 1GFCA 2CREA 1Y57A 1B3QA 4F14A 2RN8A 4AFZC 2DRMA 1EFNA 2X3WD 2JM9A 2LZ6B 4R0KA 1K4US 2IIMA 1VYVA 2HEQA 2ENMA 1OPKA 4RTZA 1BU1A 4JPBW 5L23A 1UHFA 1V1CA 1PNJA 2DILA 4FSSA 1UE9A 2LQWA 3JV3A 4CC3A 4DEXA 2KT1A 1ABOA 3VS6A 1H3HA 2KE9A 1PRLC 2F2WA 2L0AA 2I0NA 5I22A 2FRWA 3M0PA 2J6KA 2ESWA 2ROLA 1W6XA 4X1VA 4D8KA 1YNZA 2KRMA 3EG3A 4HXJA 3UATA 2H8HA 2VVKA 2CDTA 2EYZA 2YSQA 2MIOA 1Z9QA 1JEGA 3A98A 2PTKA 2EYWA 1U5SA 1QWFA 4HVUA 4IIMA 1PKTA 3KFVA 1X6GA 2AKLA 3VS0A 1UG1A 4K11A 2KGTA 1K9AA 1GRIA 3VS5A 2K2MA 2J6OA 3EG1A 2YUNA 4OMQA 4HVVA 1GCQA 2CSQA 2JS0A 2JW4A 2LX7A 3NPFA 3I35A 1CSKA 1GCQC 1M27C 4RTUA 4J9BA 1JQQA 1OV3A 2RQTA 1UHCA 3H0FA 4RUGA 1ARKA 2O88A 1GBQA 2J7IA 2VWFA 4RTXA 2CH4W 5EC7A 4AG1C 4RTWA 2K6DA 1T0JA 4OMLA 2VKNA 1OPLA 3EHRA 1Y0MA 3TVTA 1NG2A 2EYXA 4JZ4A 1ZSGA 1BK2A 2RQWA 2CUDA 3QWYA 3C0CA 1YP5A 4J9GA 2O31A 2GBQA 1AWJA 2KNBB 2KXDA 2DBKA 3O5ZA 2FEIA 2CT3A 1K1ZA 2FRYA 4JZ3A 4Y92A 2YUQA 1GBRA 4Z8AA 1MUZA 1H92A 2C0OA 3PVLA 2EYYA 4HVWA 1SRLA 2RF0A 2D1XA 1SHFA 2KYMA 4OMOA 1AWXA 2ECZA 2JMCA 2HSPA 4AG2C 1MV0B 1M30A 2W10A 1CKAA 1WX6A 2BZXA 2G6FX 3I5RA 2LCSA 2SEMA 1UFFA 3PE0A 2KEAA 2PNIA 1ZUYA 1X6BA 2FPFA 3UF4A 2O2OA 5ECAA 3VS2A 2AK5A 2EKHA 2GTJA 1GCPA 4CC7A 1OEBA 2BZYA 2GTOA 1WXBA 5HCKA 4GLMA 2A28A 4ESRA 4GBQA 1UGVA 3PVQA 1N5ZA 1SEMA 3LH5A 5FW9A 1Z9ZA 2DRKA 4AFSC 2ED0A 2C0IA 1YWOA 1KSWA 2E5KA 1T3LA 1HD3A 2L3QA 4J9HA 1HJDA 2DBMA 1ZUUA 1QWEA 2OAWA 2YUPA 2K9GA 2L3SA 1UTIA 2KYBA 2FO0A 1RLQC 1M8MA 2XMFA 1SRMA 1ABQA
chains in the Genus database with same CATH superfamily
4JRIA 1D3BB 2CT4A 1PG5B 1BYMA 1OU8A 1RAGB 1VQ9A 1TOVA 2K3YA 1WFWA 2FZKB 2K79A 2HZYA 2KRSA 1TU0B 2LX9A 3NTIA 3QYHB 1RAHB 4C8QE 5KYYB 3L2RA 3OMGA 4BDYA 2DYBA 3SWNC 2RPNA 4ATOA 1FX7A 2OJ2A 4OB1B 2L5QA 3X20B 4ZN3A 2QI2A 2ROTA 2JM8A 3AT1B 4XU0A 4MMKA 4C92E 3M0TA 1NPRA 2CP5A 5GMKj 2MI6A 3H0IA 1SF9A 4RMOA 1KQSP 3G4SA 2OTLT 4PJOD 4C92C 1VQMA 4IUQA 2ZPEB 3CMAT 4KRTA 1LOJA 3CCSA 2D0NA 1G3WA 4A54A 4BI8B 3TCJA 2K57A 1NJIC 3QWXX 3EG2A 1KD1U 1WQWA 1WA7A 2RMOA 3HRSA 4F7UF 1U3OA 4M75C 5KYXB 3M0QA 2YRCA 1VQ4T 1X6OA 2QAZA 3OYCA 4JS4A 2J06A 2CSIA 2HQEA 1NEBA 1JO8A 2XHCA 1ZLMA 3JCMJ 1PHTA 3M59A 4FYVB 3CMEQ 4AT1B 1Q81R 5GANh 2CH4A 2PUOB 1K0SA 2FVUA 4RG2A 4OMNA 1VQOQ 1F1BB 4Q5WA 3A8MB 2AKKA 5CIUA 4LN2A 2DEQA 2E64A 3L1AA 1KFZA 1WHLA 4E47A 3A5ZB 2AZSA 1UDLA 5CK9A 3FEOA 1E6GA 3CCUQ 3SD4A 1XQHA 3S3NA 3M0SA 1X43A 4ELYC 4BE2A 5DY9A 1PM3A 3EG0A 1JXOA 4PLIA 2WACA 2DF6A 5LJ3f 3CCET 1TUCA 1D1BA 2DL4A 5A0GA 5KE3A 3META 2EQKA 3DKMA 2F69A 1V76A 4E7ZA 2OTJT 2K3BA 4PJOG 4IKFA 1M90U 1TUGB 1T3SA 2MF2A 2Z0WA 2F2XA 1JU5C 2RD1A 4OMPA 1Q86U 4GLKA 2K3XA 1X69A 5GANf 2JOYA 3CCEA 2XDPA 1BIBA 3ZBDA 2DL7A 2DZ9A 2X4WA 5FU7C 2A7YA 2BKDN 1YI2Q 2YLBA 1YCSB 4LUDA 4LDWA 5GAN8 3UT1A 4AFQC 2QXFA 3P8DA 2G3RA 4KGVB 2EBPA 1Q86R 1KQ2A 4MZTA 4RTTA 3RIRA 3HKSA 1I81A 4PKCC 1MV3A 5LJ3h 2V8JA 1IGQA 3QJ6A 3CXCS 4QQDA 3OMCA 1YJNQ 2HBWA 2V8IA 3CCJQ 4NL2A 1SSHA 2L3RA 2RQRA 4C92G 3OS2A 1VQ5A 5GAN5 3V7CA 1KJWA 3UA6A 4C92D 2JJ9A 2NWMA 1YJWA 2KRNA 3OYMA 3HHTB 1QVGP 5A0LA 4E7SA 3RUXA 3CCQA 3PT9A 4PNOA 2YXYA 4IUTA 3INZA 3QUIA 1BI3A 1E7OA 4WCIA 1KC8U 1OZ3A 3JCMV 1VQ8T 4J7FA 1RUWA 4XTUA 1FYNA 4M7DG 2OI3A 3M56A 4C92A 5KH6A 4LDUA 2YHTA 1N9RA 1KQSA 3VUBA 2QTVA 3KXTA 1QLYA 1G2BA 2GNCA 2RO0A 3SWNA 3UPUA 1QKWA 1M2VB 4C8QG 4MDWA 3M0UA 3RKYA 2FPEA 1EX4A 1MGQA 4OB0B 2B86A 1GFCA 2CREA 4QKUA 5IN1A 1MMDA 3G71A 1M1KU 3X28B 4OB2B 4J5YA 2P0QA 5GAN4 5LJ5h 1VQ9Q 2ENMA 4IUVA 5LL6S 3UWNA 3OYEA 2COZA 4JPBW 1UHFA 1U1TA 2LQWA 3JV3A 2KT1A 1ABOA 3LX7A 1PRLC 2QA4A 3FRNA 5I22A 1VQNQ 2LQKA 4F04B 2ROLA 1W6XA 4X1VA 2OTLA 3UATA 2HKQB 1JRIA 3OS1A 3JCMh 2CS7A 1JEGA 3QG1A 2EYWA 1U5SA 4KUDK 1O9SA 4HVUA 4JLGA 3GPLA 2DVEA 2RJCA 1RABB 3CC7Q 2NUTA 1UG1A 2F5KA 4K11A 1XNIA 2KGTA 1SSFA 3EG1A 4OMQA 2AHJB 2RI3A 4HVVA 3OW2P 2LQ8A 4OGEA 1JBMA 3NPFA 1PC0A 1WNLA 2IVWA 1M4ZA 3HL8A 3X25B 2JN0A 4KGXB 3LWIA 4RUGA 1NPPA 1GBQA 2V26A 4J6WA 3CD6A 1IHVA 2J7IA 1YBYA 4RTXA 3RKWA 4KUIA 4AG1C 4BB7A 1Y96A 4M75E 3S3OA 1YI2T 3SDZA 2K6DA 2D0QB 4LDVA 1OPLA 2QEXA 4JJNK 1VQ5T 1ZA2B 3MKDA 2BIVA 1BKBA 2GBQA 2KNBB 2KXDA 2KMTA 4BDZA 2DBKA 2FEIA 2CT3A 1UGRB 1VQLA 4MZMA 4XAXB 1GBRA 3BFMA 1ZA1B 2D9TA 2KQWA 5I21A 1G3SA 1SRLA 2RF0A 2D1XA 2JTMA 2LC4A 3CD6Q 4BD3A 2K5IA 3LH0A 4HCCA 2P0PA 2DYIA 2ECZA 3L2VA 2JMCA 4II1A 4M78D 1WX6A 3OQ5A 1WGSA 3CCSQ 1VQKQ 3V7RA 2EFIA 3EFOB 2FPFA 3UF4A 3QDRB 2O2OA 2M02A 1YJ9T 5ECAA 4N0AC 3VS2A 3I56T 2FHDA 4EMGA 1JJ2S 5LJ5j 3C94A 5KYWB 5HY6A 1WXBA 4XTYA 4FT4A 4JRKA 2CGHA 4XTZA 1VQ7Q 4R55A 3L42A 4ESRA 4GBQA 5LJ3g 2CP7A 4E2FB 3PVQA 4IUPA 3LH5A 1QP2A 3PIOA 4C8QB 2DRKA 2ED0A 2C0IA 2ZGWA 2LCLA 1EIFA 2XIDA 1HD3A 4J9HA 2DBMA 1ZUUA 1QWEA 2E41A 2KYBA 2K5LA 5LJ5d 3L2ZA 3CCUA 3KUFA 1ABQA 3OYNA 2PQWA 4XK8E 2CP2A 1VOMA 2F2VA 1K76A 3REBB 3EHQA 4A63B 3DB3A 2KK4A 2BUDA 2P4TA 4M4ZA 3QSUA 3GNGA 4J8OA 1D0YA 1NBEB 3NGPA 3IQLA 2JZ2A 1IGUA 4QVZA 4D6WA 2DXBA 2JMAA 1I4K1 3QKJA 1SHGA 3GIBA 4L59A 1AZGB 4XTXA 2BZ8A 2COWA 1YHQT 4C92F 2HSEB 2V1RA 2M9UA 1PWTA 4JJDA 2XKOC 3TREA 4J9CA 1K73C 1K73U 1U8RA 3DLMA 3THKA 2HCKA 3OW2A 1NYFA 3QPHA 5CKFA 5GAMh 1R8OB 4VUBA 4TVRA 4J9IA 4YTLA 1M3BA 2E1HA 1AZEA 2EIFA 4M7DF 2CZ1B 3BDLA 2LNHB 2HNIA 4EMKB 5CO7A 2ABLA 2C0TA 3JB9J 3I9QA 1I07A 1WHMA 1D3BA 1WQ7A 3RMQA 3M53A 1QVGS 2K5FA 1OULA 2PVDB 1K9MU 3I5SA 4M7DC 1UJYA 3R6NA 1NM7A 5A0DA 2O9VA 2OAUA 1BBZA 5KYYA 4JUVA 2PZ1A 4IIOA 3OY9A 1P92A 5IHIA 2QASA 1S1NA 5GJVB 3QXEB 2MYSA 2YRVA 3T9NA 3NMZC 2DLPA 3O8VA 2DJQA 2CZ7B 3SB2A 2DXTA 3G6ET 2RHIA 1X2QA 3FB9A 2QTXA 5DLQE 4DEYA 3U23A 4C8QD 3MEUA 2DEUA 3CCST 4RKUE 3CMAA 3G71T 4M78F 1WYXA 4ZGEB 2YDLA 1YIJA 2NUZA 3MJXA 1MMGA 3BY7A 2FB7A 4EMKC 1N8RR 3A8GB 2ED1A 1H8KA 4NOYA 3JAME 4E7KA 3URGA 4PFOA 2MAMA 4ZNXA 4FYYB 4RTYA 4C0GA 4FYXB 3FJ5A 4J6YA 1SPKA 1PD0A 2L3PA 5IHNA 3L2UA 2FG0A 2EQJA 1AEYA 4C0DB 1VQ6Q 