1UJ0A

Crystal structure of stam2 sh3 domain in complex with a ubpy-derived peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
58
structure length
58
Chain Sequence
MARRVRALYDFEAVEDNELTFKHGELITVLDDSDANWWQGENHRGTGLFPSNFVTTDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords signal transducing adaptor molecule (SH3 domain and ITAM mot
publication title Structural insight into modest binding of a non-PXXP ligand to the signal transducing adaptor molecule-2 Src homology 3 domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein/signaling protein
total genus 13
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2003-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1uj0A00
1SPKA 4IIOA 1A0NB 1ZUUA 3M0UA 1K76A 4D8DA 2RQUA 3VS2A 2V1RA 1XOVA 2GTJA 2GNCA 4Z89A 1Z9ZA 2E5KA 1W70A 2B86A 5HCKA 2J7IA 1S1NA 2EKHA 2CREA 2JS0A 2ENMA 4M4ZA 1ABOA 1GFCA 2SEMA 1GL5A 3M0PA 4AG1C 2HSPA 1T0JA 2KRSA 2LNHB 1BK2A 4HVUA 2FPDA 2YT6A 3NMZC 1VYTA 1YN8A 4ESRA 2DVJA 2RNAA 1OV3A 2LJ1A 1ARKA 2LZ6B 4DEXA 1OPLA 2JM8A 3R6NA 2BZYA 1JO8A 2KT1A 2K7AA 2YDLA 2O9SA 2RQVA 3H0FA 2CT4A 2K3BA 1GBQA 1UHCA 5I22A 1M3BA 4J9DA 1WA7A 3FJ5A 4RTZA 1WX6A 2NWMA 2FPEA 3U23A 3EG1A 1SHGA 1J3TA 1AZGB 2OI3A 4RTTA 2DBKA 1M8MA 4JPBW 1X6BA 1VYUA 4J9HA 4OMPA 4OMNA 2KGTA 1ABQA 4AFSC 1I1JA 1BU1A 4ORZA 3VS7A 2A36A 2GBQA 2O31A 2QDLA 2YUNA 1BB9A 3VRZA 1X69A 1U3OA 1NM7A 1PKTA 2L3SA 2J05A 1WXTA 2I0NA 1TUCA 2J06A 2YSQA 1K0SA 1H92A 2GTOA 1ZSGA 1AVZC 5IHIA 4JJCA 2HDAA 2EQIA 3VS4A 1UFFA 1HD3A 4Y92A 2MCNA 1AWJA 3TVTA 5L23A 3KFVA 2LP5A 5ECAA 3ZL7C 1GBRA 1PHTA 2JTEA 1YWPA 3I9QA 2D0NA 1PKSA 2PZ1A 1KIKA 1WXUA 3M0RA 1QLYA 1X6GA 2AZSA 2CH4W 2DMOA 1JEGA 2DRMA 3H41A 2LJ0A 3VS6A 2L3PA 2D8JA 2J6OA 2KR3A 3IQLA 3EG3A 3RNJA 2EGAA 3NPFA 2EBPA 1AZEA 1WLPB 2V1QA 4HVVA 4LN2A 4E6RA 2BTTA 3SHWA 2EVRA 2L0AA 3UA7A 3VS0A 4Z8AA 3UF4A 2RPNA 2DJQA 2VWFA 3RBBB 2DNUA 4J9FA 2DA9A 2KBTA 1X43A 2CUBA 1WYXA 1JQQA 2EYZA 3EHQA 4CC2A 3JV3A 2MIOA 1YP5A 1MV3A 2K2MA 2ABLA 2X3WD 1HSQA 2KXDA 2EPDA 2C0IA 2HEQA 1UG1A 2EYXA 2JT4A 1NLPC 4AG2C 2D8HA 2ROTA 2L3QA 1M3CA 1Y0MA 2F2WA 1UDLA 4R0KA 3EGUA 1Y57A 1I0CA 1YWOA 2DBMA 1FYNA 4F17A 4LUDA 1SRLA 3CQTA 1CKAA 2LCSA 5I11A 1LCKA 1IO6A 2FG0A 1K9AA 2CDTA 1OPKA 1U06A 2ED0A 1E6GA 4RTXA 2PTKA 1NEGA 1QKXA 1B07A 2NUZA 2DL3A 1UHFA 3NGPA 2GQIA 2K9GA 1NYFA 1YNZA 2DX1A 2M0YA 2O2OA 5IHNA 4ZNXA 3I5RA 2YUOA 2ECZA 1WFWA 4J9EA 1X2QA 3GBQA 1FMKA 1AOJA 1X2KA 2KE9A 1RI9A 3PVLA 3VS5A 1GRIA 1G83A 1YCSB 1AWXA 2DM1A 3PVQA 2G6FX 1SRMA 4OMQA 4K11A 2AKLA 4JZ3A 1K1ZA 1X27A 5IH2A 1JXMA 1PWTA 2D1XA 2ROLA 2RQWA 2CUDA 1WXBA 1B3QA 4F14A 1UGVA 4RTWA 1EFNA 1HJDA 3H0IA 2O88A 1WI7A 3EHRA 4LE9A 2EW3A 4J9BA 4LUEA 2HCKA 3I35A 1JU5C 2DL5A 4J9GA 4OMOA 3TSWA 1VA7A 4GBQA 1UTIA 1OEBA 3VRYA 1RLPC 2EGCA 1QKWA 4AFQC 3REBB 3LH5A 1CKBA 1QWFA 2RMOA 2DILA 4DEYA 2BZ8A 2LQNA 3I5SA 1PRLC 1M3AA 3EG2A 2F2XA 3H0HA 1U5SA 2JM9A 2JW4A 1GCQA 4RTUA 4OMMA 5IXFA 4HCKA 2SRCA 2EGEA 1KSWA 1NLOC 2OJ2A 2CH4A 2BZXA 1WIEA 2DRKA 1E6HA 1RUWA 1PNJA 5IXBA 2AZVA 1I07A 1VYVA 2H8HA 1SHFA 2XMFA 2VKNA 2LQWA 5FWBA 1AD5A 2DL7A 2KNBB 1SSHA 1UJ0A 1KJWA 1ZX6A 1ZLMA 1TUDA 2LX7A 3M0TA 1UJYA 5FWCA 2RN8A 4JJBA 1BBZA 4RTYA 1M30A 2W10A 4EIKA 1PRMC 2OAWA 2EYWA 4QT7A 3QWXX 1UUEA 2FPFA 4CC4B 1T0HA 1Z9QA 3ULRB 4D8KA 4A63B 1RLQC 1ZUYA 4RTVA 2ED1A 4J9CA 1AWOA 1OOTA 2P4RA 1JXOA 4AFUC 1MV0B 1GCQC 2J6FA 2A28A 3NHNA 2CT3A 2KRNA 3M0QA 1ZUKA 2C0OA 5FW9A 2A37A 2JMAA 2LJ3A 2RQTA 4J9IA 4WCIA 1GFDA 1T3LA 2O9VA 4F16A 2DL4A 2AKKA 3VS3A 3UA6A 1H3HA 2FEIA 2FRWA 3PE0A 2DYBA 2DF6A 1G2BA 2X3XD 4X1VA 1AWWA 4CC3A 3REAB 2IIMA 1AEYA 4HXJA 1UECA 1ZBJA 5EC7A 1NG2A 2EYYA 1K0XA 3O5ZA 4AFZC 4JJDA 5GJWB 1M27C 1NEBA 4FSSA 2L2PA 3QWYA 2A08A 2K79A 1W1FA 2YUPA 4KRTA 2FO0A 2ESWA 3SEMA 4HVWA 1NYGA 1W6XA 1WDXA 3C0CA 2CSIA 4CC7A 1TG0A 1UE9A 3M0SA 1CSKA 2KEAA 2F2VA 1GCPA 2PNIA 2JXBA 2YUQA 2KT8A 2KXCA 1SEMA 2AK5A 1QWEA 2KRMA 4IIMA 2HBWA 2K6DA 4OMLA 1T3SA 5IHKA 2DL8A 1KFZA 1H8KA 3THKA 2KYMA 2JMCA 2LMJA 2RQRA 2JS2A 2RF0A 4Z88A 1MUZA 1E7OA 1QCFA 4GLMA 2CSQA 2FRYA 4LNPA 1V1CA 2C0TA 5GJVB 3VS1A 2MOXA 2DLPA 2KROA 4JZ4A 2J6KA 2M51A 2KYBA 1K4US 3A98A 3UATA 2GGRA 3EG0A 2VVKA 3TSZA 4RUGA 2W0ZA 1N5ZA 2DE0X
chains in the Genus database with same CATH superfamily
3UT1A 1A0NB 3QJYA 4M75D 1YIJA 2RQUA 4D6WA 1QVPA 4M7AC 2E5QA 1NBEB 1W70A 2B86A 1S1NA 3G6EA 2ENMA 1B7TA 2GFAA 5KH6A 2SEMA 3P8HA 3M0PA 2KAFA 1M1KU 2O4XA 2HSPA 3PMTA 2LNHB 1BK2A 2DYIA 1JB0E 2O01E 2NUPB 1YN8A 1XTDA 2DVJA 3I55T 4ZN3A 2CP3A 1UGSB 3CMAA 1OPLA 3P8DA 3JCMV 3GF5A 3V8LA 1QVFP 4BD3A 1RAAB 4FW2A 1VQ8Q 1F1BB 2CKKA 1QCOA 3CCVT 3H0FA 4IURA 1V29B 1M3BA 3FJ5A 1YI2Q 2NWMA 5LJ3d 3U23A 3CCJA 1SHGA 1J3TA 2OI3A 4RTTA 4HT9A 1X6BA 4J9HA 3V7CA 5GAOr 3G4SQ 4PLIA 4OMPA 4OMNA 4XU0A 4EPCA 1YITT 4M7DG 3N5BB 2V8IA 3LLRA 4LD9K 1NM7A 1WJQA 3X25B 4HCBA 3CXCA 3HRUA 1IXDA 3JCMX 2D0QB 1K0SA 1AVZC 2YLCA 2E3IA 4C92D 3VS4A 3J81E 2K5IA 5GANf 2VXFA 2PQWA 4FCYA 4FT4A 5L23A 3KFVA 2GF7A 4OMFB 3OYAA 2JTEA 3I9QA 1JJ2P 3TCJA 4FSXA 3O8VA 2QK0A 3GLXA 1QLYA 2AZSA 1WPYA 1OULA 3SWNA 1OI1A 2L3PA 2D8JA 3IQLA 3VV0A 3CCUA 3RKYA 4E6RA 4M7AD 1TOVA 3X24B 2RI2A 2RPNA 2DJQA 4IUPA 2CUBA 3EHQA 2X4XA 3OA6A 3JV3A 4ZGEB 1Q7YC 1M2OA 1HSQA 2EPDA 3A8HB 2HEQA 5KE3A 4EDUA 2JT4A 3QYGB 1NLPC 4AG2C 4C0ZA 3CCEA 3AT1B 2KY9A 1TWBA 1D3BB 4R55A 3X20B 1UDLA 1UEBA 1BCMA 3JB9H 2A7YA 5GAMg 1Y57A 3BY7A 1I0CA 5A0LA 3LWHA 3EGDB 1M90R 3S3NA 3MO8A 3S3MA 3R6OA 1VQOA 4EMGA 4M78D 1IO6A 1LJOA 4P5NA 2ED0A 4RTXA 3CPWS 2P0PA 2NUPA 2OTJT 3OB9A 3RMQA 1PM3A 2RD1A 2K9GA 1PG5B 5IHNA 4DBRA 3X28B 1O9SA 3QZ9B 1D0XA 2E65A 2COWA 3A5ZB 4QVZA 4QVDA 3J7AF 1VQ4Q 5CKFA 4XAXB 3Q1JA 3JB9I 1Q7YU 4M77C 2COYA 2KE9A 1P92A 3PVLA 5LJ5h 1G83A 2JN0A 4M7DF 1VQ6Q 4K11A 1VQ5A 2AKLA 1RAHB 1K1ZA 4J6WA 1JXMA 2D1XA 2RQWA 2CUDA 5FRMA 2XU8A 1RAEB 2CS7A 1R77A 2QEXA 2XG8D 1VQ9A 1VQMA 4GLKA 1M1KR 2DK3A 4A54A 3CC4A 1WI7A 1SF9A 3EHRA 3CCQA 3I35A 1JU5C 2E1HA 4GBQA 2K3XA 5GAN7 3REBB 3QG1A 4JDSA 1CKBA 3CCJQ 5KYUB 2JUFA 3L2UA 2KVQG 3HHTB 1JRIA 1WZOA 3EG2A 4PK4A 2R58A 3H0HA 1TTHB 2QASA 3NTKA 3CD6T 4M75A 2QXFA 4OMMA 1H3ZA 3L2WA 4XTVA 4Z02A 5CK9A 4RMOA 4OVAA 1BYMA 3OBWA 1KSWA 4C92G 1BIBA 2OJ2A 5DY9A 