1UJ0A

Crystal structure of stam2 sh3 domain in complex with a ubpy-derived peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
b'MARRVRALYDFEAVEDNELTFKHGELITVLDDSDANWWQGENHRGTGLFPSNFVTTDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords signal transducing adaptor molecule (SH3 domain and ITAM mot
publication title Structural insight into modest binding of a non-PXXP ligand to the signal transducing adaptor molecule-2 Src homology 3 domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/signaling protein
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2003-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uj0A00
2L2PA 4HVWA 3VS0A 1AEYA 4J9EA 4OMQA 3NGPA 2SEMA 1JXOA 4DEXA 1YCSB 2VVKA 4OMMA 1PHTA 1GFDA 4Z8AA 3EG3A 1LCKA 2DMOA 3TVTA 2AKLA 1ARKA 2JT4A 3VS7A 4J9DA 2YUNA 1Z9ZA 3QWXX 1WFWA 2JM8A 1AWWA 1SHGA 2ROLA 3RBBB 4RTUA 3NMZC 1X2KA 2J6KA 2V1QA 2K9GA 2KBTA 4CC4B 2JTEA 4WCIA 1XOVA 2RQWA 1WLPB 3U23A 4JJBA 1IO6A 1RLQC 1KSWA 1MV3A 4OMPA 5EC7A 3M0QA 3M0RA 4F14A 1QCFA 1NYGA 4RTVA 4IIMA 1V1CA 1VYTA 5FWCA 4J9GA 1YNZA 2ESWA 2MIOA 4Z89A 4D8KA 2BZXA 1U06A 2EYWA 3LH5A 1ZBJA 1PNJA 2ED1A 2FRWA 1S1NA 3ZL7C 2RQTA 3EGUA 5FW9A 4R0KA 1UHFA 2A36A 2D8JA 3M0TA 3PVLA 4ORZA 2ECZA 2QDLA 1GBQA 2CREA 2FG0A 1SEMA 4JJDA 2DJQA 4CC2A 2F2XA 5IH2A 2CSIA 2EYYA 1H3HA 2GTOA 1YWPA 1OV3A 2GQIA 2A28A 3GBQA 3VRYA 3VRZA 5I22A 1AWJA 3THKA 1VYUA 4X1VA 4RTYA 2D0NA 2W10A 2AKKA 1ZX6A 1T0JA 1H8KA 2RMOA 1X6BA 2O9VA 1YWOA 2P4RA 2GTJA 1T3SA 2PTKA 3IQLA 3H0HA 2DBKA 1UJ0A 4JJCA 1BU1A 1UECA 1M3CA 3TSWA 4DEYA 2YUQA 1WXBA 2C0IA 2GGRA 1MV0B 1X69A 2FPFA 4GBQA 1KJWA 2YDLA 1K9AA 3TSZA 4J9FA 4HVUA 2O31A 1HJDA 1A0NB 2KNBB 3PE0A 2B86A 1K4US 3VS6A 1GRIA 2O88A 3EG0A 1I1JA 2J7IA 4AG1C 1RUWA 5HCKA 4FSSA 1RLPC 4J9CA 2HSPA 4AFQC 1UHCA 1UGVA 2DE0X 2ROTA 1E6HA 1HSQA 2YUOA 4KRTA 2BTTA 2RF0A 4QT7A 2LP5A 2DX1A 2DM1A 1E7OA 1OPLA 5ECAA 2K7AA 2DNUA 1NEBA 2LNHB 2O9SA 2VKNA 2EVRA 3EHRA 3SHWA 1NEGA 2F2WA 1AWOA 2J05A 2J6OA 4RTWA 3REAB 1K0XA 1J3TA 1SRMA 1W6XA 2KRSA 3R6NA 1GCQC 1QWFA 1Y57A 2DLPA 2LJ0A 1AWXA 2KYBA 3I9QA 2K6DA 4J9IA 3EHQA 2GBQA 2DL8A 2DA9A 2J06A 1MUZA 1QKWA 2BZ8A 4AG2C 2YT6A 2CH4A 5IHIA 2RQUA 4OMLA 2KR3A 1TUCA 2EPDA 1PRMC 4ZNXA 2GNCA 3REBB 2LMJA 4E6RA 2DL7A 1SPKA 1M30A 4RTZA 1BK2A 2PZ1A 1HD3A 4J9HA 2E5KA 2HDAA 2DL5A 2KRMA 2FRYA 2JS2A 1SHFA 2EYXA 5IXFA 2KRNA 2JMAA 1M27C 2YUPA 2JMCA 1GCQA 1UFFA 2DF6A 2G6FX 3M0PA 4RTTA 4CC3A 5L23A 4LN2A 2EKHA 2W0ZA 2CT3A 3I35A 1H92A 1JEGA 2M0YA 2KGTA 2DRKA 2AZVA 5GJWB 3A98A 1N5ZA 1I0CA 1RI9A 1B3QA 1FYNA 3FJ5A 3QWYA 2CH4W 2I0NA 1WYXA 2KROA 1KIKA 1ABQA 2JS0A 1M3BA 2FPEA 2X3XD 1WX6A 2CT4A 4AFSC 4IIOA 4ESRA 1EFNA 1UJYA 1UG1A 3JV3A 1QWEA 3RNJA 2CSQA 1PKTA 2M51A 3M0SA 3VS1A 1Z9QA 2BZYA 2NUZA 2J6FA 2DL3A 2CUDA 2LX7A 5FWBA 4JZ3A 4F17A 4RUGA 3KFVA 1ZSGA 3ULRB 1B07A 2ED0A 1PRLC 2DYBA 2FPDA 1U3OA 4RTXA 1ZUYA 1GBRA 1BBZA 1K76A 4J9BA 2KEAA 2V1RA 1W1FA 1QLYA 4K11A 3VS5A 1GFCA 2A08A 2IIMA 4OMNA 3UATA 2EGEA 5IHNA 2KT8A 1OPKA 3VS4A 2LJ1A 1CSKA 1NM7A 2H8HA 2KT1A 1I07A 1M8MA 4LE9A 2RQRA 5I11A 1VYVA 2DBMA 1CKAA 2DVJA 2LZ6B 2KXDA 2RQVA 1WIEA 1TG0A 2X3WD 2KXCA 2HEQA 3PVQA 1AZGB 1UE9A 1AD5A 2L3SA 1PWTA 1K1ZA 2SRCA 4OMOA 3H41A 3NPFA 2KYMA 1T3LA 1WI7A 2CDTA 2HBWA 2MCNA 3EG1A 2FEIA 1NG2A 4HCKA 4HXJA 4CC7A 1JO8A 1PKSA 1X43A 4LUEA 2OAWA 1ZLMA 2MOXA 3I5RA 1U5SA 3UA7A 1UTIA 1YP5A 2YSQA 3VS3A 2ENMA 2LCSA 2C0TA 4AFZC 2AK5A 2PNIA 1AVZC 1GCPA 2LJ3A 1WXTA 2D1XA 4JZ4A 1GL5A 1QKXA 2LQNA 4Z88A 1JQQA 2F2VA 2L3QA 1FMKA 1NLOC 4Y92A 3VS2A 2DRMA 1ZUKA 1ZUUA 1OEBA 2DL4A 1K0SA 1BB9A 3C0CA 1G83A 2EGAA 1OOTA 1NLPC 4LUDA 1W70A 2L0AA 1CKBA 1AZEA 4AFUC 2DILA 1SRLA 5IHKA 2KE9A 1ABOA 2RPNA 1KFZA 4F16A 4A63B 1G2BA 2CUBA 1X6GA 2NWMA 3EG2A 1X2QA 2AZSA 4EIKA 2JM9A 2O2OA 2FO0A 1E6GA 5GJVB 4JPBW 3UA6A 2K79A 3H0FA 2EYZA 3I5SA 2EBPA 3O5ZA 2JW4A 4GLMA 4LNPA 4M4ZA 1AOJA 1M3AA 3H0IA 1NYFA 2K2MA 2EGCA 2A37A 2JXBA 1SSHA 2OI3A 1X27A 1JU5C 2XMFA 1WA7A 2RNAA 5IXBA 1T0HA 1WDXA 3SEMA 1UUEA 1JXMA 2EQIA 3NHNA 2EW3A 2LQWA 4HVVA 2ABLA 2D8HA 1YN8A 2K3BA 3CQTA 4D8DA 2OJ2A 1TUDA 1WXUA 3UF4A 2RN8A 3M0UA 1Y0MA 2L3PA 2HCKA 1VA7A 1UDLA 2C0OA 2VWFA
chains in the Genus database with same CATH superfamily
3E19A 4HVWA 3VS0A 1MMGA 2KQWA 5KYYA 2SEMA 3A1PA 1YCSB 1YI2T 4Z8AA 1D3BA 1YJ9A 3L2QA 2DMOA 2EFIA 2JT4A 1VQMT 1GXIE 4J9DA 1Z9ZA 1WFWA 1VQOT 3CBPA 2JM8A 3C4SA 2QGFB 1IHWA 2EQUA 3OYJA 4RTUA 2LX9A 3LYIA 4E7IA 5EG2A 1AHJB 2KBTA 2X4JA 1KD1C 1XOVA 3L2ZA 2KDSA 3JB9I 2EQKA 4JJBA 1SF9A 1IO6A 1RLQC 3CCJT 2CP3A 4OVAA 1KQSS 2PQWA 2WSCE 2JNGA 4PJNA 3PNWC 4OMPA 3CCRQ 4OF1A 1PD0A 2H3EB 4ANJA 4PJOG 1NYGA 4F7UB 1VQ9Q 3OW2A 1M90U 1LJOA 3M4YA 3M5AA 2V8KA 1BIBA 1U06A 1KHIA 3AHUA 1VQ8A 4EDUA 5DLQE 2XU8A 2COYA 3G1JA 2A36A 4C92E 4C0DC 1NPRA 3F70A 4ORZA 5J3BA 2AIRB 3TREA 1NJIR 2FG0A 2NUPA 3HHTB 2DJQA 3PFSA 2F2XA 2YRVA 2ZZDA 4M75C 2CSIA 1EX4A 1LNXA 2GQIA 2RHIA 2A28A 3VRZA 4C0FA 5I22A 3JB9D 3THKA 1VYUA 4ZTFA 2E12A 2D0NA 2XHCA 2QA4A 3H9NA 2KAFA 2DEQA 1H8KA 2K5IA 1WJRA 3FIFA 1YITQ 2RO0A 3J7AF 4ZN3A 2BUDA 1UECA 1QVGP 1VOMA 4A4KA 2YUQA 1WXBA 2GGRA 3G6EA 5DY9A 1Q7YC 1IRXA 3FRNA 4J9FA 2JOYA 5A0LA 3CMAA 1K4US 1IZ6A 2O88A 1N8RU 2H3JA 3EG0A 4M7AA 4Q5WA 1VQNT 1RUWA 4FSSA 1RLPC 1K73C 2DX1A 1E7OA 1Q81C 1OPLA 2DNUA 4FIBA 3CMEQ 3UWNA 1RABB 4MDWA 2OTJA 1NEBA 1QCNA 3ZFJA 5LJ5g 2EVRA 3EHRA 5FU7C 1NEGA 1AWOA 1YJWT 5LJ3d 2J6OA 2Y4YA 1S72T 1W6XA 2KRSA 2XK0A 4PJOD 3EAEA 2RI3A 2QG9B 2V26A 4PK4A 2K6DA 2VUBA 4R56A 2DA9A 1V76A 3OYAA 2J06A 1N6AA 3RUXA 3QXEB 5IHIA 4C0GA 1PM3A 2RQUA 1O9SA 4OMLA 6AT1B 2EPDA 1PRMC 4HCZA 2E65A 2GNCA 2LMJA 2DL7A 1VQ6A 1SPKA 4NL2A 2XIDA 3A8HB 4C92G 4M75B 3CXCA 2MYSA 1BK2A 1M5Q1 2HDAA 2DL5A 2RHUA 2YRCA 1SHFA 5IXFA 2JMAA 2DF6A 5FLXE 4RTTA 4LN2A 2EKHA 3ASKA 3I35A 3A5ZB 4O6JA 1BI1A 3CCVQ 5L8RE 1M4ZA 2HAXA 3L2WA 4BD3A 1YHQA 3A98A 2DPPB 3GOXA 1B3QA 3ER0A 1VQPT 3QWYA 1IB8A 2R5AA 1N9RA 2JTMA 3SB2A 1QVFS 2EJFA 1ABQA 3CEYA 2FPEA 3HRUA 3OS0A 4JRQA 1VQ8Q 3JCMe 4HT9A 1UJYA 3JV3A 4E7SA 3OS5A 3FC3A 3M58A 1ZSZA 4LDXA 3CCLA 2LTOA 9ATCB 4GY5A 1ZSGA 3ULRB 3CC2A 1B07A 4CRIA 2ED0A 1NPPA 1U3OA 4M7AF 3MEAA 3CCET 1B34A 5M9OA 4QVZA 1BBZA 2QYZA 5DM7R 4WF2A 3GF5A 3QUIA 2QA4Q 