1QW1A 5HK3A 5KYUB 4DQ2A 5CQXA 2CUBA 4Z89A 2XU8A 3OS5A 2A36A 3H41A 1VQ6A 1YI2A 1YWPA 3VUZA 1AVZC 1U06A 4M7AF 4BE1A 2AT1B 4B9WA 2RHYA 4FSXA 3E9FA 3QZ5B 1B7TA 3CCMA 1ZQ1A 2XK0A 3VJPA 4V2SA 3H0HA 2CP3A 2PU9B 1DJ7B 1BI2A 3CMEA 4MZPA 1N8RU 2JXBA 3HFNA 1X01A 4M75F 2LJ3A 1VQ7A 2RQVA 1YIJQ 2M0YA 3JCMf 2CP6A 3A1PA 4HCKA 3CC2A 2KVQG 1OZ2A 2VUBA 1WHJA 1YIJT 2XG8D 2DL5A 1PD1A 2LVMA 3H9NA 1Q82U 1VQNA 2XD0A 1WHGA 1E6HA 1JXMA 4OVAA 5IH2A 2E70A 2EGEA 4C8QC 1YITA 4IURA 4A4HA 2QGFB 1KQ1A 1X27A 2DVJA 2QA4T 1YJWT 4E7LA 3RMSA 4L5GA 1K0XA 3LLRA 3NTKA 2FZGB 3G6EA 2DNUA 3EH2A 5FLXE 1Q81C 2OTJQ 3S6WA 1Q81U 1HK9A 1N8RC 1UJ0A 4M78C 2VXFA 2DE0X 2NUPA 1AD5A 2VB6A 3G71Q 1RAEB 2DFUA 1VQOA 1PCXA 2YUOA 3PGGA 1BCOA 4E7HA 1KHCA 2Y4YA 1B3QA 2RN8A 3JCMQ 2JM9A 1C1AA 3FDRA 3CBOA 2IIMA 4FM4B 3WVDB 2QEXQ 3I55A 1OPKA 1WPYA 2ZPGB 4DOVA 3M54A 5L23A 1C6VX 3CPWA 4FSSA 4GY5A 3I55Q 4X9DA 2RI2A 3GP8A 1H3HA 2KE9A 1D0ZA 5AT1B 1YJ9Q 2OX7A 1RAAB 2L0AA 4O5VA 2FRWA 5CQYA 1VQKT 1ZSZC 1YNZA 3EG3A 3D7SB 4C92B 2GF7A 3GF5A 1WHKA 2CDTA 2RJFA 2VVKA 2YSQA 3NFCA 4HA8A 3A98A 4M7AC 2OTJA 2B8AA 1TS9A 1PKTA 4PFZA 1RL2A 3SWNB 2AKLA 4QQ6A 1S72A 2EQUA 1M2VA 2DJZA 4KT0E 4FW1A 1GRIA 3VS5A 2K2MA 2YUNA 3CMAQ 4M7DB 1CSKA 1M27C 1R77A 4F7UE 2IG0A 2RQTA 1XJWB 1FMVA 1UHCA 3H0FA 2MK5A 4M78A 2O88A 4RCCA 1RADB 2BE7D 2VWFA 1LVKA 1OX9A 3JCMc 1FWZA 4M7AG 2O4XA 1MMAA 3CMET 2PVOB 2VKNA 3EHRA 1Y0MA 1Q95G 1I5OB 3JB9G 1OYXA 2RK1A 3M57A 1RAIB 1ZSGA 1BK2A 1NJIR 3VV0A 1IZ6A 3HFOA 3QWYA 5GAMj 1UGQB 4C5HA 1M8VA 3RKXA 4A4EA 4M78E 2LTOA 4JZ3A 1K1ZA 4Y92A 1VQOT 1K8AR 4FIBA 1VQ9T 1B34A 4CRIA 1MUZA 4OF1A 4A4GA 3CEYA 3ME9A 3GOXA 2DK3A 2KI7A 1AWXA 3TEEA 6AT1B 3C95A 2RH2A 1AT1B 2QG9B 1M30A 2G6FX 8AT1B 5D6XA 4OP0A 2SEMA 1VQKA 2LT1A 4JRQA 5GMKm 2PNIA 3OYFA 2DIGA 4DBHA 1X6BA 1YITT 1Q86C 3JB9H 1S72Q 2ZPFB 3CCQQ 3EG9A 2AK5A 4LD9K 2EKHA 2GTJA 2QDYB 4N4HA 3CC7A 3MP1A 1OEBA 1LNXA 2BZYA 1PSFA 2GTOA 3V8LA 4QW2A 1YJWQ 2F1LA 3VU3C 3EGXB 3N5BB 1NJIU 3MPUB 1KD1C 2VASA 4C0FA 2EYQA 4LXCA 4ZTJA 4M7AE 3CCLQ 2V8KA 1SEMA 5FW9A 3HRTA 5GAOn 3JCMd 3JCMg 1UGSB 2E5KA 1T3LA 1IHWA 1N27A 1R0BG 5FU6B 3C12A 2LRQA 5C0MA 3PTAA 2E5QA 4PJOA 4ZTFA 3CPWP 3ER0A 2DZCA 3OYLA 3BDUA 2EGAA 3M4YA 1WXTA 2SRCA 1C0MA 1Q7YU 1VQPT 2DPPB 2O01E 2CYZB 4Z02A 2DL3A 1XOVA 4EMHA 1Y07A 2GGRA 3EFOA 2H3JA 3G7ZA 5L8RE 1KC8C 2IPOB 3Q1JA 3GBQA 1D09B 1R0CB 5IXBA 5KYWA 1OOTA 3MEVA 3P8BB 3M9QA 1QVFS 2X4YA 2KR3A 3PNWC 4PFPA 2QDLA 2JUFA 3A8HB 2LJ0A 4M75G 8ATCB 4MMLA 3L2WA 4J9DA 1W4SA 2W0ZA 3RESA 1ZBJA 1BCMA 1XTDA 2EJ9A 4X34A 4C8QA 3PMIA 2DTOA 2FPDA 3OYAA 1BB9A 1WIEA 4ME7A 2XDBA 1W2BA 2R5MA 1PSEA 5IHKA 1BI1A 4C5EA 1T0HA 3E2UA 2DTIA 4CC4B 3A8OB 3JB9F 3DB4A 3HRUA 1LJOA 5D6WA 4LNPA 4WTOB 4X9CA 5M9OA 3EFSA 3CCJA 4AFUC 5FRMA 2JVVA 3CCRT 2ZPHB 5C6SA 3PMTA 4XU3A 1IB8A 5GAOp 3AHUA 1OQKA 3CC4Q 3MEAA 2NLUA 2ZAEA 1ZX6A 2XICA 5IT9E 1I8FA 2WSCE 4JS5A 1VUBA 1TUDA 3VRZA 4M77D 2QGGA 2WSFE 1A0NB 3CCVA 1RI9A 1NLPC 4HKEA 3RBBB 1G83A 2RHUA 5GAN7 2XDDA 1OU9A 2P84A 2EGCA 4F16A 1WLPB 3OYBA 2DAQA 2HQXA 2M16A 3CC2Q 1WI7A 4E6RA 1KIKA 5EG2A 1M3AA 1WHHA 3FJPA 1LCKA 2EWNA 3EGUA 2EJGA 5CR2A 2HQHA 3VRYA 2H3EB 3CCLT 1M90R 4M75A 1I0CA 4J83A 2D8JA 5IXFA 5FWCA 1ZHIA 1K8AC 1UECA 2LP5A 1NLOC 1TWBA 2CZ0B 4J6XA 2AIRB 3ZFJA 1G5VA 2HDAA 5GAOm 3VKIA 5A2QE 2RK2A 4BI4A 4M77B 4M7AA 2ZCFB 1NYGA 5CKDA 4C5IA 3TSWA 3MO8A 4P5NA 2VC8A 4JJBA 3E9GA 2QQSA 1HYOA 4ELZC 2QQAA 3GLXA 1FMWA 4C8QF 1VQPQ 2Y90A 3I56Q 3G1JA 3VS1A 2D8HA 4PJOE 3M4GA 2D6FA 3CCLA 2LMJA 1SG5A 3OS0A 4M7DE 1YHQA 2HKNA 2PVGB 3VS4A 1WJSA 5J3BA 1PRMC 1MMNA 4J9FA 1AOJA 4N0AA 2DX1A 1QP3A 4WF2A 2KROA 3OYHA 3G4ST 2DXUA 2DERA 4KH0B 3RR6A 4BUGA 1IREB 3CCVT 3ULRB 3G4SQ 3CCVQ 5KYUA 2V1QA 4C0ZA 4M77C 4BI3A 2X51A 3OYGA 3UA7A 3HPWA 1H3ZA 3CC4A 1H641 2P4RA 4LUEA 1Q82C 2KAFA 2EVRA 2LCCA 2LQNA 4FU6A 2RHXA 1Y57A 4F14A 3OBYA 3J7AF 1G3TA 2LZ6B 4DOWA 4R0KA 2HEQA 3NTHA 4CI0C 4HCZA 4LD6A 4Y91A 3PIPA 4PJJA 1V1CA 1PNJA 1Q7YR 5KYNA 1UE9A 4CC3A 4DBFA 4DEXA 4FL6A 1YCYA 5GANd 1YITQ 1I5LA 2F2WA 2I0NA 3M0PA 2E4HA 3CCEQ 1QCNA 4F7UB 5KCOA 2FL7A 1IRXA 2KRMA 4PL6A 5GAMd 4HXJA 2H8HA 4PLLA 3V8KA 2DETA 4HT8A 3X24B 2MIOA 1Z9QA 5CCAA 2QQRA 3CBMA 4M75D 4IIMA 3KFVA 1X6GA 2HL5C 1KQSS 4ZGDB 4J7IA 3J80E 2NUPB 5HK0A 4FCYA 1W2BP 3CCMT 2CSQA 2JS0A 3I35A 2GFUA 4OGCA 1GCQC 3A8LB 4RTUA 4M7AD 4J9BA 2QEXT 3KBGA 1OV3A 4KULA 3EGDA 2RJDA 5EC7A 2CH4W 3JSCA 1Q7YC 4HCBA 2X4JA 1VQ4A 4RTWA 2GCXA 3VYGA 5GAOr 4N4IA 4OMLA 2X35A 3JCMb 3R6OA 3TVTA 2EYXA 1MHNA 4FT2A 3CBPA 2RQWA 5GANe 2CUDA 3CXCA 5GAMg 4FYWB 1YP5A 5CAIA 1ZSZB 2O31A 5GAN2 5LJ3e 5GMKi 2JTFA 4B9XA 2XI9A 3O5ZA 9ATCB 2FRYA 3OYIA 5GANg 2DD4A 3PVLA 3J81E 4HVWA 2RI5A 1Y7XA 1TSFA 1SHFA 4OMOA 1V29B 2ZPIB 2LCSA 2DTHA 2K2VA 3PE0A 2MWPA 5D6YA 3C4SA 4M7DA 3L2QA 2LT4A 1Y71A 3HTRA 3BW1A 4M78B 1GXIE 1GCPA 2CKKA 3SFMA 3EFRA 5FROA 2O4XB 5LJ5g 1W2BS 2VYTA 4B6MA 3GNFB 3QZ9B 3F70A 1UGVA 2OTLQ 1VQLQ 1N5ZA 4MDXA 4AFSC 5GAN6 1QVFP 2E12A 1YWOA 3CCRQ 5GMKl 1TTHB 3LW5E 2L3QA 1QVFA 5LJ3d 2OAWA 5IAYA 5CKBA 1B34B 5KYXA 1WJQA 1G8XA 2K9GA 1BI0A 4PJOC 2L3SA 2E6NA 1RLQC 1M8MA 2DO3A 2ZPBB 1SRMA 2LNVA 3CCUT 4IUUA 1J3TA 1IO6A 2QYZA 1RAFB 5FWBA 1M1KC 2YT6A 1G3YA 1AWOA 1VQ8A 5DLOA 2JT4A 4L6V5 4PJNA 2BTTA 3JRZA 2E65A 4EDUA 7AT1B 5D7UA 3CCQT 3MHXA 1S72T 3CXCP 4JLIA 2YLCA 4CC2A 3EG9B 1D1AA 3LWHA 2JTEA 1WDXA 3M0RA 3SHWA 3UDCA 2HAXA 2DL8A 4LE9A 1K9MR 3V7SA 2MOXA 3EGXA 4DBRA 3OA6A 3M55A 2WSEE 3OYJA 1VA7A 5GMKe 2I2LA 4C0DC 3QO3A 3CPFA 2EJFA 3FIFA 2VV5A 1YJ9A 1RI0A 3VS3A 2E3IA 1RACB 2X4XA 2C06A 2YWWA 2QA4Q 1VYTA 3OYKA 1FMKA 2DM1A 1VQMQ 3FC3A 1N9SA 1U1SA 4M78G 3CC2T 2KT8A 4M77G 2EQIA 2A08A 1M1KR 2HBPA 4PJOB 3QYGB 1KC8R 4A4KA 1YHQQ 3NHNA 2EQMA 1VQ5Q 4KGZB 4E7IA 3M5AA 1GL5A 4HT9A 4Z88A 4ZN1A 3CCRA 4JRPA 2F5TX 4QVCA 2KSSA 5GJWB 2CZ6B 3CCMQ 5LJ5f 2MWOA 2ZZDA 1YJNT 2YRDA 3RDVA 3REAB 2LJ1A 3G6EQ 1AWWA 2P0KA 3OYYA 5I11A 1NEGA 