1UJNA

Crystal structure of dehydroquinate synthase from thermus thermophilus hb8
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
347
structure length
338
Chain Sequence
MQRLEVREPVPYPILVGEGVLKEVPPLAGPAALLFDRRVEGFAQEVAKALGVRHLLGLPGGEAAKSLEVYGKVLSWLAEKGLPRNATLLVVGGGTLTDLGGFVAATYLRGVAYLAFPTTTLAIVDASVGGKTGINLPEGKNLVGAFHFPQGVYAELRALKTLPLPTFKEGLVEAFKHGLIAGDEALLKVEDLTPQSPRLEAFLARAVAVKVRVTEEDPLEKGKRRLLNLGHTLGHALEAQTRHALPHGMAVAYGLLYAALLGRALGGEDLLPPVRRLLLWLSPPPLPPLAFEDLLPYLSLHWVVPLAPGRLVVRPLPEGLLREAFAAWREELKGLGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of dehydroquinate synthase from Thermus thermophilus HB8 showing functional importance of the dimeric state.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Lyase
molecule keywords dehydroquinate synthase
total genus 111
structure length 338
sequence length 347
chains with identical sequence B
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2003-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1ujnA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ujnA01
5BR4A 1UJNA 4RGQA 1SG6A 4FR2A 1JPUA 1O2DA 1DQSA 3BFJA 5HVNA 3IV7A 1JQ5A 1VLJA 3CE9A 1XAGA 3OKFA 1NR5A 2GRUA 4RFLA 1KQ3A 3ZDRA 1NVDA 1JQAA 3JZDA 3QBDA 1OJ7A 3UHJA 1VHDA 1XAJA 1XAIA 1NVEA 3HL0A 2BI4A 4QGSA 1XAHA 1XALA 3QBEA 3ZOKA 1NVAA 2D2XA 3W5SA 5K8CA 2BL4A 3CLHA 1NRXA 3OWOA 3OX4A 4P53A 1NUAA 1NVFA 4RGVA 3RF7A 1TA9A 4MCAA 5FB3A 5EKSA 1NVBA 1RRMA
chains in the Genus database with same CATH superfamily
3G0DA 3EQ9A 4CFZA 2XYGA 3CE6A 3CKMA 4MR9A 4M9QA 5HIMA 3UKDA 3LVBA 3GFTA 1QRUA 5G0UA 4MUJA 4DQLA 1AN0A 2NUBA 1A76A 1ENOA 1L4YA 2BE7A 2OV2A 2H2WA 2F7SA 2YTZA 3OTWA 2B78A 2IODA 1JJVA 2BSQA 2VHQA 4ACAA 3BQ9A 2C0QA 5EE0A 4ZARA 2JFGA 2ZYSA 1EVLA 1I24A 2A3NA 2RK4A 1T0BA 3DE4X 1QHNA 3L93A 3QLEA 3WLPA 1JJFA 4BKUA 3D6NB 4DIKA 1T0UA 4DR7B 2XUAA 2VXCA 2XITA 3F5QA 1SXJA 3K0BA 4BU1A 5AQ1A 2JFNA 4IFBA 1JFFB 3KXPA 1T36A 5HNKA 5C4MA 1K3TA 2G0AA 2WZQA 5B4UA 3COPA 5BRAA 2I6SA 4NBLA 1M5TA 4Z8XA 1Q16A 4ER6A 3C45A 4HG2A 2EYUA 2P3QA 4GOJA 1A97A 4CODB 2ERYA 3OIVA 3KQKA 2QRZA 4BNDA 3FH0A 4NE2A 4PWYA 1LDBA 3OLYA 5CDFA 1WXDA 4ER0A 2C2HA 4AO6A 1NU6A 5TS3A 1H3NA 1EE9A 2HDNB 1ZBQA 2GCOA 2Q0HA 3OJLA 4QBGB 3TZ6A 4DEXA 1K9SA 5TEWA 1RYZA 3WSVA 1FX1A 3PGKA 1U6KA 1PV1A 3GRYA 5EPOA 5DLQC 5CA0A 4V1CI 1PSZA 1MXFA 2R2GA 5IUJC 1TECE 3HN2A 3L8CA 5LM3A 3VOBA 4B31A 4DSAA 1O8BA 3F7MA 1TGVA 3JQEA 1VSVA 1MC1A 5EA2A 2NU7B 8MHTA 1R8SA 1XGKA 3IYLW 2GCGA 2BP7B 4HNHA 4W1SA 4XQ9A 3SF8B 5LOVB 3TGLA 2HSJA 1E94E 5JEDA 4BJ5A 4XH9B 2P35A 2ID7A 4N3NA 4XLLA 3K0AB 1E0KA 2BC9A 2FSHA 4LBWA 2PCLA 2P78A 3BGIA 2IV3A 1JYSA 1T3GA 2HMTA 2RCNA 3NV7A 3QOXA 5FUMA 3X1WA 5BN3B 2NTJA 1QP0A 5DFAA 2B35A 4QYSA 2YC2C 5ITSA 1D1SA 1HYEA 2GUGA 2YYAA 4YDHB 5KYXB 2YRXA 1A7KA 1RXSA 3EXIB 2ZG6A 5JO9A 5CIQA 3DE3X 1DAIA 2XNCA 4KUEA 4DIUA 5F7OA 2Z83A 1N1DA 4N8SA 5HA5A 1D4AA 2P67A 3AJEA 4U8GA 1MH1A 1XU7A 3KHKA 4OJNA 4KI0A 4LE1A 1L7DA 2C2WA 4KDEA 5AKZA 1F1JA 4WXPA 5HXAA 5KTMA 1YF3A 1VJ0A 1Q0UA 1TEZA 4I99A 4OXNA 3DZIA 4PNZA 1JG7A 1YA4A 3BCSA 2IZZA 3DBOB 2XBMA 1Q2UA 5HCUA 3H2HA 1NJ8A 4KH0A 1J0AA 4WVLA 4ZO7A 3U16A 4IJKA 3T7EA 2AFHA 2MWMA 4BO7A 2CLDX 1BEUB 1T4MA 4AIRA 3I45A 3CRRA 4J0EA 2QRQA 3D4PA 3OPNA 3TR5A 4ECEA 2G1UA 2B21A 2FEAA 2GF0A 3EG5A 3MRVA 3Q0EA 5KVVA 5J2TA 2NO9A 4KXWA 4ZCQA 1P9LA 2RONA 9MHTA 2HJSA 2WY2D 4AJ4A 2Q5LA 3DC7A 2D5BA 4FYWA 3QW4B 4XOIA 2XWJI 1CDZA 3FMPB 5AMXA 1MKYA 1NUTA 3JD1A 4TYNA 2AQHA 1CZHA 4QGSA 4OQLA 1U7HA 4CF4A 2WYUA 5JCZA 2BLNA 4FILA 3VDRA 1AUPA 4MW1A 1XRQA 3G2KA 3PITA 4G1UC 4YAOA 1M8FA 2XI4A 2FMUA 1NX9A 4QYIA 3AKYA 5LDDC 3OEWA 2QY9A 2PRIA 1W29A 1PQPA 1KVUA 2BFPA 3AEUB 3B12A 3HCOA 2BGIA 3Q7RA 4CUJA 3JZFA 5LIPA 1D1TA 2W2NA 1WHTA 1P8JA 3VR0A 3UK7A 3ZEIA 4Z9XA 4ALKA 2FMTA 1LUAA 2ZSHA 1JQKA 4ZZ1A 1XRJA 1T2VA 4LYJA 2PKYX 4RYLA 2YICA 5MF6A 1VZ2A 2AI2A 4GRIA 1XEAA 2BVNA 2N75A 1FFYA 1QG4A 2A1IA 1T8PA 3ZIAA 4FQ5A 3B3JA 3AR3A 1TD9A 4NF2A 4QBFA 1VCOA 4Y0AA 3NUZA 3TOSA 1KMHA 2JHPA 2GZAA 2XJ9A 3HWRA 4CGZA 4JC0A 4PZZA 2PIDA 3UIEA 3CINA 3GG9A 1W4LA 2XB9A 4H3KB 3QV2A 4PR3A 2IVFA 4Q1EA 3VOSA 2CD9A 3N6VA 3U4MA 1H0SA 1L7XA 2IYLD 2WIFA 3ZXSA 1C1DB 4MP8A 4J0KA 4XWOA 2VXBA 1SVIA 1BCSB 3FDZB 3HEAA 3L8YA 1ZNYA 3OZFA 3OTQA 4TKUB 3QLTA 3C5VA 