4E7JA 1N6AA 3M4YA 2RJDA 1RUWA 1PNJA 4XU1A 3RESA 1WHJA 5KYXA 1VYVA 4KUIA 2MPXC 2DL7A 3H9NA 4Y28E 1S72A 4WTOB 1KJWA 1ZA1B 3JCMQ 1RADB 1TXQA 5HK0A 2HQEA 4VUBA 4HT8A 1ZLMA 1N9SA 5FWCA 2RN8A 3UPUA 1M30A 3FC3A 5IT9E 2HQHA 2LTOA 2YHTA 2OAWA 1MNEA 2RJCA 1D3BA 5FU7C 1W2BP 2FPFA 2EQKA 3I55Q 3M59A 2GQVA 1HK9A 1RLQC 5GAN8 1WHGA 1ZUYA 1KQ2A 4J9CA 1OOTA 1JXOA 4M77D 1BI1A 2DVEA 3G71A 4PJOE 2DZCA 3X26B 3PNWC 1KHCA 4F7UB 2CT3A 2QTVA 4KGZB 3OY9A 5GAOm 4LDWA 3PGGA 3OSSC 4PFOA 1PC0A 2C0OA 5FW9A 2JMAA 1T3LA 2H3JA 2ZPGB 4C8QB 5GAMe 2QGGA 3NTIA 4M7DC 5D7UA 4B9XA 3CCEQ 2DTHA 1VQLT 1V76A 4C92A 2DYBA 3MEVA 2DF6A 1G2BA 1AWWA 3OYIA 1U1TA 3CBMA 4F7UE 2VGNA 1UECA 1MMGA 1ZBJA 3NFCA 4M78G 4PLLA 3QKJA 2XIDA 2M02A 3JB9D 1K0XA 5GJWB 1M27C 2M0OA 1MMNA 2L2PA 2OTLT 4C8QE 5LJ5g 5CCAA 5CKEA 2R57A 2FO0A 4KRTA 4OGEA 2ESWA 3QDRB 1NYGA 5GANd 1UE9A 1CSKA 4M7AA 3KBGA 1GCPA 4ZGJB 2JXBA 4DOVA 4J7IA 2PVOB 3LH0A 5GAN2 2KRMA 3GOXA 1VQKT 3SDZA 1C6VX 3MPUB 2VV5A 3OYJA 2JMCA 4PJNA 1IB8A 2RF0A 3JRZA 2MI6A 1MUZA 5KYUA 2ZPEB 3C12A 4OB3B 2CSQA 1GXIE 2FRYA 1Q7YR 3A1PA 1VUBA 3L2ZA 1M5Q1 3V7SA 3E9FA 4FYXB 3JB9J 4JZ4A 1VQ9Q 2LQKA 3CC4Q 4M77B 3CCQQ 3EG0A 5LJ3j 1YI2A 2DE0X 1SPKA 5I21A 1ZUUA 3VKIA 1PD1A 2O4XB 4D8DA 3EH2A 8AT1B 3VS2A 2GNCA 5L8RE 3G4SA 4MZPA 1K8AC 1KD1R 3CCLA 4Z89A 1Z9ZA 1NE8A 2E5KA 3CCRT 2JS0A 2LT1A 2QQRA 1HYOA 5J26A 4AG1C 1MMDA 1LOJA 1T0JA 2E6ZA 2BIVA 4WF2A 2IVWA 2RHUA 3G7ZA 4HVUA 2FPDA 2NLUA 2YT6A 4M7DD 1Y7XA 1QP3A 2RNAA 3S3OA 2LJ1A 2OTJQ 2CP0A 2X4YA 2BZYA 1JO8A 4OF1A 3LWIA 5CIUA 2FZCB 2LT4A 2E6NA 3TREA 3HPWA 4F7UA 2RQVA 1B34B 2E10A 2CT4A 1GBQA 1UHCA 2OX7A 1WHLA 4RTZA 1WX6A 4JUVA 4FW1A 2E4HA 2VUBA 3JCMe 2RI5A 1YHQA 1VQNQ 1Y07A 1VYUA 5DLOA 3PT9A 4JRQA 4EMHA 2KGTA 4AFSC 1I1JA 3VS7A 2A36A 2GBQA 3JCMW 1I8FA 1BB9A 3CPWP 1X69A 1U3OA 1K8AU 2J05A 1WXTA 3CCMT 3G71Q 2J06A 4JJCA 3MP6A 2EQIA 4Y92A 5FU7B 4FYWB 2MCNA 4PJOF 3MP1A 3TVTA 3GNGA 2DEUA 2D0NA 2PUKB 2MWPA 5GAOl 1PKSA 1UGRB 1WXUA 1X6GA 4C92C 2DRMA 1SG5A 2BUDA 3VS6A 4MDXA 3CC2T 3RNJA 1MNDA 4L59A 4BY6C 2EBPA 1AZEA 2HD0A 4IUVA 4LN2A 6AT1B 1WHHA 2BTTA 1Q82C 5GAMh 2YRCA 4J9FA 2JNGA 2EYZA 1JQQA 4CC2A 3CCST 2FHDA 4NOYA 1MV3A 2K2MA 2ABLA 3WXMB 1NZ9A 2EYXA 1VQ4A 2L8DA 4A53A 4E7KA 4M77A 2DD4A 3FLGA 5I2SA 1KQSA 2ROTA 1M3CA 3L42A 2BE7D 2CP7A 4R0KA 1VQ6A 1Q95G 1N8RC 5AT1B 4FM4B 5CVIA 5FRNA 2CP5A 4F17A 5FU6C 4N0AC 1CKAA 2I2LA 2B8AA 2QA4T 5I11A 1D1BA 5GAN5 3OYKA 2Y4YA 4XK8E 1LCKA 4C0GA 1E6GA 1NEGA 1QKXA 1B07A 2V8KA 9ATCB 2DL3A 4AMCA 2GQIA 4ZNXA 2P4TA 3OYNA 2AHJB 1Q82U 2ECZA 2QQ9A 4EMKC 5KYYB 1WFWA 4M78C 5DLQE 3QYHB 3GBQA 2HSEB 1AOJA 3CCLQ 1B34A 3GIBA 2KDSA 2RH2A 3L2VA 1GRIA 2DM1A 2G6FX 1SRMA 5LJ5f 2EJGA 3FB9A 3E1SA 1PWTA 3M58A 2OTLQ 2DIGA 1RI0A 2DIQA 2LCLA 1N8RU 3S6WA 4F04B 3OS1A 4LE9A 4BB7A 4N4HA 4J9BA 4LUEA 3TSWA 2DL5A 2GCXA 4OMOA 5DM7R 3M53A 4II1A 2KSSA 4DBFA 1VIEA 1OEBA 3VRYA 1RLPC 3FIFA 1X75C 4M75B 2JZ2A 2DTIA 2LDMA 1VQKQ 2QG9B 2X4WA 4AFQC 2KMTA 3LGLA 3LH5A 1C1AA 1YHQQ 2E3HA 4ZTFA 3I55A 2BZ8A 2LQNA 1PRLC 3EH1A 1RAIB 3ASKA 1U5SA 2NUTA 1ACMB 4RTUA 5HKCA 5KYXB 2SRCA 1YBYA 4M75E 2EAYA 1UB4A 1WIEA 4J8OA 1TUGB 2RJEA 4JS4A 3JCMh 2ZZDA 2AZVA 1I07A 3OYHA 4ZTJA 1K8AR 1OYXA 4KGXB 4M7DA 1SHFA 4YTLA 5FWBA 3HRTA 1D0ZA 1YITA 4JJNK 1U8RA 3NTHA 3KUFA 4A4FA 3CCRQ 1ZX6A 4FT2A 4C0DB 3M0TA 1UJYA 4PNOA 1BBZA 5C0MA 2W10A 1OZ3A 4RCCA 4EIKA 2EYWA 2A0FB 3QWXX 3HKSA 1QCNA 1Z9QA 2K57A 2ATCB 4A63B 3LW5E 3BFMA 4E7SA 2ED1A 5GANj 2A28A 3NHNA 1OX9A 1YJ9T 2JTFA 3BE3A 4C92B 2WSCE 3UDCA 4OGCA 1G3SA 4N4IA 2K3YA 4PJJA 5KE2A 2LJ3A 2DD5A 2PU9B 3OBYA 4BE2A 4BY6B 5LL6S 3BW1A 1RABB 2LVMA 2MF2A 2DL4A 2AKKA 3VS3A 2IG0A 1QMCA 3UA6A 1H3HA 3HTRA 2X3XD 5GMKj 4CC3A 5KYYA 2HL5C 5GMKm 2XK0A 2IIMA 4C5HA 4C92E 3HFOA 2DZ9A 1QW1A 1XQHA 2EYYA 2EJ9A 3EAEA 4M7AB 2G3RA 3RR6A 4JJDA 3E9GA 2ZPBB 1NEBA 1D1CA 1SSFA 1YFNA 2RHIA 3OYFA 2K79A 1W1FA 4B9WA 4HCZA 2D9TA 1I5LA 5KCHA 2CSIA 1TG0A 1VQPT 3VJPA 5FU6B 2PNIA 3HSBA 2YUQA 3L2RA 2KT8A 2XHCA 4BACA 3CC2Q 1FMVA 1QWEA 1I4K1 3I56T 4MZTA 4M7AE 1RL2A 3CEYA 1K9MC 3D7SB 5HY6A 1VQ7T 4UC4A 1YJNT 4XU2A 1Q82R 5LJ3e 2KYMA 1LNXA 2MWOA 3M54A 2JS2A 3FEOA 4Z88A 1EIFA 1PD0A 2OTJA 5GMKh 1QCFA 4GLMA 4LNPA 1XJWB 4EMKB 3DB4A 3CCSQ 2CP2A 4M78B 3CMET 3A98A 3PIPA 3QDFA 2VVKA 3CBOA 3TSZA 2AT1B 3RKWA 3CC7T 4X34A 3EFSA 4GY5A 2YXYA 2R5AA 3C95A 1N8RR 1K76A 2R5MA 1QP2A 1VQNA 1QVGS 1XOVA 3MEWA 4E7IA 1ZA2B 5KYNA 3JCMg 2J7IA 2YWWA 2CREA 4M78E 3OYGA 4M4ZA 1GL5A 2CP6A 2XICA 1WNLA 3A8GB 3TQ7P 3OMCA 2VGMA 2MYSA 1KHIA 3NMZC 1I81A 1WQWA 1K9MU 1OV3A 3FDRA 3CCVQ 1ARKA 2JM8A 3R6NA 2COZA 2F1LA 3PTAA 1NPRA 3JCMc 3LX7A 2XDPA 2O9SA 5A2QE 1Y96A 3CD6A 1YITQ 1ZBXA 4LDVA 2EYQA 1UGQB 3EG1A 3EG9B 1AZGB 1AHJB 2DBKA 1VQ8T 1G3YA 1M8MA 3VYGA 2P0QA 1ABQA 5LJ5d 2L89A 2QDLA 1NJIC 3VRZA 1WGSA 3KXTA 2L3SA 3QO3A 4QQGA 1LVKA 2EFIA 2I0NA 2BKDN 2FVUA 4KH1B 1TUCA 4L5GA 4QW2A 2GTOA 1KQSS 1UFFA 1HD3A 2FZKB 2JOYA 8ATCB 2HKNA 4ZN1A 2X35A 4E2FB 3HFNA 1AWJA 3OW2A 4PJOG 4B6MA 1PHTA 1YWPA 2RK2A 3CPWA 2PZ1A 4RKUE 2CH4W 1IZ6A 1YJWT 3H41A 4N0AA 4FL6A 5GANg 4QVCA 2KR3A 3EG3A 1M2VA 2EGAA 2ZAEA 1WLPB 2V1QA 4HVVA 5D6WA 1VIFA 2L5QA 2EVRA 3UA7A 3VS0A 1M1FA 4Z8AA 2VWFA 5GMKl 2XI9A 1K73C 2KBTA 3RUXA 2MIOA 1YP5A 5GAMf 4EMKA 1VQLA 4KH0B 2DERA 4OB1B 1BI0A 4M78A 2KXDA 2C0IA 2BE9B 1NJIU 4LDUA 4LDXA 2X9HA 3V8KA 4C8QG 2DAQA 1Y0MA 1VOMA 1WHKA 4O5VA 3CXCS 1FX7A 3EGUA 4M77E 2RO0A 3TU4K 1YWOA 2OTLA 4JRKA 4LXCA 1WJRA 4TVRA 3LYIA 2DTOA 4HCCA 1YJ9Q 4ANJA 3OS0A 2CDTA 5FLXE 2VB6A 4PFZA 3J80E 3NGPA 1UHFA 2DJZA 1VQKA 2O2OA 1YNZA 4DBQA 2M16A 4NS5A 5LJ3h 1FMWA 2K2VA 2L3RA 2K5LA 5GAN3 2ZPIB 1X2QA 1K73U 2HKQB 2Y4XA 1FMKA 1X2KA 1WJSA 3VS5A 1IGQA 1YCYA 1QVFA 1AWXA 5CAIA 3EFOA 4OMQA 1YIJT 4PJLA 1N27A 1M9SA 3EG9A 3UWNA 2HL3A 5IH2A 4XU3A 3MHXA 1B3QA 3VUBA 3G6ET 1UGVA 3H8ZA 2RJFA 1VQ6T 4MZMA 1VQPQ 2EW3A 1IREB 2JVVA 2HCKA 4J9GA 1D0YA 2DXCA 1K9MR 3CCRA 2DXTA 2EGCA 2NUTB 3I56Q 3CMAT 2QI2A 3CD6Q 7AT1B 4BDZA 1QKWA 1VQ7Q 1BI3A 3QUIA 2QGFB 3I5SA 1M3AA 3MKDA 2XDDA 4JRPA 3WVDB 2P84A 1R8OB 2V8JA 1R0CB 4HCKA 3MJXA 4F7UF 3CCJT 4M7DB 3GNFB 2DPPB 1JJ2A 1HXDA 5A0GA 2EGEA 3EGXB 2CH4A 1E6HA 4IKFA 2ZGWA 2EQMA 5IXBA 4C8QF 4BDYA 1U1SA 3OQ5A 1Q86C 3JCMf 2VKNA 5M9OA 4KULA 2CGHA 3MEAA 3FRNA 