1HXDA 1VYUA 1KD1R 1M3CA 3RNJA 4M7DD 3EAEA 4O6JA 3CPWS 2RQUA 3H8ZA 2AZVA 4KBMB 1K9MC 4F17A 4RG8A 4BY6C 4EIKA 2QQBA 2VGMA 1W70A 2DKGA 2DMOA 2VGNA 5CVIA 3ZL7C 4F7UG 2NYSA 4OMMA 3JCMW 1QCFA 4D8DA 4QT7A 2K7AA 1AHJB 1SKUB 2QQ9A 3SEMA 2J6FA 2KY9A 1BIAA 1VQ7T 4NL3A 1UEBA 2BE9B 1EZZB 1M90C 4ZGJB 5GAN3 1YFNA 3PFSA 1TXQA 3E1SA 2A3LA 2KBTA 1YN8A 3S3MA 5FU6C 4RTVA 1TG0A 1ZBXA 3TSZA 3MP8A 1WXUA 1ZUKA 2EPDA 1VQ6T 3OW2S 2GQIA 1UB4A 4XQ3A 1ACMB 4JDSA 1VQ4Q 2L2PA 2A37A 2E6ZA 3VYHB 4J9EA 3JB9D 1QMCA 1NZ9A 1QCOA 3DLLA 2EKOA 2J05A 4XTWA 5KE2A 4NS5A 4QVDA 2MCNA 4LDYA 2VXEA 4RCBA 1JJ2A 4OMFB 3OSVA 1QKXA 3BE3A 3CC4T 1B07A 4PJOF 5GAOl 1RLPC 2M51A 3JCMX 4PJMA 2JS2A 1NE8A 1GFDA 3HSBA 5GAMf 1UUEA 5I2MA 1W1FA 4M77E 1X2KA 4ORZA 3QHSA 4BE0A 2O9SA 1I1JA 4PK4A 3HP9A 4JJCA 2HL3A 4M75B 4DBQA 1KK7A 1PKSA 3M58A 4A53A 2ATCB 5DM7R 2DA9A 1HSQA 3CQTA 2CP0A 1JB0E 3ASKA 2KXCA 1CKBA 2RNAA 5J26A 4A4FA 3VS7A 3RERA 5HKCA 1X75C 3ZEHA 2X3XD 3FLGA 4M77A 1K8AU 4M7AB 2EW3A 3P8HA 5GAOq 2RB6A 3OSSC 3TU4K 3JB9I 2NUTB 1MNEA 5I2SA 2DD5A 1TH7A 5J39A 4AFZC 2DRMA 1EFNA 2X3WD 1VIFA 3WXMB 3OB9A 2L89A 1K4US 1VYVA 5CKHA 2GFAA 3LGLA 3OYDA 4OB3B 4RTZA 1BU1A 1Y96B 2DIQA 3JCMP 2X9HA 2DILA 2DXCA 3QDFA 3I55T 2L8DA 3VS6A 3MCAB 2RA2A 1N6AA 2MMPA 2J6KA 4EPCA 2ESWA 3H6ZA 4D8KA 2RHZA 3JCMe 1VIEA 2K4YA 4PJLA 3OBWA 2EYZA 2JNGA 4UC4A 2HMAA 2PTKA 4BY6B 1QVGA 2M0OA 1LPLA 1QWFA 2FYKA 1D0XA 4E7JA 2LDMA 2M1HA 3WVEB 1OI1A 1YJNA 3VS0A 2GQVA 3I56A 1K9AA 5CKEA 2EAYA 2J6OA 5GAMe 2COYA 1GCQA 1VQ8Q 2R5AA 2JW4A 1MNDA 2LX7A 3V8JA 1JQQA 4XU1A 3QBYA 1UGPB 1ARKA 4AMCA 2RJEA 1OX8A 1KHIA 1T0JA 5GANj 1NG2A 1KG1A 4JZ4A 4QQGA 1VQLT 5FU7B 3C0CA 3LYIA 4J9GA 1M5Q1 2HD0A 4F7UA 4XU2A 4N4GA 1AWJA 2YUQA 4ANJA 3LGFA 4Z8AA 1H92A 1JJ2P 2C0OA 5LJ3j 2EYYA 2PUKB 1M9SA 2KYMA 2E10A 2KDSA 4KH1B 3TQ7P 2R58A 1Q82R 1M2OA 2HSPA 4C5GA 4AG2C 1MV0B 2W10A 3X26B 5KCHA 1CKAA 2BZXA 3I5RA 3QJYA 1VQNT 1UFFA 2KEAA 1M1FA 5GMKh 1ZUYA 1FXXA 3MEWA 3QIIA 5FRNA 4FW2A 4Y28E 1VQMT 4CC7A 3EGDB 2RM4A 1QVPA 5HCKA 2E3HA 4DA4A 4GLMA 1D1CA 5LJ5e 1O75A 2R57A 2A28A 3CC7T 2QK0A 1WZOA 4LDXA 4BACA 1Z9ZA 1IXDA 3EH1A 1VQPA 3E19A 1ZSZA 2A0FB 1KSWA 5AYFA 1HJDA 2Y4XA 4XTVA 1M1GA 2YUPA 4R56A 1QQJA 3CCJT 2MPXC 1UTIA 3MP6A 2FO0A 1WJRA 3CD6T 4EMKA 2XMFA 4M77F 2FZCB 1K73R
chains in the Genus database with same CATH topology
1J3TA 1IO6A 2CT4A 2EGAA 1WXTA 2SRCA 2F2VA 5FWBA 1K76A 3REBB 2YT6A 3EHQA 1WFWA 4A63B 1AWOA 2DL3A 1XOVA 2JT4A 2K79A 2KRSA 4M4ZA 2BTTA 2GGRA 4CC2A 3NGPA 3IQLA 2JTEA 3GBQA 2DYBA 2RPNA 2OJ2A 1WDXA 2JMAA 1OOTA 3M0RA 3SHWA 5IXBA 2ROTA 1SHGA 2JM8A 2DL8A 1AZGB 4LE9A 3M0TA 2BZ8A 2KR3A 2MOXA 3H0IA 2QDLA 2V1RA 1PWTA 2LJ0A 4JJDA 4J9DA 1VA7A 2W0ZA 4KRTA 4J9CA 1ZBJA 2D0NA 3VS3A 3THKA 2FPDA 2HCKA 3QWXX 3EG2A 1BB9A 1WA7A 1NYFA 1WIEA 2RMOA 1VYTA 1U3OA 1FMKA 2DM1A 4J9IA 1M3BA 5IHKA 2KT8A 1T0HA 3M0QA 1AZEA 2EQIA 2A08A 4CC4B 2LNHB 2J06A 3NHNA 2ABLA 2C0TA 2CSIA 4LNPA 3I9QA 1I07A 1NEBA 1JO8A 1GL5A 1ZLMA 1PHTA 4Z88A 4AFUC 2CH4A 3I5SA 1K0SA 1UJYA 3R6NA 1NM7A 2O9VA 1BBZA 5GJWB 4OMNA 2PZ1A 4IIOA 2AKKA 4LN2A 1ZX6A 3REAB 1KFZA 2LJ1A 5IHIA 1AWWA 2AZSA 1S1NA 5GJVB 1UDLA 1TUDA 3VRZA 1E6GA 2DLPA 3NMZC 2DJQA 1A0NB 5I11A 1NEGA 1VYUA 3M0SA 1M3CA 3RNJA 1RI9A 1X2QA 2RQUA 1NLPC 3RBBB 1G83A 2AZVA 1X43A 4F17A 4EIKA 4DEYA 3U23A 1W70A 2DMOA 3ZL7C 4OMMA 2EGCA 3EG0A 1JXOA 1QCFA 4F16A 1WLPB 4D8DA 2DF6A 4QT7A 1WYXA 2K7AA 1TUCA 2YDLA 2DL4A 3SEMA 2J6FA 1WI7A 4E6RA 1KIKA 1M3AA 2NUZA 2K3BA 1LCKA 3EGUA 1T3SA 3VRYA 2ED1A 1H8KA 2F2XA 1JU5C 4OMPA 4ZNXA 2KBTA 1I0CA 4RTYA 1YN8A 1X69A 2D8JA 3FJ5A 5IXFA 1SPKA 2DL7A 4RTVA 5FWCA 1TG0A 1UECA 2L3PA 2LP5A 5IHNA 1NLOC 3TSZA 2FG0A 1WXUA 2HDAA 1AEYA 1ZUKA 2EPDA 2GQIA 2L2PA 2CUBA 2A37A 4Z89A 1YCSB 1NYGA 4J9EA 4LUDA 2A36A 3H41A 4AFQC 3TSWA 1YWPA 1AVZC 1U06A 2J05A 4JJBA 2MCNA 2EBPA 4RTTA 3H0HA 1QKXA 1MV3A 3VS1A 1B07A 2D8HA 2HBWA 2JXBA 1SSHA 2LMJA 1RLPC 2RQRA 2M51A 2LJ3A 2JS2A 1KJWA 3UA6A 2RQVA 2NWMA 1GFDA 2KRNA 1UUEA 1W1FA 2M0YA 3VS4A 1X2KA 4ORZA 1PRMC 2O9SA 1I1JA 4HCKA 4JJCA 4J9FA 1AOJA 1PKSA 1E7OA 2DL5A 2DX1A 2DA9A 4WCIA 1HSQA 1E6HA 1JXMA 5IH2A 3CQTA 2EGEA 2KROA 1RUWA 2KXCA 1CKBA 1FYNA 2OI3A 2RNAA 3VS7A 1X27A 2DVJA 3ULRB 2X3XD 2V1QA 2EW3A 1K0XA 1QLYA 1G2BA 2DNUA 3UA7A 2GNCA 2P4RA 1UJ0A 4LUEA 1QKWA 2DE0X 1AD5A 3M0UA 2FPEA 2EVRA 2LQNA 2YUOA 2B86A 1GFCA 2CREA 1Y57A 1B3QA 4F14A 2RN8A 4AFZC 2DRMA 1EFNA 2X3WD 2JM9A 2LZ6B 4R0KA 1K4US 2IIMA 1VYVA 2HEQA 2ENMA 1OPKA 4RTZA 1BU1A 4JPBW 5L23A 1UHFA 1V1CA 1PNJA 2DILA 4FSSA 1UE9A 2LQWA 3JV3A 4CC3A 4DEXA 2KT1A 1ABOA 3VS6A 1H3HA 2KE9A 1PRLC 2F2WA 2L0AA 2I0NA 5I22A 2FRWA 3M0PA 2J6KA 2ESWA 2ROLA 1W6XA 4X1VA 4D8KA 1YNZA 2KRMA 3EG3A 4HXJA 3UATA 2H8HA 2VVKA 2CDTA 2EYZA 2YSQA 2MIOA 1Z9QA 1JEGA 3A98A 2PTKA 2EYWA 1U5SA 1QWFA 4HVUA 4IIMA 1PKTA 3KFVA 1X6GA 2AKLA 3VS0A 1UG1A 4K11A 2KGTA 1K9AA 1GRIA 3VS5A 2K2MA 2J6OA 3EG1A 2YUNA 4OMQA 4HVVA 1GCQA 2CSQA 2JS0A 2JW4A 2LX7A 3NPFA 3I35A 1CSKA 1GCQC 1M27C 4RTUA 4J9BA 1JQQA 1OV3A 2RQTA 1UHCA 3H0FA 4RUGA 1ARKA 2O88A 1GBQA 2J7IA 2VWFA 4RTXA 2CH4W 5EC7A 4AG1C 4RTWA 2K6DA 1T0JA 4OMLA 2VKNA 1OPLA 3EHRA 1Y0MA 3TVTA 1NG2A 2EYXA 4JZ4A 1ZSGA 1BK2A 2RQWA 2CUDA 3QWYA 3C0CA 1YP5A 4J9GA 2O31A 2GBQA 1AWJA 2KNBB 2KXDA 2DBKA 3O5ZA 2FEIA 2CT3A 1K1ZA 2FRYA 4JZ3A 4Y92A 2YUQA 1GBRA 4Z8AA 1MUZA 1H92A 2C0OA 3PVLA 2EYYA 4HVWA 1SRLA 2RF0A 2D1XA 1SHFA 2KYMA 4OMOA 1AWXA 2ECZA 2JMCA 2HSPA 4AG2C 1MV0B 1M30A 2W10A 1CKAA 1WX6A 2BZXA 2G6FX 3I5RA 2LCSA 2SEMA 1UFFA 3PE0A 2KEAA 2PNIA 1ZUYA 1X6BA 2FPFA 3UF4A 2O2OA 5ECAA 3VS2A 2AK5A 2EKHA 2GTJA 1GCPA 4CC7A 1OEBA 2BZYA 2GTOA 1WXBA 5HCKA 4GLMA 2A28A 4ESRA 4GBQA 1UGVA 3PVQA 1N5ZA 1SEMA 3LH5A 5FW9A 1Z9ZA 2DRKA 4AFSC 2ED0A 2C0IA 1YWOA 1KSWA 2E5KA 1T3LA 1HD3A 2L3QA 4J9HA 1HJDA 2DBMA 1ZUUA 1QWEA 2OAWA 2YUPA 2K9GA 2L3SA 1UTIA 2KYBA 2FO0A 1RLQC 1M8MA 2XMFA 1SRMA 1ABQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J3T