4DHWA 1M0SA 4H4EA 1XKTA 2OXCA 3G8BA 3QUSA 1RBZA 3RVOA 3X44A 4EHLA 3JARA 1NJGA 3LNTA 4MHSA 4AX8A 3KELA 4FIDA 4KQKA 1E3WB 2PT5A 5J2TB 1RYDA 1O6ZA 5EE5B 2YZKA 2OD7A 4HNTA 1ODLA 1U94A 3NGMA 4MJXA 1Y9EA 2FPKA 2CBGA 1OGJA 2IU0A 4G5SA 3R3VA 4TZKA 4OHUA 3DE2X 2B5WA 1QG2A 4CKEA 1NUAA 2RGNC 3F46A 3AEYA 4DIOA 3M2PA 2D4AA 1MLDA 4IQGA 4L5YA 4L51A 2ZITA 3P45A 3B78A 3W1EA 4XB2A 2BFEB 2ID9A 1LPOA 2QTZA 3TM4A 1R0YA 3D7KA 4H3HB 2W6QA 1AS2A 4Z1MD 2GTHA 5EWLB 1D5WA 4JBYA 1BC5A 5IUKC 1DCFA 3BA1A 4ZOCA 4JSTA 4L5AA 1ZM7A 2RB4A 2VAXA 2WVGA 3C7CB 4G1EB 3WDSA 5CLJA 1HG1A 3LHIA 4MGYR 3A3NA 1XXHE 2AOTB 4AP9A 1E63A 4ZI7F 2TS1A 2NV0A 3VOTA 1HYGA 3E7PA 4MB2A 4GNKA 4GZ5A 2ZXUA 1QHYA 3QU7A 3NIFB 4QICA 2JFQA 2HEIA 3BMQA 3R5HA 3T5MA 5AYVA 3P4YA 4IQ8A 4X8HA 3K5PA 1B6SA 4I6EA 2NSHA 1FXWA 4U9HS 4DDVA 5A4DA 2IUUA 3R9XA 1W8DA 4GO1A 5HJ5A 2CYAA 3O8BA 3FIJA 4UDNA 3SSAA 1MW8X 4LF4B 4JT2A 1X7WB 4MWBA 1ND5A 2RAFA 2RHRA 3VV2A 2JGIA 4C5BA 5FKJA 2X8BA 1APBA 4D46A 2F4NA 3P9KA 5EKUA 4EO9A 4ITUA 4M88A 4QFBA 5CDYA 4IWNA 1PE0A 2WSIA 4OMFG 4QU5A 5H9WA 2YHIA 3LHKA 4TVSA 1AOXA 2XUGA 5FO1A 2VTVA 4E15A 2ZAIA 3A05A 1UL1X 1PNTA 4URFA 1Q5PA 2YWGA 2XUDA 3Q7QA 1RI2A 2EFCB 2JIPA 3QUQA 4DMGA 1JMVA 1LI4A 3N7AA 1ZXXA 5DRTA 1QZXA 5JVDF 4KFTA 4ARBA 2QHXA 1JZTA 3LWBA 4RF5A 5DNAA 1UFKA 4F4IA 1Q0HA 3PYXA 4MP6A 1FPQA 1TQDA 2E5LB 1R37A 1Z6XA 4P35A 3DKKA 2EFYA 5C5CA 1CUBA 1G6Q1 2XADA 4NICA 4L0CA 3F7TA 3KZNA 1Z8NA 2Q4EA 5K0BA 3T5GA 4E0BA 3E5RA 1FSPA 2G7ZA 2GYUA 4MKHA 4MUAA 4OHCA 3SE0A 1R8JA 3V8RA 1WMAA 1MX1A 4W5NA 1HQCA 1E96A 4FS3A 1FQKA 1MOSA 2FW6A 2Q4TA 1KO1A 1SB9A 1XJ5A 2FWPA 4MSUA 4YV1A 1HNXB 2FVYA 1FYWA 3A3YA 2IZ5A 1N2ZA 3RWBA 4V2IA 1P6XA 4I1OA 3RVMA 4RKYA 2EG9A 3FOZA 1Q0QA 2O5CA 2W8BA 3KKEA 3NOXA 2PPVA 3HABA 3QNMA 1JG2A 2F3QA 1DTEA 2C5AA 2JIZA 3GZJA 3M49A 5J40A 3ZCRA 1ZINA 2OCIA 2XYRA 2ZRBA 2VJAA 4GRDA 5FOVA 2IPLA 1NXTA 3HN7A 1W76A 2FHSA 1OI3A 3GROA 2VAWA 3PQ5A 3SYMA 5K4GA 4PHGA 3DBIA 3KOYA 1XZGA 4QKQA 4Q3EA 3LFUA 1K7SN 4RY8A 4MTCA 4E2WA 1F60A 2WI8A 4CEHB 1BMDA 1ITZA 1ZKMA 3ETEA 2Q49A 4G9EA 1PT9A 1YE8A 4KYUA 5K5EA 4DADA 4OD0A 5MGBA 4QSMA 4MQBA 4O25A 1VJGA 2K7FA 3ABRB 4F6CA 1R0BA 2JLCA 1JI3A 1AV6A 3F1KA 5FT9A 2G4CA 3HVKA 4PSDA 1G20B 3NHPA 4KTTE 3ZEAA 3IEXA 5GY7A 3IP6A 5AESA 4N3CA 1V1MA 2G0TA 3VNQA 3RAJA 2O6HA 2J8ZA 2R1UA 1UC9A 3QUCA 4NWIA 4P7KA 2C5LA 1PL7A 1XD9A 2DQ4A 2VP5A 2UZIR 2Z58A 4N7RA 3U9SA 4F5EA 4CEJB 3M4NA 2OHGA 2O8NA 2QVBA 2QL6A 5E4FA 3AEKA 1Y1PA 1HETA 3DEYX 3KJNA 3Q40A 5KTYA 1NSTA 3S8YA 3HCDA 2WAXA 2IDJA 4FX5A 4IJMA 4Y9DA 3B7WA 4C0JA 5KX5A 2HF8A 2Q3BA 3PTAA 4FOLA 1CCWA 3U7GA 1IBSA 2WUEA 4N0DA 3AZPA 3GK3A 2XZDA 3K8OE 3R3JA 3GJ0A 3OE5A 1L4MA 5LP1A 2YVUA 1U11A 4QXMA 3ASYA 3LBHA 2ZETA 4WECA 3R0QA 1LLUA 3C98A 4MV8A 1J42A 3VMFA 2PZ8A 1JLLB 1MA3A 3NQ41 3UKJA 3SJ7A 4HJXA 1L5MA 4Y67A 3GMSA 3P4XA 4YR7A 4TS4A 3U6BA 3IGFA 2BR3A 1VQ1A 3HKBA 4A5SA 1OLSB 2YY7A 4K8OA 4DAEA 3O95A 4RIEA 2YW9A 4EENA 1KRXA 1CY2A 5TQ0A 3L4KA 4B6JA 5L51A 4Q4DA 2CFTA 1ZM9A 3PT9A 3QBJA 4P3NA 4RENA 5MGNA 3E27A 4KR3A 1YRBA 1EFKA 4FEYA 2V1UA 1PVOA 1NVAA 5C8YF 5CK5A 4LTDA 3WRVA 1J9GA 1EH5A 3E9ZA 1A5ZA 3INYA 3OZDA 2C96A 3PEEA 4W8HA 2PWPA 1VSQA 1H2EA 1NVBA 4FJ0A 2MSLA 2G77B 3DGFC 1XL1A 2CZQA 4ZV7A 3ZCPA 1N8SA 3F78A 3KLBA 1DKPA 1RTTA 2FMKA 3ZGXA 2II6A 3TL2A 4ZYZA 1XQ6A 2ZANA 4Y9UA 4XWWA 3CTPA 1CJVC 4Y6PA 5C4IA 1F3LA 1QIFA 3CUSA 5EUMA 3CSUA 5JIBA 5JTUA 3TSOA 1KQNA 3KAQA 1KGDA 1A9SA 3KZCA 1HE1C 5HE9A 1RYNA 1WQ4A 5T57A 3HNOA 3KYBA 4KCGA 3O1LA 1M10A 4EQ6B 2H0QA 4INOA 1D4OA 3IQXA 1AHIA 1C0IA 1UPFA 3KKPA 3BMCA 4G0NA 1X15A 4U7TB 1KJJA 4HXFB 2PU7A 1UC8A 1LI7A 3YASA 2VTKA 1NVVR 1MHTA 5H68A 1R6BX 1A8PA 3EE6A 3ETJA 3LO5A 5TX7A 4QYMA 2IJGX 2JAXA 3DOEA 3VR5D 1CQZA 2VH2A 4WT7A 1TCAA 1XK7A 1YI8A 2SKEA 1DAMA 3KAJA 4EEKA 2ZIGA 2WABA 2WWWA 4IEFB 5CB8A 4ZCTA 2ANBA 1PHPA 1O96A 1ZR4A 4XAQA 2WTBA 3PUHA 4BFSA 4QBKA 4KIFA 1P2FA 2O23A 3GJXC 4H15A 4TROA 5HCNA 3B36A 1R8XA 1IQRA 3DVSX 3N7TA 2DFTA 2C42A 3HFJA 4FQ8A 1W2WB 4KE7A 4KR9A 4DUGA 3LL4A 1Z18A 2OAEA 4KJZA 3WKDA 4PEVA 5KYYA 3D02A 1KFJB 1T3LA 2NV2B 4JY7A 4M38A 5IAJA 3UT5A 1GJRA 5TQ2A 3ID6C 3HBLA 4DLYA 1ZRMA 2HLPA 4IHAA 3FAKA 5FUVA 1VPLA 3Q2OA 1L6IA 1XLUA 4YCAA 1PRYA 2NO4A 2P8SA 3IESA 3OPYA 4E5PA 5C52B 4P54A 3W5UA 1Y1RA 4LJRA 4IIHA 4H59A 1LVGA 