5GANe 1SSHA 1UJ0A 2MK5A 1X6OA 4XTYA 3INZA 1TUDA 2LX7A 4RG2A 4M7DE 4HA8A 4JJBA 3RMSA 3CCMA 4J5YA 4QT7A 3M57A 1EX4A 1G8XA 3PFSA 1BIAA 1C0MA 3DB3A 1T0HA 3ULRB 1W4SA 4RTVA 2XKOC 5FROA 1AWOA 2P4RA 2VYTA 4ZGDB 2CZ0B 3QBYA 1MV0B 1GCQC 2DEQA 1PSFA 5GMKe 2C06A 3ZEHA 4XTXA 3VU3C 3RDVA 3CCUT 3M0QA 1VQLQ 1GFDA 4J9IA 1QVGP 2JTMA 3OMGA 3CC2A 5CQXA 2DXUA 4F16A 3L1AA 3A8OB 3E19A 4QQDA 2MMPA 4X1VA 1NJIR 4XTWA 1Q86U 4XQ3A 1AEYA 4HXJA 5LJ3g 3CCET 2EIFA 3CCSA 5EC7A 5J39A 3V8JA 1OZ2A 1OU9A 1NG2A 4M77F 4PJOC 3O5ZA 4AFZC 2F5KA 2YLBA 4KUDK 2A08A 4J6YA 2LRQA 3OYMA 4C5EA 4CC7A 1VQOT 5A0DA 2X4JA 2HZYA 3OSVA 3LGFA 1D09B 1Q81C 1YJWQ 3VUZA 2CZ7B 2QA4A 1G3TA 2EQUA 1T3SA 4NL2A 3QJ6A 4RG8A 4QKUA 3QSUA 1KFZA 4E7LA 2LMJA 2GFUA 2RQRA 3C94A 4JS5A 1E7OA 3M4GA 4NL3A 1K73R 3CCVA 1V1CA 2C0TA 3JB9F 4IUQA 1NPPA 1KQSP 2MOXA 2DLPA 4C8QC 1PCXA 2CYZB 1K4US 1VQ5T 5GAOp 4C5IA 2GGRA 5GAMd 2RHZA 3EGXA 4RUGA 1WQ7A 1ZSZC 4LDYA 4ELYC 2QEXT 2FZGB 4IIOA 2LC4A 2VASA 3M0UA 1VQ9T 5GAOn 1VQMT 2RB6A 4PJMA 3WVEB 2PVDB 3CC4T 1PSEA 2V1RA 4J6XA 3CCQT 2GTJA 3GPLA 5LJ5j 2F5TX 1D1AA 5HCKA 4KBMB 2EKHA 3ZFJA 5CKHA 1ABOA 1GFCA 1Q81U 2F69A 2CZ6B 2KRSA 3OYEA 2Z0WA 2QQBA 1VYTA 4ESRA 1KD1C 1Y96B 1Y71A 2LZ6B 4DEXA 3OYYA 3OW2S 1G5VA 4LD6A 1I5OB 4E47A 4JLIA 1MHNA 5KCOA 1WHMA 3M5AA 4RCBA 1W2BA 2KT1A 5AYFA 2K7AA 2YDLA 3VYHB 3DKMA 2NYSA 4M75G 2K5FA 3CXCP 2XD0A 2K3BA 4PJOD 5I22A 4DOWA 2KQWA 4J9DA 1WA7A 3TEEA 4ATOA 2RI3A 3RKXA 1X01A 2FPEA 1MGQA 4BI4A 1YIJQ 1M8VA 4CI0C 4JPBW 4C5GA 2DKGA 4IUUA 3CCMQ 3META 1M4ZA 3SFMA 1S72T 4J7FA 1IHVA 1BU1A 2VC8A 4ORZA 1H641 1JBMA 3G6EQ 3QPHA 2EKOA 3JCMP 2QYZA 2O31A 2YUNA 1RACB 4A4GA 3EFRA 1PKTA 1VQNT 1AT1B 5CKDA 3OYCA 2YSQA 1XNIA 1MMAA 1H92A 5GANh 3OS5A 1ZSGA 4PKCC 5IHIA 2HDAA 2P0KA 4OB0B 3CMAQ 2E41A 2QDYB 1M2VB 3G71T 2LP5A 1KD1U 5ECAA 4C8QD 3RERA 3ZL7C 1GBRA 4J83A 1RAGB 2M9UA 1KIKA 3M0RA 2DMOA 1JEGA 2LJ0A 5CO7A 5D6YA 2J6OA 3CBPA 1YJ9A 4FU6A 4OB2B 3DLLA 2LNVA 1BKBA 3NPFA 3OYBA 1TSFA 3RIRA 2HNIA 1M1GA 2K4YA 1ZQ1A 3L2QA 2QAZA 3SHWA 3T9NA 2KI7A 2L0AA 4XTZA 1Q86R 3UF4A 2EQJA 3RBBB 5CKBA 2DNUA 2DA9A 1X43A 1WYXA 3OYLA 1KC8C 2X3WD 2M1HA 4OP0A 1UG1A 4FIBA 3JCMd 2HBPA 2QTXA 1QVFS 2D8HA 4E7ZA 2KK4A 2L3QA 2F2WA 4PJOB 2QA4Q 4FYYB 5HK3A 2ZPHB 4DBHA 2DBMA 3DLMA 1FYNA 5C6SA 4LUDA 3SWNC 1SRLA 3CQTA 4Y91A 4M7AG 3JSCA 2LCSA 3ZBDA 3BDUA 1VQPA 3CCUQ 1IRXA 2FG0A 1K9AA 2ZCFB 1OPKA 1U06A 2DXBA 2PTKA 2NUZA 2ZPFB 4M75F 3EGDA 3I56A 1NYFA 2DX1A 2M0YA 1VQ7A 3I5RA 1YJNA 3EFOB 5GAOq 2YUOA 3FJPA 3P8BB 1EZZB 1OU8A 5LJ3f 4J9EA 3OS2A 3MEUA 4N4GA 4R56A 2OAUA 2Y90A 2RA2A 1YI2T 1RI9A 1KC8U 1JJ2S 1YCSB 3PVQA 4BUGA 4FYVB 3CMEA 2HQXA 2XDBA 3PIOA 1KG1A 2DFUA 4JZ3A 1X27A 1ZSZB 3G4ST 2ROLA 3CCLT 4PL6A 1WXBA 5J3BA 4F14A 3CC7A 2H3EB 2RM4A 4KGVB 1KK7A 3C4SA 3BDLA 4RTWA 1EFNA 4IUTA 1HJDA 3H0IA 1VQOQ 3M55A 1Q81R 1ZHIA 2O88A 2IPOB 4JLGA 2FYKA 3PMIA 1VA7A 4XTUA 1UTIA 4C0FA 3MP8A 2YRDA 2E12A 1O75A 3HL8A 2HMAA 1SKUB 1FXXA 4V2SA 1QWFA 2RMOA 2D6FA 2DILA 4DEYA 3G1JA 1G3WA 1TH7A 1UGPB 2F2XA 2QQSA 5IAYA 2DETA 3QXEB 5IN1A 5CR2A 1BCOA 5KYWB 2JM9A 5GAN4 3GP8A 2JW4A 1GCQA 4L6V5 5IXFA 1YHQT 4F7UG 2FL7A 3SB2A 2CZ1B 2FB7A 1VQ5Q 4PFPA 4C92F 4KT0E 4BI8B 1NLOC 5GMKi 2BZXA 2DRKA 2QEXQ 1R0BG 1VQMQ 2WACA 1VQ8A 3ME9A 3QIIA 5GAN6 4X9DA 2H8HA 3V7RA 2XMFA 2LQWA 1AD5A 2DO3A 2AIRB 4A4HA 2KNBB 2PUOB 2X51A 3ER0A 5I2MA 1IHWA 3E2UA 4RTYA 3SD4A 1PRMC 2EJFA 3M56A 4M7AF 1RAFB 4MMLA 2LQ8A 4PJOA 1UUEA 3F70A 4CC4B 4ELZC 4A4KA 4QQ6A 2QQAA 1QQJA 4D8KA 2YRVA 4DQ2A 1BI2A 4M75C 4AFUC 2J6FA 2WSEE 3JCMJ 1M90C 2KRNA 3AHUA 4AT1B 2LX9A 1ZUKA 2A37A 1YJWA 2RQTA 4WCIA 3URGA 1TU0B 2O9VA 2V26A 4BE0A 4MDWA 4A4EA 2LCCA 3JAME 2FEIA 2FRWA 3PE0A 4X9CA 1S72Q 1N9RA 2A3LA 3REAB 1VQ4T 3M9QA 2PVGB 4DA4A 2RK1A 3MCAB 2VXEA 4C8QA 2EWNA 4M78F 2RHXA 2MAMA 3OW2P 3OYDA 1DJ7B 2E64A 3A8MB 1QVGA 4M77G 1OQKA 5GAMj 4FSSA 3QWYA 1TS9A 3A8LB 1ZSZA 2YUPA 5D6XA 4C0DC 3SEMA 1FWZA 3CPFA 4HVWA 1W6XA 1WDXA 3C0CA 1KQ1A 1OX8A 3M0SA 3JCMb 1IGUA 2JJ9A 2KEAA 1YJNQ 2F2VA 1M1KC 3SWNB 2HAXA 4Q5WA 4E7HA 3HRSA 4JRIA 2KXCA 1SEMA 3QHSA 2AK5A 4IIMA 1M90U 2HBWA 2K6DA 4OMLA 5CQYA 2WSFE 5IHKA 2DL8A 4ME7A 1H8KA 3THKA 4O6JA 3CMEQ 2E70A 3HP9A 2RHYA 3JB9G 5EG2A 3H6ZA 1W2BS 3CC7Q 4MMKA 5GJVB 1KC8R 3VS1A 4BE1A 5LJ5e 5KYWA 2KROA 2J6KA 2M51A 2KYBA 3UATA 3QZ5B 2W0ZA 4BI3A 4HKEA 1N5ZA 4CRIA 1LPLA
chains in the Genus database with same CATH topology
1SPKA 4IIOA 1A0NB 1ZUUA 3M0UA 1K76A 4D8DA 2RQUA 3VS2A 2V1RA 1XOVA 2GTJA 2GNCA 4Z89A 1Z9ZA 2E5KA 1W70A 2B86A 5HCKA 2J7IA 1S1NA 2EKHA 2CREA 2JS0A 2ENMA 4M4ZA 1ABOA 1GFCA 2SEMA 1GL5A 3M0PA 4AG1C 2HSPA 1T0JA 2KRSA 2LNHB 1BK2A 4HVUA 2FPDA 2YT6A 3NMZC 1VYTA 1YN8A 4ESRA 2DVJA 2RNAA 1OV3A 2LJ1A 1ARKA 2LZ6B 4DEXA 1OPLA 2JM8A 3R6NA 2BZYA 1JO8A 2KT1A 2K7AA 2YDLA 2O9SA 2RQVA 3H0FA 2CT4A 2K3BA 1GBQA 1UHCA 5I22A 1M3BA 4J9DA 1WA7A 3FJ5A 4RTZA 1WX6A 2NWMA 2FPEA 3U23A 3EG1A 1SHGA 1J3TA 1AZGB 2OI3A 4RTTA 2DBKA 1M8MA 4JPBW 1X6BA 1VYUA 4J9HA 4OMPA 4OMNA 2KGTA 1ABQA 4AFSC 1I1JA 1BU1A 4ORZA 3VS7A 2A36A 2GBQA 2O31A 2QDLA 2YUNA 1BB9A 3VRZA 1X69A 1U3OA 1NM7A 1PKTA 2L3SA 2J05A 1WXTA 2I0NA 1TUCA 2J06A 2YSQA 1K0SA 1H92A 2GTOA 1ZSGA 1AVZC 5IHIA 4JJCA 2HDAA 2EQIA 3VS4A 1UFFA 1HD3A 4Y92A 2MCNA 1AWJA 3TVTA 5L23A 3KFVA 2LP5A 5ECAA 3ZL7C 1GBRA 1PHTA 2JTEA 1YWPA 3I9QA 2D0NA 1PKSA 2PZ1A 1KIKA 1WXUA 3M0RA 1QLYA 1X6GA 2AZSA 2CH4W 2DMOA 1JEGA 2DRMA 3H41A 2LJ0A 3VS6A 2L3PA 2D8JA 2J6OA 2KR3A 3IQLA 3EG3A 3RNJA 2EGAA 3NPFA 2EBPA 1AZEA 1WLPB 2V1QA 4HVVA 4LN2A 4E6RA 2BTTA 3SHWA 2EVRA 2L0AA 3UA7A 3VS0A 4Z8AA 3UF4A 2RPNA 2DJQA 2VWFA 3RBBB 2DNUA 4J9FA 2DA9A 2KBTA 1X43A 2CUBA 1WYXA 1JQQA 2EYZA 3EHQA 4CC2A 3JV3A 2MIOA 1YP5A 1MV3A 2K2MA 2ABLA 2X3WD 1HSQA 2KXDA 2EPDA 2C0IA 2HEQA 1UG1A 2EYXA 2JT4A 1NLPC 4AG2C 2D8HA 2ROTA 2L3QA 1M3CA 1Y0MA 2F2WA 1UDLA 4R0KA 3EGUA 1Y57A 1I0CA 1YWOA 2DBMA 1FYNA 4F17A 4LUDA 1SRLA 3CQTA 1CKAA 2LCSA 5I11A 1LCKA 1IO6A 2FG0A 1K9AA 2CDTA 1OPKA 1U06A 2ED0A 1E6GA 4RTXA 2PTKA 1NEGA 1QKXA 1B07A 2NUZA 2DL3A 1UHFA 3NGPA 2GQIA 2K9GA 1NYFA 1YNZA 2DX1A 2M0YA 2O2OA 5IHNA 4ZNXA 3I5RA 2YUOA 2ECZA 1WFWA 4J9EA 1X2QA 3GBQA 1FMKA 1AOJA 1X2KA 2KE9A 1RI9A 3PVLA 3VS5A 1GRIA 1G83A 1YCSB 1AWXA 2DM1A 3PVQA 2G6FX 1SRMA 4OMQA 4K11A 2AKLA 