1VQ4A 1W1FA 3QIIA 4II1A 1K9MC 1UGSB 4OMNA 2RK1A 2DERA 3OYBA 5D6XA 2LJ1A 2COWA 2KT1A 3G6EQ 4JS5A 4C8QC 3X26B 4L6V5 5I11A 3CC4A 1VYVA 4M77C 2DBMA 2R5MA 3OA6A 2DVJA 3CMAQ 3MCAB 4N0AC 5GANe 1TG0A 3CCQA 5LJ3h 2HEQA 2ZPBB 4C92D 2XKOC 4JRPA 1Y71A 4QKUA 1TU0B 2EIFA 4FT4A 4KUIA 4PJOA 3RERA 3H41A 1R8OB 3EH1A 1FWZA 2OTJQ 2FEIA 1BCOA 2E1HA 1PKSA 4LUEA 4PKCC 3QDRB 1FMVA 4E7ZA 3I5RA 4OB2B 3CCRT 1UTIA 2PVDB 2MK5A 1K8AU 3VS3A 3LW5E 4LD6A 2ENMA 1VQ9T 2LCSA 5GAOq 2PNIA 1B7TA 1I8FA 1X75C 3VJPA 2D1XA 4JS4A 2VXFA 4DOVA 2COZA 4BI4A 2DRMA 1ZA2B 3RKXA 3T9NA 4BE0A 1ZUKA 3C0CA 1JRIA 4LUDA 3LWHA 4FSXA 1G3SA 3CCUA 3JB9F 4KGVB 1RAIB 4EMHA 2XDPA 1KQSA 1SRLA 2HNIA 1ABOA 2RPNA 1W2BS 1TS9A 4A63B 4EIKA 1O75A 2OX7A 3CPWA 4XU1A 1I81A 3OYIA 1WZOA 3X24B 5LJ3f 4M78B 5GJVB 2YWWA 3GP8A 2EBPA 3O5ZA 4LNPA 1YITT 2OAUA 3TU4K 2QI2A 2XMFA 1WA7A 2OTLA 2RNAA 4C8QB 5IXBA 4M77B 1W4SA 1M1FA 5GAN6 3NHNA 2QQBA 5HY6A 3CC7A 3EGXA 4HVVA 2D8HA 4ELYC 4N4HA 2CZ0B 2K3BA 2RHYA 4D8DA 2OJ2A 3CCLQ 4ME7A 2MPXC 5GMKl 1KHCA 4AMCA 2L3PA 4E47A 3CC2Q 2RJDA 4NOYA 2JVVA 2QAZA 3D7SB 3LLRA 1NZ9A 3PMIA 3CMET 4RCCA 3NGPA 3V8KA 5A0DA 2A7YA 4PFPA 4XU0A 2R58A 4PJOF 4M7DC 4OMMA 3OYFA 1PHTA 4X9DA 1VQ4Q 1GFDA 4PL6A 2CZ1B 4OB3B 5GMKi 2AKLA 4OGEA 3VS7A 3CPFA 2FZCB 2QQAA 2I2LA 5CAIA 1AWWA 2E6NA 2IG0A 2YLBA 4C92A 2QQSA 5KCOA 2QASA 1X2KA 3VUBA 1XQHA 1OU9A 1BI3A 4XQ3A 2K9GA 3CC4Q 1WPYA 4WCIA 1NJIU 3L2RA 1G3WA 1X01A 2M9UA 2M1HA 3VYHB 3QHSA 3CCQQ 4XTWA 4ZGEB 1BYMA 5GAOl 1OZ3A 1QCFA 1QQJA 3HFNA 1KD1R 1Q86C 1V1CA 4BUGA 5GMKh 3L2VA 2PUOB 3HTRA 2FHDA 5FWCA 4Z89A 2BZXA 4V2SA 3OY9A 5CK9A 2K3XA 1Q82U 1S1NA 2BIVA 3ZL7C 2RQTA 3RDVA 5KYXB 3JCMP 3HL8A 3WVDB 5IN1A 4JRKA 3CBOA 2P0PA 2B8AA 2D8JA 3KUFA 2ECZA 3DB4A 5GAN5 1GBQA 3OYCA 2CREA 1VIFA 4Y91A 1SEMA 2E6ZA 2DTHA 3MP1A 2ZAEA 5KYWB 3JCMV 4IUTA 1H3HA 4MZTA 1YWPA 1OV3A 3UDCA 5GAOn 3GIBA 1VQ8T 1IGUA 5GMKj 4P5NA 1D0YA 3EGDB 3M56A 1T0JA 1X6BA 2WSEE 1KC8C 2AT1B 1YWOA 2F5TX 3MKDA 2P4RA 1LOJA 3CCUQ 1T3SA 3KBGA 2DBKA 2E64A 1BU1A 3RKWA 2DXBA 4RCBA 3JB9G 4M7DB 5CVIA 2C0IA 1FMWA 2LNVA 2QA4T 2DETA 4BDZA 2KNBB 3DLLA 5FROA 2B86A 2BKDN 1Y96B 1GRIA 3VS6A 5GANg 1RACB 3TQ7P 3OQ5A 3OYDA 1Q7YR 4AG1C 4J9CA 2HSPA 4AFQC 1UHCA 2ROTA 4QT7A 1E6HA 2HKQB 4KRTA 2OTLQ 3OS2A 1P92A 2LP5A 1IXDA 1SSFA 5ECAA 2K7AA 3CD6A 3G6ET 2K5FA 2XICA 3CC7Q 1VUBA 4C92F 3MO8A 2RM4A 3BFMA 8ATCB 2O4XA 2M16A 1K73R 2F2WA 3CMAT 3JCMd 1Q81R 4FCYA 3P8HA 4LDWA 1SRMA 1MMAA 2K2VA 1QWFA 1WHHA 1Y57A 2RD1A 3I9QA 4LD9K 2DL8A 3UPUA 1OX8A 1RADB 1ZHIA 2OTJT 1MUZA 1QKWA 5D6WA 2CH4A 2RJEA 1QVGA 3V7SA 5GAN7 1G8XA 3AT1B 2ATCB 2MAMA 4RG8A 4ZNXA 4QVDA 2LVMA 1M1KC 3GPLA 1VQ5A 1I5OB 1F1BB 1QVFP 2XI9A 2JUFA 5GAMd 2HL5C 2KRMA 3LGLA 1VQ7A 3QYGB 4FYWB 1MMDA 1UFFA 2G6FX 3M53A 4DOWA 2QXFA 1QP2A 4QW2A 4IUQA 2E10A 2DRKA 3OSVA 3QO3A 1VQ6T 5KE2A 1JBMA 1FYNA 2HSEB 3RMQA 1KIKA 1HXDA 5KYUA 3Q1JA 3TEEA 2DXTA 1KQ2A 3JB9H 2CT4A 3ZBDA 2FB7A 4ESRA 1EFNA 1MHNA 1UG1A 3VV0A 4RG2A 1PKTA 1TUGB 4OP0A 3JCMX 3VS1A 3G4SA 1Z9QA 1MNDA 4X9CA 4J6YA 4JZ3A 4RUGA 3KFVA 1R77A 3EG9A 4IUVA 3RESA 5CKBA 1FXXA 1PRLC 5CKDA 2RJCA 4RTXA 1ZUYA 1GBRA 2LDMA 1OZ2A 2DD5A 3BE3A 1PSEA 3P8DA 3CCLT 1I4K1 2RK2A 4K11A 1XJWB 3I55A 3FB9A 2DFUA 2EGEA 3CC2T 3EFOB 3R6OA 3G71A 2LRQA 1WHJA 3VS4A 1CSKA 2MWPA 2QQ9A 5CO7A 2H8HA 1ZBXA 2VC8A 3SFMA 2DIGA 2VV5A 1K9MR 4LE9A 3DLMA 1VQKA 1D1BA 1VQ4T 4A4GA 2PU9B 2KXDA 2VYTA 2RQVA 3OMCA 3JCMh 5FU6C 2KXCA 4M75E 1WHLA 2EWNA 4D6WA 2HQHA 2DO3A 1KG1A 2L3SA 1YIJA 3E9FA 1K1ZA 4OMOA 5HKCA 1G5VA 4RKUE 3CD6Q 3MEUA 2CDTA 3CC4T 1YJ9Q 3CCMA 2L89A 2QTVA 4CC7A 1U8RA 2OAWA 3CCQT 2CS7A 1VQLA 1TH7A 2F69A 2X9HA 7AT1B 3DB3A 4AFZC 1AVZC 1AT1B 1W2BP 4LXCA 1G3YA 1U1TA 5GAMh 1TSFA 4JZ4A 1GL5A 2E3HA 1C1AA 5CCAA 2VGNA 2F2VA 3OYKA 4XU2A 4Y92A 1VQ5Q 4L59A 1ZUUA 5KH6A 1BB9A 1G83A 2LC4A 5KYYB 4PLLA 1W70A 4Z02A 4DQ2A 4A4HA 2NUTA 2JTFA 3QKJA 3WVEB 2P0KA 1D3BB 2FZKB 3M55A 4BACA 4LDUA 4F16A 1N27A 3LWIA 5LJ5d 1X2QA 2AZSA 5IT9E 2RI5A 1Q82C 3JCMb 2O2OA 2FO0A 3JCMf 5GAMj 3MHXA 4M7AC 2JW4A 3QSUA 1AOJA 2DKGA 3CCUT 2K2MA 2KSSA 3C12A 2A37A 1SSHA 2X51A 3LGFA 1NE8A 1RAFB 1IHVA 1WHMA 4XTVA 3SEMA 4FYVB 4ZGJB 1BI0A 2EQIA 2EW3A 4C0ZA 4M78C 4BI3A 2DZCA 5CQXA 5FU6B 4JRIA 4QQGA 1TUDA 5GMKm 2XDBA 3NTIA 1Y07A 2WSFE 3UF4A 2GF7A 2RN8A 1RI0A 2HCKA 3P8BB 2OTLT 5GAMf 1D0XA 2C0OA 3NFCA 3G7ZA 4M75G 4DA4A 2VWFA 2L2PA 1QP3A 4J9EA 4OMQA 4PJMA 4Y28E 2HBPA 3CC7T 4XAXB 1JXOA 2K3YA 2DVEA 4FL6A 4EMKA 2HZYA 2CYZB 3I56A 3OYYA 1KD1U 2NUPB 4PJJA 4GLKA 2DYIA 3I55Q 5GAN3 4C5EA 3TVTA 4KBMB 4C5IA 3OW2S 2RI2A 2YUNA 3QWXX 3G71Q 3S3OA 2KMTA 2XDDA 1SHGA 2DXUA 5DLOA 3FLGA 3N5BB 2J6KA 4UC4A 3RMSA 4CC4B 2JTEA 1R0CB 1VQKQ 4J7FA 2V8IA 3SWNA 1KSWA 1D0ZA 5GAOm 1WQWA 4F14A 5D6YA 4MZMA 3DKMA 1YIJQ 3OBYA 4IIMA 1YJNA 4J9GA 2ESWA 2MIOA 2EYWA 3LH5A 3CCMQ 3SD4A 1ZBJA 1HK9A 1PNJA 2ED1A 1OU8A 1TXQA 3J80E 4HA8A 1VQ6Q 1ZSZC 4PFZA 4M7AB 4M78E 1Q86R 1VIEA 4R0KA 1H3ZA 3GLXA 1UHFA 4MZPA 3S3NA 3VUZA 2K57A 1OULA 4IUPA 1ZA1B 3PVLA 1VQLQ 2QDLA 3HRTA 1M90C 4C8QE 4BB7A 4XU3A 3UT1A 4M77E 5IH2A 2HL3A 2E41A 4A54A 3GBQA 1YHQQ 3VRYA 2P84A 4X1VA 1Q7YU 5LJ5h 4RTYA 2DXCA 2AKKA 5LJ3e 1V29B 5GAN8 2O9VA 1D1AA 4KGXB 1UGPB 3PIOA 4A4EA 1LPLA 3VU3C 3IQLA 3MPUB 4M75D 3V7RA 3L42A 1M3CA 1K73U 3TSWA 5GAN4 1Q81U 1KC8R 4E2FB 1MV0B 2FPFA 4GBQA 1M9SA 1M1GA 1K9AA 3TSZA 4HCCA 2NLUA 1A0NB 2HMAA 4XTZA 2CGHA 1I1JA 5I2SA 5LJ5j 2E70A 5HCKA 4PJOC 1UGVA 3RR6A 1HSQA 2YUOA 3E2UA 1BKBA 3A8LB 3S6WA 4FU6A 1M2VA 2LT1A 3SHWA 1YBYA 2J05A 1N8RC 4RTWA 3REAB 2VGMA 4QQ6A 2HD0A 1GCQC 2NUTB 2DLPA 3CCRA 1AWXA 4E7KA 4J9IA 3EHQA 1QVPA 4KULA 3CD6T 4LDYA 2QQRA 2XG8D 1YJ9T 2BZ8A 1ZSZB 2YT6A 5LJ5f 1KQ1A 1PSFA 1QCOA 4FW2A 3REBB 5A0GA 3NTKA 4B9XA 4B9WA 1B34B 1HD3A 4J9HA 4E7LA 2EJGA 2FRYA 2KRNA 3V7CA 1M27C 5HK3A 2JMCA 1M1KR 4C8QG 4CC3A 3M9QA 3CCSA 4M77G 2JN0A 2C06A 2RHZA 1H92A 3H8ZA 2L3RA 1VQ5T 2QK0A 3PGGA 1I0CA 1RI9A 1M8VA 2ZPFB 4E7HA 2LQKA 3HKSA 2KROA 3QJYA 1VQ7T 2XD0A 3OB9A 4M7DE 2X3XD 4AFSC 2PVOB 2R57A 2E3IA 1QWEA 3RNJA 4BY6C 2M51A 2M02A 3M0SA 5I21A 4FM4B 2KVQG 4PJOB 2BZYA 2NUZA 2F5KA 4N4IA 2QEXA 2K5LA 1K9MU 2EAYA 4OGCA 3S3MA 4DBRA 2DYBA 2FPDA 2RA2A 2CP5A 4XTXA 1BI2A 4PJLA 4M75A 1QVFA 4OB1B 4JJNK 4J9BA 3G4ST 4DBHA 5CKHA 