1RLTA 1B26A 1IFXA 2QX6A 3G2QA 4MZXA 4DNFA 3Q7IA 5M5BA 2VA8A 4TTRA 5FTWA 4YRSA 1DO0A 1NVTA 3GCWA 3NBYC 4CQLB 3S2FA 4R1NA 2JI7A 4DKXA 3PHGA 4RV4A 1E1NA 1AK1A 1NDUA 1AQUA 1TO1E 4G8BA 5B1YA 4QECA 4W7HA 3K1TA 1R2QA 2XOXA 1FDIA 1R88A 3FNFA 3PGXA 1EMDA 4CMEA 1XCMA 2KPOA 3R3ZA 4E5YA 3D8HA 1Y3BE 3RANA 5KC8A 1NSFA 1UM8A 4KB5A 3GFPA 1OYOA 3W3AH 3HXOA 1GTVA 2CMKA 1C1DA 2BKEA 1UOOA 3WA6A 1AZWA 3AW9A 3CSSA 4P98A 3WGNA 3WYFA 1UWLA 3DFFA 5IM4A 1YNOA 4UCFA 4GT1A 2I62A 3QVVA 1JW9B 2VWQA 3U3ZA 1V7CA 5BQ3A 4JI6B 4DNQA 1P2DA 3I04M 1H6BA 3JALA 3O2NA 3LH5A 3P2EA 4CLDA 2IHTA 4UM7A 4ZK6A 1L8AA 1KJQA 5JBNA 1CNMA 5IJWA 3W79A 4TWZA 1NVWQ 3UH1A 4DJAA 3OQIA 4JC5A 1LPAB 1YJBA 3TLJA 2XDWA 1T34A 1UT6A 2FUKA 2J0UA 4B9EA 1ZD9A 5IH7A 2BM0A 2IXGA 2PGXA 4M1MA 3AY3A 3OM0A 1GDTA 1TJ3A 2DQSA 1XYYA 3CX7A 3OCVA 3EGDB 2AG6A 3IEUA 3O1IC 3QKTA 4LOJA 5J5AA 3RHSA 4EAQA 5TQ0B 2PWYA 2QRHA 3KEFA 4E5KA 1VECA 4I3HA 3MIIA 2HU7A 4JVLA 1PT7A 4H1TA 2Q1XA 3D3QA 1SU4A 1T5OA 4F4HA 3DJFA 2ZYHA 1SBIA 2ZJFA 4HDSA 2NU8A 2J9YB 1MB9A 4PYQA 4LAFA 2PUWA 2HF2A 1FTYA 3UOAB 1U0LA 1IPHA 2Q9CA 2ZS9A 3K9HA 3KEQA 3QLUA 2R6FA 1V5WA 4I2NA 1QXSA 1N2CE 1WG8A 3A36A 4FUTA 2FR8A 2DHDA 5ALZA 3S99A 4UOZA 4RL6A 2CDAA 2O2DA 4PNPA 1E2DA 1ZWLA 2ID8A 3MOSA 4KRGA 4IDQA 5DBOA 1M8JA 1U7DA 2HRDA 2C2XA 3CZ5A 1TZKA 2BBSA 4XM2A 4D9NA 3QUBA 5HPYB 1I0IA 3ELWA 4M89A 2BTQB 1RMQA 4ARSA 2KBEA 2NUAB 4BAUA 4C3VA 3HJFA 1BX1A 3LQ4A 3AESB 3QPVA 2PYIA 3BMCB 1P0QA 4ZU1X 5KB3A 2E4AA 2B3DA 4FBMA 4HTFB 4TMZA 1BG6A 1NATA 5EPEA 5T64A 3FI9A 2HA4A 5SV2A 4O3FA 3N2IA 4OP2A 4XOUA 2QROA 5BQXA 3KWMA 2FTKE 2IOFA 2ZROA 2HK9A 1F06A 3NP9A 3UWSA 4MQEA 1PYGA 3ANLA 1M3SA 3ES9A 4PAQA 4IIBA 5IEBA 3KR2A 3T8YA 3CLUD 4G0PA 1JIIA 1KEEA 1JYFA 4ZYYA 3L0SA 3MJRA 4FYMA 5AVKA 5B5SA 2ZT6A 1MABA 1P1FA 3ESAA 4F4FA 4ENWA 1HT1E 3NTLA 5I8PA 1VIDA 2WAOA 4LJAA 1IIRA 4HAIA 1P5JA 2DCUA 1I2DA 4QRDA 1LJUA 2P2DA 1R3DA 4K0KB 2NUPA 5IT5A 2GOYA 4MPDA 3RIHA 4YIHA 4OLBA 2F4VB 1A8QA 1T1EA 2ZIAA 3T1NA 2ES4A 2P91A 3JQRA 1Z0KA 3LUCA 1RQ7A 3HUUA 3OJEA 1EGHA 1GEGA 5B37A 3S8MA 1XV5A 2QW8A 4BCDA 4C21A 4RSGA 3HYCA 3MAGA 4QVGA 4CKZA 5LD2C 4AZ0B 2H00A 4FMDF 1JG1A 3RYIB 3VZRA 4H3VA 1XIVA 5J63A 3CURA 2H59A 2VZ8A 4PRZA 2IX9A 3K6JA 1WDTA 1WPGA 3N6XA 4QQNA 3FCYA 3RU2A 1CUGA 4OQNA 5KNDA 3AUSA 4CDRA 2WTUA 1QBKC 2AKEA 1HC7A 1B4DA 1XLTC 3WLFA 3JD2A 3LBNA 4MQUA 4AMVA 4C14A 1XZPA 2P9TA 3PEUA 5K0LA 3DPIA 1JT9A 2LRHA 3KOXA 4D3YA 4CG0A 4FGZA 1X9IA 3C3YA 3EZYA 1WS6A 1E1DA 1EBUA 1O08A 4GRAA 4OB8A 4MVCA 4CDMA 5CFLA 1JN0A 5JC8A 2C8JA 4V2UA 4L6IA 1R9MA 2J5KA 1R16A 4U2GA 2V4MA 2VKTA 1LNQA 3FRHA 5EINA 3TDKA 3THYB 4UC0A 2GRUA 3DZBA 3VZDA 3V4VB 3WB1A 3ZU5A 2P5SA 1LF0A 3SX2A 4UZEA 1G4UR 3W1VA 4IZ6A 3MUFA 3GF4A 2JLQA 4LRUA 1N0WA 3VZCA 3ZU4A 1WXHA 3DNFA 2AD5A 1HLDA 2O2CA 1Z6ZA 2C4UA 5BW6B 2X0FA 4RK6A 4MRPA 3WQRA 2WWYA 2M9MA 2YS7A 5ED4A 4D6PA 4L08A 4W63A 1T0PA 1MEEA 4WY5A 4I50A 4GECA 5BR4A 1UK9A 3AERA 1GUDA 2Z6VA 5KU1A 2ILVA 2Z3VA 3JZAA 3MGGA 4X95A 5DCLA 4HD8A 1JPUA 1HURA 4JHLA 2YZ2A 1B6GA 4XDYA 4XW2A 5LMUB 1YRQA 2CLIB 2E82A 1XZCA 2ZPTX 3Q3CA 2CF6A 1G8HA 2NVBA 3FVTA 3RUCA 5B55A 4B9AA 3DEFA 4BKOA 1V8PA 4L76A 4ZOLF 4LHWA 1JEJA 1KP9A 2FRXA 1E5DA 1SKYE 3LP6A 4UPVA 3LC0A 1DAEA 3TD2A 4ER5A 5JATA 3NRJA 4WDRA 1ZGJA 4XWTA 2OBYA 4TZTA 5K4AA 1N7GA 1Z35A 4B6QA 4UNPA 5KYNA 3DF9A 2PBLA 2DKOA 2I7VA 3H99A 4LI0A 2F1RA 4MW4A 4OXQA 3WLJA 1OZHA 5I51A 1PG2A 3HR4A 3FFAA 4N7JA 4NOMA 1DKRA 5HKLA 3UC9A 1G98A 1YCHA 2GLXA 3ZVRA 4WBNB 5KTNA 4XQGA 4UOQA 4IJWA 3L7OA 1A77A 1SG0A 2WEKA 3CVWA 3FUWA 3GGPA 1T9BA 4LBVA 3R41A 4IXNA 2PH1A 2IUEA 1VG8A 2C82A 3AHCA 4QATA 2V3WA 2YV3A 3I2YX 3A1EA 4IOJA 3T12A 4PCVA 1NVDA 3FNEA 4UTXA 1SN7A 2QTVB 3AUAA 5I9TA 1FNNA 3DYIA 1ORIA 2Y9PB 2VPIA 3PHBE 5ES4B 4EH1A 2EW1A 4XM1A 1IU9A 5DU2A 2IHUA 2AXPA 1E2PA 4MS1B 1EVKA 5JOQA 1TTTA 4X5OA 1LCIA 3JRWA 4PX2A 2WU0A 3S1AA 3ZGOA 3ZJYA 3WA7A 1PZMA 1S1CA 3GRVA 3W5HA 3I2FA 4TTQA 1ZCJA 3LIPA 4HLQB 3RJ9A 1FU8A 4WK6A 4A92A 1ZIXA 2PQ2A 3SDBA 3ZBPA 2G82A 4BB9A 2WUDA 3FDJA 5ITWA 2ATCA 2O19A 1Y7LA 1MMFB 4G89A 4EHIA 2D2EA 3OF2A 1U6IA 2NXCA 1RP7A 1T91A 2R97A 2YZGA 3QEKA 4G56A 5EVCA 4HNAA 2NZYA 5DW0A 1CEEA 4GOOD 2I8LA 5EXPA 5FI5A 2HXGA 2OTCA 2BDEA 1IZ0A 3FLEA 3N8KA 3MJSA 4E30A 5FEMA 5GAJA 1MG0A 1T2FA 1UMKA 2GFQA 5A9TA 1M83A 3BIXA 3I32A 