4JZ3A 1K1ZA 1X27A 5IH2A 1JXMA 1PWTA 2D1XA 2ROLA 2RQWA 2CUDA 1WXBA 1B3QA 4F14A 1UGVA 4RTWA 1EFNA 1HJDA 3H0IA 2O88A 1WI7A 3EHRA 4LE9A 2EW3A 4J9BA 4LUEA 2HCKA 3I35A 1JU5C 2DL5A 4J9GA 4OMOA 3TSWA 1VA7A 4GBQA 1UTIA 1OEBA 3VRYA 1RLPC 2EGCA 1QKWA 4AFQC 3REBB 3LH5A 1CKBA 1QWFA 2RMOA 2DILA 4DEYA 2BZ8A 2LQNA 3I5SA 1PRLC 1M3AA 3EG2A 2F2XA 3H0HA 1U5SA 2JM9A 2JW4A 1GCQA 4RTUA 4OMMA 5IXFA 4HCKA 2SRCA 2EGEA 1KSWA 1NLOC 2OJ2A 2CH4A 2BZXA 1WIEA 2DRKA 1E6HA 1RUWA 1PNJA 5IXBA 2AZVA 1I07A 1VYVA 2H8HA 1SHFA 2XMFA 2VKNA 2LQWA 5FWBA 1AD5A 2DL7A 2KNBB 1SSHA 1UJ0A 1KJWA 1ZX6A 1ZLMA 1TUDA 2LX7A 3M0TA 1UJYA 5FWCA 2RN8A 4JJBA 1BBZA 4RTYA 1M30A 2W10A 4EIKA 1PRMC 2OAWA 2EYWA 4QT7A 3QWXX 1UUEA 2FPFA 4CC4B 1T0HA 1Z9QA 3ULRB 4D8KA 4A63B 1RLQC 1ZUYA 4RTVA 2ED1A 4J9CA 1AWOA 1OOTA 2P4RA 1JXOA 4AFUC 1MV0B 1GCQC 2J6FA 2A28A 3NHNA 2CT3A 2KRNA 3M0QA 1ZUKA 2C0OA 5FW9A 2A37A 2JMAA 2LJ3A 2RQTA 4J9IA 4WCIA 1GFDA 1T3LA 2O9VA 4F16A 2DL4A 2AKKA 3VS3A 3UA6A 1H3HA 2FEIA 2FRWA 3PE0A 2DYBA 2DF6A 1G2BA 2X3XD 4X1VA 1AWWA 4CC3A 3REAB 2IIMA 1AEYA 4HXJA 1UECA 1ZBJA 5EC7A 1NG2A 2EYYA 1K0XA 3O5ZA 4AFZC 4JJDA 5GJWB 1M27C 1NEBA 4FSSA 2L2PA 3QWYA 2A08A 2K79A 1W1FA 2YUPA 4KRTA 2FO0A 2ESWA 3SEMA 4HVWA 1NYGA 1W6XA 1WDXA 3C0CA 2CSIA 4CC7A 1TG0A 1UE9A 3M0SA 1CSKA 2KEAA 2F2VA 1GCPA 2PNIA 2JXBA 2YUQA 2KT8A 2KXCA 1SEMA 2AK5A 1QWEA 2KRMA 4IIMA 2HBWA 2K6DA 4OMLA 1T3SA 5IHKA 2DL8A 1KFZA 1H8KA 3THKA 2KYMA 2JMCA 2LMJA 2RQRA 2JS2A 2RF0A 4Z88A 1MUZA 1E7OA 1QCFA 4GLMA 2CSQA 2FRYA 4LNPA 1V1CA 2C0TA 5GJVB 3VS1A 2MOXA 2DLPA 2KROA 4JZ4A 2J6KA 2M51A 2KYBA 1K4US 3A98A 3UATA 2GGRA 3EG0A 2VVKA 3TSZA 4RUGA 2W0ZA 1N5ZA 2DE0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SPK A;  4IIO A;  1A0N B;  1ZUU A;  3M0U A;  1K76 A;  4D8D A;  2RQU A;  3VS2 A;  2V1R A;  1XOV A;  2GTJ A;  2GNC A;  4Z89 A;  1Z9Z A;  2E5K A;  1W70 A;  2B86 A;  5HCK A;  2J7I A;  1S1N A;  2EKH A;  2CRE A;  2JS0 A;  2ENM A;  4M4Z A;  1ABO A;  1GFC A;  2SEM A;  1GL5 A;  3M0P A;  4AG1 C;  2HSP A;  1T0J A;  2KRS A;  2LNH B;  1BK2 A;  4HVU A;  2FPD A;  2YT6 A;  3NMZ C;  1VYT A;  1YN8 A;  4ESR A;  2DVJ A;  2RNA A;  1OV3 A;  2LJ1 A;  1ARK A;  2LZ6 B;  4DEX A;  1OPL A;  2JM8 A;  3R6N A;  2BZY A;  1JO8 A;  2KT1 A;  2K7A A;  2YDL A;  2O9S A;  2RQV A;  3H0F A;  2CT4 A;  2K3B A;  1GBQ A;  1UHC A;  5I22 A;  1M3B A;  4J9D A;  1WA7 A;  3FJ5 A;  4RTZ A;  1WX6 A;  2NWM A;  2FPE A;  3U23 A;  3EG1 A;  1SHG A;  1J3T A;  1AZG B;  2OI3 A;  4RTT A;  2DBK A;  1M8M A;  4JPB W;  1X6B A;  1VYU A;  4J9H A;  4OMP A;  4OMN A;  2KGT A;  1ABQ A;  4AFS C;  1I1J A;  1BU1 A;  4ORZ A;  3VS7 A;  2A36 A;  2GBQ A;  2O31 A;  2QDL A;  2YUN A;  1BB9 A;  3VRZ A;  1X69 A;  1U3O A;  1NM7 A;  1PKT A;  2L3S A;  2J05 A;  1WXT A;  2I0N A;  1TUC A;  2J06 A;  2YSQ A;  1K0S A;  1H92 A;  2GTO A;  1ZSG A;  1AVZ C;  5IHI A;  4JJC A;  2HDA A;  2EQI A;  3VS4 A;  1UFF A;  1HD3 A;  4Y92 A;  2MCN A;  1AWJ A;  3TVT A;  5L23 A;  3KFV A;  2LP5 A;  5ECA A;  3ZL7 C;  1GBR A;  1PHT A;  2JTE A;  1YWP A;  3I9Q A;  2D0N A;  1PKS A;  2PZ1 A;  1KIK A;  1WXU A;  3M0R A;  1QLY A;  1X6G A;  2AZS A;  2CH4 W;  2DMO A;  1JEG A;  2DRM A;  3H41 A;  2LJ0 A;  3VS6 A;  2L3P A;  2D8J A;  2J6O A;  2KR3 A;  3IQL A;  3EG3 A;  3RNJ A;  2EGA A;  3NPF A;  2EBP A;  1AZE A;  1WLP B;  2V1Q A;  4HVV A;  4LN2 A;  4E6R A;  2BTT A;  3SHW A;  2EVR A;  2L0A A;  3UA7 A;  3VS0 A;  4Z8A A;  3UF4 A;  2RPN A;  2DJQ A;  2VWF A;  3RBB B;  2DNU A;  4J9F A;  2DA9 A;  2KBT A;  1X43 A;  2CUB A;  1WYX A;  1JQQ A;  2EYZ A;  3EHQ A;  4CC2 A;  3JV3 A;  2MIO A;  1YP5 A;  1MV3 A;  2K2M A;  2ABL A;  2X3W D;  1HSQ A;  2KXD A;  2EPD A;  2C0I A;  2HEQ A;  1UG1 A;  2EYX A;  2JT4 A;  1NLP C;  4AG2 C;  2D8H A;  2ROT A;  2L3Q A;  1M3C A;  1Y0M A;  2F2W A;  1UDL A;  4R0K A;  3EGU A;  1Y57 A;  1I0C A;  1YWO A;  2DBM A;  1FYN A;  4F17 A;  4LUD A;  1SRL A;  3CQT A;  1CKA A;  2LCS A;  5I11 A;  1LCK A;  1IO6 A;  2FG0 A;  1K9A A;  2CDT A;  1OPK A;  1U06 A;  2ED0 A;  1E6G A;  4RTX A;  2PTK A;  1NEG A;  1QKX A;  1B07 A;  2NUZ A;  2DL3 A;  1UHF A;  3NGP A;  2GQI A;  2K9G A;  1NYF A;  1YNZ A;  2DX1 A;  2M0Y A;  2O2O A;  5IHN A;  4ZNX A;  3I5R A;  2YUO A;  2ECZ A;  1WFW A;  4J9E A;  1X2Q A;  3GBQ A;  1FMK A;  1AOJ A;  1X2K A;  2KE9 A;  1RI9 A;  3PVL A;  3VS5 A;  1GRI A;  1G83 A;  1YCS B;  1AWX A;  2DM1 A;  3PVQ A;  2G6F X;  1SRM A;  4OMQ A;  4K11 A;  2AKL A;  4JZ3 A;  1K1Z A;  1X27 A;  5IH2 A;  1JXM A;  1PWT A;  2D1X A;  2ROL A;  2RQW A;  2CUD A;  1WXB A;  1B3Q A;  4F14 A;  1UGV A;  4RTW A;  1EFN A;  1HJD A;  3H0I A;  2O88 A;  1WI7 A;  3EHR A;  4LE9 A;  2EW3 A;  4J9B A;  4LUE A;  2HCK A;  3I35 A;  1JU5 C;  2DL5 A;  4J9G A;  4OMO A;  3TSW A;  1VA7 A;  4GBQ A;  1UTI A;  1OEB A;  3VRY A;  1RLP C;  2EGC A;  1QKW A;  4AFQ C;  3REB B;  3LH5 A;  1CKB A;  1QWF A;  2RMO A;  2DIL A;  4DEY A;  2BZ8 A;  2LQN A;  3I5S A;  1PRL C;  1M3A A;  3EG2 A;  2F2X A;  3H0H A;  1U5S A;  2JM9 A;  2JW4 A;  1GCQ A;  4RTU A;  4OMM A;  5IXF A;  4HCK A;  2SRC A;  2EGE A;  1KSW A;  1NLO C;  2OJ2 A;  2CH4 A;  2BZX A;  1WIE A;  2DRK A;  1E6H A;  1RUW A;  1PNJ A;  5IXB A;  2AZV A;  1I07 A;  1VYV A;  2H8H A;  1SHF A;  2XMF A;  2VKN A;  2LQW A;  5FWB A;  1AD5 A;  2DL7 A;  2KNB B;  1SSH A;  1UJ0 A;  1KJW A;  1ZX6 A;  1ZLM A;  1TUD A;  2LX7 A;  3M0T A;  1UJY A;  5FWC A;  2RN8 A;  4JJB A;  1BBZ A;  4RTY A;  1M30 A;  2W10 A;  4EIK A;  1PRM C;  2OAW A;  2EYW A;  4QT7 A;  3QWX X;  1UUE A;  2FPF A;  4CC4 B;  1T0H A;  1Z9Q A;  3ULR B;  4D8K A;  4A63 B;  1RLQ C;  1ZUY A;  4RTV A;  2ED1 A;  4J9C A;  1AWO A;  1OOT A;  2P4R A;  1JXO A;  4AFU C;  1MV0 B;  1GCQ C;  2J6F A;  2A28 A;  3NHN A;  2CT3 A;  2KRN A;  3M0Q A;  1ZUK A;  2C0O A;  5FW9 A;  2A37 A;  2JMA A;  2LJ3 A;  2RQT A;  4J9I A;  4WCI A;  1GFD A;  1T3L A;  2O9V A;  4F16 A;  2DL4 A;  2AKK A;  3VS3 A;  3UA6 A;  1H3H A;  2FEI A;  2FRW A;  3PE0 A;  2DYB A;  2DF6 A;  1G2B A;  2X3X D;  4X1V A;  1AWW A;  4CC3 A;  3REA B;  2IIM A;  1AEY A;  4HXJ A;  1UEC A;  1ZBJ A;  5EC7 A;  1NG2 A;  2EYY A;  1K0X A;  3O5Z A;  4AFZ C;  4JJD A;  5GJW B;  1M27 C;  1NEB A;  4FSS A;  2L2P A;  3QWY A;  2A08 A;  2K79 A;  1W1F A;  2YUP A;  4KRT A;  2FO0 A;  2ESW A;  3SEM A;  4HVW A;  1NYG A;  1W6X A;  1WDX A;  3C0C A;  2CSI A;  4CC7 A;  1TG0 A;  1UE9 A;  3M0S A;  1CSK A;  2KEA A;  2F2V A;  1GCP A;  2PNI A;  2JXB A;  2YUQ A;  2KT8 A;  2KXC A;  1SEM A;  2AK5 A;  1QWE A;  2KRM A;  4IIM A;  2HBW A;  2K6D A;  4OML A;  1T3S A;  5IHK A;  2DL8 A;  1KFZ A;  1H8K A;  3THK A;  2KYM A;  2JMC A;  2LMJ A;  2RQR A;  2JS2 A;  2RF0 A;  4Z88 A;  1MUZ A;  1E7O A;  1QCF A;  4GLM A;  2CSQ A;  2FRY A;  4LNP A;  1V1C A;  2C0T A;  5GJV B;  3VS1 A;  2MOX A;  2DLP A;  2KRO A;  4JZ4 A;  2J6K A;  2M51 A;  2KYB A;  1K4U S;  3A98 A;  3UAT A;  2GGR A;  3EG0 A;  2VVK A;  3TSZ A;  4RUG A;  2W0Z A;  1N5Z A;  2DE0 X; 