4C5HA 5CQYA 3VS5A 3URGA 1C6VX 3QJ6A 1KK7A 4PLIA 4FYYB 3UATA 2LT4A 4C92C 5IHNA 2KT8A 5GAOp 2YXYA 2P0QA 1M8MA 2ZPGB 2LQ8A 2RQRA 3PIPA 5I2MA 3I55T 2LZ6B 4F7UE 3JCMQ 4IUUA 4M78D 1XTDA 2X3WD 3OYHA 3G71T 1JJ2P 1AD5A 1SG5A 4JLGA 3C94A 3QYHB 2JZ2A 1T3LA 1WI7A 4C8QD 4BDYA 4M77D 1VQKT 4J6WA 2IVWA 4RMOA 1NG2A 3M54A 4J8OA 5KE3A 1X43A 1ZLMA 1X6OA 2CP0A 2MOXA 4R55A 4ZTJA 1U5SA 3UA7A 1YP5A 3CCVA 2YSQA 1YIJT 5KYNA 2C0TA 1XNIA 3EGXB 3CPWS 3CCMT 3QBYA 4PNOA 4MMLA 1YFNA 4BY6B 3E1SA 4M7DG 5CR2A 4LDVA 1JQQA 3HP9A 1NLOC 1VQLT 5J39A 5LJ3g 1K8AC 5GANd 5CKEA 1OEBA 2DL4A 2HKNA 1OOTA 1NLPC 2MF2A 2L0AA 1CKBA 1AZEA 5AT1B 2CP2A 1D1CA 2AHJB 5C6SA 1UGRB 2M0OA 5CIUA 5IHKA 3PTAA 3L1AA 1YHQT 3CCSQ 1M2VB 1KFZA 2KY9A 3M4GA 1G2BA 2CZ6B 1X6GA 2DIQA 3BDLA 2WACA 2JM9A 5GAOr 3QDFA 1PCXA 4JPBW 4M75F 2LCLA 2K79A 2EYZA 4C92B 4OB0B 4M4ZA 2FZGB 2A3LA 4WTOB 5KCHA 1M3AA 2ZPEB 3NTHA 2HQXA 2EGCA 2Y90A 2JXBA 2OI3A 4BE1A 1Q82R 2LCCA 4B6MA 2MWOA 1WDXA 3EFSA 3KXTA 1ACMB 4JDSA 1JXMA 3JSCA 2LQWA 3FJPA 1W2BA 4BI8B 1YN8A 4FYXB 3JCMc 4J5YA 5AYFA 1YI2A 1TTHB 3ME9A 3OW2P 2ZPHB 2QEXQ 2L8DA 1D09B 1Y0MA 4F7UG 1VQMA 2YRDA 4QQDA 3BY7A 8AT1B 1VQOA 1UUEA 3OYMA 3PVQA 1AEYA 5FRNA 2L5QA 3FDRA 4DEXA 2DK3A 2DTOA 5GAN2 2QTXA 2VVKA 3EG3A 1LCKA 4ZGDB 3OBWA 3MEWA 3CCJA 3BW1A 1ARKA 4BE2A 4M78A 3JB9J 1Q86U 2ROLA 3GNGA 3RBBB 3NMZC 5HK0A 4A53A 2V1QA 1RAAB 3J81E 2CKKA 3M59A 1WHGA 4M7DD 3I56T 2RQWA 4C8QA 1WLPB 4O5VA 3U23A 1OQKA 4M77A 1RAHB 3JCMW 2PVGB 2QDYB 1MV3A 1C0MA 5EC7A 1JJ2S 3M0QA 3M0RA 2KI7A 4C0DB 3RKYA 4N0AA 3C95A 1EIFA 3BDUA 4RTVA 1BIAA 2BE7D 1VYTA 2GCXA 2D0QB 2E5QA 1YNZA 3V8LA 4D8KA 1EZZB 1NBEB 1NJIC 2FRWA 3VKIA 5C0MA 4KH1B 3EGUA 3X25B 5FW9A 3PMTA 3M0TA 1M2OA 2O01E 1VQ7Q 5GANh 1KC8U 4KT0E 3TCJA 1N9SA 1YJNT 4JJDA 1R0BG 2YLCA 2HQEA 3GNFB 4CC2A 2EYYA 2O4XB 2GTOA 3X28B 3EH2A 4NS5A 4AT1B 4TVRA 1AWJA 2IPOB 1M90R 4EMGA 2W10A 1ZX6A 2RMOA 2VXEA 1MMNA 2GTJA 2PTKA 1VQNA 3H0HA 1I5LA 1UJ0A 2GFAA 2V8JA 1G3TA 4JJCA 4JUVA 4DEYA 5GANj 3OYNA 1UB4A 1TWBA 1WQ7A 3G4SQ 2BE9B 4HCBA 3MP6A 1X69A 1KJWA 2YDLA 4HVUA 5FU7B 2O31A 1HJDA 3CXCP 2FVUA 3PE0A 4J83A 1YJWA 3ZEHA 5KYXA 2Y4XA 1S72A 2G3RA 2J7IA 2VB6A 3MJXA 2PUKB 1K0SA 2DE0X 2BTTA 2RF0A 3LH0A 5GAMe 2VASA 2EQJA 2DM1A 1QVGS 4QVCA 2FL7A 4M78F 2LNHB 2O9SA 3META 3OYLA 2DZ9A 2VKNA 5KYWA 2DTIA 1YI2Q 1WJSA 3VYGA 5GANf 5KYUB 1K0XA 1J3TA 2RJFA 3R6NA 3EGDA 4C8QF 2EQMA 1M1KU 1VQMQ 4M77F 1MNEA 2LJ0A 1VQOQ 2KYBA 2KK4A 2DAQA 2GBQA 3QPHA 1N8RR 4AG2C 1Y7XA 4M7AE 4KUDK 1ZQ1A 3JAME 2KR3A 1TUCA 4ELZC 1OX9A 4M7DA 3CCJQ 3M57A 2DEUA 3EG9B 4E6RA 2K4YA 1PG5B 1M30A 2X35A 4RTZA 2PZ1A 1VQPA 2E5KA 1Y96A 3OSSC 2JS2A 2D6FA 2EYXA 5IAYA 2YUPA 1MGQA 4J6XA 1GCQA 5L23A 3M0PA 3HPWA 3JCMJ 2W0ZA 2CT3A 5LJ3j 4FT2A 1JEGA 2M0YA 3SDZA 2KGTA 5FRMA 2AZVA 5GJWB 1N5ZA 4N4GA 1FX7A 3FJ5A 2CH4W 2I0NA 1WYXA 4XTYA 2JS0A 1M3BA 4J7IA 2X4YA 1PC0A 2EJ9A 3CCST 1WX6A 4IIOA 4DBFA 3CCEA 1OI1A 2CSQA 2J6FA 2DL3A 2CUDA 2LX7A 5FWBA 4F17A 3OS1A 1H641 3HSBA 4MMKA 4F7UA 3A8MB 5A2QE 1YCYA 2GFUA 4EMKC 3QG1A 4IURA 4CI0C 1TOVA 1K76A 1QMCA 2KEAA 3OYEA 2A0FB 2MI6A 2V1RA 4ZN1A 1QLYA 1GFCA 2A08A 1WGSA 2QEXT 2IIMA 4E7JA 3INZA 4KGZB 2RB6A 1VQNQ 2D9TA 2FYKA 1OPKA 1NM7A 5CKFA 2RHXA 1I07A 4X34A 2JJ9A 4XK8E 5D7UA 3H6ZA 3CXCS 3SWNC 1WHKA 1CKAA 1YJWQ 4M7AG 1WIEA 1RAGB 1S72Q 1AZGB 1KQSP 3LX7A 1PD1A 4ATOA 1UE9A 3A8OB 4M7DF 2YHTA 3HRSA 1PWTA 2SRCA 3O8VA 1VQ9A 1IREB 1HYOA 3CPWP 3NPFA 3I56Q 2KYMA 2ZGWA 3E9GA 2HBWA 1WJQA 2GQVA 4YTLA 2MCNA 1WNLA 3EG1A 5LJ5e 4HCKA 1DJ7B 4HXJA 4M78G 1JO8A 2ZPIB 5J26A 3PT9A 1UEBA 3QZ5B 3JRZA 2ZCFB 3MEVA 3X20B 2QGGA 4JLIA 3L2UA 2AK5A 2CZ7B 2X4XA 2Z0WA 1GCPA 4EPCA 3EFOA 4A4FA 1UGQB 1WXTA 2LJ3A 4HT8A 2DD4A 1IGQA 2EKOA 2X4WA 4IKFA 3V8JA 1QKXA 2LQNA 3HFOA 4XTUA 2RH2A 4Z88A 4NL3A 2L3QA 1FMKA 3JCMg 3CCVT 3VS2A 4PJOE 4C5GA 4OMFB 1YJNQ 2EGAA 2MMPA 1U1SA 3WXMB 1YITA 1RL2A 1VQPQ 4AFUC 4DBQA 2DILA 4EMKB 3CBMA 1K8AR 2F1LA 2KE9A 1BCMA 2NYSA 1JJ2A 4MDXA 4HKEA 2CUBA 3EG2A 2NWMA 1OYXA 4F7UF 5LL6S 2P4TA 1E6GA 3UA6A 3H0FA 3I5SA 3RIRA 4GLMA 3H0IA 1NYFA 4L5GA 1X27A 1JU5C 5GAMg 3OYGA 1T0HA 4KH0B 2CP7A 2CP6A 3SWNB 1JB0E 3CMEA 4F04B 3A8GB 3CCEQ 4PFOA 3QZ9B 2ABLA 1RAEB 3MP8A 2E4HA 2EYQA 3CQTA 4M7AD 2DJZA 5GMKe 1SKUB 3OMGA 1WXUA 3EFRA 4FW1A 3M0UA 1QW1A 1VA7A 1Q95G 1LVKA 1UDLA 3FEOA 4VUBA
chains in the Genus database with same CATH topology
2L2PA 4HVWA 3VS0A 1AEYA 4J9EA 4OMQA 3NGPA 2SEMA 1JXOA 4DEXA 1YCSB 2VVKA 4OMMA 1PHTA 1GFDA 4Z8AA 3EG3A 1LCKA 2DMOA 3TVTA 2AKLA 1ARKA 2JT4A 3VS7A 4J9DA 2YUNA 1Z9ZA 3QWXX 1WFWA 2JM8A 1AWWA 1SHGA 2ROLA 3RBBB 4RTUA 3NMZC 1X2KA 2J6KA 2V1QA 2K9GA 2KBTA 4CC4B 2JTEA 4WCIA 1XOVA 2RQWA 1WLPB 3U23A 4JJBA 1IO6A 1RLQC 1KSWA 1MV3A 4OMPA 5EC7A 3M0QA 3M0RA 4F14A 1QCFA 1NYGA 4RTVA 4IIMA 1V1CA 1VYTA 5FWCA 4J9GA 1YNZA 2ESWA 2MIOA 4Z89A 4D8KA 2BZXA 1U06A 2EYWA 3LH5A 1ZBJA 1PNJA 2ED1A 2FRWA 1S1NA 3ZL7C 2RQTA 3EGUA 5FW9A 4R0KA 1UHFA 2A36A 2D8JA 3M0TA 3PVLA 4ORZA 2ECZA 2QDLA 1GBQA 2CREA 2FG0A 1SEMA 4JJDA 2DJQA 4CC2A 2F2XA 5IH2A 2CSIA 2EYYA 1H3HA 2GTOA 1YWPA 1OV3A 2GQIA 2A28A 3GBQA 3VRYA 3VRZA 5I22A 1AWJA 3THKA 1VYUA 4X1VA 4RTYA 2D0NA 2W10A 2AKKA 1ZX6A 1T0JA 1H8KA 2RMOA 1X6BA 2O9VA 1YWOA 2P4RA 2GTJA 1T3SA 2PTKA 3IQLA 3H0HA 2DBKA 1UJ0A 4JJCA 1BU1A 1UECA 1M3CA 3TSWA 4DEYA 2YUQA 1WXBA 2C0IA 2GGRA 1MV0B 1X69A 2FPFA 4GBQA 1KJWA 2YDLA 1K9AA 3TSZA 4J9FA 4HVUA 2O31A 1HJDA 1A0NB 2KNBB 3PE0A 2B86A 1K4US 3VS6A 1GRIA 2O88A 3EG0A 1I1JA 2J7IA 4AG1C 1RUWA 5HCKA 4FSSA 1RLPC 4J9CA 2HSPA 4AFQC 1UHCA 1UGVA 2DE0X 2ROTA 1E6HA 1HSQA 2YUOA 4KRTA 2BTTA 2RF0A 4QT7A 2LP5A 2DX1A 2DM1A 1E7OA 1OPLA 5ECAA 2K7AA 2DNUA 1NEBA 2LNHB 2O9SA 2VKNA 2EVRA 3EHRA 3SHWA 1NEGA 2F2WA 1AWOA 2J05A 2J6OA 4RTWA 3REAB 1K0XA 1J3TA 1SRMA 1W6XA 2KRSA 3R6NA 1GCQC 1QWFA 1Y57A 2DLPA 2LJ0A 1AWXA 2KYBA 3I9QA 2K6DA 4J9IA 3EHQA 2GBQA 2DL8A 2DA9A 2J06A 1MUZA 1QKWA 2BZ8A 4AG2C 2YT6A 2CH4A 5IHIA 2RQUA 4OMLA 2KR3A 1TUCA 2EPDA 1PRMC 4ZNXA 2GNCA 3REBB 2LMJA 4E6RA 2DL7A 1SPKA 1M30A 4RTZA 1BK2A 2PZ1A 1HD3A 4J9HA 2E5KA 2HDAA 2DL5A 2KRMA 2FRYA 2JS2A 1SHFA 2EYXA 5IXFA 2KRNA 2JMAA 1M27C 2YUPA 2JMCA 1GCQA 1UFFA 2DF6A 2G6FX 3M0PA 4RTTA 4CC3A 5L23A 4LN2A 2EKHA 2W0ZA 2CT3A 3I35A 1H92A 1JEGA 2M0YA 2KGTA 2DRKA 2AZVA 5GJWB 3A98A 1N5ZA 1I0CA 1RI9A 1B3QA 1FYNA 3FJ5A 3QWYA 2CH4W 2I0NA 1WYXA 2KROA 1KIKA 1ABQA 2JS0A 1M3BA 2FPEA 2X3XD 1WX6A 2CT4A 4AFSC 4IIOA 4ESRA 1EFNA 1UJYA 1UG1A 3JV3A 1QWEA 3RNJA 2CSQA 1PKTA 2M51A 3M0SA 3VS1A 1Z9QA 2BZYA 2NUZA 2J6FA 2DL3A 2CUDA 2LX7A 5FWBA 4JZ3A 4F17A 4RUGA 3KFVA 1ZSGA 3ULRB 1B07A 2ED0A 1PRLC 2DYBA 2FPDA 1U3OA 4RTXA 1ZUYA 1GBRA 1BBZA 1K76A 4J9BA 2KEAA 2V1RA 1W1FA 1QLYA 4K11A 3VS5A 1GFCA 2A08A 2IIMA 4OMNA 3UATA 2EGEA 5IHNA 2KT8A 1OPKA 3VS4A 2LJ1A 1CSKA 1NM7A 2H8HA 2KT1A 1I07A 1M8MA 4LE9A 2RQRA 5I11A 1VYVA 2DBMA 1CKAA 2DVJA 2LZ6B 2KXDA 2RQVA 1WIEA 1TG0A 2X3WD 2KXCA 2HEQA 3PVQA 1AZGB 1UE9A 1AD5A 2L3SA 1PWTA 1K1ZA 2SRCA 4OMOA 3H41A 3NPFA 2KYMA 1T3LA 1WI7A 2CDTA 2HBWA 2MCNA 3EG1A 2FEIA 1NG2A 4HCKA 4HXJA 4CC7A 1JO8A 1PKSA 1X43A 4LUEA 2OAWA 1ZLMA 2MOXA 3I5RA 1U5SA 3UA7A 1UTIA 1YP5A 2YSQA 3VS3A 2ENMA 2LCSA 2C0TA 4AFZC 2AK5A 2PNIA 1AVZC 1GCPA 2LJ3A 1WXTA 2D1XA 4JZ4A 1GL5A 1QKXA 2LQNA 4Z88A 1JQQA 2F2VA 2L3QA 1FMKA 1NLOC 4Y92A 3VS2A 2DRMA 1ZUKA 1ZUUA 1OEBA 2DL4A 1K0SA 1BB9A 3C0CA 1G83A 2EGAA 1OOTA 1NLPC 4LUDA 1W70A 2L0AA 1CKBA 1AZEA 4AFUC 2DILA 1SRLA 5IHKA 2KE9A 1ABOA 2RPNA 1KFZA 4F16A 4A63B 1G2BA 2CUBA 1X6GA 2NWMA 3EG2A 1X2QA 2AZSA 4EIKA 2JM9A 2O2OA 2FO0A 1E6GA 5GJVB 4JPBW 3UA6A 2K79A 3H0FA 2EYZA 3I5SA 2EBPA 3O5ZA 2JW4A 4GLMA 4LNPA 4M4ZA 1AOJA 1M3AA 3H0IA 1NYFA 2K2MA 2EGCA 2A37A 2JXBA 1SSHA 2OI3A 1X27A 1JU5C 2XMFA 1WA7A 2RNAA 5IXBA 1T0HA 1WDXA 3SEMA 1UUEA 1JXMA 2EQIA 3NHNA 2EW3A 2LQWA 4HVVA 2ABLA 2D8HA 1YN8A 2K3BA 3CQTA 4D8DA 2OJ2A 1TUDA 1WXUA 3UF4A 2RN8A 3M0UA 1Y0MA 2L3PA 2HCKA 1VA7A 1UDLA 2C0OA 2VWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2P A;  4HVW A;  3VS0 A;  1AEY A;  4J9E A;  4OMQ A;  3NGP A;  2SEM A;  1JXO A;  4DEX A;  1YCS B;  2VVK A;  4OMM A;  1PHT A;  1GFD A;  4Z8A A;  3EG3 A;  1LCK A;  2DMO A;  3TVT A;  2AKL A;  1ARK A;  2JT4 A;  3VS7 A;  4J9D A;  2YUN A;  1Z9Z A;  3QWX X;  1WFW A;  2JM8 A;  1AWW A;  1SHG A;  2ROL A;  3RBB B;  4RTU A;  3NMZ C;  1X2K A;  2J6K A;  2V1Q A;  2K9G A;  2KBT A;  4CC4 B;  2JTE A;  4WCI A;  1XOV A;  2RQW A;  1WLP B;  3U23 A;  4JJB A;  1IO6 A;  1RLQ C;  1KSW A;  1MV3 A;  4OMP A;  5EC7 A;  3M0Q A;  3M0R A;  4F14 A;  1QCF A;  1NYG A;  4RTV A;  4IIM A;  1V1C A;  1VYT A;  5FWC A;  4J9G A;  1YNZ A;  2ESW A;  2MIO A;  4Z89 A;  4D8K A;  2BZX A;  1U06 A;  2EYW A;  3LH5 A;  1ZBJ A;  1PNJ A;  2ED1 A;  2FRW A;  1S1N A;  3ZL7 C;  2RQT A;  3EGU A;  5FW9 A;  4R0K A;  1UHF A;  2A36 A;  2D8J A;  3M0T A;  3PVL A;  4ORZ A;  2ECZ A;  2QDL A;  1GBQ A;  2CRE A;  2FG0 A;  1SEM A;  4JJD A;  2DJQ A;  4CC2 A;  2F2X A;  5IH2 A;  2CSI A;  2EYY A;  1H3H A;  2GTO A;  1YWP A;  1OV3 A;  2GQI A;  2A28 A;  3GBQ A;  3VRY A;  3VRZ A;  5I22 A;  1AWJ A;  3THK A;  1VYU A;  4X1V A;  4RTY A;  2D0N A;  2W10 A;  2AKK A;  1ZX6 A;  1T0J A;  1H8K A;  2RMO A;  1X6B A;  2O9V A;  1YWO A;  2P4R A;  2GTJ A;  1T3S A;  2PTK A;  3IQL A;  3H0H A;  2DBK A;  1UJ0 A;  4JJC A;  1BU1 A;  1UEC A;  1M3C A;  3TSW A;  4DEY A;  2YUQ A;  1WXB A;  2C0I A;  2GGR A;  1MV0 B;  1X69 A;  2FPF A;  4GBQ A;  1KJW A;  2YDL A;  1K9A A;  3TSZ A;  4J9F A;  4HVU A;  2O31 A;  1HJD A;  1A0N B;  2KNB B;  3PE0 A;  2B86 A;  1K4U S;  3VS6 A;  1GRI A;  2O88 A;  3EG0 A;  1I1J A;  2J7I A;  4AG1 C;  1RUW A;  5HCK A;  4FSS A;  1RLP C;  4J9C A;  2HSP A;  4AFQ C;  1UHC A;  1UGV A;  2DE0 X;  2ROT A;  1E6H A;  1HSQ A;  2YUO A;  4KRT A;  2BTT A;  2RF0 A;  4QT7 A;  2LP5 A;  2DX1 A;  2DM1 A;  1E7O A;  1OPL A;  5ECA A;  2K7A A;  2DNU A;  1NEB A;  2LNH B;  2O9S A;  2VKN A;  2EVR A;  3EHR A;  3SHW A;  1NEG A;  2F2W A;  1AWO A;  2J05 A;  2J6O A;  4RTW A;  3REA B;  1K0X A;  1J3T A;  1SRM A;  1W6X A;  2KRS A;  3R6N A;  1GCQ C;  1QWF A;  1Y57 A;  2DLP A;  2LJ0 A;  1AWX A;  2KYB A;  3I9Q A;  2K6D A;  4J9I A;  3EHQ A;  2GBQ A;  2DL8 A;  2DA9 A;  2J06 A;  1MUZ A;  1QKW A;  2BZ8 A;  4AG2 C;  2YT6 A;  2CH4 A;  5IHI A;  2RQU A;  4OML A;  2KR3 A;  1TUC A;  2EPD A;  1PRM C;  4ZNX A;  2GNC A;  3REB B;  2LMJ A;  4E6R A;  2DL7 A;  1SPK A;  1M30 A;  4RTZ A;  1BK2 A;  2PZ1 A;  1HD3 A;  4J9H A;  2E5K A;  2HDA A;  2DL5 A;  2KRM A;  2FRY A;  2JS2 A;  1SHF A;  2EYX A;  5IXF A;  2KRN A;  2JMA A;  1M27 C;  2YUP A;  2JMC A;  1GCQ A;  1UFF A;  2DF6 A;  2G6F X;  3M0P A;  4RTT A;  4CC3 A;  5L23 A;  4LN2 A;  2EKH A;  2W0Z A;  2CT3 A;  3I35 A;  1H92 A;  1JEG A;  2M0Y A;  2KGT A;  2DRK A;  2AZV A;  5GJW B;  3A98 A;  1N5Z A;  1I0C A;  1RI9 A;  1B3Q A;  1FYN A;  3FJ5 A;  3QWY A;  2CH4 W;  2I0N A;  1WYX A;  2KRO A;  1KIK A;  1ABQ A;  2JS0 A;  1M3B A;  2FPE A;  2X3X D;  1WX6 A;  2CT4 A;  4AFS C;  4IIO A;  4ESR A;  1EFN A;  1UJY A;  1UG1 A;  3JV3 A;  1QWE A;  3RNJ A;  2CSQ A;  1PKT A;  2M51 A;  3M0S A;  3VS1 A;  1Z9Q A;  2BZY A;  2NUZ A;  2J6F A;  2DL3 A;  2CUD A;  2LX7 A;  5FWB A;  4JZ3 A;  4F17 A;  4RUG A;  3KFV A;  1ZSG A;  3ULR B;  1B07 A;  2ED0 A;  1PRL C;  2DYB A;  2FPD A;  1U3O A;  4RTX A;  1ZUY A;  1GBR A;  1BBZ A;  1K76 A;  4J9B A;  2KEA A;  2V1R A;  1W1F A;  1QLY A;  4K11 A;  3VS5 A;  1GFC A;  2A08 A;  2IIM A;  4OMN A;  3UAT A;  2EGE A;  5IHN A;  2KT8 A;  1OPK A;  3VS4 A;  2LJ1 A;  1CSK A;  1NM7 A;  2H8H A;  2KT1 A;  1I07 A;  1M8M A;  4LE9 A;  2RQR A;  5I11 A;  1VYV A;  2DBM A;  1CKA A;  2DVJ A;  2LZ6 B;  2KXD A;  2RQV A;  1WIE A;  1TG0 A;  2X3W D;  2KXC A;  2HEQ A;  3PVQ A;  1AZG B;  1UE9 A;  1AD5 A;  2L3S A;  1PWT A;  1K1Z A;  2SRC A;  4OMO A;  3H41 A;  3NPF A;  2KYM A;  1T3L A;  1WI7 A;  2CDT A;  2HBW A;  2MCN A;  3EG1 A;  2FEI A;  1NG2 A;  4HCK A;  4HXJ A;  4CC7 A;  1JO8 A;  1PKS A;  1X43 A;  4LUE A;  2OAW A;  1ZLM A;  2MOX A;  3I5R A;  1U5S A;  3UA7 A;  1UTI A;  1YP5 A;  2YSQ A;  3VS3 A;  2ENM A;  2LCS A;  2C0T A;  4AFZ C;  2AK5 A;  2PNI A;  1AVZ C;  1GCP A;  2LJ3 A;  1WXT A;  2D1X A;  4JZ4 A;  1GL5 A;  1QKX A;  2LQN A;  4Z88 A;  1JQQ A;  2F2V A;  2L3Q A;  1FMK A;  1NLO C;  4Y92 A;  3VS2 A;  2DRM A;  1ZUK A;  1ZUU A;  1OEB A;  2DL4 A;  1K0S A;  1BB9 A;  3C0C A;  1G83 A;  2EGA A;  1OOT A;  1NLP C;  4LUD A;  1W70 A;  2L0A A;  1CKB A;  1AZE A;  4AFU C;  2DIL A;  1SRL A;  5IHK A;  2KE9 A;  1ABO A;  2RPN A;  1KFZ A;  4F16 A;  4A63 B;  1G2B A;  2CUB A;  1X6G A;  2NWM A;  3EG2 A;  1X2Q A;  2AZS A;  4EIK A;  2JM9 A;  2O2O A;  2FO0 A;  1E6G A;  5GJV B;  4JPB W;  3UA6 A;  2K79 A;  3H0F A;  2EYZ A;  3I5S A;  2EBP A;  3O5Z A;  2JW4 A;  4GLM A;  4LNP A;  4M4Z A;  1AOJ A;  1M3A A;  3H0I A;  1NYF A;  2K2M A;  2EGC A;  2A37 A;  2JXB A;  1SSH A;  2OI3 A;  1X27 A;  1JU5 C;  2XMF A;  1WA7 A;  2RNA A;  5IXB A;  1T0H A;  1WDX A;  3SEM A;  1UUE A;  1JXM A;  2EQI A;  3NHN A;  2EW3 A;  2LQW A;  4HVV A;  2ABL A;  2D8H A;  1YN8 A;  2K3B A;  3CQT A;  4D8D A;  2OJ2 A;  1TUD A;  1WXU A;  3UF4 A;  2RN8 A;  3M0U A;  1Y0M A;  2L3P A;  2HCK A;  1VA7 A;  1UDL A;  2C0O A;  2VWF A; 