2PZBA 2YINC 3DWEX 5FJJA 4OI1A 3HCWA 2I2CA 1HKUA 1RTKA 4P4LA 1ZI8A 1VG0B 3UK0A 4E2ZA 2RHWA 4QLOA 5DEOA 1HX7A 1JFVA 3J81A 1ORWA 1MQAA 1GR1A 2BFMA 2VRWA 2X6RA 4FWIB 3M9XA 3UMSA 1SK8A 1QWSA 1XRRA 3L3BA 3ZXUB 2RHCA 2A94A 4DILA 3WL6A 3O91A 3H5OA 2ENUA 2FDRA 1DAHA 4XQCA 4C0WA 10MHA 4YWJA 3ROKA 4HQKA 4YTEA 4E5SA 4Y9RA 5CIYA 1TYDE 3GN2A 1L9KA 2LPMA 2R3SA 1ID1A 2ORVA 4FP9A 5FBKA 3KU1A 1TT5B 1D2EA 3VR1A 4I3FA 3NBUA 1YRWA 4B8YA 3MSCA 5KOIA 5CFMA 3KQNA 1VKJA 1Y4ZA 1I7NA 3D6MA 1SA0A 2X3UA 4BRWA 2Q5OA 3FTCA 4MRSA 1M73E 2H4HA 5DGIA 3HXTA 2ATVA 2VUIB 1U0OC 3MTGA 4I1SA 4IDBA 3SJCA 4IJUA 4F5ZA 4CN9A 4QOEA 4UTOA 2PUJA 3ZDZB 4Q82A 3U17A 1OF1A 2JFBA 2W9XA 3ENNA 5FUXA 1E6KA 1PR4A 2IEBA 2QN8A 4KWHA 4Q9IA 5DSZA 3VU8A 4X41A 4OLAA 4P9NA 2YUTA 3TSWA 4LXYA 3AUJB 2HLNA 3D4IA 2QZ4A 3SYLA 4GDFA 3F3SA 3HACA 4N76A 3I9OA 3AUXA 4Y2GA 4PV7A 2X8WA 4P86A 2Q3HA 4R01A 2PMFA 2UYGA 3GFRA 2QTMA 2QR5A 2QAGA 1GL3A 4XLTA 2G0NA 2H1RA 3FDZA 2B2NA 2WU4A 4JAVC 3SZMA 4E32A 4K1LA 2PDAA 2HJGA 2RKOA 4RNDB 3R7WB 1GSIA 1M72A 4IMPA 1E1MA 4LZLA 3GLFA 3HZOA 2DBVO 1P2TA 5IEJA 3OTOB 4XWAA 1NOIA 5LMNB 1GAJA 2ACVA 4YJ2B 1BVHA 3V7WA 4KHZA 5I9IA 1GAQA 3H05A 1ZAYA 5C2JB 4JGBA 1O97C 1UC5B 2WR8A 3B3GA 1XZKA 1OU0A 1SC4A 2A1TR 3PPIA 4GM0A 1OYWA 1UANA 4HDKB 4LW8A 1RJWA 3UHFA 4L78A 4D8VA 2AZTA 1E1CA 5T6MA 1U81A 2OAP1 3RAGA 1EG7A 4ZT4A 2VUTA 4QASA 1H4QA 2A59A 1U8AA 2V03A 3LD9A 3IDAA 4R6WA 4XQEA 3WWZA 1US8B 3DEIA 2F3SA 1V1MB 1Y8RB 2PZKA 1H2HA 1EJ0A 1YWGO 4AF8A 3N8IA 4EQ6A 3ASZA 5CYPA 2JFZA 3JATA 1C7RA 3OWHA 3DWIA 4KSCA 2E87A 5F2NA 5ANRB 16PKA 5K6AA 1BKDR 4IXMA 1ZXLA 4M7PA 2GPJA 4Y2HA 2DHRA 4AF6A 4Q9DA 1Y82A 3F96A 3ZVMA 3DMPA 1UT8A 3WP1B 1K66A 3EQ7A 3L01A 2J3MA 1I0LA 1ZAKA 4JB8A 5C32A 1JWLA 4LZOA 1DOHA 3UO8B 1PBNA 3R3UA 1G19A 3C41J 4PNHA 1PKEA 3ANTA 1T4CA 2C2MA 2JH8A 3T9EA 2DTEA 2GCNA 4YMUA 1YR6A 3B1VA 2WJ6A 4LTMA 1EUCA 1Y63A 1X1SA 5DLYA 2WG0A 4F9FA 5L3QB 1L4NA 5C3UA 3RS4A 3UQYS 2HD4A 1J07A 5CMLA 2VJOA 4XX0B 3RRYA 1YR3A 4MUGA 4NEHB 3FYUA 1BHO1 3PS9A 4PIPA 3RIEA 3DR5A 4MINA 1EVYA 3IAXA 3NHFA 4PIVA 3EF3A 3NDJA 4YCJA 3R5XA 1ISFA 2KYRA 4RMNA 5DK6A 4RGYA 4ZQGA 5ALLA 1ZP6A 5JLJA 1TQ8A 1JT2A 5ER6A 5A3QA 1VKNA 5HZMA 1WU7A 2ZE7A 4V02A 4GPD1 3R77A 5IRCD 4MDEA 2XH8A 3KKOA 3OZEA 1BHJA 1U2RA 1FTGA 1V9SA 2W2OA 4LNAA 3ETGA 3MJCA 3SC4A 3VZBA 4CTOA 3KPVA 3NC4A 5LPNA 3KCQA 1OBOA 4RQTA 3H7AA 1M9NA 2VT6A 4G0MA 4D99A 5HKKD 4X64B 4LJ6A 3JRXA 4JFAA 2ZZMA 1J20A 4MKZA 4ZZ2A 4KQXA 1OAAA 3ZCVA 2J9XB 2D3TA 2D2XA 3G3EA 1HUQA 2QAJA 4YCLA 1EFRA 1KEWA 4O5OA 1B00A 1FFGA 3C3AA 5ECYA 2P5UA 4RF3A 4D9GA 4EABA 1X2BA 3WL8A 5BORA 3NO4A 3PUWA 2CUZA 4RTPA 1H3FA 1FFWA 4JP2A 4QRHA 3ZV6A 2FE1A 2D2IA 4LECA 4IGFA 2PFKA 1U02A 4CI9A 5CX1B 2YKGA 3T3OA 1LPNA 3ZKWA 4JI0B 1A8UA 1E7RA 2GEDA 2YRWA 3AY6A 4FZ3A 1FLVA 3ON5A 4Y6RA 1NOJA 3WLOA 3LIIA 1B23P 5AVJA 5DGCA 1OWOA 5TJ9A 4K81B 3PEVA 2VHTA 5IJ9A 3Q0TA 4L8LA 3MMZA 4NKRA 1OLXB 4HMQA 2YIDA 5L3ZA 1A98A 2XXAB 3WYAA 5GPBA 3OOSA 2VJMA 4RNCA 4UBIA 1OREA 3CVJA 3B6KA 4KODA 1CNEA 1IHDA 1NG1A 2VK1A 4CCYA 4DIFA 3PXAA 4B43A 5LVAA 1X86B 3VR2D 4EX7A 4DIBA 3OA2A 1QJCA 1GN9A 4B1FA 2QP3A 1YNSA 3VZPA 4BQEA 4G85A 4FUQA 2KI5A 1T5TA 2R8BA 4P0PB 1N78A 2PMEA 2ZQYA 3M3PA 1ZUIA 2IIBA 5DXAA 3AHFA 3SBEA 1W93A 1VA4A 4J7UA 3N9IA 2DH5A 3VMMA 2NZ2A 2J32A 4V0SA 1QV6A 1RQGA 2Z8ZA 5CM8B 1EXVA 5BV1A 1T0JB 4CMHA 2Q5IA 1J1ZA 4PQFA 4ESEA 1MAHA 5AKHA 5ICFA 1MV5A 2W2XA 3SQDA 3FRJA 5DOZA 4BU0A 1CS0A 3A31A 2E48A 4TTSA 5JNRA 4J1NA 1Y4UA 4CIXA 2GO1A 2AJ8A 4GZ3A 5J4HA 4F3NA 1P3Y1 3QVTA 4XTRA 4P84A 1K8ZB 4UREA 2V7BA 3WMFA 2EJCA 4LV6A 1CNFA 1JR3E 1KKLA 1WLSA 2YY5A 3E3MA 2ZOSA 2E6UX 1T3TA 1MIOA 3HJUA 3HU2A 1Z45A 1WD7A 4GM1A 2VDWA 4HDCA 5TDHA 4CIWA 4Q48A 1HDRA 4IRXA 1D8AA 1E3WA 3EVCA 4XIGS 9GPBA 4UNNA 4EKNB 4DDUA 3C87A 5DI3A 4B82A 4LIPD 1Y8AA 1UCFA 5B7QA 3PFBA 4GDMA 4JL6A 1HNWB 3C8MA 3DVRX 5HIJA 1M1UA 3IVCA 2D7CA 1BJRE 3FVVA 4O4IF 1OXTA 4C9BA 4D57A 4W1PA 3QJYA 1DBPA 3FJOA 1Z7YA 4R7ZA 2FWRA 2QVGA 4V0RA 1YZYA 2NVWA 1G41A 1L4EA 4R54A 3L7BA 1RZRD 2H4FA 3DWFA 3NAZA 3PZRA 1XMJA 1XLTA 3WBFA 4KO3S 3H5IA 4D6YA 1Z74A 3TI7A 1M2GA 2J3HA 2QAGC 3G68A 4MROA 1Y8QA 3FHLA 3SQNA 4CL2A 3A1WA 3DUFA 1N75A 3N76A 3B6JA 4MLPA 3GLHA 1Z82A 3QG1A 1P72A 5B12A 3WKEA 3HDJA 4JSYA 2O2ZA 5LBTA 3USES 3G9UA 3GJQA 1ODJA 1CJUC 