#chains in the Genus database with same CATH topology
 3UT1 A;  1A0N B;  3QJY A;  4M75 D;  1YIJ A;  2RQU A;  4D6W A;  1QVP A;  4M7A C;  2E5Q A;  1NBE B;  1W70 A;  2B86 A;  1S1N A;  3G6E A;  2ENM A;  1B7T A;  2GFA A;  5KH6 A;  2SEM A;  3P8H A;  3M0P A;  2KAF A;  1M1K U;  2O4X A;  2HSP A;  3PMT A;  2LNH B;  1BK2 A;  2DYI A;  1JB0 E;  2O01 E;  2NUP B;  1YN8 A;  1XTD A;  2DVJ A;  3I55 T;  4ZN3 A;  2CP3 A;  1UGS B;  3CMA A;  1OPL A;  3P8D A;  3JCM V;  3GF5 A;  3V8L A;  1QVF P;  4BD3 A;  1RAA B;  4FW2 A;  1VQ8 Q;  1F1B B;  2CKK A;  1QCO A;  3CCV T;  3H0F A;  4IUR A;  1V29 B;  1M3B A;  3FJ5 A;  1YI2 Q;  2NWM A;  5LJ3 d;  3U23 A;  3CCJ A;  1SHG A;  1J3T A;  2OI3 A;  4RTT A;  4HT9 A;  1X6B A;  4J9H A;  3V7C A;  5GAO r;  3G4S Q;  4PLI A;  4OMP A;  4OMN A;  4XU0 A;  4EPC A;  1YIT T;  4M7D G;  3N5B B;  2V8I A;  3LLR A;  4LD9 K;  1NM7 A;  1WJQ A;  3X25 B;  4HCB A;  3CXC A;  3HRU A;  1IXD A;  3JCM X;  2D0Q B;  1K0S A;  1AVZ C;  2YLC A;  2E3I A;  4C92 D;  3VS4 A;  3J81 E;  2K5I A;  5GAN f;  2VXF A;  2PQW A;  4FCY A;  4FT4 A;  5L23 A;  3KFV A;  2GF7 A;  4OMF B;  3OYA A;  2JTE A;  3I9Q A;  1JJ2 P;  3TCJ A;  4FSX A;  3O8V A;  2QK0 A;  3GLX A;  1QLY A;  2AZS A;  1WPY A;  1OUL A;  3SWN A;  1OI1 A;  2L3P A;  2D8J A;  3IQL A;  3VV0 A;  3CCU A;  3RKY A;  4E6R A;  4M7A D;  1TOV A;  3X24 B;  2RI2 A;  2RPN A;  2DJQ A;  4IUP A;  2CUB A;  3EHQ A;  2X4X A;  3OA6 A;  3JV3 A;  4ZGE B;  1Q7Y C;  1M2O A;  1HSQ A;  2EPD A;  3A8H B;  2HEQ A;  5KE3 A;  4EDU A;  2JT4 A;  3QYG B;  1NLP C;  4AG2 C;  4C0Z A;  3CCE A;  3AT1 B;  2KY9 A;  1TWB A;  1D3B B;  4R55 A;  3X20 B;  1UDL A;  1UEB A;  1BCM A;  3JB9 H;  2A7Y A;  5GAM g;  1Y57 A;  3BY7 A;  1I0C A;  5A0L A;  3LWH A;  3EGD B;  1M90 R;  3S3N A;  3MO8 A;  3S3M A;  3R6O A;  1VQO A;  4EMG A;  4M78 D;  1IO6 A;  1LJO A;  4P5N A;  2ED0 A;  4RTX A;  3CPW S;  2P0P A;  2NUP A;  2OTJ T;  3OB9 A;  3RMQ A;  1PM3 A;  2RD1 A;  2K9G A;  1PG5 B;  5IHN A;  4DBR A;  3X28 B;  1O9S A;  3QZ9 B;  1D0X A;  2E65 A;  2COW A;  3A5Z B;  4QVZ A;  4QVD A;  3J7A F;  1VQ4 Q;  5CKF A;  4XAX B;  3Q1J A;  3JB9 I;  1Q7Y U;  4M77 C;  2COY A;  2KE9 A;  1P92 A;  3PVL A;  5LJ5 h;  1G83 A;  2JN0 A;  4M7D F;  1VQ6 Q;  4K11 A;  1VQ5 A;  2AKL A;  1RAH B;  1K1Z A;  4J6W A;  1JXM A;  2D1X A;  2RQW A;  2CUD A;  5FRM A;  2XU8 A;  1RAE B;  2CS7 A;  1R77 A;  2QEX A;  2XG8 D;  1VQ9 A;  1VQM A;  4GLK A;  1M1K R;  2DK3 A;  4A54 A;  3CC4 A;  1WI7 A;  1SF9 A;  3EHR A;  3CCQ A;  3I35 A;  1JU5 C;  2E1H A;  4GBQ A;  2K3X A;  5GAN 7;  3REB B;  3QG1 A;  4JDS A;  1CKB A;  3CCJ Q;  5KYU B;  2JUF A;  3L2U A;  2KVQ G;  3HHT B;  1JRI A;  1WZO A;  3EG2 A;  4PK4 A;  2R58 A;  3H0H A;  1TTH B;  2QAS A;  3NTK A;  3CD6 T;  4M75 A;  2QXF A;  4OMM A;  1H3Z A;  3L2W A;  4XTV A;  4Z02 A;  5CK9 A;  4RMO A;  4OVA A;  1BYM A;  3OBW A;  1KSW A;  4C92 G;  1BIB A;  2OJ2 A;  5DY9 A;  4E7J A;  1N6A A;  3M4Y A;  2RJD A;  1RUW A;  1PNJ A;  4XU1 A;  3RES A;  1WHJ A;  5KYX A;  1VYV A;  4KUI A;  2MPX C;  2DL7 A;  3H9N A;  4Y28 E;  1S72 A;  4WTO B;  1KJW A;  1ZA1 B;  3JCM Q;  1RAD B;  1TXQ A;  5HK0 A;  2HQE A;  4VUB A;  4HT8 A;  1ZLM A;  1N9S A;  5FWC A;  2RN8 A;  3UPU A;  1M30 A;  3FC3 A;  5IT9 E;  2HQH A;  2LTO A;  2YHT A;  2OAW A;  1MNE A;  2RJC A;  1D3B A;  5FU7 C;  1W2B P;  2FPF A;  2EQK A;  3I55 Q;  3M59 A;  2GQV A;  1HK9 A;  1RLQ C;  5GAN 8;  1WHG A;  1ZUY A;  1KQ2 A;  4J9C A;  1OOT A;  1JXO A;  4M77 D;  1BI1 A;  2DVE A;  3G71 A;  4PJO E;  2DZC A;  3X26 B;  3PNW C;  1KHC A;  4F7U B;  2CT3 A;  2QTV A;  4KGZ B;  3OY9 A;  5GAO m;  4LDW A;  3PGG A;  3OSS C;  4PFO A;  1PC0 A;  2C0O A;  5FW9 A;  2JMA A;  1T3L A;  2H3J A;  2ZPG B;  4C8Q B;  5GAM e;  2QGG A;  3NTI A;  4M7D C;  5D7U A;  4B9X A;  3CCE Q;  2DTH A;  1VQL T;  1V76 A;  4C92 A;  2DYB A;  3MEV A;  2DF6 A;  1G2B A;  1AWW A;  3OYI A;  1U1T A;  3CBM A;  4F7U E;  2VGN A;  1UEC A;  1MMG A;  1ZBJ A;  3NFC A;  4M78 G;  4PLL A;  3QKJ A;  2XID A;  2M02 A;  3JB9 D;  1K0X A;  5GJW B;  1M27 C;  2M0O A;  1MMN A;  2L2P A;  2OTL T;  4C8Q E;  5LJ5 g;  5CCA A;  5CKE A;  2R57 A;  2FO0 A;  4KRT A;  4OGE A;  2ESW A;  3QDR B;  1NYG A;  5GAN d;  1UE9 A;  1CSK A;  4M7A A;  3KBG A;  1GCP A;  4ZGJ B;  2JXB A;  4DOV A;  4J7I A;  2PVO B;  3LH0 A;  5GAN 2;  2KRM A;  3GOX A;  1VQK T;  3SDZ A;  1C6V X;  3MPU B;  2VV5 A;  3OYJ A;  2JMC A;  4PJN A;  1IB8 A;  2RF0 A;  3JRZ A;  2MI6 A;  1MUZ A;  5KYU A;  2ZPE B;  3C12 A;  4OB3 B;  2CSQ A;  1GXI E;  2FRY A;  1Q7Y R;  3A1P A;  1VUB A;  3L2Z A;  1M5Q 1;  3V7S A;  3E9F A;  4FYX B;  3JB9 J;  4JZ4 A;  1VQ9 Q;  2LQK A;  3CC4 Q;  4M77 B;  3CCQ Q;  3EG0 A;  5LJ3 j;  1YI2 A;  2DE0 X;  1SPK A;  5I21 A;  1ZUU A;  3VKI A;  1PD1 A;  2O4X B;  4D8D A;  3EH2 A;  8AT1 B;  3VS2 A;  2GNC A;  5L8R E;  3G4S A;  4MZP A;  1K8A C;  1KD1 R;  3CCL A;  4Z89 A;  1Z9Z A;  1NE8 A;  2E5K A;  3CCR T;  2JS0 A;  2LT1 A;  2QQR A;  1HYO A;  5J26 A;  4AG1 C;  1MMD A;  1LOJ A;  1T0J A;  2E6Z A;  2BIV A;  4WF2 A;  2IVW A;  2RHU A;  3G7Z A;  4HVU A;  2FPD A;  2NLU A;  2YT6 A;  4M7D D;  1Y7X A;  1QP3 A;  2RNA A;  3S3O A;  2LJ1 A;  2OTJ Q;  2CP0 A;  2X4Y A;  2BZY A;  1JO8 A;  4OF1 A;  3LWI A;  5CIU A;  2FZC B;  2LT4 A;  2E6N A;  3TRE A;  3HPW A;  4F7U A;  2RQV A;  1B34 B;  2E10 A;  2CT4 A;  1GBQ A;  1UHC A;  2OX7 A;  1WHL A;  4RTZ A;  1WX6 A;  4JUV A;  4FW1 A;  2E4H A;  2VUB A;  3JCM