A;  1IO6 A;  2CT4 A;  2EGA A;  1WXT A;  2SRC A;  2F2V A;  5FWB A;  1K76 A;  3REB B;  2YT6 A;  3EHQ A;  1WFW A;  4A63 B;  1AWO A;  2DL3 A;  1XOV A;  2JT4 A;  2K79 A;  2KRS A;  4M4Z A;  2BTT A;  2GGR A;  4CC2 A;  3NGP A;  3IQL A;  2JTE A;  3GBQ A;  2DYB A;  2RPN A;  2OJ2 A;  1WDX A;  2JMA A;  1OOT A;  3M0R A;  3SHW A;  5IXB A;  2ROT A;  1SHG A;  2JM8 A;  2DL8 A;  1AZG B;  4LE9 A;  3M0T A;  2BZ8 A;  2KR3 A;  2MOX A;  3H0I A;  2QDL A;  2V1R A;  1PWT A;  2LJ0 A;  4JJD A;  4J9D A;  1VA7 A;  2W0Z A;  4KRT A;  4J9C A;  1ZBJ A;  2D0N A;  3VS3 A;  3THK A;  2FPD A;  2HCK A;  3QWX X;  3EG2 A;  1BB9 A;  1WA7 A;  1NYF A;  1WIE A;  2RMO A;  1VYT A;  1U3O A;  1FMK A;  2DM1 A;  4J9I A;  1M3B A;  5IHK A;  2KT8 A;  1T0H A;  3M0Q A;  1AZE A;  2EQI A;  2A08 A;  4CC4 B;  2LNH B;  2J06 A;  3NHN A;  2ABL A;  2C0T A;  2CSI A;  4LNP A;  3I9Q A;  1I07 A;  1NEB A;  1JO8 A;  1GL5 A;  1ZLM A;  1PHT A;  4Z88 A;  4AFU C;  2CH4 A;  3I5S A;  1K0S A;  1UJY A;  3R6N A;  1NM7 A;  2O9V A;  1BBZ A;  5GJW B;  4OMN A;  2PZ1 A;  4IIO A;  2AKK A;  4LN2 A;  1ZX6 A;  3REA B;  1KFZ A;  2LJ1 A;  5IHI A;  1AWW A;  2AZS A;  1S1N A;  5GJV B;  1UDL A;  1TUD A;  3VRZ A;  1E6G A;  2DLP A;  3NMZ C;  2DJQ A;  1A0N B;  5I11 A;  1NEG A;  1VYU A;  3M0S A;  1M3C A;  3RNJ A;  1RI9 A;  1X2Q A;  2RQU A;  1NLP C;  3RBB B;  1G83 A;  2AZV A;  1X43 A;  4F17 A;  4EIK A;  4DEY A;  3U23 A;  1W70 A;  2DMO A;  3ZL7 C;  4OMM A;  2EGC A;  3EG0 A;  1JXO A;  1QCF A;  4F16 A;  1WLP B;  4D8D A;  2DF6 A;  4QT7 A;  1WYX A;  2K7A A;  1TUC A;  2YDL A;  2DL4 A;  3SEM A;  2J6F A;  1WI7 A;  4E6R A;  1KIK A;  1M3A A;  2NUZ A;  2K3B A;  1LCK A;  3EGU A;  1T3S A;  3VRY A;  2ED1 A;  1H8K A;  2F2X A;  1JU5 C;  4OMP A;  4ZNX A;  2KBT A;  1I0C A;  4RTY A;  1YN8 A;  1X69 A;  2D8J A;  3FJ5 A;  5IXF A;  1SPK A;  2DL7 A;  4RTV A;  5FWC A;  1TG0 A;  1UEC A;  2L3P A;  2LP5 A;  5IHN A;  1NLO C;  3TSZ A;  2FG0 A;  1WXU A;  2HDA A;  1AEY A;  1ZUK A;  2EPD A;  2GQI A;  2L2P A;  2CUB A;  2A37 A;  4Z89 A;  1YCS B;  1NYG A;  4J9E A;  4LUD A;  2A36 A;  3H41 A;  4AFQ C;  3TSW A;  1YWP A;  1AVZ C;  1U06 A;  2J05 A;  4JJB A;  2MCN A;  2EBP A;  4RTT A;  3H0H A;  1QKX A;  1MV3 A;  3VS1 A;  1B07 A;  2D8H A;  2HBW A;  2JXB A;  1SSH A;  2LMJ A;  1RLP C;  2RQR A;  2M51 A;  2LJ3 A;  2JS2 A;  1KJW A;  3UA6 A;  2RQV A;  2NWM A;  1GFD A;  2KRN A;  1UUE A;  1W1F A;  2M0Y A;  3VS4 A;  1X2K A;  4ORZ A;  1PRM C;  2O9S A;  1I1J A;  4HCK A;  4JJC A;  4J9F A;  1AOJ A;  1PKS A;  1E7O A;  2DL5 A;  2DX1 A;  2DA9 A;  4WCI A;  1HSQ A;  1E6H A;  1JXM A;  5IH2 A;  3CQT A;  2EGE A;  2KRO A;  1RUW A;  2KXC A;  1CKB A;  1FYN A;  2OI3 A;  2RNA A;  3VS7 A;  1X27 A;  2DVJ A;  3ULR B;  2X3X D;  2V1Q A;  2EW3 A;  1K0X A;  1QLY A;  1G2B A;  2DNU A;  3UA7 A;  2GNC A;  2P4R A;  1UJ0 A;  4LUE A;  1QKW A;  2DE0 X;  1AD5 A;  3M0U A;  2FPE A;  2EVR A;  2LQN A;  2YUO A;  2B86 A;  1GFC A;  2CRE A;  1Y57 A;  1B3Q A;  4F14 A;  2RN8 A;  4AFZ C;  2DRM A;  1EFN A;  2X3W D;  2JM9 A;  2LZ6 B;  4R0K A;  1K4U S;  2IIM A;  1VYV A;  2HEQ A;  2ENM A;  1OPK A;  4RTZ A;  1BU1 A;  4JPB W;  5L23 A;  1UHF A;  1V1C A;  1PNJ A;  2DIL A;  4FSS A;  1UE9 A;  2LQW A;  3JV3 A;  4CC3 A;  4DEX A;  2KT1 A;  1ABO A;  3VS6 A;  1H3H A;  2KE9 A;  1PRL C;  2F2W A;  2L0A A;  2I0N A;  5I22 A;  2FRW A;  3M0P A;  2J6K A;  2ESW A;  2ROL A;  1W6X A;  4X1V A;  4D8K A;  1YNZ A;  2KRM A;  3EG3 A;  4HXJ A;  3UAT A;  2H8H A;  2VVK A;  2CDT A;  2EYZ A;  2YSQ A;  2MIO A;  1Z9Q A;  1JEG A;  3A98 A;  2PTK A;  2EYW A;  1U5S A;  1QWF A;  4HVU A;  4IIM A;  1PKT A;  3KFV A;  1X6G A;  2AKL A;  3VS0 A;  1UG1 A;  4K11 A;  2KGT A;  1K9A A;  1GRI A;  3VS5 A;  2K2M A;  2J6O A;  3EG1 A;  2YUN A;  4OMQ A;  4HVV A;  1GCQ A;  2CSQ A;  2JS0 A;  2JW4 A;  2LX7 A;  3NPF A;  3I35 A;  1CSK A;  1GCQ C;  1M27 C;  4RTU A;  4J9B A;  1JQQ A;  1OV3 A;  2RQT A;  1UHC A;  3H0F A;  4RUG A;  1ARK A;  2O88 A;  1GBQ A;  2J7I A;  2VWF A;  4RTX A;  2CH4 W;  5EC7 A;  4AG1 C;  4RTW A;  2K6D A;  1T0J A;  4OML A;  2VKN A;  1OPL A;  3EHR A;  1Y0M A;  3TVT A;  1NG2 A;  2EYX A;  4JZ4 A;  1ZSG A;  1BK2 A;  2RQW A;  2CUD A;  3QWY A;  3C0C A;  1YP5 A;  4J9G A;  2O31 A;  2GBQ A;  1AWJ A;  2KNB B;  2KXD A;  2DBK A;  3O5Z A;  2FEI A;  2CT3 A;  1K1Z A;  2FRY A;  4JZ3 A;  4Y92 A;  2YUQ A;  1GBR A;  4Z8A A;  1MUZ A;  1H92 A;  2C0O A;  3PVL A;  2EYY A;  4HVW A;  1SRL A;  2RF0 A;  2D1X A;  1SHF A;  2KYM A;  4OMO A;  1AWX A;  2ECZ A;  2JMC A;  2HSP A;  4AG2 C;  1MV0 B;  1M30 A;  2W10 A;  1CKA A;  1WX6 A;  2BZX A;  2G6F X;  3I5R A;  2LCS A;  2SEM A;  1UFF A;  3PE0 A;  2KEA A;  2PNI A;  1ZUY A;  1X6B A;  2FPF A;  3UF4 A;  2O2O A;  5ECA A;  3VS2 A;  2AK5 A;  2EKH A;  2GTJ A;  1GCP A;  4CC7 A;  1OEB A;  2BZY A;  2GTO A;  1WXB A;  5HCK A;  4GLM A;  2A28 A;  4ESR A;  4GBQ A;  1UGV A;  3PVQ A;  1N5Z A;  1SEM A;  3LH5 A;  5FW9 A;  1Z9Z A;  2DRK A;  4AFS C;  2ED0 A;  2C0I A;  1YWO A;  1KSW A;  2E5K A;  1T3L A;  1HD3 A;  2L3Q A;  4J9H A;  1HJD A;  2DBM A;  1ZUU A;  1QWE A;  2OAW A;  2YUP A;  2K9G A;  2L3S A;  1UTI A;  2KYB A;  2FO0 A;  1RLQ C;  1M8M A;  2XMF A;  1SRM A;  1ABQ A; 
#chains in the Genus database with same CATH topology