1IHOA 1YBVA 2I99A 3QTTA 1SU8A 1X77A 3H8VA 1X94A 4E7PA 2DLCX 2QJRA 4G1VA 3TKYA 3X2SA 3W3ZB 1C1YA 3ICQB 5DYWA 4IJVA 1M1YE 1X0XA 5AOBA 5K0TA 2ARKA 1NT2A 3KRTA 1GNPA 2H1FA 4UNQA 5HTKA 2XE6A 3ORRA 4NDAA 5DF1A 2GETA 4QODA 5H70A 1M2WA 2LCIA 3GLQA 3VR6A 4KP7A 2VYFA 5FBHA 3ZKAA 3NC0C 4Z51A 1WSWA 4V0KA 3TIXB 1UAAA 1A04A 4JKIA 2P9BA 5FNVF 1IONA 3S27A 4AD8A 2QUHA 2CL0X 2OCAA 3SYNA 3MMPA 3DBHB 4XUCA 3L6RA 3DPUA 4WN3A 4KX3A 1YDHA 1MCZA 2Q6KA 3KTAB 2Z0MA 2IEAA 2OCBA 2CHGA 4QHSA 3VPBA 4F85A 2ONCA 4JEHA 3CZ9A 4P58A 1W88A 1YQXA 5HF6A 3AONB 2QD1A 3C6QA 4IIDA 1CBUA 5JH7B 3ECAA 3PA8A 1TU3A 2RIRA 2VF8A 2CFRA 3L4BA 5GVRA 3HXKA 5AVUA 3KQMA 1Z4NA 3MFYA 4JB2A 1AXEA 1F12A 4WXHA 4YJGB 5EJMA 4RTNA 1DJNA 1PL8A 1XCLA 1E3SA 1JNYA 1NQXA 4L3VA 4B45A 5CUQA 3IHTA 1RADA 3UMBA 1ID8A 2DUMA 2P2ZA 3UGKA 1KMNA 1QS0B 1Y5RA 2FP4B 2M6SA 3QJGA 1IBRA 1YK0A 4C2TA 4CTKA 3B2NA 2OXIA 3STXA 5G1PA 2CDNA 1YS2X 5FOTA 4XSVA 2QJTA 3VFDA 1JDTA 1E2UA 4DQ0A 4R84A 5K8TA 1XC7A 2B7CA 2BMEA 2HC9A 2V5VA 3PIDA 4JN6B 4LOLA 1I3OA 2YMPA 2C7BA 1NZDA 4FYIA 4G37A 4LNUB 1V8ZA 4GI7A 2FPWA 3F98A 4O4HB 1I13A 4C20A 4EHFA 2RBKA 3O4FA 3LHDA 4K26A 5CFRA 2AVDA 2I1VB 3V4FA 4F9GA 2FSUA 2OCYC 2H11A 1NI4B 2E7ZA 4OHXA 3EIHA 2OK7A 5H3LA 3SKXA 4N5LA 1IY1A 2R79A 4UBNA 3JQ9C 2CXHA 1E2KA 3KWJA 4NOLA 2QUJA 1DEHA 1G3UA 1ODIA 2B1GA 2W6PA 4UMVA 4D92A 3OQ1A 5JNLA 3M1LA 5K4HA 1TYAE 3G8CA 2IGBA 1YQGA 3WAJA 1EGAA 1QO7A 4LHZA 4RA6B 3VOAA 3L04A 1JR6A 3LZ6A 5GP1A 1HZJA 1PQWA 1V43A 3AXSA 4ZVUA 1CT9A 2HJWA 3IURA 3EZLA 3ZX5A 1YB7A 4BNJA 1U9ZA 1UXKA 5JAPA 2PSJA 1DHTA 1EDBA 3MXOA 5IABA 3T9DA 2XODA 1P17A 2B92A 1UBUS 2XE4A 3EXFA 4IVPA 4TRRA 1L3BA 4Y98A 2Z2JA 3JX9A 1FMJA 2C83A 3P9CA 5TPZA 3LUKA 5F7XA 1X14A 1BU8A 1BX3A 1KR5A 2QPTA 1OHHA 2JEZA 3EAGA 4MS4A 4REQA 5EQFA 4BNZA 3AEKB 2CJPA 1TL7C 4KFUA 5DGHA 4CR6A 5C53B 2ON6A 3GFQA 2IKSA 1UOPA 3ASVA 3FHTA 4F06A 3L4EA 1R5JA 4OTZA 4HNUA 4FGLA 4TMWA 3ZHCA 4QX6A 2WMNB 2NSYA 3AF2A 2X76A 3BGSA 1N1GA 2Q6OA 1RRKA 2XVZA 3T15A 4H17A 5ES3A 3F4BA 4AFNA 1JTFA 1B74A 1AK9A 1G5FA 2WVJA 3JYLA 2QRPA 4M60A 4TMFA 2CL6X 1GU1A 1TFUA 3GLTA 4LISA 5DISB 5F35A 3RK1A 5HRUA 4LHSA 4WBNA 2JGKA 4BASA 5EQDA 3ODGA 4LDRA 4TV9B 2QSJA 1N1EA 2QRVB 1FCJA 1ZN8A 1JZSA 3BF7A 3Q9SA 1W4AA 3QNUA 2FW1A 1EGVB 3OHPA 1JHZA 2ZBUA 1DIBA 5LD2B 2AL7A 3BFKA 1POWA 2Q6TA 3RU3A 1Z2PX 1H9BA 1Y7PA 2JFWA 2W48A 2ORWA 5JAMA 3SR3A 1CULC 3OT1A 1KYWA 3UJ3X 3WXBA 1OBFO 1XXHB 1HDOA 2PO5A 2XW6A 3N0RA 4CM6A 1HR0B 1DXYA 2XA1A 5CA0B 2O2EA 2OK8A 1UK8A 2P0EA 1KI8A 1TKCA 2ZRNA 1H2ZA 2W98A 3MBKA 5M2QA 2G88A 2YIVX 3S2EA 3B9PA 1T29A 2J0VA 3CYFA 3ROQA 4AYTA 1Z5UA 1NFFA 4RF4A 3WISA 2B3TA 1XDWA 3MIZA 4JHXA 5KPJA 1A2QA 4KKXB 4A73A 4PANA 1LW6E 3S5JA 5CM2Z 1P3JA 5B3KA 2GZRA 4KITB 4LQCA 4Q3AA 1PFVA 3OEYA 2CCGA 4XUGB 4BNDB 4J2HA 1EZZA 2VDQB 3WDLA 1K7EB 1GKIA 4DW8A 4ZHQF 3TUZC 1KOJA 5B36A 4PYKA 2CHVA 1OZFA 5FNVA 5MDHA 1SKQA 4X54A 1KPGA 1NVMB 3EVGA 2YH2A 3SYTA 1JAHA 1U8FO 2C78A 1Q0RA 3T7IA 1JKJB 5C35A 4CKBA 4GSYA 3SWWA 1FIUA 1UDCA 3I6ZA 4E4TA 3HJGA 4IHJF 3BWCA 3I2GA 4LKOA 5EXTA 4LF5B 4YBRA 4G5FA 4UD2A 1C7ZA 4ZMSA 3FMVA 1OC4A 5I9SA 3EGWA 3NT4A 4YPFA 1MB0A 1B1AA 2V8OA 3VX3A 5ESRA 5KJ1A 1H93A 2DLNA 1KAMA 1G8FA 2DR0A 2JFXA 2MR5A 5JQGB 1S89A 2HT1A 1ZWKA 4Q0MA 5BNZA 5HKOA 4MICA 1OAOA 1EXNA 3IAAA 4IAOA 2FDCA 3NHAA 3AH8A 3B7PA 4FMDB 3NALA 4KXYA 4HT3B 3WIOA 5JYEA 3UWOA 1DDIA 2QXTA 4X71A 4NBVA 3N2ZB 1CP2A 2OWEA 3QVSA 4RS3A 3PGMA 2BKXA 4IWYA 4A16A 1W5AA 1GFIA 3WDMA 2H1WA 4JBXA 1C2TA 5KJFA 4NJMB 1G66A 1U65A 2PKWA 1W49A 1UKVY 3VC3A 4KSBA 4AF7A 4AMUA 1CD5A 3KX2A 4O4IA 1U31A 1M0WA 2ZE6A 2YXLA 3BH6A 1L7PA 2VATA 4NATA 2YWCA 3GBSA 3M6UA 3K73O 1AF7A 4DPMA 2HPAA 2ZB7A 1ST3A 3NDPA 1XHLA 4P36A 4MQEB 1ISJA 1TD1A 5FA5A 4ZWNA 3PKZA 1T4BA 2YDYA 3A28A 3HZHA 4V03A 3WSTA 4DT1B 1E2IA 3QBEA 4YMVA 3KBBA 1ETHA 5JQWA 3THWB 4N01A 1M6VB 4R9SA 2I9PA 1D4ZA 3EFEA 1Z6GA 2PSSA 3OF3A 2ESRA 3R7LA 4AG3A 3OZXA 4EYGA 2G17A 3OJFA 4LWOA 3JRNA 4WJZA 4F2GA 3SHWA 5LP6A 4OGKA 3IMEA 1PFGA 4NHOA 3T4PA 1BGXT 3EVBA 4Q16A 3TZKA 4HEA1 4C1NA 4M1QA 4O0LA 2O3SA 4ZU3A 1HPLA 1FDVA 2PMWB 4OOFA 4RIIA 3WMEA 2GMWA 2YMLA 1NRIA 2JZNA 3UGTA 5LUAA 2HIMA 4KO8A 3ZD6A 2YHBA 5HYVA 2XCIA 3JQAD 2YWDA 5JPDA 5BYBA 2DFDA 4HFMA 1UWVA 3JARB 4DN6A 2JLVA 5FQOA 3CLKA 2GASA 4BVLA 4Q1AA 1L4BA 4RTOA 