e;  2RI5 A;  1YHQ A;  1VQN Q;  1Y07 A;  1VYU A;  5DLO A;  3PT9 A;  4JRQ A;  4EMH A;  2KGT A;  4AFS C;  1I1J A;  3VS7 A;  2A36 A;  2GBQ A;  3JCM W;  1I8F A;  1BB9 A;  3CPW P;  1X69 A;  1U3O A;  1K8A U;  2J05 A;  1WXT A;  3CCM T;  3G71 Q;  2J06 A;  4JJC A;  3MP6 A;  2EQI A;  4Y92 A;  5FU7 B;  4FYW B;  2MCN A;  4PJO F;  3MP1 A;  3TVT A;  3GNG A;  2DEU A;  2D0N A;  2PUK B;  2MWP A;  5GAO l;  1PKS A;  1UGR B;  1WXU A;  1X6G A;  4C92 C;  2DRM A;  1SG5 A;  2BUD A;  3VS6 A;  4MDX A;  3CC2 T;  3RNJ A;  1MND A;  4L59 A;  4BY6 C;  2EBP A;  1AZE A;  2HD0 A;  4IUV A;  4LN2 A;  6AT1 B;  1WHH A;  2BTT A;  1Q82 C;  5GAM h;  2YRC A;  4J9F A;  2JNG A;  2EYZ A;  1JQQ A;  4CC2 A;  3CCS T;  2FHD A;  4NOY A;  1MV3 A;  2K2M A;  2ABL A;  3WXM B;  1NZ9 A;  2EYX A;  1VQ4 A;  2L8D A;  4A53 A;  4E7K A;  4M77 A;  2DD4 A;  3FLG A;  5I2S A;  1KQS A;  2ROT A;  1M3C A;  3L42 A;  2BE7 D;  2CP7 A;  4R0K A;  1VQ6 A;  1Q95 G;  1N8R C;  5AT1 B;  4FM4 B;  5CVI A;  5FRN A;  2CP5 A;  4F17 A;  5FU6 C;  4N0A C;  1CKA A;  2I2L A;  2B8A A;  2QA4 T;  5I11 A;  1D1B A;  5GAN 5;  3OYK A;  2Y4Y A;  4XK8 E;  1LCK A;  4C0G A;  1E6G A;  1NEG A;  1QKX A;  1B07 A;  2V8K A;  9ATC B;  2DL3 A;  4AMC A;  2GQI A;  4ZNX A;  2P4T A;  3OYN A;  2AHJ B;  1Q82 U;  2ECZ A;  2QQ9 A;  4EMK C;  5KYY B;  1WFW A;  4M78 C;  5DLQ E;  3QYH B;  3GBQ A;  2HSE B;  1AOJ A;  3CCL Q;  1B34 A;  3GIB A;  2KDS A;  2RH2 A;  3L2V A;  1GRI A;  2DM1 A;  2G6F X;  1SRM A;  5LJ5 f;  2EJG A;  3FB9 A;  3E1S A;  1PWT A;  3M58 A;  2OTL Q;  2DIG A;  1RI0 A;  2DIQ A;  2LCL A;  1N8R U;  3S6W A;  4F04 B;  3OS1 A;  4LE9 A;  4BB7 A;  4N4H A;  4J9B A;  4LUE A;  3TSW A;  2DL5 A;  2GCX A;  4OMO A;  5DM7 R;  3M53 A;  4II1 A;  2KSS A;  4DBF A;  1VIE A;  1OEB A;  3VRY A;  1RLP C;  3FIF A;  1X75 C;  4M75 B;  2JZ2 A;  2DTI A;  2LDM A;  1VQK Q;  2QG9 B;  2X4W A;  4AFQ C;  2KMT A;  3LGL A;  3LH5 A;  1C1A A;  1YHQ Q;  2E3H A;  4ZTF A;  3I55 A;  2BZ8 A;  2LQN A;  1PRL C;  3EH1 A;  1RAI B;  3ASK A;  1U5S A;  2NUT A;  1ACM B;  4RTU A;  5HKC A;  5KYX B;  2SRC A;  1YBY A;  4M75 E;  2EAY A;  1UB4 A;  1WIE A;  4J8O A;  1TUG B;  2RJE A;  4JS4 A;  3JCM h;  2ZZD A;  2AZV A;  1I07 A;  3OYH A;  4ZTJ A;  1K8A R;  1OYX A;  4KGX B;  4M7D A;  1SHF A;  4YTL A;  5FWB A;  3HRT A;  1D0Z A;  1YIT A;  4JJN K;  1U8R A;  3NTH A;  3KUF A;  4A4F A;  3CCR Q;  1ZX6 A;  4FT2 A;  4C0D B;  3M0T A;  1UJY A;  4PNO A;  1BBZ A;  5C0M A;  2W10 A;  1OZ3 A;  4RCC A;  4EIK A;  2EYW A;  2A0F B;  3QWX X;  3HKS A;  1QCN A;  1Z9Q A;  2K57 A;  2ATC B;  4A63 B;  3LW5 E;  3BFM A;  4E7S A;  2ED1 A;  5GAN j;  2A28 A;  3NHN A;  1OX9 A;  1YJ9 T;  2JTF A;  3BE3 A;  4C92 B;  2WSC E;  3UDC A;  4OGC A;  1G3S A;  4N4I A;  2K3Y A;  4PJJ A;  5KE2 A;  2LJ3 A;  2DD5 A;  2PU9 B;  3OBY A;  4BE2 A;  4BY6 B;  5LL6 S;  3BW1 A;  1RAB B;  2LVM A;  2MF2 A;  2DL4 A;  2AKK A;  3VS3 A;  2IG0 A;  1QMC A;  3UA6 A;  1H3H A;  3HTR A;  2X3X D;  5GMK j;  4CC3 A;  5KYY A;  2HL5 C;  5GMK m;  2XK0 A;  2IIM A;  4C5H A;  4C92 E;  3HFO A;  2DZ9 A;  1QW1 A;  1XQH A;  2EYY A;  2EJ9 A;  3EAE A;  4M7A B;  2G3R A;  3RR6 A;  4JJD A;  3E9G A;  2ZPB B;  1NEB A;  1D1C A;  1SSF A;  1YFN A;  2RHI A;  3OYF A;  2K79 A;  1W1F A;  4B9W A;  4HCZ A;  2D9T A;  1I5L A;  5KCH A;  2CSI A;  1TG0 A;  1VQP T;  3VJP A;  5FU6 B;  2PNI A;  3HSB A;  2YUQ A;  3L2R A;  2KT8 A;  2XHC A;  4BAC A;  3CC2 Q;  1FMV A;  1QWE A;  1I4K 1;  3I56 T;  4MZT A;  4M7A E;  1RL2 A;  3CEY A;  1K9M C;  3D7S B;  5HY6 A;  1VQ7 T;  4UC4 A;  1YJN T;  4XU2 A;  1Q82 R;  5LJ3 e;  2KYM A;  1LNX A;  2MWO A;  3M54 A;  2JS2 A;  3FEO A;  4Z88 A;  1EIF A;  1PD0 A;  2OTJ A;  5GMK h;  1QCF A;  4GLM A;  4LNP A;  1XJW B;  4EMK B;  3DB4 A;  3CCS Q;  2CP2 A;  4M78 B;  3CME T;  3A98 A;  3PIP A;  3QDF A;  2VVK A;  3CBO A;  3TSZ A;  2AT1 B;  3RKW A;  3CC7 T;  4X34 A;  3EFS A;  4GY5 A;  2YXY A;  2R5A A;  3C95 A;  1N8R R;  1K76 A;  2R5M A;  1QP2 A;  1VQN A;  1QVG S;  1XOV A;  3MEW A;  4E7I A;  1ZA2 B;  5KYN A;  3JCM g;  2J7I A;  2YWW A;  2CRE A;  4M78 E;  3OYG A;  4M4Z A;  1GL5 A;  2CP6 A;  2XIC A;  1WNL A;  3A8G B;  3TQ7 P;  3OMC A;  2VGM A;  2MYS A;  1KHI A;  3NMZ C;  1I81 A;  1WQW A;  1K9M U;  1OV3 A;  3FDR A;  3CCV Q;  1ARK A;  2JM8 A;  3R6N A;  2COZ A;  2F1L A;  3PTA A;  1NPR A;  3JCM c;  3LX7 A;  2XDP A;  2O9S A;  5A2Q E;  1Y96 A;  3CD6 A;  1YIT Q;  1ZBX A;  4LDV A;  2EYQ A;  1UGQ B;  3EG1 A;  3EG9 B;  1AZG B;  1AHJ B;  2DBK A;  1VQ8 T;  1G3Y A;  1M8M A;  3VYG A;  2P0Q A;  1ABQ A;  5LJ5 d;  2L89 A;  2QDL A;  1NJI C;  3VRZ A;  1WGS A;  3KXT A;  2L3S A;  3QO3 A;  4QQG A;  1LVK A;  2EFI A;  2I0N A;  2BKD N;  2FVU A;  4KH1 B;  1TUC A;  4L5G A;  4QW2 A;  2GTO A;  1KQS S;  1UFF A;  1HD3 A;  2FZK B;  2JOY A;  8ATC B;  2HKN A;  4ZN1 A;  2X35 A;  4E2F B;  3HFN A;  1AWJ A;  3OW2 A;  4PJO G;  4B6M A;  1PHT A;  1YWP A;  2RK2 A;  3CPW A;  2PZ1 A;  4RKU E;  2CH4 W;  1IZ6 A;  1YJW T;  3H41 A;  4N0A A;  4FL6 A;  5GAN g;  4QVC A;  2KR3 A;  3EG3 A;  1M2V A;  2EGA A;  2ZAE A;  1WLP B;  2V1Q A;  4HVV A;  5D6W A;  1VIF A;  2L5Q A;  2EVR A;  3UA7 A;  3VS0 A;  1M1F A;  4Z8A A;  2VWF A;  5GMK l;  2XI9 A;  1K73 C;  2KBT A;  3RUX A;  2MIO A;  1YP5 A;  5GAM f;  4EMK A;  1VQL A;  4KH0 B;  2DER A;  4OB1 B;  1BI0 A;  4M78 A;  2KXD A;  2C0I A;  2BE9 B;  1NJI U;  4LDU A;  4LDX A;  2X9H A;  3V8K A;  4C8Q G;  2DAQ A;  1Y0M A;  1VOM A;  1WHK A;  4O5V A;  3CXC S;  1FX7 A;  3EGU A;  4M77 E;  2RO0 A;  3TU4 K;  1YWO A;  2OTL A;  4JRK A;  4LXC A;  1WJR A;  4TVR A;  3LYI A;  2DTO A;  4HCC A;  1YJ9 Q;  4ANJ A;  3OS0 A;  2CDT A;  5FLX E;  2VB6 A;  4PFZ A;  3J80 E;  3NGP A;  1UHF A;  2DJZ A;  1VQK A;  2O2O A;  1YNZ A;  4DBQ A;  2M16 A;  4NS5 A;  5LJ3 h;  1FMW A;  2K2V A;  2L3R A;  2K5L A;  5GAN 3;  2ZPI B;  1X2Q A;  1K73 U;  2HKQ B;  2Y4X A;  1FMK A;  1X2K A;  1WJS A;  3VS5 A;  1IGQ A;  1YCY A;  1QVF A;  1AWX A;  5CAI A;  3EFO A;  4OMQ A;  1YIJ T;  4PJL A;  1N27 A;  1M9S A;  3EG9 A;  3UWN A;  2HL3 A;  5IH2 A;  4XU3 A;  3MHX A;  1B3Q A;  3VUB A;  3G6E T;  1UGV A;  3H8Z A;  2RJF A;  1VQ6 T;  4MZM A;  1VQP Q;  2EW3 A;  1IRE B;  2JVV