#chains in the Genus database with same CATH topology
 3E19 A;  4HVW A;  3VS0 A;  1MMG A;  2KQW A;  5KYY A;  2SEM A;  3A1P A;  1YCS B;  1YI2 T;  4Z8A A;  1D3B A;  1YJ9 A;  3L2Q A;  2DMO A;  2EFI A;  2JT4 A;  1VQM T;  1GXI E;  4J9D A;  1Z9Z A;  1WFW A;  1VQO T;  3CBP A;  2JM8 A;  3C4S A;  2QGF B;  1IHW A;  2EQU A;  3OYJ A;  4RTU A;  2LX9 A;  3LYI A;  4E7I A;  5EG2 A;  1AHJ B;  2KBT A;  2X4J A;  1KD1 C;  1XOV A;  3L2Z A;  2KDS A;  3JB9 I;  2EQK A;  4JJB A;  1SF9 A;  1IO6 A;  1RLQ C;  3CCJ T;  2CP3 A;  4OVA A;  1KQS S;  2PQW A;  2WSC E;  2JNG A;  4PJN A;  3PNW C;  4OMP A;  3CCR Q;  4OF1 A;  1PD0 A;  2H3E B;  4ANJ A;  4PJO G;  1NYG A;  4F7U B;  1VQ9 Q;  3OW2 A;  1M90 U;  1LJO A;  3M4Y A;  3M5A A;  2V8K A;  1BIB A;  1U06 A;  1KHI A;  3AHU A;  1VQ8 A;  4EDU A;  5DLQ E;  2XU8 A;  2COY A;  3G1J A;  2A36 A;  4C92 E;  4C0D C;  1NPR A;  3F70 A;  4ORZ A;  5J3B A;  2AIR B;  3TRE A;  1NJI R;  2FG0 A;  2NUP A;  3HHT B;  2DJQ A;  3PFS A;  2F2X A;  2YRV A;  2ZZD A;  4M75 C;  2CSI A;  1EX4 A;  1LNX A;  2GQI A;  2RHI A;  2A28 A;  3VRZ A;  4C0F A;  5I22 A;  3JB9 D;  3THK A;  1VYU A;  4ZTF A;  2E12 A;  2D0N A;  2XHC A;  2QA4 A;  3H9N A;  2KAF A;  2DEQ A;  1H8K A;  2K5I A;  1WJR A;  3FIF A;  1YIT Q;  2RO0 A;  3J7A F;  4ZN3 A;  2BUD A;  1UEC A;  1QVG P;  1VOM A;  4A4K A;  2YUQ A;  1WXB A;  2GGR A;  3G6E A;  5DY9 A;  1Q7Y C;  1IRX A;  3FRN A;  4J9F A;  2JOY A;  5A0L A;  3CMA A;  1K4U S;  1IZ6 A;  2O88 A;  1N8R U;  2H3J A;  3EG0 A;  4M7A A;  4Q5W A;  1VQN T;  1RUW A;  4FSS A;  1RLP C;  1K73 C;  2DX1 A;  1E7O A;  1Q81 C;  1OPL A;  2DNU A;  4FIB A;  3CME Q;  3UWN A;  1RAB B;  4MDW A;  2OTJ A;  1NEB A;  1QCN A;  3ZFJ A;  5LJ5 g;  2EVR A;  3EHR A;  5FU7 C;  1NEG A;  1AWO A;  1YJW T;  5LJ3 d;  2J6O A;  2Y4Y A;  1S72 T;  1W6X A;  2KRS A;  2XK0 A;  4PJO D;  3EAE A;  2RI3 A;  2QG9 B;  2V26 A;  4PK4 A;  2K6D A;  2VUB A;  4R56 A;  2DA9 A;  1V76 A;  3OYA A;  2J06 A;  1N6A A;  3RUX A;  3QXE B;  5IHI A;  4C0G A;  1PM3 A;  2RQU A;  1O9S A;  4OML A;  6AT1 B;  2EPD A;  1PRM C;  4HCZ A;  2E65 A;  2GNC A;  2LMJ A;  2DL7 A;  1VQ6 A;  1SPK A;  4NL2 A;  2XID A;  3A8H B;  4C92 G;  4M75 B;  3CXC A;  2MYS A;  1BK2 A;  1M5Q 1;  2HDA A;  2DL5 A;  2RHU A;  2YRC A;  1SHF A;  5IXF A;  2JMA A;  2DF6 A;  5FLX E;  4RTT A;  4LN2 A;  2EKH A;  3ASK A;  3I35 A;  3A5Z B;  4O6J A;  1BI1 A;  3CCV Q;  5L8R E;  1M4Z A;  2HAX A;  3L2W A;  4BD3 A;  1YHQ A;  3A98 A;  2DPP B;  3GOX A;  1B3Q A;  3ER0 A;  1VQP T;  3QWY A;  1IB8 A;  2R5A A;  1N9R A;  2JTM A;  3SB2 A;  1QVF S;  2EJF A;  1ABQ A;  3CEY A;  2FPE A;  3HRU A;  3OS0 A;  4JRQ A;  1VQ8 Q;  3JCM e;  4HT9 A;  1UJY A;  3JV3 A;  4E7S A;  3OS5 A;  3FC3 A;  3M58 A;  1ZSZ A;  4LDX A;  3CCL A;  2LTO A;  9ATC B;  4GY5 A;  1ZSG A;  3ULR B;  3CC2 A;  1B07 A;  4CRI A;  2ED0 A;  1NPP A;  1U3O A;  4M7A F;  3MEA A;  3CCE T;  1B34 A;  5M9O A;  4QVZ A;  1BBZ A;  2QYZ A;  5DM7 R;  4WF2 A;  3GF5 A;  3QUI A;  2QA4 Q;  1VQ4 A;  1W1F A;  3QII A;  4II1 A;  1K9M C;  1UGS B;  4OMN A;  2RK1 A;  2DER A;  3OYB A;  5D6X A;  2LJ1 A;  2COW A;  2KT1 A;  3G6E Q;  4JS5 A;  4C8Q C;  3X26 B;  4L6V 5;  5I11 A;  3CC4 A;  1VYV A;  4M77 C;  2DBM A;  2R5M A;  3OA6 A;  2DVJ A;  3CMA Q;  3MCA B;  4N0A C;  5GAN e;  1TG0 A;  3CCQ A;  5LJ3 h;  2HEQ A;  2ZPB B;  4C92 D;  2XKO C;  4JRP A;  1Y71 A;  4QKU A;  1TU0 B;  2EIF A;  4FT4 A;  4KUI A;  4PJO A;  3RER A;  3H41 A;  1R8O B;  3EH1 A;  1FWZ A;  2OTJ Q;  2FEI A;  1BCO A;  2E1H A;  1PKS A;  4LUE A;  4PKC C;  3QDR B;  1FMV A;  4E7Z A;  3I5R A;  4OB2 B;  3CCR T;  1UTI A;  2PVD B;  2MK5 A;  1K8A U;  3VS3 A;  3LW5 E;  4LD6 A;  2ENM A;  1VQ9 T;  2LCS A;  5GAO q;  2PNI A;  1B7T A;  1I8F A;  1X75 C;  3VJP A;  2D1X A;  4JS4 A;  2VXF A;  4DOV A;  2COZ A;  4BI4 A;  2DRM A;  1ZA2 B;  3RKX A;  3T9N A;  4BE0 A;  1ZUK A;  3C0C A;  1JRI A;  4LUD A;  3LWH A;  4FSX A;  1G3S A;  3CCU A;  3JB9 F;  4KGV B;  1RAI B;  4EMH A;  2XDP A;  1KQS A;  1SRL A;  2HNI A;  1ABO A;  2RPN A;  1W2B S;  1TS9 A;  4A63 B;  4EIK A;  1O75 A;  2OX7 A;  3CPW A;  4XU1 A;  1I81 A;  3OYI A;  1WZO A;  3X24 B;  5LJ3 f;  4M78 B;  5GJV B;  2YWW A;  3GP8 A;  2EBP A;  3O5Z A;  4LNP A;  1YIT T;  2OAU A;  3TU4 K;  2QI2 A;  2XMF A;  1WA7 A;  2OTL A;  2RNA A;  4C8Q B;  5IXB A;  4M77 B;  1W4S A;  1M1F A;  5GAN 6;  3NHN A;  2QQB A;  5HY6 A;  3CC7 A;  3EGX A;  4HVV A;  2D8H A;  4ELY C;  4N4H A;  2CZ0 B;  2K3B A;  2RHY A;  4D8D A;  2OJ2 A;  3CCL Q;  4ME7 A;  2MPX C;  5GMK l;  1KHC A;  4AMC A;  2L3P A;  4E47 A;  3CC2 Q;  2RJD A;  4NOY A;  2JVV A;  2QAZ A;  3D7S B;  3LLR A;  1NZ9 A;  3PMI A;  3CME T;  4RCC A;  3NGP A;  3V8K A;  5A0D A;  2A7Y A;  4PFP A;  4XU0 A;  2R58 A;  4PJO F;  4M7D C;  4OMM A;  3OYF A;  1PHT A;  4X9D A;  1VQ4 Q;  1GFD A;  4PL6 A;  2CZ1 B;  4OB3 B;  5GMK i;  2AKL A;  4OGE A;  3VS7 A;  3CPF A;  2FZC B;  2QQA A;  2I2L A;  5CAI A;  1AWW A;  2E6N A;  2IG0 A;  2YLB A;  4C92 A;  2QQS A;  5KCO A;  2QAS A;  1X2K A;  3VUB A;  1XQH A;  1OU9 A;  1BI3 A;  4XQ3 A;  2K9G A;  3CC4 Q;  1WPY A;  4WCI A;  1NJI U;  3L2R A;  1G3W A;  1X01 A;  2M9U A;  2M1H A;  3VYH B;  3QHS A;  3CCQ Q;  4XTW A;  4ZGE B;  1BYM A;  5GAO l;  1OZ3 A;  1QCF A;  1QQJ A;  3HFN A;  1KD1 R;  1Q86 C;  1V1C A;  4BUG A;  5GMK h;  3L2V A;  2PUO B;  3HTR A;  2FHD A;  5FWC A;  4Z89 A;  2BZX A;  4V2S A;  3OY9 A;  5CK9 A;  2K3X A;  1Q82 U;  1S1N A;  2BIV A;  3ZL7 C;  