4OI2A 3RDPA 5LQKA 2V54A 2F3PA 2VJBA 3F4LA 1RPAA 3QVMA 4E6PA 2ZIXB 2JL1A 4EFDA 3ESYA 1Y6ZA 3ZNNA 1GFZA 2PFGA 3MTQA 1BMFA 5HUJA 4PC1A 3AUUA 3VNUA 2AT1A 4QGHA 1KEUA 3OQMA 2R7AA 2O48X 4NS4A 4A4DA 5EP2A 3ZDDA 1YJXA 1G1AA 3U4DA 4QXAA 3CIFA 1SBNE 3M89A 5ALTA 3HB1A 2HT6A 4IKEA 4TMXA 4FT4A 3WNDA 1KKUA 3TRJA 1MX9A 2LDXA 3IP3A 1R4AA 4IXDA 1SCKA 3WJAA 5J1SB 3T7AA 4RELA 1UDBA 4Q7KA 4G6ZA 2EL7A 5E7QA 2LKDA 3H9EO 3LBAA 3MMSA 4X92A 5F4BA 1E2BA 5GJWC 1E1RD 3H3XA 3KL2A 3M70A 2ZE8A 3RYFB 2BRUC 4K5QA 5DK4A 1I94B 2E5WA 1ZD1A 3IA2A 3NFYA 4PAWA 2A67A 2AC2A 2ATEA 2H16A 3EC2A 5AHWA 2XEDA 1ORVA 5I5GA 2OXEA 4MW0A 1P4SA 3QWAA 4HWKA 1U7TA 4UUNA 5C7LO 4QJBA 4BO2A 4MGKR 2I7TA 2WOOA 4GOND 1WRBA 4K46A 3ZZNA 1KVRA 5DE3A 221PA 2EJVA 2Y1DA 3A1SA 3UWPA 4BX8A 4YLYA 4MUBA 3L7AA 2HQBA 1G8PA 1C50A 4TT8A 5DYTA 5EMNA 3PG5A 2DKNA 2JAUA 1KMMA 3FR8A 4KAAA 2F8LA 1EFCA 4A6XA 4YRKA 2PD3A 3OU7A 3VDXA 4CMIA 3I61A 1O94C 2DULA 2WLSA 4PSVA 4O2RA 5EQJB 1GUZA 4MS4B 1VI5A 3RVKA 3UCFA 3KJZA 3EXFB 1G21B 3AV0B 2JAQA 3H7IA 3JAWB 1EDDA 4A3SA 2B25A 3DC2A 4NS1A 3U2QA 1UMBA 1U99A 4QL3A 3KT3A 4XYLA 4DCOA 3I72A 5BMVF 1HYHA 2Q1TA 2TRSB 3AFIA 4HQLA 4ND1A 4PSKA 4PZ0A 3VI3B 4C7BA 5I7HA 1QB8A 3BG5A 3ZVNA 1F9AA 1RQLA 4HXEB 4PINA 1KH1A 1X8LA 4X1YB 7YASA 3QVGA 2C2YA 4UBLA 1TJ4A 4O0MA 4Z3DA 3C14C 2MSKA 3C48A 3NRCA 3DNPA 3EDMA 4DSUA 3DLCA 3NIBA 2F59A 3TW0A 1QZTA 5KYYB 4F6RA 2QD5A 1M33A 4NARA 4EIWA 4CETA 4AMGA 3FTEA 2DHCA 2JIQA 3ZBQA 2PAFA 3LZCA 4UVEA 1GDHA 1KEVA 5E9JA 4G4IA 4WN9A 3DLHA 2GBLC 1BN6A 3CG0A 4HGQA 3VUEA 4X7PA 4IHJA 3K0AA 2Q5FA 2FFRA 4FYXA 1TF7A 2C9DA 5A1TA 4LZJA 5CTAA 3CVOA 2Z6AA 1AGRA 2QUZA 3PDJA 3D2AA 4JR0A 2JHGA 1KORA 2MYTA 2X0NA 5JVDB 1ZY2A 5AJZA 2E0IA 5EWMB 1FF9A 3HTXA 1I7SB 1I1QB 2C2OA 2GHTA 3AR2A 4CRWB 2WTEA 5IDQA 2IW1A 2ZVDA 3CO5A 5H3HA 1MTZA 1WXFA 1MJHA 1KIAA 4LA4A 4PHTA 4RPGA 3NOVA 4H6VA 4JLDA 2F17A 2PHZA 2IWHA 3SR4A 2DRIA 2FPUA 5BN5A 3UAZA 4HZGA 3OFJA 4YRJA 1TKAA 4FEGA 3WHKA 1PK8A 1T1GA 4RLSA 1I4DD 3REQA 9ABPA 3CW2A 4F3RA 1PG0A 1UOQA 9ATCA 3BOSA 2J0EA 3OKAA 4LYYA 3DL4A 1GZ3A 5C46F 2HFJA 2QS9A 5FOXA 5GIOE 3CWQA 4TTJA 5BSEA 1T36B 4GUAA 3MJDA 3IRUA 3W5IA 4GBED 3R5JA 3AEXA 1R1DA 2XAAA 4IBOA 1T25A 4JLUA 3D7MA 1FJXA 3MWJA 5ERYA 3UJ9A 5ILQA 3EW7A 3NM6B 2JKZA 4MPTA 4ONEA 2I4OA 2VC2B 3EZ9A 1RKUA 4MUEA 1KK1A 2GSDA 4BECA 3AV3A 3COWA 1YS6A 5AT1A 1ABEA 4DZRA 1R6TA 3KT8A 4JOBA 2QN6A 2ZIFA 4YR9A 1FNMA 1SVNA 1ZIYA 3CPSA 5HZKA 1L7RA 1WO8A 4Y2UA 5CNIA 2H9YA 1WBDA 1S3GA 5JXJA 5KPDA 5HBGA 2CJXA 1E5XA 1M8KA 1KZ6A 2NQ8A 3BJRA 3LUPA 2P2SA 4J76A 3PC8A 4Z49A 1M6WA 3HSYA 1SVLA 5BN4A 1ZCFA 2A9JA 2D7DA 1NMZA 4BZPA 1PR0A 1U8CB 3U9LA 3RV4A 2BGNA 2OVBA 4FKZA 3KVRA 2X8JA 3FCXA 4JT4A 3RC9A 3HY4A 3PE3A 5EHNA 2I22A 3B1YA 2O3TA 4CCYB 1E2FA 2ZR7A 1EZ4A 3M9WA 1U3TA 3C70A 1DHRA 1KMCA 3DHNA 2BEUB 2IYZA 1RI3A 4JJ6A 4M83A 4WKPA 2I7CA 1SHKA 3PF8A 1C3EA 2HF7A 3A2LA 3ED5A 4K87A 5AICA 5IXJA 2K87A 3PVZA 4R16A 1L5VA 1I7LA 2L17A 4XGKA 5CPFA 1CRWG 1BSVA 5AW7A 4X24A 5EHQA 2GZSA 4EGSA 1EBBA 1LS6A 2EDCA 1WTAA 3EIOA 1KJYA 3PHLA 3BCHA 4M1ZA 2FJPA 4ZO6A 3ZYZA 2HCTA 3ZW9A 1QGYA 5J3JA 5IVKA 5BURA 3QKRB 1YKFA 4BBPA 3H1TA 4QBIA 1IOWA 3GJSA 4OYLA 4TV8B 2VBFA 2Y1KA 2YOHA 2BKUA 2L19A 3TRIA 4P0QB 2IS4A 2Y27A 3ZLVA 3GEMA 1MHPA 2AXEA 4OQZA 4LXXA 1LPMA 1OXVA 5JAQA 2X4IA 4P81A 4Z2YA 3VZSA 4DDHA 4ZCMA 2CT8A 4LK2A 3EFOA 2RGEA 1NUSA 2Y68A 3LY9A 4QFDA 4PC2A 1ZCBA 4QTXA 1JDNA 1EGMB 1GIAA 1I32A 2EU8A 1KSFX 3OZUA 5FULA 1AUQA 1Y5NA 5BWOA 1VB5A 4MA0A 2Q45A 2LW7A 3E81A 4I1YA 2OL4A 3LFHA 2FWNA 4GOMD 4HB3A 2R0QC 1ZA2A 3MWEA 1C30A 4US0R 1RYBA 2EBWA 5CVCA 1Y6RA 4OXKA 3R7AA 3ELYA 2G9NA 2IYYA 4TL8A 3PIRA 2C04A 3K31A 2AD1A 2OCGA 3HYSA 3WS7A 3LUAA 2TMYA 1B16A 4PICA 5FUQA 4FCCA 4X93A 4AQYB 3ZR4B 3QKSA 4DRXB 4TV9F 3ZXXA 3LQYA 2BZGA 5GWXA 1OWLA 4B6GA 1QQBA 3QI7A 4JP1A 3DGEC 3IIEA 2DYKA 3GT7A 3OCZA 1LWNA 1TQHA 3NBXX 3BE5A 3DAGA 3Q72A 5AJVB 1VE6A 2FSIA 4BHTA 5I7SA 5CNMA 2ETVA 3HCRA 3QM1A 2QT9A 4KEAA 3K9LA 3BFVA 1EEHA 4AS1A 2GNOA 2WAYA 4WSOA 5K3OA 3AIMA 3KE8A 4UJ3A 3IP9A 4B47A 1F5SA 1XMPA 1FYDA 1LVUA 1TLTA 2YVLA 3B8HA 3KQHA 2NAPA 2JVJA 1K27A 1UP7A 3HBFA 1UBJS 4QLAA 4RJ2A 1WHSA 3PEFA 4AJJA 2JGRA 3BMXA 4INZA 4ND8A 4JVMA 1ZL2A 1Z25A 2PG3A 3NM5A 3C4VA 3T41A 1O57A 2PUBA 2CLCX 1QYRA 4KFSA 3WV5A 5FAKA 1XVIA 2J3LA 5CW2A 