A;  2HCK A;  4J9G A;  1D0Y A;  2DXC A;  1K9M R;  3CCR A;  2DXT A;  2EGC A;  2NUT B;  3I56 Q;  3CMA T;  2QI2 A;  3CD6 Q;  7AT1 B;  4BDZ A;  1QKW A;  1VQ7 Q;  1BI3 A;  3QUI A;  2QGF B;  3I5S A;  1M3A A;  3MKD A;  2XDD A;  4JRP A;  3WVD B;  2P84 A;  1R8O B;  2V8J A;  1R0C B;  4HCK A;  3MJX A;  4F7U F;  3CCJ T;  4M7D B;  3GNF B;  2DPP B;  1JJ2 A;  1HXD A;  5A0G A;  2EGE A;  3EGX B;  2CH4 A;  1E6H A;  4IKF A;  2ZGW A;  2EQM A;  5IXB A;  4C8Q F;  4BDY A;  1U1S A;  3OQ5 A;  1Q86 C;  3JCM f;  2VKN A;  5M9O A;  4KUL A;  2CGH A;  3MEA A;  3FRN A;  5GAN e;  1SSH A;  1UJ0 A;  2MK5 A;  1X6O A;  4XTY A;  3INZ A;  1TUD A;  2LX7 A;  4RG2 A;  4M7D E;  4HA8 A;  4JJB A;  3RMS A;  3CCM A;  4J5Y A;  4QT7 A;  3M57 A;  1EX4 A;  1G8X A;  3PFS A;  1BIA A;  1C0M A;  3DB3 A;  1T0H A;  3ULR B;  1W4S A;  4RTV A;  2XKO C;  5FRO A;  1AWO A;  2P4R A;  2VYT A;  4ZGD B;  2CZ0 B;  3QBY A;  1MV0 B;  1GCQ C;  2DEQ A;  1PSF A;  5GMK e;  2C06 A;  3ZEH A;  4XTX A;  3VU3 C;  3RDV A;  3CCU T;  3M0Q A;  1VQL Q;  1GFD A;  4J9I A;  1QVG P;  2JTM A;  3OMG A;  3CC2 A;  5CQX A;  2DXU A;  4F16 A;  3L1A A;  3A8O B;  3E19 A;  4QQD A;  2MMP A;  4X1V A;  1NJI R;  4XTW A;  1Q86 U;  4XQ3 A;  1AEY A;  4HXJ A;  5LJ3 g;  3CCE T;  2EIF A;  3CCS A;  5EC7 A;  5J39 A;  3V8J A;  1OZ2 A;  1OU9 A;  1NG2 A;  4M77 F;  4PJO C;  3O5Z A;  4AFZ C;  2F5K A;  2YLB A;  4KUD K;  2A08 A;  4J6Y A;  2LRQ A;  3OYM A;  4C5E A;  4CC7 A;  1VQO T;  5A0D A;  2X4J A;  2HZY A;  3OSV A;  3LGF A;  1D09 B;  1Q81 C;  1YJW Q;  3VUZ A;  2CZ7 B;  2QA4 A;  1G3T A;  2EQU A;  1T3S A;  4NL2 A;  3QJ6 A;  4RG8 A;  4QKU A;  3QSU A;  1KFZ A;  4E7L A;  2LMJ A;  2GFU A;  2RQR A;  3C94 A;  4JS5 A;  1E7O A;  3M4G A;  4NL3 A;  1K73 R;  3CCV A;  1V1C A;  2C0T A;  3JB9 F;  4IUQ A;  1NPP A;  1KQS P;  2MOX A;  2DLP A;  4C8Q C;  1PCX A;  2CYZ B;  1K4U S;  1VQ5 T;  5GAO p;  4C5I A;  2GGR A;  5GAM d;  2RHZ A;  3EGX A;  4RUG A;  1WQ7 A;  1ZSZ C;  4LDY A;  4ELY C;  2QEX T;  2FZG B;  4IIO A;  2LC4 A;  2VAS A;  3M0U A;  1VQ9 T;  5GAO n;  1VQM T;  2RB6 A;  4PJM A;  3WVE B;  2PVD B;  3CC4 T;  1PSE A;  2V1R A;  4J6X A;  3CCQ T;  2GTJ A;  3GPL A;  5LJ5 j;  2F5T X;  1D1A A;  5HCK A;  4KBM B;  2EKH A;  3ZFJ A;  5CKH A;  1ABO A;  1GFC A;  1Q81 U;  2F69 A;  2CZ6 B;  2KRS A;  3OYE A;  2Z0W A;  2QQB A;  1VYT A;  4ESR A;  1KD1 C;  1Y96 B;  1Y71 A;  2LZ6 B;  4DEX A;  3OYY A;  3OW2 S;  1G5V A;  4LD6 A;  1I5O B;  4E47 A;  4JLI A;  1MHN A;  5KCO A;  1WHM A;  3M5A A;  4RCB A;  1W2B A;  2KT1 A;  5AYF A;  2K7A A;  2YDL A;  3VYH B;  3DKM A;  2NYS A;  4M75 G;  2K5F A;  3CXC P;  2XD0 A;  2K3B A;  4PJO D;  5I22 A;  4DOW A;  2KQW A;  4J9D A;  1WA7 A;  3TEE A;  4ATO A;  2RI3 A;  3RKX A;  1X01 A;  2FPE A;  1MGQ A;  4BI4 A;  1YIJ Q;  1M8V A;  4CI0 C;  4JPB W;  4C5G A;  2DKG A;  4IUU A;  3CCM Q;  3MET A;  1M4Z A;  3SFM A;  1S72 T;  4J7F A;  1IHV A;  1BU1 A;  2VC8 A;  4ORZ A;  1H64 1;  1JBM A;  3G6E Q;  3QPH A;  2EKO A;  3JCM P;  2QYZ A;  2O31 A;  2YUN A;  1RAC B;  4A4G A;  3EFR A;  1PKT A;  1VQN T;  1AT1 B;  5CKD A;  3OYC A;  2YSQ A;  1XNI A;  1MMA A;  1H92 A;  5GAN h;  3OS5 A;  1ZSG A;  4PKC C;  5IHI A;  2HDA A;  2P0K A;  4OB0 B;  3CMA Q;  2E41 A;  2QDY B;  1M2V B;  3G71 T;  2LP5 A;  1KD1 U;  5ECA A;  4C8Q D;  3RER A;  3ZL7 C;  1GBR A;  4J83 A;  1RAG B;  2M9U A;  1KIK A;  3M0R A;  2DMO A;  1JEG A;  2LJ0 A;  5CO7 A;  5D6Y A;  2J6O A;  3CBP A;  1YJ9 A;  4FU6 A;  4OB2 B;  3DLL A;  2LNV A;  1BKB A;  3NPF A;  3OYB A;  1TSF A;  3RIR A;  2HNI A;  1M1G A;  2K4Y A;  1ZQ1 A;  3L2Q A;  2QAZ A;  3SHW A;  3T9N A;  2KI7 A;  2L0A A;  4XTZ A;  1Q86 R;  3UF4 A;  2EQJ A;  3RBB B;  5CKB A;  2DNU A;  2DA9 A;  1X43 A;  1WYX A;  3OYL A;  1KC8 C;  2X3W D;  2M1H A;  4OP0 A;  1UG1 A;  4FIB A;  3JCM d;  2HBP A;  2QTX A;  1QVF S;  2D8H A;  4E7Z A;  2KK4 A;  2L3Q A;  2F2W A;  4PJO B;  2QA4 Q;  4FYY B;  5HK3 A;  2ZPH B;  4DBH A;  2DBM A;  3DLM A;  1FYN A;  5C6S A;  4LUD A;  3SWN C;  1SRL A;  3CQT A;  4Y91 A;  4M7A G;  3JSC A;  2LCS A;  3ZBD A;  3BDU A;  1VQP A;  3CCU Q;  1IRX A;  2FG0 A;  1K9A A;  2ZCF B;  1OPK A;  1U06 A;  2DXB A;  2PTK A;  2NUZ A;  2ZPF B;  4M75 F;  3EGD A;  3I56 A;  1NYF A;  2DX1 A;  2M0Y A;  1VQ7 A;  3I5R A;  1YJN A;  3EFO B;  5GAO q;  2YUO A;  3FJP A;  3P8B B;  1EZZ B;  1OU8 A;  5LJ3 f;  4J9E A;  3OS2 A;  3MEU A;  4N4G A;  4R56 A;  2OAU A;  2Y90 A;  2RA2 A;  1YI2 T;  1RI9 A;  1KC8 U;  1JJ2 S;  1YCS B;  3PVQ A;  4BUG A;  4FYV B;  3CME A;  2HQX A;  2XDB A;  3PIO A;  1KG1 A;  2DFU A;  4JZ3 A;  1X27 A;  1ZSZ B;  3G4S T;  2ROL A;  3CCL T;  4PL6 A;  1WXB A;  5J3B A;  4F14 A;  3CC7 A;  2H3E B;  2RM4 A;  4KGV B;  1KK7 A;  3C4S A;  3BDL A;  4RTW A;  1EFN A;  4IUT A;  1HJD A;  3H0I A;  1VQO Q;  3M55 A;  1Q81 R;  1ZHI A;  2O88 A;  2IPO B;  4JLG A;  2FYK A;  3PMI A;  1VA7 A;  4XTU A;  1UTI A;  4C0F A;  3MP8 A;  2YRD A;  2E12 A;  1O75 A;  3HL8 A;  2HMA A;  1SKU B;  1FXX A;  4V2S A;  1QWF A;  2RMO A;  2D6F A;  2DIL A;  4DEY A;  3G1J A;  1G3W A;  1TH7 A;  1UGP B;  2F2X A;  2QQS A;  5IAY A;  2DET A;  3QXE B;  5IN1 A;  5CR2 A;  1BCO A;  5KYW B;  2JM9 A;  5GAN 4;  3GP8 A;  2JW4 A;  1GCQ A;  4L6V 5;  5IXF A;  1YHQ T;  4F7U G;  2FL7 A;  3SB2 A;  2CZ1 B;  2FB7 A;  1VQ5 Q;  4PFP A;  4C92 F;  4KT0 E;  4BI8 B;  1NLO C;  5GMK i;  2BZX A;  2DRK A;  2QEX Q;  1R0B G;  1VQM Q;  2WAC A;  1VQ8 A;  3ME9 A;  3QII A;  5GAN 6;  4X9D A;  2H8H A;  3V7R A;  2XMF A;  2LQW A;  1AD5 A;  2DO3 A;  2AIR B;  4A4H A;  2KNB B;  2PUO B;  2X51 A;  3ER0 A;  5I2M A;  1IHW A;  3E2U A;  4RTY A;  3SD4 A;  1PRM C;  2EJF A;  3M56 A;  4M7A F;  1RAF B;  4MML A;  2LQ8 A;  4PJO A;  1UUE A;  3F70 A;  4CC4 B;  4ELZ C;  4A4K A;  4QQ6 A;  2QQA A;  1QQJ A;  4D8K A;  2YRV A;  4DQ2 A;  1BI2 A;  4M75 C;  4AFU C;  2J6F A;  2WSE E;  3JCM J;  1M90 C;  2KRN A;  3AHU A;  4AT1 B;  2LX9 A;  1ZUK A;  2A37 A;  1YJW A;  2RQT A;  4WCI A;  3URG A;  1TU0 B;  2O9V A;  2V26 A;  4BE0 A;  4MDW A;  4A4E A;  2LCC A;  3JAM E;  2FEI A;  2FRW A;  3PE0 A;  4X9C A;  1S72 Q;  1N9R A;  2A3L A;  3REA B;  1VQ4 T;  3M9Q A;  2PVG B;  4DA4 A;  2RK1 A;  3MCA B;  2VXE A;  4C8Q A;  2EWN A;  4M78 F;  2RHX A;  2MAM A;  3OW2 P;  3OYD A;  1DJ7 B;  2E64 A;  3A8M B;  1QVG A;  4M77 G;  1OQK A;  5GAM j;  4FSS A;  3QWY A;  1TS9 A;  3A8L B;  1ZSZ A;  2YUP A;  5D6X A;  4C0D C;  3SEM A;  1FWZ A;  3CPF A;  4HVW A;  1W6X A;  1WDX A;  3C0C A;  1KQ1 A;  1OX8 A;  3M0S A;  3JCM b;  1IGU A;  2JJ9 A;  2KEA A;  1YJN Q;  2F2V A;  1M1K C;  3SWN B;  2HAX A;  4Q5W A;  4E7H A;  3HRS A;  4JRI A;  2KXC A;  1SEM A;  3QHS A;  2AK5 A;  4IIM A;  1M90 U;  2HBW A;  2K6D A;  4OML A;  5CQY A;  2WSF E;  5IHK A;  2DL8 A;  4ME7 A;  1H8K A;  3THK A;  4O6J A;  3CME Q;  2E70 A;  3HP9 A;  2RHY A;  3JB9 G;  5EG2 A;  3H6Z A;  1W2B S;  3CC7 Q;  4MMK A;  5GJV B;  1KC8 R;  3VS1 A;  4BE1 A;  5LJ5 e;  5KYW A;  2KRO A;  2J6K A;  2M51 A;  2KYB A;  3UAT A;  3QZ5 B;  2W0Z A;  4BI3 A;  4HKE A;  1N5Z A;  4CRI A;  1LPL A; 