 4JRI A;  1D3B B;  2CT4 A;  1PG5 B;  1BYM A;  1OU8 A;  1RAG B;  1VQ9 A;  1TOV A;  2K3Y A;  1WFW A;  2FZK B;  2K79 A;  2HZY A;  2KRS A;  1TU0 B;  2LX9 A;  3NTI A;  3QYH B;  1RAH B;  4C8Q E;  5KYY B;  3L2R A;  3OMG A;  4BDY A;  2DYB A;  3SWN C;  2RPN A;  4ATO A;  1FX7 A;  2OJ2 A;  4OB1 B;  2L5Q A;  3X20 B;  4ZN3 A;  2QI2 A;  2ROT A;  2JM8 A;  3AT1 B;  4XU0 A;  4MMK A;  4C92 E;  3M0T A;  1NPR A;  2CP5 A;  5GMK j;  2MI6 A;  3H0I A;  1SF9 A;  4RMO A;  1KQS P;  3G4S A;  2OTL T;  4PJO D;  4C92 C;  1VQM A;  4IUQ A;  2ZPE B;  3CMA T;  4KRT A;  1LOJ A;  3CCS A;  2D0N A;  1G3W A;  4A54 A;  4BI8 B;  3TCJ A;  2K57 A;  1NJI C;  3QWX X;  3EG2 A;  1KD1 U;  1WQW A;  1WA7 A;  2RMO A;  3HRS A;  4F7U F;  1U3O A;  4M75 C;  5KYX B;  3M0Q A;  2YRC A;  1VQ4 T;  1X6O A;  2QAZ A;  3OYC A;  4JS4 A;  2J06 A;  2CSI A;  2HQE A;  1NEB A;  1JO8 A;  2XHC A;  1ZLM A;  3JCM J;  1PHT A;  3M59 A;  4FYV B;  3CME Q;  4AT1 B;  1Q81 R;  5GAN h;  2CH4 A;  2PUO B;  1K0S A;  2FVU A;  4RG2 A;  4OMN A;  1VQO Q;  1F1B B;  4Q5W A;  3A8M B;  2AKK A;  5CIU A;  4LN2 A;  2DEQ A;  2E64 A;  3L1A A;  1KFZ A;  1WHL A;  4E47 A;  3A5Z B;  2AZS A;  1UDL A;  5CK9 A;  3FEO A;  1E6G A;  3CCU Q;  3SD4 A;  1XQH A;  3S3N A;  3M0S A;  1X43 A;  4ELY C;  4BE2 A;  5DY9 A;  1PM3 A;  3EG0 A;  1JXO A;  4PLI A;  2WAC A;  2DF6 A;  5LJ3 f;  3CCE T;  1TUC A;  1D1B A;  2DL4 A;  5A0G A;  5KE3 A;  3MET A;  2EQK A;  3DKM A;  2F69 A;  1V76 A;  4E7Z A;  2OTJ T;  2K3B A;  4PJO G;  4IKF A;  1M90 U;  1TUG B;  1T3S A;  2MF2 A;  2Z0W A;  2F2X A;  1JU5 C;  2RD1 A;  4OMP A;  1Q86 U;  4GLK A;  2K3X A;  1X69 A;  5GAN f;  2JOY A;  3CCE A;  2XDP A;  1BIB A;  3ZBD A;  2DL7 A;  2DZ9 A;  2X4W A;  5FU7 C;  2A7Y A;  2BKD N;  1YI2 Q;  2YLB A;  1YCS B;  4LUD A;  4LDW A;  5GAN 8;  3UT1 A;  4AFQ C;  2QXF A;  3P8D A;  2G3R A;  4KGV B;  2EBP A;  1Q86 R;  1KQ2 A;  4MZT A;  4RTT A;  3RIR A;  3HKS A;  1I81 A;  4PKC C;  1MV3 A;  5LJ3 h;  2V8J A;  1IGQ A;  3QJ6 A;  3CXC S;  4QQD A;  3OMC A;  1YJN Q;  2HBW A;  2V8I A;  3CCJ Q;  4NL2 A;  1SSH A;  2L3R A;  2RQR A;  4C92 G;  3OS2 A;  1VQ5 A;  5GAN 5;  3V7C A;  1KJW A;  3UA6 A;  4C92 D;  2JJ9 A;  2NWM A;  1YJW A;  2KRN A;  3OYM A;  3HHT B;  1QVG P;  5A0L A;  4E7S A;  3RUX A;  3CCQ A;  3PT9 A;  4PNO A;  2YXY A;  4IUT A;  3INZ A;  3QUI A;  1BI3 A;  1E7O A;  4WCI A;  1KC8 U;  1OZ3 A;  3JCM V;  1VQ8 T;  4J7F A;  1RUW A;  4XTU A;  1FYN A;  4M7D G;  2OI3 A;  3M56 A;  4C92 A;  5KH6 A;  4LDU A;  2YHT A;  1N9R A;  1KQS A;  3VUB A;  2QTV A;  3KXT A;  1QLY A;  1G2B A;  2GNC A;  2RO0 A;  3SWN A;  3UPU A;  1QKW A;  1M2V B;  4C8Q G;  4MDW A;  3M0U A;  3RKY A;  2FPE A;  1EX4 A;  1MGQ A;  4OB0 B;  2B86 A;  1GFC A;  2CRE A;  4QKU A;  5IN1 A;  1MMD A;  3G71 A;  1M1K U;  3X28 B;  4OB2 B;  4J5Y A;  2P0Q A;  5GAN 4;  5LJ5 h;  1VQ9 Q;  2ENM A;  4IUV A;  5LL6 S;  3UWN A;  3OYE A;  2COZ A;  4JPB W;  1UHF A;  1U1T A;  2LQW A;  3JV3 A;  2KT1 A;  1ABO A;  3LX7 A;  1PRL C;  2QA4 A;  3FRN A;  5I22 A;  1VQN Q;  2LQK A;  4F04 B;  2ROL A;  1W6X A;  4X1V A;  2OTL A;  3UAT A;  2HKQ B;  1JRI A;  3OS1 A;  3JCM h;  2CS7 A;  1JEG A;  3QG1 A;  2EYW A;  1U5S A;  4KUD K;  1O9S A;  4HVU A;  4JLG A;  3GPL A;  2DVE A;  2RJC A;  1RAB B;  3CC7 Q;  2NUT A;  1UG1 A;  2F5K A;  4K11 A;  1XNI A;  2KGT A;  1SSF A;  3EG1 A;  4OMQ A;  2AHJ B;  2RI3 A;  4HVV A;  3OW2 P;  2LQ8 A;  4OGE A;  1JBM A;  3NPF A;  1PC0 A;  1WNL A;  2IVW A;  1M4Z A;  3HL8 A;  3X25 B;  2JN0 A;  4KGX B;  3LWI A;  4RUG A;  1NPP A;  1GBQ A;  2V26 A;  4J6W A;  3CD6 A;  1IHV A;  2J7I A;  1YBY A;  4RTX A;  3RKW A;  4KUI A;  4AG1 C;  4BB7 A;  1Y96 A;  4M75 E;  3S3O A;  1YI2 T;  3SDZ A;  2K6D A;  2D0Q B;  4LDV A;  1OPL A;  2QEX A;  4JJN K;  1VQ5 T;  1ZA2 B;  3MKD A;  2BIV A;  1BKB A;  2GBQ A;  2KNB B;  2KXD A;  2KMT A;  4BDZ A;  2DBK A;  2FEI A;  2CT3 A;  1UGR B;  1VQL A;  4MZM A;  4XAX B;  1GBR A;  3BFM A;  1ZA1 B;  2D9T A;  2KQW A;  5I21 A;  1G3S A;  1SRL A;  2RF0 A;  2D1X A;  2JTM A;  2LC4 A;  3CD6 Q;  4BD3 A;  2K5I A;  3LH0 A;  4HCC A;  2P0P A;  2DYI A;  2ECZ A;  3L2V A;  2JMC A;  4II1 A;  4M78 D;  1WX6 A;  3OQ5 A;  1WGS A;  3CCS Q;  1VQK Q;  3V7R A;  2EFI A;  3EFO B;  2FPF A;  3UF4 A;  3QDR B;  2O2O A;  2M02 A;  1YJ9 T;  5ECA A;  4N0A C;  3VS2 A;  3I56 T;  2FHD A;  4EMG A;  1JJ2 S;  5LJ5 j;  3C94 A;  5KYW B;  5HY6 A;  1WXB A;  4XTY A;  4FT4 A;  4JRK A;  2CGH A;  4XTZ A;  1VQ7 Q;  4R55 A;  3L42 A;  4ESR A;  4GBQ A;  5LJ3 g;  2CP7 A;  4E2F B;  3PVQ A;  4IUP A;  3LH5 A;  1QP2 A;  3PIO A;  4C8Q B;  2DRK A;  2ED0 A;  2C0I A;  2ZGW A;  2LCL A;  1EIF A;  2XID A;  1HD3 A;  4J9H A;  2DBM A;  1ZUU A;  1QWE A;  2E41 A;  2KYB A;  2K5L A;  5LJ5 d;  3L2Z A;  3CCU A;  3KUF A;  1ABQ A;  3OYN A;  2PQW A;  4XK8 E;  2CP2 A;  1VOM A;  2F2V A;  1K76 A;  3REB B;  3EHQ A;  4A63 B;  3DB3 A;  2KK4 A;  2BUD A;  2P4T A;  4M4Z A;  3QSU A;  3GNG A;  4J8O A;  1D0Y A;  1NBE B;  3NGP A;  3IQL A;  2JZ2 A;  1IGU A;  4QVZ A;  4D6W A;  2DXB A;  2JMA A;  1I4K 1;  3QKJ A;  1SHG A;  3GIB A;  4L59 A;  1AZG B;  4XTX A;  2BZ8 A;  2COW A;  1YHQ T;  4C92 F;  2HSE B;  2V1R A;  2M9U A;  1PWT A;  4JJD A;  2XKO C;  3TRE A;  4J9C A;  1K73 C;  1K73 U;  1U8R A;  3DLM A;  3THK A;  2HCK A;  3OW2 A;  1NYF A;  3QPH A;  5CKF A;  5GAM h;  1R8O B;  4VUB A;  4TVR A;  4J9I A;  4YTL A;  1M3B A;  2E1H A;  1AZE A;  2EIF A;  4M7D F;  2CZ1 B;  3BDL A;  2LNH B;  2HNI A;  4EMK B;  5CO7 A;  2ABL A;  2C0T A;  3JB9 J;  3I9Q A;  1I07 A;  1WHM A;  1D3B A;  1WQ7 A;  3RMQ A;  3M53 A;  1QVG S;  2K5F A;  1OUL A;  2PVD B;  1K9M U;  3I5S A;  4M7D C;  1UJY A;  3R6N A;  1NM7 A;  5A0D A;  2O9V A;  2OAU A;  1BBZ A;  5KYY A;  4JUV A;  2PZ1 A;  4IIO A;  3OY9 A;  1P92 A;  5IHI A;  2QAS A;  1S1N A;  5GJV B;  3QXE B;  2MYS A;  2YRV A;  3T9N A;  3NMZ C;  2DLP A;  3O8V A;  2DJQ A;  2CZ7 B;  3SB2 A;  2DXT A;  3G6E T;  2RHI A;  1X2Q A;  3FB9 A;  2QTX A;  5DLQ E;  4DEY A;  3U23 A;  4C8Q D;  3MEU A;  2DEU A;  3CCS T;  4RKU E;  3CMA A;  3G71 T;  4M78 F;  1WYX A;  4ZGE B;  2YDL A;  1YIJ A;  2NUZ A;  3MJX A;  1MMG A;  3BY7 A;  2FB7 A;  4EMK C;  1N8R R;  3A8G B;  2ED1 A;  1H8K A;  4NOY A;  3JAM E;  4E7K A;  3URG A;  4PFO A;  2MAM A;  4ZNX A;  4FYY B;  4RTY A;  4C0G A;  4FYX B;  3FJ5 A;  4J6Y A;  1SPK A;  1PD0 A;  2L3P A;  5IHN A;  3L2U A;  2FG0 A;  2EQJ A;  1AEY A;  