2RQT A;  3RDV A;  5KYX B;  3JCM P;  3HL8 A;  3WVD B;  5IN1 A;  4JRK A;  3CBO A;  2P0P A;  2B8A A;  2D8J A;  3KUF A;  2ECZ A;  3DB4 A;  5GAN 5;  1GBQ A;  3OYC A;  2CRE A;  1VIF A;  4Y91 A;  1SEM A;  2E6Z A;  2DTH A;  3MP1 A;  2ZAE A;  5KYW B;  3JCM V;  4IUT A;  1H3H A;  4MZT A;  1YWP A;  1OV3 A;  3UDC A;  5GAO n;  3GIB A;  1VQ8 T;  1IGU A;  5GMK j;  4P5N A;  1D0Y A;  3EGD B;  3M56 A;  1T0J A;  1X6B A;  2WSE E;  1KC8 C;  2AT1 B;  1YWO A;  2F5T X;  3MKD A;  2P4R A;  1LOJ A;  3CCU Q;  1T3S A;  3KBG A;  2DBK A;  2E64 A;  1BU1 A;  3RKW A;  2DXB A;  4RCB A;  3JB9 G;  4M7D B;  5CVI A;  2C0I A;  1FMW A;  2LNV A;  2QA4 T;  2DET A;  4BDZ A;  2KNB B;  3DLL A;  5FRO A;  2B86 A;  2BKD N;  1Y96 B;  1GRI A;  3VS6 A;  5GAN g;  1RAC B;  3TQ7 P;  3OQ5 A;  3OYD A;  1Q7Y R;  4AG1 C;  4J9C A;  2HSP A;  4AFQ C;  1UHC A;  2ROT A;  4QT7 A;  1E6H A;  2HKQ B;  4KRT A;  2OTL Q;  3OS2 A;  1P92 A;  2LP5 A;  1IXD A;  1SSF A;  5ECA A;  2K7A A;  3CD6 A;  3G6E T;  2K5F A;  2XIC A;  3CC7 Q;  1VUB A;  4C92 F;  3MO8 A;  2RM4 A;  3BFM A;  8ATC B;  2O4X A;  2M16 A;  1K73 R;  2F2W A;  3CMA T;  3JCM d;  1Q81 R;  4FCY A;  3P8H A;  4LDW A;  1SRM A;  1MMA A;  2K2V A;  1QWF A;  1WHH A;  1Y57 A;  2RD1 A;  3I9Q A;  4LD9 K;  2DL8 A;  3UPU A;  1OX8 A;  1RAD B;  1ZHI A;  2OTJ T;  1MUZ A;  1QKW A;  5D6W A;  2CH4 A;  2RJE A;  1QVG A;  3V7S A;  5GAN 7;  1G8X A;  3AT1 B;  2ATC B;  2MAM A;  4RG8 A;  4ZNX A;  4QVD A;  2LVM A;  1M1K C;  3GPL A;  1VQ5 A;  1I5O B;  1F1B B;  1QVF P;  2XI9 A;  2JUF A;  5GAM d;  2HL5 C;  2KRM A;  3LGL A;  1VQ7 A;  3QYG B;  4FYW B;  1MMD A;  1UFF A;  2G6F X;  3M53 A;  4DOW A;  2QXF A;  1QP2 A;  4QW2 A;  4IUQ A;  2E10 A;  2DRK A;  3OSV A;  3QO3 A;  1VQ6 T;  5KE2 A;  1JBM A;  1FYN A;  2HSE B;  3RMQ A;  1KIK A;  1HXD A;  5KYU A;  3Q1J A;  3TEE A;  2DXT A;  1KQ2 A;  3JB9 H;  2CT4 A;  3ZBD A;  2FB7 A;  4ESR A;  1EFN A;  1MHN A;  1UG1 A;  3VV0 A;  4RG2 A;  1PKT A;  1TUG B;  4OP0 A;  3JCM X;  3VS1 A;  3G4S A;  1Z9Q A;  1MND A;  4X9C A;  4J6Y A;  4JZ3 A;  4RUG A;  3KFV A;  1R77 A;  3EG9 A;  4IUV A;  3RES A;  5CKB A;  1FXX A;  1PRL C;  5CKD A;  2RJC A;  4RTX A;  1ZUY A;  1GBR A;  2LDM A;  1OZ2 A;  2DD5 A;  3BE3 A;  1PSE A;  3P8D A;  3CCL T;  1I4K 1;  2RK2 A;  4K11 A;  1XJW B;  3I55 A;  3FB9 A;  2DFU A;  2EGE A;  3CC2 T;  3EFO B;  3R6O A;  3G71 A;  2LRQ A;  1WHJ A;  3VS4 A;  1CSK A;  2MWP A;  2QQ9 A;  5CO7 A;  2H8H A;  1ZBX A;  2VC8 A;  3SFM A;  2DIG A;  2VV5 A;  1K9M R;  4LE9 A;  3DLM A;  1VQK A;  1D1B A;  1VQ4 T;  4A4G A;  2PU9 B;  2KXD A;  2VYT A;  2RQV A;  3OMC A;  3JCM h;  5FU6 C;  2KXC A;  4M75 E;  1WHL A;  2EWN A;  4D6W A;  2HQH A;  2DO3 A;  1KG1 A;  2L3S A;  1YIJ A;  3E9F A;  1K1Z A;  4OMO A;  5HKC A;  1G5V A;  4RKU E;  3CD6 Q;  3MEU A;  2CDT A;  3CC4 T;  1YJ9 Q;  3CCM A;  2L89 A;  2QTV A;  4CC7 A;  1U8R A;  2OAW A;  3CCQ T;  2CS7 A;  1VQL A;  1TH7 A;  2F69 A;  2X9H A;  7AT1 B;  3DB3 A;  4AFZ C;  1AVZ C;  1AT1 B;  1W2B P;  4LXC A;  1G3Y A;  1U1T A;  5GAM h;  1TSF A;  4JZ4 A;  1GL5 A;  2E3H A;  1C1A A;  5CCA A;  2VGN A;  2F2V A;  3OYK A;  4XU2 A;  4Y92 A;  1VQ5 Q;  4L59 A;  1ZUU A;  5KH6 A;  1BB9 A;  1G83 A;  2LC4 A;  5KYY B;  4PLL A;  1W70 A;  4Z02 A;  4DQ2 A;  4A4H A;  2NUT A;  2JTF A;  3QKJ A;  3WVE B;  2P0K A;  1D3B B;  2FZK B;  3M55 A;  4BAC A;  4LDU A;  4F16 A;  1N27 A;  3LWI A;  5LJ5 d;  1X2Q A;  2AZS A;  5IT9 E;  2RI5 A;  1Q82 C;  3JCM b;  2O2O A;  2FO0 A;  3JCM f;  5GAM j;  3MHX A;  4M7A C;  2JW4 A;  3QSU A;  1AOJ A;  2DKG A;  3CCU T;  2K2M A;  2KSS A;  3C12 A;  2A37 A;  1SSH A;  2X51 A;  3LGF A;  1NE8 A;  1RAF B;  1IHV A;  1WHM A;  4XTV A;  3SEM A;  4FYV B;  4ZGJ B;  1BI0 A;  2EQI A;  2EW3 A;  4C0Z A;  4M78 C;  4BI3 A;  2DZC A;  5CQX A;  5FU6 B;  4JRI A;  4QQG A;  1TUD A;  5GMK m;  2XDB A;  3NTI A;  1Y07 A;  2WSF E;  3UF4 A;  2GF7 A;  2RN8 A;  1RI0 A;  2HCK A;  3P8B B;  2OTL T;  5GAM f;  1D0X A;  2C0O A;  3NFC A;  3G7Z A;  4M75 G;  4DA4 A;  2VWF A;  2L2P A;  1QP3 A;  4J9E A;  4OMQ A;  4PJM A;  4Y28 E;  2HBP A;  3CC7 T;  4XAX B;  1JXO A;  2K3Y A;  2DVE A;  4FL6 A;  4EMK A;  2HZY A;  2CYZ B;  3I56 A;  3OYY A;  1KD1 U;  2NUP B;  4PJJ A;  4GLK A;  2DYI A;  3I55 Q;  5GAN 3;  4C5E A;  3TVT A;  4KBM B;  4C5I A;  3OW2 S;  2RI2 A;  2YUN A;  3QWX X;  3G71 Q;  3S3O A;  2KMT A;  2XDD A;  1SHG A;  2DXU A;  5DLO A;  3FLG A;  3N5B B;  2J6K A;  4UC4 A;  3RMS A;  4CC4 B;  2JTE A;  1R0C B;  1VQK Q;  4J7F A;  2V8I A;  3SWN A;  1KSW A;  1D0Z A;  5GAO m;  1WQW A;  4F14 A;  5D6Y A;  4MZM A;  3DKM A;  1YIJ Q;  3OBY A;  4IIM A;  1YJN A;  4J9G A;  2ESW A;  2MIO A;  2EYW A;  3LH5 A;  3CCM Q;  3SD4 A;  1ZBJ A;  1HK9 A;  1PNJ A;  2ED1 A;  1OU8 A;  1TXQ A;  3J80 E;  4HA8 A;  1VQ6 Q;  1ZSZ C;  4PFZ A;  4M7A B;  4M78 E;  1Q86 R;  1VIE A;  4R0K A;  1H3Z A;  3GLX A;  1UHF A;  4MZP A;  3S3N A;  3VUZ A;  2K57 A;  1OUL A;  4IUP A;  1ZA1 B;  3PVL A;  1VQL Q;  2QDL A;  3HRT A;  1M90 C;  4C8Q E;  4BB7 A;  4XU3 A;  3UT1 A;  4M77 E;  5IH2 A;  2HL3 A;  2E41 A;  4A54 A;  3GBQ A;  1YHQ Q;  3VRY A;  2P84 A;  4X1V A;  1Q7Y U;  5LJ5 h;  4RTY A;  2DXC A;  2AKK A;  5LJ3 e;  1V29 B;  5GAN 8;  2O9V A;  1D1A A;  4KGX B;  1UGP B;  3PIO A;  4A4E A;  1LPL A;  3VU3 C;  3IQL A;  3MPU B;  4M75 D;  3V7R A;  3L42 A;  1M3C A;  1K73 U;  3TSW A;  5GAN 4;  1Q81 U;  1KC8 R;  4E2F B;  1MV0 B;  2FPF A;  4GBQ A;  1M9S A;  1M1G A;  1K9A A;  3TSZ A;  4HCC A;  2NLU A;  1A0N B;  2HMA A;  4XTZ A;  2CGH A;  1I1J A;  5I2S A;  5LJ5 j;  2E70 A;  5HCK A;  4PJO C;  1UGV A;  3RR6 A;  1HSQ A;  2YUO A;  3E2U A;  1BKB A;  3A8L B;  3S6W A;  4FU6 A;  1M2V A;  2LT1 A;  3SHW A;  1YBY A;  2J05 A;  1N8R C;  4RTW A;  3REA B;  2VGM A;  4QQ6 A;  2HD0 A;  1GCQ C;  2NUT B;  2DLP A;  3CCR A;  1AWX A;  4E7K A;  4J9I A;  3EHQ A;  1QVP A;  4KUL A;  3CD6 T;  4LDY A;  2QQR A;  2XG8 D;  1YJ9 T;  2BZ8 A;  1ZSZ B;  2YT6 A;  5LJ5 f;  1KQ1 A;  1PSF A;  1QCO A;  4FW2 A;  3REB B;  5A0G A;  3NTK A;  4B9X A;  4B9W A;  1B34 B;  1HD3 A;  4J9H A;  4E7L A;  2EJG A;  2FRY A;  2KRN A;  3V7C A;  1M27 C;  5HK3 A;  2JMC A;  1M1K R;  4C8Q G;  4CC3 A;  3M9Q A;  