3D1LA 3RF6A 4RMGA 3PCXA 5J59A 3BH7A 4NHEA 2WWXA 4NSNA 3UT6A 1FBTA 2WIBA 2PTHA 1OX4B 1SOAA 3BN3A 3Q7SA 2C2ZA 1B0AA 2AFIA 2B36A 2RC6A 4G97A 4TWBA 4TPKA 1W73A 2J4CA 5BVHA 2XXJA 1P4HA 3WRXA 3F3KA 3UYLA 3U7FB 2CVPA 2GI4A 2WJJA 1J4AA 3MT7A 5EZYA 1QIIA 3AF4A 1WXIA 3EVNA 4EHKA 3EPPA 3R23A 4KOAA 1EUZA 3PQFA 3SIRA 1RZUA 3AB3A 1YK1A 2J33A 3E03A 1DJOA 2FEKA 3I0ZA 4Q7LA 1SGWA 2OXTA 4YAJA 1KEPA 3EFHA 1O6CA 1OT5A 3LDUA 3G23A 4KIWA 5ESDA 5AVSA 3HHEA 1ZICA 1E4VA 1H0HA 2CLMB 1SBCA 2YC4C 3B1ZA 4R8VA 3RS7A 3UYKA 4CVNA 5AW8A 1GZVA 3DM5A 1VCMA 1SCJA 2ZRPA 4KYIB 4EG6A 1BJTA 3A1FA 4YC7A 5JNWA 1GV1A 3I09A 1EAYA 2OUIA 2EKZA 3QV1A 4N8EA 5B30A 2OFFA 5LC1A 2AH5A 3HJRA 2FPPA 4S24A 4Z4QA 3RNLA 3JQ7B 4H7JA 1R6AA 2OORA 3UJ7A 3HXMA 3H0CA 1UBFA 2CWDA 4V0ME 4AKHA 3B5JA 5HQTA 3BZWA 4OHFA 4QZVA 4R2WA 2PTGA 2HA3A 1P1HA 4RK5A 3VSAA 2FPGA 2P77A 1FP2A 1USUA 4I8DA 2ADMA 1XVVA 2WMOB 3GWZA 4YWHA 1MEOA 1ZBDA 3SJAA 3SYRA 4PN7A 5P21A 1WF3A 5THQA 4BVHA 2J0UB 1I36A 3EXG2 4EKDA 1EDZA 1ORHA 2IYRA 4I4IA 1WXXA 3K16A 2RDMA 2ZBVA 1DVRA 3GPIA 2YXNA 4DB2A 4WOKA 1EUDB 1C3OA 4P3YA 5KWVA 4J4HA 2QD3A 2V4UA 1VJ5A 2BSAA 3LP5A 1CQIA 4HS4A 4ZYWA 3BB4A 2GPAA 4M0UA 3OE1A 3V8EA 3WYBA 2QTRA 4BX2A 2FF5A 4FOTA 5LNK6 1BXRB 1ESZA 2R8PA 2ZJ6A 2JDID 1BX0A 2CBZA 4CYMA 2VO1A 3QBTA 2OO5A 2WIJA 4M98A 1BCSA 2PN1A 4BNUA 1WP4A 2W37A 3EBOA 3H1BA 1NQWA 4CI0B 5MN4A 4ZRDA 1VE7A 2E4UA 3J7TA 4BQSA 1X7HA 1IXKA 1DAPA 1PIWA 2DKFA 3E48A 3QWFA 1X38A 4QUIA 2Z6UA 4L5CA 1HT3A 4N9QA 4RXMA 3SEFA 2QMUA 4BLVA 5REQA 4BZXA 1MZPA 3HHPA 2UAGA 1JBKA 2FOIA 2ODBA 3H17A 4G8JA 1L4KA 3NX4A 4H7KA 3A70A 3DB1A 5AKLA 3MS2A 5CD1A 3TYXA 1FPMA 3PJDA 4EKYA 1P73A 3RUPA 2NVUB 4DCCA 5B7PA 1IM5A 2ECPA 1TAQA 4Q15A 3ZE0B 5CVDA 3ZLTA 1E2MA 4Z1OA 1V9CA 5BV8A 3ABIA 5EHZA 4ILEA 3A06A 3CVUA 5DN9A 3KD2A 3T5DA 3DCYA 2B8TA 3LOPA 3LYAA 3LI2A 4RD1A 2C7OA 4KQCA 3MGKA 4Q3BA 1SOUA 3KSRA 2G25A 2CF5A 3P0FA 4B4VA 3I53A 5DX1A 4IMRA 3LGSA 2EC5A 4C7KA 1XMXA 3AU8A 4Z4CA 1XBTA 1JEDA 2IIVA 1HDYA 2FNAA 2PV0A 1OFTA 4A1OA 3WLLA 2HRBA 1QPZA 2JHAA 4G3XA 5L3QA 2QLMA 2RG7A 3NEPX 3TAUA 1FP7A 1AA9A 4AW9A 1PJQA 3PUZA 5B3JC 2BOVA 4FXPA 3QX7A 2FY8A 3FSRA 3I2IA 3AEZA 3OJXA 2JJ2D 2QYOA 4OB6A 4S2UA 4U2BA 3VSCA 3TKLA 2Q0XA 5IPFA 3OIGA 1B0PA 1GGNA 5FWNA 2PL3A 3LSYA 1M2OA 3TFWA 4DLPA 1GITA 4A2CA 3DTTA 3TE6A 4ZHSA 4R6XA 3CVVA 1I10A 1N6IA 2WTNA 3UMJA 5IAOA 4P4NA 1Q1AA 3OTHA 1HF3A 2XE8A 1G5RA 1YGYA 4PU0A 3SF0A 3JTMA 3KKNA 2P7HA 2Q7DA 5AUQA 4M22A 4N65A 4ZA2A 5BNWA 2B0JA 2W90A 1VYVA 4RVOA 2DB3A 4OAOA 1ST2A 5ITZA 3LPLA 1CSEE 5M34A 2G3YA 1VPEA 3GWGA 1IXSB 1MIOB 2KMLA 3HU5A 1QLJA 3KWLA 5EP4A 4L15A 3RAPR 3BHNA 3JXEA 4TTTS 1J97A 3DZJA 1T4GA 1RHJA 4YJFA 5LYJB 2GBIA 4LV8B 3EQ2A 1ZMOA 1BVRA 1LV8A 4QM6A 1WOMA 3W6PA 4QARA 2VYND 1X8JA 1CY4A 1HYBA 4KLCA 4Q9LA 3VPHA 2FP3A 1O1YA 4QXOA 1G4HA 1FRFS 1UINA 3I4FA 5DBEX 3L6EA 4Z0NA 3D3JA 1Z8HA 1QAQA 2EG5A 3R2JA 5EN4A 4BMSA 3GV0A 4URUR 3HRKA 4Q37A 1GRCA 1V5IA 3EDCA 5EGNA 2I67A 2X9NA 1K7YA 1TVKB 1TVMA 4UHFA 3RM3A 3BMNA 3I83A 3TJRA 1PWHA 3VPDA 3IP7A 4F11A 3KQWA 3NP7A 1Y3IA 4OHRA 3V80A 1FFBA 3NORA 3I34X 2O8EA 2YFHA 4JLBA 3MTEA 3L82B 4LKRA 3HMKA 4XYMA 4Y6OA 8LDHA 1JSLA 4NK4A 1G21A 3JAWA 4PZCA 3WGLA 4D3FA 1JH9A 4Q03A 5AI9A 2O7VA 3E1GA 2HMAA 3FBGA 4HADA 4ARIA 1XEXA 1IZYA 1RW4A 5BUCA 1AZTA 3I30X 3WKAA 4OB7A 1UKCA 3TRHA 1RKXA 1V7QA 2OWDA 2WINI 2HYDA 4GVXA 4YMSA 2QZZA 4IOLA 3UCXA 3IELA 1PWEA 1K7FB 1NF2A 1M6VA 4BN0A 1J7KA 1MQSA 4Q9AA 5KYTA 1C0PA 2WJPA 5ENVA 3I4CA 2RGWA 2G8LA 4O08A 1EQ2A 2W2KA 2LNDA 1Z5WA 3P27A 1CRZA 2IP1A 3TX2A 3UWMA 1X1QA 2RG1A 4E09A 4EHJA 2C88A 1I7PA 4II7A 5COQA 5DHTA 2HREA 1DMRA 3EZ6A 1W581 1JU3A 2SECE 1I3NA 4HDAA 2FKAA 2QP4A 3LOUA 4ZYVA 1F8XA 4I5DA 2WG1A 3RYFA 4BVAA 2JLYA 4FEEA 4IGAA 1AN9A 5T4FA 2C84A 1ZU5A 3G0OA 6CHYA 3RYTC 1E20A 3CH7A 4MRVA 3GHHA 3D1VA 2LE0A 2XNDD 2LVBA 4ZEOA 1OKKA 4RVUA 3SC6A 3FDXA 1ZEJA 3IJRA 1PX0A 2R60A 5GOZA 2HRRA 3QMPA 1L5OA 1DP4A 2GA8A 3FCSB 1AUXA 1B3RA 2C4HA 1DS6A 1RMYA 4FFRA 4P4UA 3VNBA 5C8XA 1L2TA 3NVAA 2OBLA 2RHBA 5T3UA 1H2FA 3AP1A 3N59A 4O02B 3OJOA 4WGFA 5EJAA 2VNKA 5AXCA 1YS7A 2GR9A 4COKA 3Q12A 4J3JA 3LWNA 4BNVA 4UASA 4YBZA 2P1ZA 3UICA 5GV8A 1XTZA 3SIPA 3WYDA 2R86A 2V3VA 2FN9A 3FDFA 4RK1A 5FR2A 3MAAC 4P92A 4TUYA 4UUPA 4M9SA 4PFQA 3BFJA 2KQUA 3NR2A 4RFVA 5C8YA 