4C0D B;  1VQ6 Q;  1QW1 A;  5HK3 A;  5KYU B;  4DQ2 A;  5CQX A;  2CUB A;  4Z89 A;  2XU8 A;  3OS5 A;  2A36 A;  3H41 A;  1VQ6 A;  1YI2 A;  1YWP A;  3VUZ A;  1AVZ C;  1U06 A;  4M7A F;  4BE1 A;  2AT1 B;  4B9W A;  2RHY A;  4FSX A;  3E9F A;  3QZ5 B;  1B7T A;  3CCM A;  1ZQ1 A;  2XK0 A;  3VJP A;  4V2S A;  3H0H A;  2CP3 A;  2PU9 B;  1DJ7 B;  1BI2 A;  3CME A;  4MZP A;  1N8R U;  2JXB A;  3HFN A;  1X01 A;  4M75 F;  2LJ3 A;  1VQ7 A;  2RQV A;  1YIJ Q;  2M0Y A;  3JCM f;  2CP6 A;  3A1P A;  4HCK A;  3CC2 A;  2KVQ G;  1OZ2 A;  2VUB A;  1WHJ A;  1YIJ T;  2XG8 D;  2DL5 A;  1PD1 A;  2LVM A;  3H9N A;  1Q82 U;  1VQN A;  2XD0 A;  1WHG A;  1E6H A;  1JXM A;  4OVA A;  5IH2 A;  2E70 A;  2EGE A;  4C8Q C;  1YIT A;  4IUR A;  4A4H A;  2QGF B;  1KQ1 A;  1X27 A;  2DVJ A;  2QA4 T;  1YJW T;  4E7L A;  3RMS A;  4L5G A;  1K0X A;  3LLR A;  3NTK A;  2FZG B;  3G6E A;  2DNU A;  3EH2 A;  5FLX E;  1Q81 C;  2OTJ Q;  3S6W A;  1Q81 U;  1HK9 A;  1N8R C;  1UJ0 A;  4M78 C;  2VXF A;  2DE0 X;  2NUP A;  1AD5 A;  2VB6 A;  3G71 Q;  1RAE B;  2DFU A;  1VQO A;  1PCX A;  2YUO A;  3PGG A;  1BCO A;  4E7H A;  1KHC A;  2Y4Y A;  1B3Q A;  2RN8 A;  3JCM Q;  2JM9 A;  1C1A A;  3FDR A;  3CBO A;  2IIM A;  4FM4 B;  3WVD B;  2QEX Q;  3I55 A;  1OPK A;  1WPY A;  2ZPG B;  4DOV A;  3M54 A;  5L23 A;  1C6V X;  3CPW A;  4FSS A;  4GY5 A;  3I55 Q;  4X9D A;  2RI2 A;  3GP8 A;  1H3H A;  2KE9 A;  1D0Z A;  5AT1 B;  1YJ9 Q;  2OX7 A;  1RAA B;  2L0A A;  4O5V A;  2FRW A;  5CQY A;  1VQK T;  1ZSZ C;  1YNZ A;  3EG3 A;  3D7S B;  4C92 B;  2GF7 A;  3GF5 A;  1WHK A;  2CDT A;  2RJF A;  2VVK A;  2YSQ A;  3NFC A;  4HA8 A;  3A98 A;  4M7A C;  2OTJ A;  2B8A A;  1TS9 A;  1PKT A;  4PFZ A;  1RL2 A;  3SWN B;  2AKL A;  4QQ6 A;  1S72 A;  2EQU A;  1M2V A;  2DJZ A;  4KT0 E;  4FW1 A;  1GRI A;  3VS5 A;  2K2M A;  2YUN A;  3CMA Q;  4M7D B;  1CSK A;  1M27 C;  1R77 A;  4F7U E;  2IG0 A;  2RQT A;  1XJW B;  1FMV A;  1UHC A;  3H0F A;  2MK5 A;  4M78 A;  2O88 A;  4RCC A;  1RAD B;  2BE7 D;  2VWF A;  1LVK A;  1OX9 A;  3JCM c;  1FWZ A;  4M7A G;  2O4X A;  1MMA A;  3CME T;  2PVO B;  2VKN A;  3EHR A;  1Y0M A;  1Q95 G;  1I5O B;  3JB9 G;  1OYX A;  2RK1 A;  3M57 A;  1RAI B;  1ZSG A;  1BK2 A;  1NJI R;  3VV0 A;  1IZ6 A;  3HFO A;  3QWY A;  5GAM j;  1UGQ B;  4C5H A;  1M8V A;  3RKX A;  4A4E A;  4M78 E;  2LTO A;  4JZ3 A;  1K1Z A;  4Y92 A;  1VQO T;  1K8A R;  4FIB A;  1VQ9 T;  1B34 A;  4CRI A;  1MUZ A;  4OF1 A;  4A4G A;  3CEY A;  3ME9 A;  3GOX A;  2DK3 A;  2KI7 A;  1AWX A;  3TEE A;  6AT1 B;  3C95 A;  2RH2 A;  1AT1 B;  2QG9 B;  1M30 A;  2G6F X;  8AT1 B;  5D6X A;  4OP0 A;  2SEM A;  1VQK A;  2LT1 A;  4JRQ A;  5GMK m;  2PNI A;  3OYF A;  2DIG A;  4DBH A;  1X6B A;  1YIT T;  1Q86 C;  3JB9 H;  1S72 Q;  2ZPF B;  3CCQ Q;  3EG9 A;  2AK5 A;  4LD9 K;  2EKH A;  2GTJ A;  2QDY B;  4N4H A;  3CC7 A;  3MP1 A;  1OEB A;  1LNX A;  2BZY A;  1PSF A;  2GTO A;  3V8L A;  4QW2 A;  1YJW Q;  2F1L A;  3VU3 C;  3EGX B;  3N5B B;  1NJI U;  3MPU B;  1KD1 C;  2VAS A;  4C0F A;  2EYQ A;  4LXC A;  4ZTJ A;  4M7A E;  3CCL Q;  2V8K A;  1SEM A;  5FW9 A;  3HRT A;  5GAO n;  3JCM d;  3JCM g;  1UGS B;  2E5K A;  1T3L A;  1IHW A;  1N27 A;  1R0B G;  5FU6 B;  3C12 A;  2LRQ A;  5C0M A;  3PTA A;  2E5Q A;  4PJO A;  4ZTF A;  3CPW P;  3ER0 A;  2DZC A;  3OYL A;  3BDU A;  2EGA A;  3M4Y A;  1WXT A;  2SRC A;  1C0M A;  1Q7Y U;  1VQP T;  2DPP B;  2O01 E;  2CYZ B;  4Z02 A;  2DL3 A;  1XOV A;  4EMH A;  1Y07 A;  2GGR A;  3EFO A;  2H3J A;  3G7Z A;  5L8R E;  1KC8 C;  2IPO B;  3Q1J A;  3GBQ A;  1D09 B;  1R0C B;  5IXB A;  5KYW A;  1OOT A;  3MEV A;  3P8B B;  3M9Q A;  1QVF S;  2X4Y A;  2KR3 A;  3PNW C;  4PFP A;  2QDL A;  2JUF A;  3A8H B;  2LJ0 A;  4M75 G;  8ATC B;  4MML A;  3L2W A;  4J9D A;  1W4S A;  2W0Z A;  3RES A;  1ZBJ A;  1BCM A;  1XTD A;  2EJ9 A;  4X34 A;  4C8Q A;  3PMI A;  2DTO A;  2FPD A;  3OYA A;  1BB9 A;  1WIE A;  4ME7 A;  2XDB A;  1W2B A;  2R5M A;  1PSE A;  5IHK A;  1BI1 A;  4C5E A;  1T0H A;  3E2U A;  2DTI A;  4CC4 B;  3A8O B;  3JB9 F;  3DB4 A;  3HRU A;  1LJO A;  5D6W A;  4LNP A;  4WTO B;  4X9C A;  5M9O A;  3EFS A;  3CCJ A;  4AFU C;  5FRM A;  2JVV A;  3CCR T;  2ZPH B;  5C6S A;  3PMT A;  4XU3 A;  1IB8 A;  5GAO p;  3AHU A;  1OQK A;  3CC4 Q;  3MEA A;  2NLU A;  2ZAE A;  1ZX6 A;  2XIC A;  5IT9 E;  1I8F A;  2WSC E;  4JS5 A;  1VUB A;  1TUD A;  3VRZ A;  4M77 D;  2QGG A;  2WSF E;  1A0N B;  3CCV A;  1RI9 A;  1NLP C;  4HKE A;  3RBB B;  1G83 A;  2RHU A;  5GAN 7;  2XDD A;  1OU9 A;  2P84 A;  2EGC A;  4F16 A;  1WLP B;  3OYB A;  2DAQ A;  2HQX A;  2M16 A;  3CC2 Q;  1WI7 A;  4E6R A;  1KIK A;  5EG2 A;  1M3A A;  1WHH A;  3FJP A;  1LCK A;  2EWN A;  3EGU A;  2EJG A;  5CR2 A;  2HQH A;  3VRY A;  2H3E B;  3CCL T;  1M90 R;  4M75 A;  1I0C A;  4J83 A;  2D8J A;  5IXF A;  5FWC A;  1ZHI A;  1K8A C;  1UEC A;  2LP5 A;  1NLO C;  1TWB A;  2CZ0 B;  4J6X A;  2AIR B;  3ZFJ A;  1G5V A;  2HDA A;  5GAO m;  3VKI A;  5A2Q E;  2RK2 A;  4BI4 A;  4M77 B;  4M7A A;  2ZCF B;  1NYG A;  5CKD A;  4C5I A;  3TSW A;  3MO8 A;  4P5N A;  2VC8 A;  4JJB A;  3E9G A;  2QQS A;  1HYO A;  4ELZ C;  2QQA A;  3GLX A;  1FMW A;  4C8Q F;  1VQP Q;  2Y90 A;  3I56 Q;  3G1J A;  3VS1 A;  2D8H A;  4PJO E;  3M4G A;  2D6F A;  3CCL A;  2LMJ A;  1SG5 A;  3OS0 A;  4M7D E;  1YHQ A;  2HKN A;  2PVG B;  3VS4 A;  1WJS A;  5J3B A;  1PRM C;  1MMN A;  4J9F A;  1AOJ A;  4N0A A;  2DX1 A;  1QP3 A;  4WF2 A;  2KRO A;  3OYH A;  3G4S T;  2DXU A;  2DER A;  4KH0 B;  3RR6 A;  4BUG A;  1IRE B;  3CCV T;  3ULR B;  3G4S Q;  3CCV Q;  5KYU A;  2V1Q A;  4C0Z A;  4M77 C;  4BI3 A;  2X51 A;  3OYG A;  3UA7 A;  3HPW A;  1H3Z A;  3CC4 A;  1H64 1;  2P4R A;  4LUE A;  1Q82 C;  2KAF A;  2EVR A;  2LCC A;  2LQN A;  4FU6 A;  2RHX A;  1Y57 A;  4F14 A;  3OBY A;  3J7A F;  1G3T A;  2LZ6 B;  4DOW A;  4R0K A;  2HEQ A;  3NTH A;  4CI0 C;  4HCZ A;  4LD6 A;  4Y91 A;  3PIP A;  4PJJ A;  1V1C A;  1PNJ A;  1Q7Y R;  5KYN A;  1UE9 A;  4CC3 A;  4DBF A;  4DEX A;  4FL6 A;  1YCY A;  5GAN d;  1YIT Q;  1I5L A;  2F2W A;  2I0N A;  3M0P A;  2E4H A;  3CCE Q;  1QCN A;  4F7U B;  5KCO A;  2FL7 A;  1IRX A;  2KRM A;  4PL6 A;  5GAM d;  4HXJ A;  2H8H A;  4PLL A;  3V8K A;  2DET A;  4HT8 A;  3X24 B;  2MIO A;  1Z9Q A;  5CCA A;  2QQR A;  3CBM A;  4M75 D;  4IIM A;  3KFV A;  1X6G A;  2HL5 C;  1KQS S;  4ZGD B;  4J7I A;  3J80 E;  2NUP B;  5HK0 A;  4FCY A;  1W2B P;  3CCM T;  2CSQ A;  2JS0 A;  3I35 A;  2GFU A;  4OGC A;  1GCQ C;  3A8L B;  4RTU A;  4M7A D;  4J9B A;  2QEX T;  3KBG A;  1OV3 A;  4KUL A;  3EGD A;  2RJD A;  5EC7 A;  2CH4 W;  3JSC A;  1Q7Y C;  4HCB A;  2X4J A;  1VQ4 A;  4RTW A;  2GCX A;  3VYG A;  5GAO r;  4N4I A;  4OML A;  2X35 A;  3JCM b;  3R6O A;  3TVT A;  2EYX A;  1MHN A;  4FT2 A;  3CBP A;  2RQW A;  5GAN e;  2CUD A;  3CXC A;  5GAM g;  4FYW B;  1YP5 A;  5CAI A;  1ZSZ B;  2O31 A;  5GAN 2;  5LJ3 e;  5GMK i;  2JTF A;  4B9X A;  2XI9 A;  3O5Z A;  9ATC B;  2FRY A;  3OYI A;  5GAN g;  2DD4 A;  3PVL A;  3J81 E;  4HVW A;  2RI5 A;  1Y7X A;  1TSF A;  1SHF A;  4OMO A;  1V29 B;  2ZPI B;  2LCS A;  2DTH A;  2K2V A;  3PE0 A;  2MWP A;  5D6Y A;  3C4S A;  4M7D A;  3L2Q A;  2LT4 A;  1Y71 A;  3HTR A;  3BW1 A;  4M78 B;  1GXI E;  1GCP A;  2CKK A;  3SFM A;  3EFR A;  5FRO A;  2O4X B;  5LJ5 g;  1W2B S;  2VYT A;  4B6M A;  3GNF B;  3QZ9 B;  3F70 A;  1UGV A;  2OTL Q;  1VQL Q;  1N5Z A;  4MDX A;  4AFS C;  5GAN 6;  1QVF P;  2E12 A;  1YWO A;  3CCR Q;  5GMK l;  1TTH B;  3LW5 E;  2L3Q A;  1QVF A;  5LJ3 d;  2OAW A;  5IAY A;  5CKB A;  1B34 B;  5KYX A;  1WJQ A;  1G8X A;  2K9G A;  1BI0 A;  4PJO C;  2L3S A;  2E6N A;  1RLQ C;  1M8M A;  2DO3 A;  2ZPB B;  1SRM A;  2LNV A;  3CCU T;  4IUU A;  1J3T A;  1IO6 A;  2QYZ A;  1RAF B;  5FWB A;  1M1K C;  2YT6 A;  1G3Y A;  1AWO A;  1VQ8 A;  5DLO A;  2JT4 A;  4L6V 5;  4PJN A;  2BTT A;  3JRZ A;  2E65 A;  4EDU A;  7AT1 B;  5D7U A;  3CCQ T;  3MHX A;  1S72 T;  3CXC P;  4JLI A;  2YLC A;  4CC2 A;  3EG9 B;  1D1A A;  3LWH A;  2JTE A;  1WDX A;  3M0R A;  3SHW A;  3UDC A;  2HAX A;  2DL8 A;  4LE9 A;  1K9M R;  3V7S A;  2MOX A;  3EGX A;  4DBR A;  3OA6 A;  3M55 A;  2WSE E;  3OYJ A;  1VA7 A;  5GMK e;  2I2L A;  4C0D C;  3QO3 A;  3CPF A;  2EJF A;  3FIF A;  2VV5 A;  1YJ9 A;  1RI0 A;  3VS3 A;  2E3I A;  1RAC B;  2X4X A;  2C06 A;  2YWW A;  2QA4 Q;  1VYT A;  3OYK A;  1FMK A;  2DM1 A;  1VQM Q;  3FC3 A;  1N9S A;  1U1S A;  4M78 G;  3CC2 T;  2KT8 A;  4M77 G;  2EQI A;  2A08 A;  1M1K R;  2HBP A;  4PJO B;  3QYG B;  1KC8 R;  4A4K A;  1YHQ Q;  3NHN A;  2EQM A;  1VQ5 Q;  4KGZ B;  4E7I A;  3M5A A;  1GL5 A;  4HT9 A;  4Z88 A;  4ZN1 A;  3CCR A;  4JRP A;  2F5T X;  4QVC A;  2KSS A;  5GJW B;  2CZ6 B;  3CCM Q;  5LJ5 f;  2MWO A;  2ZZD A;  1YJN T;  2YRD A;  3RDV A;  3REA B;  2LJ1 A;  3G6E Q;  1AWW A;  2P0K A;  3OYY A;  5I11 A;  1NEG A;  1HXD A;  1VYU A;  1KD1 R;  1M3C A;  3RNJ A;  4M7D D;  3EAE A;  4O6J A;  3CPW S;  2RQU A;  3H8Z A;  2AZV A;  4KBM B;  1K9M C;  4F17 A;  4RG8 A;  4BY6 C;  4EIK A;  2QQB A;  2VGM A;  1W70 A;  2DKG A;  2DMO A;  2VGN A;  5CVI A;  3ZL7 C;  4F7U G;  2NYS A;  4OMM A;  3JCM W;  1QCF A;  4D8D A;  4QT7 A;  2K7A A;  1AHJ B;  1SKU B;  2QQ9 A;  3SEM A;  2J6F A;  2KY9 A;  1BIA A;  1VQ7 T;  4NL3 A;  1UEB A;  2BE9 B;  1EZZ B;  1M90 C;  4ZGJ B;  5GAN 3;  1YFN A;  3PFS A;  1TXQ A;  3E1S A;  2A3L A;  2KBT A;  1YN8 A;  3S3M A;  5FU6 C;  4RTV A;  1TG0 A;  1ZBX A;  3TSZ A;  3MP8 A;  1WXU A;  1ZUK A;  2EPD A;  1VQ6 T;  3OW2 S;  2GQI A;  1UB4 A;  4XQ3 A;  1ACM B;  4JDS A;  1VQ4 Q;  2L2P A;  2A37 A;  2E6Z A;  3VYH B;  4J9E A;  3JB9 D;  1QMC A;  1NZ9 A;  1QCO A;  3DLL A;  2EKO A;  2J05 A;  4XTW A;  5KE2 A;  4NS5 A;  4QVD A;  2MCN A;  4LDY A;  2VXE A;  4RCB A;  1JJ2 A;  4OMF B;  3OSV A;  1QKX A;  3BE3 A;  3CC4 T;  1B07 A;  4PJO F;  5GAO l;  1RLP C;  2M51 A;  3JCM X;  4PJM A;  2JS2 A;  1NE8 A;  1GFD A;  3HSB A;  5GAM f;  1UUE A;  5I2M A;  1W1F A;  4M77 E;  1X2K A;  4ORZ A;  3QHS A;  4BE0 A;  2O9S A;  1I1J A;  4PK4 A;  3HP9 A;  4JJC A;  2HL3 A;  4M75 B;  4DBQ A;  1KK7 A;  1PKS A;  3M58 A;  4A53 A;  2ATC B;  5DM7 R;  2DA9 A;  1HSQ A;  3CQT A;  2CP0 A;  1JB0 E;  3ASK A;  2KXC A;  1CKB A;  2RNA A;  5J26 A;  4A4F A;  3VS7 A;  3RER A;  5HKC A;  1X75 C;  3ZEH A;  2X3X D;  3FLG A;  4M77 A;  1K8A U;  4M7A B;  2EW3 A;  3P8H A;  5GAO q;  2RB6 A;  3OSS C;  3TU4 K;  3JB9 I;  2NUT B;  1MNE A;  5I2S A;  2DD5 A;  1TH7 A;  5J39 A;  4AFZ C;  2DRM A;  1EFN A;  2X3W D;  1VIF A;  3WXM B;  3OB9 A;  2L89 A;  1K4U S;  1VYV A;  5CKH A;  2GFA A;  3LGL A;  3OYD A;  4OB3 B;  4RTZ A;  1BU1 A;  1Y96 B;  2DIQ A;  3JCM P;  2X9H A;  2DIL A;  2DXC A;  3QDF A;  3I55 T;  2L8D A;  3VS6 A;  3MCA B;  2RA2 A;  1N6A A;  2MMP A;  2J6K A;  4EPC A;  2ESW A;  3H6Z A;  4D8K A;  2RHZ A;  3JCM e;  1VIE A;  2K4Y A;  4PJL A;  3OBW A;  2EYZ A;  2JNG A;  4UC4 A;  2HMA A;  2PTK A;  4BY6 B;  1QVG A;  2M0O A;  1LPL A;  1QWF A;  2FYK A;  1D0X A;  4E7J A;  2LDM A;  2M1H A;  3WVE B;  1OI1 A;  1YJN A;  3VS0 A;  2GQV A;  3I56 A;  1K9A A;  5CKE A;  2EAY A;  2J6O A;  5GAM e;  2COY A;  1GCQ A;  1VQ8 Q;  2R5A A;  2JW4 A;  1MND A;  2LX7 A;  3V8J A;  1JQQ A;  4XU1 A;  3QBY A;  1UGP B;  1ARK A;  4AMC A;  2RJE A;  1OX8 A;  1KHI A;  1T0J A;  5GAN j;  1NG2 A;  1KG1 A;  4JZ4 A;  4QQG A;  1VQL T;  5FU7 B;  3C0C A;  3LYI A;  4J9G A;  1M5Q 1;  2HD0 A;  4F7U A;  4XU2 A;  4N4G A;  1AWJ A;  2YUQ A;  4ANJ A;  3LGF A;  4Z8A A;  1H92 A;  1JJ2 P;  2C0O A;  5LJ3 j;  2EYY A;  2PUK B;  1M9S A;  2KYM A;  2E10 A;  2KDS A;  4KH1 B;  3TQ7 P;  2R58 A;  1Q82 R;  1M2O A;  2HSP A;  4C5G A;  4AG2 C;  1MV0 B;  2W10 A;  3X26 B;  5KCH A;  1CKA A;  2BZX A;  3I5R A;  3QJY A;  1VQN T;  1UFF A;  2KEA A;  1M1F A;  5GMK h;  1ZUY A;  1FXX A;  3MEW A;  3QII A;  5FRN A;  4FW2 A;  4Y28 E;  1VQM T;  4CC7 A;  3EGD B;  2RM4 A;  1QVP A;  5HCK A;  2E3H A;  4DA4 A;  4GLM A;  1D1C A;  5LJ5 e;  1O75 A;  2R57 A;  2A28 A;  3CC7 T;  2QK0 A;  1WZO A;  4LDX A;  4BAC A;  1Z9Z A;  1IXD A;  3EH1 A;  1VQP A;  3E19 A;  1ZSZ A;  2A0F B;  1KSW A;  5AYF A;  1HJD A;  2Y4X A;  4XTV A;  1M1G A;  2YUP A;  4R56 A;  1QQJ A;  3CCJ T;  2MPX C;  1UTI A;  3MP6 A;  2FO0 A;  1WJR A;  3CD6 T;  4EMK A;  2XMF A;  4M77 F;  2FZC B;  1K73 R; 