3CCS A;  4M77 G;  2JN0 A;  2C06 A;  2RHZ A;  1H92 A;  3H8Z A;  2L3R A;  1VQ5 T;  2QK0 A;  3PGG A;  1I0C A;  1RI9 A;  1M8V A;  2ZPF B;  4E7H A;  2LQK A;  3HKS A;  2KRO A;  3QJY A;  1VQ7 T;  2XD0 A;  3OB9 A;  4M7D E;  2X3X D;  4AFS C;  2PVO B;  2R57 A;  2E3I A;  1QWE A;  3RNJ A;  4BY6 C;  2M51 A;  2M02 A;  3M0S A;  5I21 A;  4FM4 B;  2KVQ G;  4PJO B;  2BZY A;  2NUZ A;  2F5K A;  4N4I A;  2QEX A;  2K5L A;  1K9M U;  2EAY A;  4OGC A;  3S3M A;  4DBR A;  2DYB A;  2FPD A;  2RA2 A;  2CP5 A;  4XTX A;  1BI2 A;  4PJL A;  4M75 A;  1QVF A;  4OB1 B;  4JJN K;  4J9B A;  3G4S T;  4DBH A;  5CKH A;  4C5H A;  5CQY A;  3VS5 A;  3URG A;  1C6V X;  3QJ6 A;  1KK7 A;  4PLI A;  4FYY B;  3UAT A;  2LT4 A;  4C92 C;  5IHN A;  2KT8 A;  5GAO p;  2YXY A;  2P0Q A;  1M8M A;  2ZPG B;  2LQ8 A;  2RQR A;  3PIP A;  5I2M A;  3I55 T;  2LZ6 B;  4F7U E;  3JCM Q;  4IUU A;  4M78 D;  1XTD A;  2X3W D;  3OYH A;  3G71 T;  1JJ2 P;  1AD5 A;  1SG5 A;  4JLG A;  3C94 A;  3QYH B;  2JZ2 A;  1T3L A;  1WI7 A;  4C8Q D;  4BDY A;  4M77 D;  1VQK T;  4J6W A;  2IVW A;  4RMO A;  1NG2 A;  3M54 A;  4J8O A;  5KE3 A;  1X43 A;  1ZLM A;  1X6O A;  2CP0 A;  2MOX A;  4R55 A;  4ZTJ A;  1U5S A;  3UA7 A;  1YP5 A;  3CCV A;  2YSQ A;  1YIJ T;  5KYN A;  2C0T A;  1XNI A;  3EGX B;  3CPW S;  3CCM T;  3QBY A;  4PNO A;  4MML A;  1YFN A;  4BY6 B;  3E1S A;  4M7D G;  5CR2 A;  4LDV A;  1JQQ A;  3HP9 A;  1NLO C;  1VQL T;  5J39 A;  5LJ3 g;  1K8A C;  5GAN d;  5CKE A;  1OEB A;  2DL4 A;  2HKN A;  1OOT A;  1NLP C;  2MF2 A;  2L0A A;  1CKB A;  1AZE A;  5AT1 B;  2CP2 A;  1D1C A;  2AHJ B;  5C6S A;  1UGR B;  2M0O A;  5CIU A;  5IHK A;  3PTA A;  3L1A A;  1YHQ T;  3CCS Q;  1M2V B;  1KFZ A;  2KY9 A;  3M4G A;  1G2B A;  2CZ6 B;  1X6G A;  2DIQ A;  3BDL A;  2WAC A;  2JM9 A;  5GAO r;  3QDF A;  1PCX A;  4JPB W;  4M75 F;  2LCL A;  2K79 A;  2EYZ A;  4C92 B;  4OB0 B;  4M4Z A;  2FZG B;  2A3L A;  4WTO B;  5KCH A;  1M3A A;  2ZPE B;  3NTH A;  2HQX A;  2EGC A;  2Y90 A;  2JXB A;  2OI3 A;  4BE1 A;  1Q82 R;  2LCC A;  4B6M A;  2MWO A;  1WDX A;  3EFS A;  3KXT A;  1ACM B;  4JDS A;  1JXM A;  3JSC A;  2LQW A;  3FJP A;  1W2B A;  4BI8 B;  1YN8 A;  4FYX B;  3JCM c;  4J5Y A;  5AYF A;  1YI2 A;  1TTH B;  3ME9 A;  3OW2 P;  2ZPH B;  2QEX Q;  2L8D A;  1D09 B;  1Y0M A;  4F7U G;  1VQM A;  2YRD A;  4QQD A;  3BY7 A;  8AT1 B;  1VQO A;  1UUE A;  3OYM A;  3PVQ A;  1AEY A;  5FRN A;  2L5Q A;  3FDR A;  4DEX A;  2DK3 A;  2DTO A;  5GAN 2;  2QTX A;  2VVK A;  3EG3 A;  1LCK A;  4ZGD B;  3OBW A;  3MEW A;  3CCJ A;  3BW1 A;  1ARK A;  4BE2 A;  4M78 A;  3JB9 J;  1Q86 U;  2ROL A;  3GNG A;  3RBB B;  3NMZ C;  5HK0 A;  4A53 A;  2V1Q A;  1RAA B;  3J81 E;  2CKK A;  3M59 A;  1WHG A;  4M7D D;  3I56 T;  2RQW A;  4C8Q A;  1WLP B;  4O5V A;  3U23 A;  1OQK A;  4M77 A;  1RAH B;  3JCM W;  2PVG B;  2QDY B;  1MV3 A;  1C0M A;  5EC7 A;  1JJ2 S;  3M0Q A;  3M0R A;  2KI7 A;  4C0D B;  3RKY A;  4N0A A;  3C95 A;  1EIF A;  3BDU A;  4RTV A;  1BIA A;  2BE7 D;  1VYT A;  2GCX A;  2D0Q B;  2E5Q A;  1YNZ A;  3V8L A;  4D8K A;  1EZZ B;  1NBE B;  1NJI C;  2FRW A;  3VKI A;  5C0M A;  4KH1 B;  3EGU A;  3X25 B;  5FW9 A;  3PMT A;  3M0T A;  1M2O A;  2O01 E;  1VQ7 Q;  5GAN h;  1KC8 U;  4KT0 E;  3TCJ A;  1N9S A;  1YJN T;  4JJD A;  1R0B G;  2YLC A;  2HQE A;  3GNF B;  4CC2 A;  2EYY A;  2O4X B;  2GTO A;  3X28 B;  3EH2 A;  4NS5 A;  4AT1 B;  4TVR A;  1AWJ A;  2IPO B;  1M90 R;  4EMG A;  2W10 A;  1ZX6 A;  2RMO A;  2VXE A;  1MMN A;  2GTJ A;  2PTK A;  1VQN A;  3H0H A;  1I5L A;  1UJ0 A;  2GFA A;  2V8J A;  1G3T A;  4JJC A;  4JUV A;  4DEY A;  5GAN j;  3OYN A;  1UB4 A;  1TWB A;  1WQ7 A;  3G4S Q;  2BE9 B;  4HCB A;  3MP6 A;  1X69 A;  1KJW A;  2YDL A;  4HVU A;  5FU7 B;  2O31 A;  1HJD A;  3CXC P;  2FVU A;  3PE0 A;  4J83 A;  1YJW A;  3ZEH A;  5KYX A;  2Y4X A;  1S72 A;  2G3R A;  2J7I A;  2VB6 A;  3MJX A;  2PUK B;  1K0S A;  2DE0 X;  2BTT A;  2RF0 A;  3LH0 A;  5GAM e;  2VAS A;  2EQJ A;  2DM1 A;  1QVG S;  4QVC A;  2FL7 A;  4M78 F;  2LNH B;  2O9S A;  3MET A;  3OYL A;  2DZ9 A;  2VKN A;  5KYW A;  2DTI A;  1YI2 Q;  1WJS A;  3VYG A;  5GAN f;  5KYU B;  1K0X A;  1J3T A;  2RJF A;  3R6N A;  3EGD A;  4C8Q F;  2EQM A;  1M1K U;  1VQM Q;  4M77 F;  1MNE A;  2LJ0 A;  1VQO Q;  2KYB A;  2KK4 A;  2DAQ A;  2GBQ A;  3QPH A;  1N8R R;  4AG2 C;  1Y7X A;  4M7A E;  4KUD K;  1ZQ1 A;  3JAM E;  2KR3 A;  1TUC A;  4ELZ C;  1OX9 A;  4M7D A;  3CCJ Q;  3M57 A;  2DEU A;  3EG9 B;  4E6R A;  2K4Y A;  1PG5 B;  1M30 A;  2X35 A;  4RTZ A;  2PZ1 A;  1VQP A;  2E5K A;  1Y96 A;  3OSS C;  2JS2 A;  2D6F A;  2EYX A;  5IAY A;  2YUP A;  1MGQ A;  4J6X A;  1GCQ A;  5L23 A;  3M0P A;  3HPW A;  3JCM J;  2W0Z A;  2CT3 A;  5LJ3 j;  4FT2 A;  1JEG A;  2M0Y A;  3SDZ A;  2KGT A;  5FRM A;  2AZV A;  5GJW B;  1N5Z A;  4N4G A;  1FX7 A;  3FJ5 A;  2CH4 W;  2I0N A;  1WYX A;  4XTY A;  2JS0 A;  1M3B A;  4J7I A;  2X4Y A;  1PC0 A;  2EJ9 A;  3CCS T;  1WX6 A;  4IIO A;  4DBF A;  3CCE A;  1OI1 A;  2CSQ A;  2J6F A;  2DL3 A;  2CUD A;  2LX7 A;  5FWB A;  4F17 A;  3OS1 A;  1H64 1;  3HSB A;  4MMK A;  4F7U A;  3A8M B;  5A2Q E;  1YCY A;  2GFU A;  4EMK C;  3QG1 A;  4IUR A;  4CI0 C;  1TOV A;  1K76 A;  1QMC A;  2KEA A;  3OYE A;  2A0F B;  2MI6 A;  2V1R A;  4ZN1 A;  1QLY A;  1GFC A;  2A08 A;  1WGS A;  2QEX T;  2IIM A;  4E7J A;  3INZ A;  4KGZ B;  2RB6 A;  1VQN Q;  2D9T A;  2FYK A;  1OPK A;  1NM7 A;  5CKF A;  2RHX A;  1I07 A;  4X34 A;  2JJ9 A;  4XK8 E;  5D7U A;  3H6Z A;  3CXC S;  3SWN C;  1WHK A;  1CKA A;  1YJW Q;  4M7A G;  1WIE A;  1RAG B;  1S72 Q;  1AZG B;  1KQS P;  3LX7 A;  1PD1 A;  4ATO A;  1UE9 A;  3A8O B;  4M7D F;  2YHT A;  3HRS A;  1PWT A;  2SRC A;  3O8V A;  1VQ9 A;  1IRE B;  1HYO A;  3CPW P;  3NPF A;  3I56 Q;  2KYM A;  2ZGW A;  3E9G A;  2HBW A;  1WJQ A;  2GQV A;  4YTL A;  2MCN A;  1WNL A;  3EG1 A;  5LJ5 e;  4HCK A;  1DJ7 B;  4HXJ A;  4M78 G;  1JO8 A;  2ZPI B;  5J26 A;  3PT9 A;  1UEB A;  3QZ5 B;  3JRZ A;  2ZCF B;  3MEV A;  3X20 B;  2QGG A;  4JLI A;  3L2U A;  2AK5 A;  2CZ7 B;  2X4X A;  2Z0W A;  1GCP A;  4EPC A;  3EFO A;  4A4F A;  1UGQ B;  1WXT A;  2LJ3 A;  4HT8 A;  2DD4 A;  1IGQ A;  2EKO A;  2X4W A;  4IKF A;  3V8J A;  1QKX A;  2LQN A;  3HFO A;  4XTU A;  2RH2 A;  4Z88 A;  4NL3 A;  2L3Q A;  1FMK A;  3JCM g;  3CCV T;  3VS2 A;  4PJO E;  4C5G A;  4OMF B;  1YJN Q;  2EGA A;  2MMP A;  1U1S A;  3WXM B;  1YIT A;  1RL2 A;  1VQP Q;  4AFU C;  4DBQ A;  2DIL A;  4EMK B;  3CBM A;  1K8A R;  2F1L A;  2KE9 A;  1BCM A;  2NYS A;  1JJ2 A;  4MDX A;  4HKE A;  2CUB A;  3EG2 A;  2NWM A;  1OYX A;  4F7U F;  5LL6 S;  2P4T A;  1E6G A;  3UA6 A;  3H0F A;  3I5S A;  3RIR A;  4GLM A;  3H0I A;  1NYF A;  4L5G A;  1X27 A;  1JU5 C;  5GAM g;  3OYG A;  1T0H A;  4KH0 B;  2CP7 A;  2CP6 A;  3SWN B;  1JB0 E;  3CME A;  4F04 B;  3A8G B;  3CCE Q;  4PFO A;  3QZ9 B;  2ABL A;  1RAE B;  3MP8 A;  2E4H A;  2EYQ A;  3CQT A;  4M7A D;  2DJZ A;  5GMK e;  1SKU B;  3OMG A;  1WXU A;  3EFR A;  4FW1 A;  3M0U A;  1QW1 A;  1VA7 A;  1Q95 G;  1LVK A;  1UDL A;  3FEO A;  4VUB A; 