#chains in the Genus database with same CATH homology
 1SPK A;  4IIO A;  1A0N B;  1ZUU A;  3M0U A;  1K76 A;  4D8D A;  2RQU A;  3VS2 A;  2V1R A;  1XOV A;  2GTJ A;  2GNC A;  4Z89 A;  1Z9Z A;  2E5K A;  1W70 A;  2B86 A;  5HCK A;  2J7I A;  1S1N A;  2EKH A;  2CRE A;  2JS0 A;  2ENM A;  4M4Z A;  1ABO A;  1GFC A;  2SEM A;  1GL5 A;  3M0P A;  4AG1 C;  2HSP A;  1T0J A;  2KRS A;  2LNH B;  1BK2 A;  4HVU A;  2FPD A;  2YT6 A;  3NMZ C;  1VYT A;  1YN8 A;  4ESR A;  2DVJ A;  2RNA A;  1OV3 A;  2LJ1 A;  1ARK A;  2LZ6 B;  4DEX A;  1OPL A;  2JM8 A;  3R6N A;  2BZY A;  1JO8 A;  2KT1 A;  2K7A A;  2YDL A;  2O9S A;  2RQV A;  3H0F A;  2CT4 A;  2K3B A;  1GBQ A;  1UHC A;  5I22 A;  1M3B A;  4J9D A;  1WA7 A;  3FJ5 A;  4RTZ A;  1WX6 A;  2NWM A;  2FPE A;  3U23 A;  3EG1 A;  1SHG A;  1J3T A;  1AZG B;  2OI3 A;  4RTT A;  2DBK A;  1M8M A;  4JPB W;  1X6B A;  1VYU A;  4J9H A;  4OMP A;  4OMN A;  2KGT A;  1ABQ A;  4AFS C;  1I1J A;  1BU1 A;  4ORZ A;  3VS7 A;  2A36 A;  2GBQ A;  2O31 A;  2QDL A;  2YUN A;  1BB9 A;  3VRZ A;  1X69 A;  1U3O A;  1NM7 A;  1PKT A;  2L3S A;  2J05 A;  1WXT A;  2I0N A;  1TUC A;  2J06 A;  2YSQ A;  1K0S A;  1H92 A;  2GTO A;  1ZSG A;  1AVZ C;  5IHI A;  4JJC A;  2HDA A;  2EQI A;  3VS4 A;  1UFF A;  1HD3 A;  4Y92 A;  2MCN A;  1AWJ A;  3TVT A;  5L23 A;  3KFV A;  2LP5 A;  5ECA A;  3ZL7 C;  1GBR A;  1PHT A;  2JTE A;  1YWP A;  3I9Q A;  2D0N A;  1PKS A;  2PZ1 A;  1KIK A;  1WXU A;  3M0R A;  1QLY A;  1X6G A;  2AZS A;  2CH4 W;  2DMO A;  1JEG A;  2DRM A;  3H41 A;  2LJ0 A;  3VS6 A;  2L3P A;  2D8J A;  2J6O A;  2KR3 A;  3IQL A;  3EG3 A;  3RNJ A;  2EGA A;  3NPF A;  2EBP A;  1AZE A;  1WLP B;  2V1Q A;  4HVV A;  4LN2 A;  4E6R A;  2BTT A;  3SHW A;  2EVR A;  2L0A A;  3UA7 A;  3VS0 A;  4Z8A A;  3UF4 A;  2RPN A;  2DJQ A;  2VWF A;  3RBB B;  2DNU A;  4J9F A;  2DA9 A;  2KBT A;  1X43 A;  2CUB A;  1WYX A;  1JQQ A;  2EYZ A;  3EHQ A;  4CC2 A;  3JV3 A;  2MIO A;  1YP5 A;  1MV3 A;  2K2M A;  2ABL A;  2X3W D;  1HSQ A;  2KXD A;  2EPD A;  2C0I A;  2HEQ A;  1UG1 A;  2EYX A;  2JT4 A;  1NLP C;  4AG2 C;  2D8H A;  2ROT A;  2L3Q A;  1M3C A;  1Y0M A;  2F2W A;  1UDL A;  4R0K A;  3EGU A;  1Y57 A;  1I0C A;  1YWO A;  2DBM A;  1FYN A;  4F17 A;  4LUD A;  1SRL A;  3CQT A;  1CKA A;  2LCS A;  5I11 A;  1LCK A;  1IO6 A;  2FG0 A;  1K9A A;  2CDT A;  1OPK A;  1U06 A;  2ED0 A;  1E6G A;  4RTX A;  2PTK A;  1NEG A;  1QKX A;  1B07 A;  2NUZ A;  2DL3 A;  1UHF A;  3NGP A;  2GQI A;  2K9G A;  1NYF A;  1YNZ A;  2DX1 A;  2M0Y A;  2O2O A;  5IHN A;  4ZNX A;  3I5R A;  2YUO A;  2ECZ A;  1WFW A;  4J9E A;  1X2Q A;  3GBQ A;  1FMK A;  1AOJ A;  1X2K A;  2KE9 A;  1RI9 A;  3PVL A;  3VS5 A;  1GRI A;  1G83 A;  1YCS B;  1AWX A;  2DM1 A;  3PVQ A;  2G6F X;  1SRM A;  4OMQ A;  4K11 A;  2AKL A;  4JZ3 A;  1K1Z A;  1X27 A;  5IH2 A;  1JXM A;  1PWT A;  2D1X A;  2ROL A;  2RQW A;  2CUD A;  1WXB A;  1B3Q A;  4F14 A;  1UGV A;  4RTW A;  1EFN A;  1HJD A;  3H0I A;  2O88 A;  1WI7 A;  3EHR A;  4LE9 A;  2EW3 A;  4J9B A;  4LUE A;  2HCK A;  3I35 A;  1JU5 C;  2DL5 A;  4J9G A;  4OMO A;  3TSW A;  1VA7 A;  4GBQ A;  1UTI A;  1OEB A;  3VRY A;  1RLP C;  2EGC A;  1QKW A;  4AFQ C;  3REB B;  3LH5 A;  1CKB A;  1QWF A;  2RMO A;  2DIL A;  4DEY A;  2BZ8 A;  2LQN A;  3I5S A;  1PRL C;  1M3A A;  3EG2 A;  2F2X A;  3H0H A;  1U5S A;  2JM9 A;  2JW4 A;  1GCQ A;  4RTU A;  4OMM A;  5IXF A;  4HCK A;  2SRC A;  2EGE A;  1KSW A;  1NLO C;  2OJ2 A;  2CH4 A;  2BZX A;  1WIE A;  2DRK A;  1E6H A;  1RUW A;  1PNJ A;  5IXB A;  2AZV A;  1I07 A;  1VYV A;  2H8H A;  1SHF A;  2XMF A;  2VKN A;  2LQW A;  5FWB A;  1AD5 A;  2DL7 A;  2KNB B;  1SSH A;  1UJ0 A;  1KJW A;  1ZX6 A;  1ZLM A;  1TUD A;  2LX7 A;  3M0T A;  1UJY A;  5FWC A;  2RN8 A;  4JJB A;  1BBZ A;  4RTY A;  1M30 A;  2W10 A;  4EIK A;  1PRM C;  2OAW A;  2EYW A;  4QT7 A;  3QWX X;  1UUE A;  2FPF A;  4CC4 B;  1T0H A;  1Z9Q A;  3ULR B;  4D8K A;  4A63 B;  1RLQ C;  1ZUY A;  4RTV A;  2ED1 A;  4J9C A;  1AWO A;  1OOT A;  2P4R A;  1JXO A;  4AFU C;  1MV0 B;  1GCQ C;  2J6F A;  2A28 A;  3NHN A;  2CT3 A;  2KRN A;  3M0Q A;  1ZUK A;  2C0O A;  5FW9 A;  2A37 A;  2JMA A;  2LJ3 A;  2RQT A;  4J9I A;  4WCI A;  1GFD A;  1T3L A;  2O9V A;  4F16 A;  2DL4 A;  2AKK A;  3VS3 A;  3UA6 A;  1H3H A;  2FEI A;  2FRW A;  3PE0 A;  2DYB A;  2DF6 A;  1G2B A;  2X3X D;  4X1V A;  1AWW A;  4CC3 A;  3REA B;  2IIM A;  1AEY A;  4HXJ A;  1UEC A;  1ZBJ A;  5EC7 A;  1NG2 A;  2EYY A;  1K0X A;  3O5Z A;  4AFZ C;  4JJD A;  5GJW B;  1M27 C;  1NEB A;  4FSS A;  2L2P A;  3QWY A;  2A08 A;  2K79 A;  1W1F A;  2YUP A;  4KRT A;  2FO0 A;  2ESW A;  3SEM A;  4HVW A;  1NYG A;  1W6X A;  1WDX A;  3C0C A;  2CSI A;  4CC7 A;  1TG0 A;  1UE9 A;  3M0S A;  1CSK A;  2KEA A;  2F2V A;  1GCP A;  2PNI A;  2JXB A;  2YUQ A;  2KT8 A;  2KXC A;  1SEM A;  2AK5 A;  1QWE A;  2KRM A;  4IIM A;  2HBW A;  2K6D A;  4OML A;  1T3S A;  5IHK A;  2DL8 A;  1KFZ A;  1H8K A;  3THK A;  2KYM A;  2JMC A;  2LMJ A;  2RQR A;  2JS2 A;  2RF0 A;  4Z88 A;  1MUZ A;  1E7O A;  1QCF A;  4GLM A;  2CSQ A;  2FRY A;  4LNP A;  1V1C A;  2C0T A;  5GJV B;  3VS1 A;  2MOX A;  2DLP A;  2KRO A;  4JZ4 A;  2J6K A;  2M51 A;  2KYB A;  1K4U S;  3A98 A;  3UAT A;  2GGR A;  3EG0 A;  2VVK A;  3TSZ A;  4RUG A;  2W0Z A;  1N5Z A;  2DE0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...