#chains in the Genus database with same CATH homology
 1J3T A;  1IO6 A;  2CT4 A;  2EGA A;  1WXT A;  2SRC A;  2F2V A;  5FWB A;  1K76 A;  3REB B;  2YT6 A;  3EHQ A;  1WFW A;  4A63 B;  1AWO A;  2DL3 A;  1XOV A;  2JT4 A;  2K79 A;  2KRS A;  4M4Z A;  2BTT A;  2GGR A;  4CC2 A;  3NGP A;  3IQL A;  2JTE A;  3GBQ A;  2DYB A;  2RPN A;  2OJ2 A;  1WDX A;  2JMA A;  1OOT A;  3M0R A;  3SHW A;  5IXB A;  2ROT A;  1SHG A;  2JM8 A;  2DL8 A;  1AZG B;  4LE9 A;  3M0T A;  2BZ8 A;  2KR3 A;  2MOX A;  3H0I A;  2QDL A;  2V1R A;  1PWT A;  2LJ0 A;  4JJD A;  4J9D A;  1VA7 A;  2W0Z A;  4KRT A;  4J9C A;  1ZBJ A;  2D0N A;  3VS3 A;  3THK A;  2FPD A;  2HCK A;  3QWX X;  3EG2 A;  1BB9 A;  1WA7 A;  1NYF A;  1WIE A;  2RMO A;  1VYT A;  1U3O A;  1FMK A;  2DM1 A;  4J9I A;  1M3B A;  5IHK A;  2KT8 A;  1T0H A;  3M0Q A;  1AZE A;  2EQI A;  2A08 A;  4CC4 B;  2LNH B;  2J06 A;  3NHN A;  2ABL A;  2C0T A;  2CSI A;  4LNP A;  3I9Q A;  1I07 A;  1NEB A;  1JO8 A;  1GL5 A;  1ZLM A;  1PHT A;  4Z88 A;  4AFU C;  2CH4 A;  3I5S A;  1K0S A;  1UJY A;  3R6N A;  1NM7 A;  2O9V A;  1BBZ A;  5GJW B;  4OMN A;  2PZ1 A;  4IIO A;  2AKK A;  4LN2 A;  1ZX6 A;  3REA B;  1KFZ A;  2LJ1 A;  5IHI A;  1AWW A;  2AZS A;  1S1N A;  5GJV B;  1UDL A;  1TUD A;  3VRZ A;  1E6G A;  2DLP A;  3NMZ C;  2DJQ A;  1A0N B;  5I11 A;  1NEG A;  1VYU A;  3M0S A;  1M3C A;  3RNJ A;  1RI9 A;  1X2Q A;  2RQU A;  1NLP C;  3RBB B;  1G83 A;  2AZV A;  1X43 A;  4F17 A;  4EIK A;  4DEY A;  3U23 A;  1W70 A;  2DMO A;  3ZL7 C;  4OMM A;  2EGC A;  3EG0 A;  1JXO A;  1QCF A;  4F16 A;  1WLP B;  4D8D A;  2DF6 A;  4QT7 A;  1WYX A;  2K7A A;  1TUC A;  2YDL A;  2DL4 A;  3SEM A;  2J6F A;  1WI7 A;  4E6R A;  1KIK A;  1M3A A;  2NUZ A;  2K3B A;  1LCK A;  3EGU A;  1T3S A;  3VRY A;  2ED1 A;  1H8K A;  2F2X A;  1JU5 C;  4OMP A;  4ZNX A;  2KBT A;  1I0C A;  4RTY A;  1YN8 A;  1X69 A;  2D8J A;  3FJ5 A;  5IXF A;  1SPK A;  2DL7 A;  4RTV A;  5FWC A;  1TG0 A;  1UEC A;  2L3P A;  2LP5 A;  5IHN A;  1NLO C;  3TSZ A;  2FG0 A;  1WXU A;  2HDA A;  1AEY A;  1ZUK A;  2EPD A;  2GQI A;  2L2P A;  2CUB A;  2A37 A;  4Z89 A;  1YCS B;  1NYG A;  4J9E A;  4LUD A;  2A36 A;  3H41 A;  4AFQ C;  3TSW A;  1YWP A;  1AVZ C;  1U06 A;  2J05 A;  4JJB A;  2MCN A;  2EBP A;  4RTT A;  3H0H A;  1QKX A;  1MV3 A;  3VS1 A;  1B07 A;  2D8H A;  2HBW A;  2JXB A;  1SSH A;  2LMJ A;  1RLP C;  2RQR A;  2M51 A;  2LJ3 A;  2JS2 A;  1KJW A;  3UA6 A;  2RQV A;  2NWM A;  1GFD A;  2KRN A;  1UUE A;  1W1F A;  2M0Y A;  3VS4 A;  1X2K A;  4ORZ A;  1PRM C;  2O9S A;  1I1J A;  4HCK A;  4JJC A;  4J9F A;  1AOJ A;  1PKS A;  1E7O A;  2DL5 A;  2DX1 A;  2DA9 A;  4WCI A;  1HSQ A;  1E6H A;  1JXM A;  5IH2 A;  3CQT A;  2EGE A;  2KRO A;  1RUW A;  2KXC A;  1CKB A;  1FYN A;  2OI3 A;  2RNA A;  3VS7 A;  1X27 A;  2DVJ A;  3ULR B;  2X3X D;  2V1Q A;  2EW3 A;  1K0X A;  1QLY A;  1G2B A;  2DNU A;  3UA7 A;  2GNC A;  2P4R A;  1UJ0 A;  4LUE A;  1QKW A;  2DE0 X;  1AD5 A;  3M0U A;  2FPE A;  2EVR A;  2LQN A;  2YUO A;  2B86 A;  1GFC A;  2CRE A;  1Y57 A;  1B3Q A;  4F14 A;  2RN8 A;  4AFZ C;  2DRM A;  1EFN A;  2X3W D;  2JM9 A;  2LZ6 B;  4R0K A;  1K4U S;  2IIM A;  1VYV A;  2HEQ A;  2ENM A;  1OPK A;  4RTZ A;  1BU1 A;  4JPB W;  5L23 A;  1UHF A;  1V1C A;  1PNJ A;  2DIL A;  4FSS A;  1UE9 A;  2LQW A;  3JV3 A;  4CC3 A;  4DEX A;  2KT1 A;  1ABO A;  3VS6 A;  1H3H A;  2KE9 A;  1PRL C;  2F2W A;  2L0A A;  2I0N A;  5I22 A;  2FRW A;  3M0P A;  2J6K A;  2ESW A;  2ROL A;  1W6X A;  4X1V A;  4D8K A;  1YNZ A;  2KRM A;  3EG3 A;  4HXJ A;  3UAT A;  2H8H A;  2VVK A;  2CDT A;  2EYZ A;  2YSQ A;  2MIO A;  1Z9Q A;  1JEG A;  3A98 A;  2PTK A;  2EYW A;  1U5S A;  1QWF A;  4HVU A;  4IIM A;  1PKT A;  3KFV A;  1X6G A;  2AKL A;  3VS0 A;  1UG1 A;  4K11 A;  2KGT A;  1K9A A;  1GRI A;  3VS5 A;  2K2M A;  2J6O A;  3EG1 A;  2YUN A;  4OMQ A;  4HVV A;  1GCQ A;  2CSQ A;  2JS0 A;  2JW4 A;  2LX7 A;  3NPF A;  3I35 A;  1CSK A;  1GCQ C;  1M27 C;  4RTU A;  4J9B A;  1JQQ A;  1OV3 A;  2RQT A;  1UHC A;  3H0F A;  4RUG A;  1ARK A;  2O88 A;  1GBQ A;  2J7I A;  2VWF A;  4RTX A;  2CH4 W;  5EC7 A;  4AG1 C;  4RTW A;  2K6D A;  1T0J A;  4OML A;  2VKN A;  1OPL A;  3EHR A;  1Y0M A;  3TVT A;  1NG2 A;  2EYX A;  4JZ4 A;  1ZSG A;  1BK2 A;  2RQW A;  2CUD A;  3QWY A;  3C0C A;  1YP5 A;  4J9G A;  2O31 A;  2GBQ A;  1AWJ A;  2KNB B;  2KXD A;  2DBK A;  3O5Z A;  2FEI A;  2CT3 A;  1K1Z A;  2FRY A;  4JZ3 A;  4Y92 A;  2YUQ A;  1GBR A;  4Z8A A;  1MUZ A;  1H92 A;  2C0O A;  3PVL A;  2EYY A;  4HVW A;  1SRL A;  2RF0 A;  2D1X A;  1SHF A;  2KYM A;  4OMO A;  1AWX A;  2ECZ A;  2JMC A;  2HSP A;  4AG2 C;  1MV0 B;  1M30 A;  2W10 A;  1CKA A;  1WX6 A;  2BZX A;  2G6F X;  3I5R A;  2LCS A;  2SEM A;  1UFF A;  3PE0 A;  2KEA A;  2PNI A;  1ZUY A;  1X6B A;  2FPF A;  3UF4 A;  2O2O A;  5ECA A;  3VS2 A;  2AK5 A;  2EKH A;  2GTJ A;  1GCP A;  4CC7 A;  1OEB A;  2BZY A;  2GTO A;  1WXB A;  5HCK A;  4GLM A;  2A28 A;  4ESR A;  4GBQ A;  1UGV A;  3PVQ A;  1N5Z A;  1SEM A;  3LH5 A;  5FW9 A;  1Z9Z A;  2DRK A;  4AFS C;  2ED0 A;  2C0I A;  1YWO A;  1KSW A;  2E5K A;  1T3L A;  1HD3 A;  2L3Q A;  4J9H A;  1HJD A;  2DBM A;  1ZUU A;  1QWE A;  2OAW A;  2YUP A;  2K9G A;  2L3S A;  1UTI A;  2KYB A;  2FO0 A;  1RLQ C;  1M8M A;  2XMF A;  1SRM A;  1ABQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...