#chains in the Genus database with same CATH homology
 2L2P A;  4HVW A;  3VS0 A;  1AEY A;  4J9E A;  4OMQ A;  3NGP A;  2SEM A;  1JXO A;  4DEX A;  1YCS B;  2VVK A;  4OMM A;  1PHT A;  1GFD A;  4Z8A A;  3EG3 A;  1LCK A;  2DMO A;  3TVT A;  2AKL A;  1ARK A;  2JT4 A;  3VS7 A;  4J9D A;  2YUN A;  1Z9Z A;  3QWX X;  1WFW A;  2JM8 A;  1AWW A;  1SHG A;  2ROL A;  3RBB B;  4RTU A;  3NMZ C;  1X2K A;  2J6K A;  2V1Q A;  2K9G A;  2KBT A;  4CC4 B;  2JTE A;  4WCI A;  1XOV A;  2RQW A;  1WLP B;  3U23 A;  4JJB A;  1IO6 A;  1RLQ C;  1KSW A;  1MV3 A;  4OMP A;  5EC7 A;  3M0Q A;  3M0R A;  4F14 A;  1QCF A;  1NYG A;  4RTV A;  4IIM A;  1V1C A;  1VYT A;  5FWC A;  4J9G A;  1YNZ A;  2ESW A;  2MIO A;  4Z89 A;  4D8K A;  2BZX A;  1U06 A;  2EYW A;  3LH5 A;  1ZBJ A;  1PNJ A;  2ED1 A;  2FRW A;  1S1N A;  3ZL7 C;  2RQT A;  3EGU A;  5FW9 A;  4R0K A;  1UHF A;  2A36 A;  2D8J A;  3M0T A;  3PVL A;  4ORZ A;  2ECZ A;  2QDL A;  1GBQ A;  2CRE A;  2FG0 A;  1SEM A;  4JJD A;  2DJQ A;  4CC2 A;  2F2X A;  5IH2 A;  2CSI A;  2EYY A;  1H3H A;  2GTO A;  1YWP A;  1OV3 A;  2GQI A;  2A28 A;  3GBQ A;  3VRY A;  3VRZ A;  5I22 A;  1AWJ A;  3THK A;  1VYU A;  4X1V A;  4RTY A;  2D0N A;  2W10 A;  2AKK A;  1ZX6 A;  1T0J A;  1H8K A;  2RMO A;  1X6B A;  2O9V A;  1YWO A;  2P4R A;  2GTJ A;  1T3S A;  2PTK A;  3IQL A;  3H0H A;  2DBK A;  1UJ0 A;  4JJC A;  1BU1 A;  1UEC A;  1M3C A;  3TSW A;  4DEY A;  2YUQ A;  1WXB A;  2C0I A;  2GGR A;  1MV0 B;  1X69 A;  2FPF A;  4GBQ A;  1KJW A;  2YDL A;  1K9A A;  3TSZ A;  4J9F A;  4HVU A;  2O31 A;  1HJD A;  1A0N B;  2KNB B;  3PE0 A;  2B86 A;  1K4U S;  3VS6 A;  1GRI A;  2O88 A;  3EG0 A;  1I1J A;  2J7I A;  4AG1 C;  1RUW A;  5HCK A;  4FSS A;  1RLP C;  4J9C A;  2HSP A;  4AFQ C;  1UHC A;  1UGV A;  2DE0 X;  2ROT A;  1E6H A;  1HSQ A;  2YUO A;  4KRT A;  2BTT A;  2RF0 A;  4QT7 A;  2LP5 A;  2DX1 A;  2DM1 A;  1E7O A;  1OPL A;  5ECA A;  2K7A A;  2DNU A;  1NEB A;  2LNH B;  2O9S A;  2VKN A;  2EVR A;  3EHR A;  3SHW A;  1NEG A;  2F2W A;  1AWO A;  2J05 A;  2J6O A;  4RTW A;  3REA B;  1K0X A;  1J3T A;  1SRM A;  1W6X A;  2KRS A;  3R6N A;  1GCQ C;  1QWF A;  1Y57 A;  2DLP A;  2LJ0 A;  1AWX A;  2KYB A;  3I9Q A;  2K6D A;  4J9I A;  3EHQ A;  2GBQ A;  2DL8 A;  2DA9 A;  2J06 A;  1MUZ A;  1QKW A;  2BZ8 A;  4AG2 C;  2YT6 A;  2CH4 A;  5IHI A;  2RQU A;  4OML A;  2KR3 A;  1TUC A;  2EPD A;  1PRM C;  4ZNX A;  2GNC A;  3REB B;  2LMJ A;  4E6R A;  2DL7 A;  1SPK A;  1M30 A;  4RTZ A;  1BK2 A;  2PZ1 A;  1HD3 A;  4J9H A;  2E5K A;  2HDA A;  2DL5 A;  2KRM A;  2FRY A;  2JS2 A;  1SHF A;  2EYX A;  5IXF A;  2KRN A;  2JMA A;  1M27 C;  2YUP A;  2JMC A;  1GCQ A;  1UFF A;  2DF6 A;  2G6F X;  3M0P A;  4RTT A;  4CC3 A;  5L23 A;  4LN2 A;  2EKH A;  2W0Z A;  2CT3 A;  3I35 A;  1H92 A;  1JEG A;  2M0Y A;  2KGT A;  2DRK A;  2AZV A;  5GJW B;  3A98 A;  1N5Z A;  1I0C A;  1RI9 A;  1B3Q A;  1FYN A;  3FJ5 A;  3QWY A;  2CH4 W;  2I0N A;  1WYX A;  2KRO A;  1KIK A;  1ABQ A;  2JS0 A;  1M3B A;  2FPE A;  2X3X D;  1WX6 A;  2CT4 A;  4AFS C;  4IIO A;  4ESR A;  1EFN A;  1UJY A;  1UG1 A;  3JV3 A;  1QWE A;  3RNJ A;  2CSQ A;  1PKT A;  2M51 A;  3M0S A;  3VS1 A;  1Z9Q A;  2BZY A;  2NUZ A;  2J6F A;  2DL3 A;  2CUD A;  2LX7 A;  5FWB A;  4JZ3 A;  4F17 A;  4RUG A;  3KFV A;  1ZSG A;  3ULR B;  1B07 A;  2ED0 A;  1PRL C;  2DYB A;  2FPD A;  1U3O A;  4RTX A;  1ZUY A;  1GBR A;  1BBZ A;  1K76 A;  4J9B A;  2KEA A;  2V1R A;  1W1F A;  1QLY A;  4K11 A;  3VS5 A;  1GFC A;  2A08 A;  2IIM A;  4OMN A;  3UAT A;  2EGE A;  5IHN A;  2KT8 A;  1OPK A;  3VS4 A;  2LJ1 A;  1CSK A;  1NM7 A;  2H8H A;  2KT1 A;  1I07 A;  1M8M A;  4LE9 A;  2RQR A;  5I11 A;  1VYV A;  2DBM A;  1CKA A;  2DVJ A;  2LZ6 B;  2KXD A;  2RQV A;  1WIE A;  1TG0 A;  2X3W D;  2KXC A;  2HEQ A;  3PVQ A;  1AZG B;  1UE9 A;  1AD5 A;  2L3S A;  1PWT A;  1K1Z A;  2SRC A;  4OMO A;  3H41 A;  3NPF A;  2KYM A;  1T3L A;  1WI7 A;  2CDT A;  2HBW A;  2MCN A;  3EG1 A;  2FEI A;  1NG2 A;  4HCK A;  4HXJ A;  4CC7 A;  1JO8 A;  1PKS A;  1X43 A;  4LUE A;  2OAW A;  1ZLM A;  2MOX A;  3I5R A;  1U5S A;  3UA7 A;  1UTI A;  1YP5 A;  2YSQ A;  3VS3 A;  2ENM A;  2LCS A;  2C0T A;  4AFZ C;  2AK5 A;  2PNI A;  1AVZ C;  1GCP A;  2LJ3 A;  1WXT A;  2D1X A;  4JZ4 A;  1GL5 A;  1QKX A;  2LQN A;  4Z88 A;  1JQQ A;  2F2V A;  2L3Q A;  1FMK A;  1NLO C;  4Y92 A;  3VS2 A;  2DRM A;  1ZUK A;  1ZUU A;  1OEB A;  2DL4 A;  1K0S A;  1BB9 A;  3C0C A;  1G83 A;  2EGA A;  1OOT A;  1NLP C;  4LUD A;  1W70 A;  2L0A A;  1CKB A;  1AZE A;  4AFU C;  2DIL A;  1SRL A;  5IHK A;  2KE9 A;  1ABO A;  2RPN A;  1KFZ A;  4F16 A;  4A63 B;  1G2B A;  2CUB A;  1X6G A;  2NWM A;  3EG2 A;  1X2Q A;  2AZS A;  4EIK A;  2JM9 A;  2O2O A;  2FO0 A;  1E6G A;  5GJV B;  4JPB W;  3UA6 A;  2K79 A;  3H0F A;  2EYZ A;  3I5S A;  2EBP A;  3O5Z A;  2JW4 A;  4GLM A;  4LNP A;  4M4Z A;  1AOJ A;  1M3A A;  3H0I A;  1NYF A;  2K2M A;  2EGC A;  2A37 A;  2JXB A;  1SSH A;  2OI3 A;  1X27 A;  1JU5 C;  2XMF A;  1WA7 A;  2RNA A;  5IXB A;  1T0H A;  1WDX A;  3SEM A;  1UUE A;  1JXM A;  2EQI A;  3NHN A;  2EW3 A;  2LQW A;  4HVV A;  2ABL A;  2D8H A;  1YN8 A;  2K3B A;  3CQT A;  4D8D A;  2OJ2 A;  1TUD A;  1WXU A;  3UF4 A;  2RN8 A;  3M0U A;  1Y0M A;  2L3P A;  2HCK A;  1VA7 A;  1UDL A;  2C0O A;  2VWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...