3Q2IA 2IZ6A 2MINA 5LZ5A 2VTBB 3QKWA 4MEBA 3N2GB 1A7JA 2JCVA 3M5WA 2DBRA 4YUXA 2HU2A 3VGJA 1HFJA 1UK6A 2H1VA 4XYGA 2Z4SA 4QM7A 3LBYA 3DOJA 1K63A 2BGUA 1ISMA 1PKXA 1E2HA 1ZCZA 2CDRA 2GTIA 2P6MA 2R6DA 1H65A 2HHJA 1ULTA 1FYVA 3G2OA 1A9YA 4V24A 5EZ5A 3V3TA 1SMKA 2NUAA 4HBZA 4AS2A 2AEJA 1QUFA 3R44A 1NI3A 2X6TA 3MQ2A 4HLDA 4KMMA 1YRYE 3X1KA 3MWDB 1GQQA 4IDAA 1M34A 5DBGA 1N6PA 3LL7A 1FEZA 4DLAA 2ZRDA 4IDPA 4M0KA 4GEKA 4HB0A 1YGPA 4GI2A 2OKGA 2W0MA 1ARZA 4LHVA 3R6GA 5EPUA 4AMZA 1X92A 1SG6A 4LI3X 4ZOEA 2IXDA 2LUOA 3ZXYA 1Y9ZA 4A8JC 1YVRA 3LUBA 2J0SA 1C9MA 1BXZA 1X1EA 3E84A 3LGXA 4LY6A 1I2ZA 2JA1A 5FWYA 3ZUGA 2VK4A 1Z7WA 3LJKA 3HEMA 4JX9A 4N03A 4RV9A 5BMVA 5HOEA 4R1UA 2GD6A 3RVSA 4X3CA 2BW0A 3QFFA 4TWRA 3O8DA 1JR4A 1D0IA 3WMXA 5CIWA 4ZHQB 1CY8A 2HIGA 1QVRA 4Z9BA 5JCOA 1THMA 1ND6A 3GT0A 1I4LD 4EPTA 2X58A 3PGLA 5IAEA 2AFVA 4D9JA 3LWDA 1IAVA 3KJIA 1TB4A 2DBYA 2ZPUA 1DINA 1D0SA 1P39A 3DKRA 4W5WA 4YJ3A 4KO2S 3K6SA 2P4UA 2C29D 1TVCA 4RD6A 5CJ2A 3WZMA 2XIQA 4KVGA 2YNMD 4HAUA 4F45A 2OFXA 2PLWA 2YV1A 3W1WA 1JSXA 3II6X 1BQ3A 3MTDA 1ZVQA 4WERA 3SX0A 3OE4A 1YZGA 2FH5B 2AUNA 1XEWY 4JXZA 2YCBA 5FPYA 4MR8A 1WSDA 3FYSA 1U63A 1PYDA 5TF0A 3VTFA 2OZVA 4C2AA 2QTTA 2V7TA 5K0FA 1UKEA 1TYEB 3HC7A 4ZGBA 1YFKA 1COWD 5I8WA 1E9SA 4NCAA 4L02A 3GZNA 5L7TA 3M6LA 4OUDB 3ONNA 2RHOA 2XB2A 2NMVA 1JEAA 3GVCA 2PS9A 2HADA 4UOEA 1SPBS 5LQCA 5IJ0A 1QIKA 3V1TC 3HDYA 4CM4B 1RM4A 3PHJA 3M4YA 1VRCA 2AFRA 2ERCA 1UDWA 2BFCA 4NYMQ 2ECQA 4H2DA 4OYRA 5SY6A 2HW8A 1LLCA 2NO6A 5CEEA 5KYKA 1LBSA 3T4EA 1SCIA 3DHYA 3WHIA 1VLQA 1OYYA 4IH1A 4KFCA 5KS2A 2QDKA 2Y92A 4IILA 5ARCA 4GPZA 3K2BA 4FHCA 4JBGA 4JUIA 1M6EX 5ECWA 2HQOA 3RWOA 1GPKA 3BGDA 4BV3A 1G3QA 4J4BA 1YDGA 4M8NE 3O82A 4I0WB 2A0XA 5I4KA 1TRHA 3IPAA 2B1QA 3HR7A 1ONSA 3KOWA 4HF7A 1MF7A 2F64A 3IS3A 2WTAA 3ZG6A 3VKHA 5CGZA 3ER6A 4W4TA 5AVRA 2QE6A 1K7XB 1PT8A 2I2BA 5BSFA 1UBNA 1NV9A 1OE0A 3BD6A 1KZHA 4ER3A 2Q3DA 2RH5A 3B82A 4FSDA 5BMOA 2R7KA 2D5IA 1EVZA 2FMFA 1K98A 2PYDA 1Y1KE 2XZPA 5DWVA 3WADA 4EY6A 2EHDA 2ZBQA 4C43A 2PA3A 1E5TA 4JJKA 1QJ4A 5DWQA 3ZD7A 3LX8A 2D4HA 4EB6A 5FIUA 4WV3A 1F2UB 1KZ1A 3IC5A 4A0GA 4ZI2A 4KLNA 3W5VA 1G5TA 3HCBA 1QHGA 4DNPA 4O3MA 5JG7A 3DBLB 3KYJB 1W8IA 3RU7A 4F46A 4A36A 3BEOA 1W5BA 2GAFA 4HMOA 2AVNA 2PEYA 3ECCA 3HGTA 1CKEA 4WKBA 5LQMA 1GU0A 5EIEA 3ITKA 1PL6A 3W4JA 3QKUA 4M9RA 2VAPA 4FDLA 1EX6A 3TZQA 1IY2A 3ZQJA 3QPUA 2RGYA 3U60B 2ZDHA 1FDRA 4TYWA 3SLGA 2C5HA 5A4AA 3IEMA 3EVEA 4UUOA 4LSZA 5JE8A 2IUFA 2AI3A 1SK9A 4Y2TA 5EXEA 4G26A 1TU0A 1YZNA 3RRFA 3WLEA 5BQPA 4EYOA 4CL0A 3BRCA 2HXYA 3LYUA 3AL0C 4EG1A 2ACEA 2FPGB 2P3OA 4JI4B 1W4CA 4Q4AB 1QC5A 4F6LA 2XECA 3EA5A 2Y1WA 1YZUA 2BFDB 4QO8A 4UHHA 4GKKB 2CK3A 1OFIA 1C3XA 3U7IA 4YS6A 4RJIA 3U7RA 4K9RA 2PR7A 3WE7A 4ZCIA 1ZR2A 5UKDA 4NYIR 3W8NA 3KVNA 3VTZA 3F73A 4DJEC 1NMEA 2RFLA 4KL8S 3PR1A 2Y67A 5A7HA 3T6KA 5AJTA 4BGIA 1WB9A 2QMQA 1NQUA 3ZHYA 3K4HA 3U13A 3JPWA 2AOWA 5B1IA 3RVQA 1SVOA 2ZFUA 2PRYA 4CKCB 1KKMA 4YT4A 4Q6BA 3D8NA 4MV1A 5E9WA 2IQIA 2HSGA 1WXQA 2QW1A 1Z2CA 3DOCA 2H2GA 2KWIA 4HFNA 1H2BA 2EBUA 2FFHA 4JGIA 1W0CA 4PLPA 5T3YA 3ROMA 2PUAA 4KR2A 3QE3A 1N6RA 1ODSA 1N2CB 5BN1A 4GP6A 2ZULA 1N2EA 1S0UA 3I42A 4MO9A 5CXSA 4B3DA 4A0QA 4CMKA 1M54A 2V3CC 4OXIA 3HB4X 5BXYA 1CJCA 5IULC 1U98A 4O59O 3BREA 1LBQA 2W6JA 4I50B 1X74A 3BE4A 1I3LA 3RI3A 1J0EA 4WZAA 3GP8A 4O2AB 4EYQA 1SCAA 3PJFA 2JK1A 1GNVA 4IIUA 1B43A 2QMZA 4KH1A 5DNCA 1GRRA 2ZEJA 4B79A 4B3IA 4EO7A 2ZAMA 2H6EA 1XA3A 2VP4A 4FC6A 5E6SB 1PNRA 2KE5A 3MRXA 3QTBA 4CLRA 2FZ4A 1JB9A 1G9TA 2ZUCA 3A6FA 3B51X 4IFEA 4HZIA 1TZJA 1W94A 2IYQA 4NPAA 1FRQA 2G67A 1MJ5A 4QDKA 4QUGA 4RJKA 3ZBUA 2VVTA 4BRSA 2VDWB 3ECSA 3P2YA 4FHGA 2G9QA 3LOQA 1JU9A 4Q93A 2YRFA 3REGA 3ZTTA 2GAOA 4P5DA 5AHXA 2CNLA 1AQ6A 1HGXA 2H2IA 4Y7DA 2QT0A 3E35A 5LDGA 4GMXA 4CJXA 3ILYA 5KDOA 1MB2A 1MNQA 2EIHA 4PYLA 3G0GA 2B99A 1FZTA 1KRWA 4OP1A 2F48A 4PS0A 3U6KA 3FSGD 1NVXQ 5L95A 2VA9A 3KHUA 1QHHB 2ZBGA 4EL0A 1J56A 1JLHA 3V1MA 3UCEA 4MQFA 4DIDA 4S1TA 2BI7A 3GGDA 2VNHA 1Q83A 1VE9A 2C5GA 3DP9A 4JZKA 1DJMA 3WJ2A 2X2PA 3VPXA 4CIBA 3AOEC 3BL6A 3PGJA 4KTVE 3ETHA 5AKKA 2JGNA 1ZVKA 4XIIA 5G0SA 2F00A 3WGZA 3EXG1 4D0GA 1FDSA 4DPKA 2XQVA 2C58A 4ZV4A 1H8EA 5IWAB 5IWCA 3X1YA 3PEWA 3Q7TA 1W7AA 3GEGA 3OP4A 2B1JA 2BMWA 4M4SA 3TX6A 3IMKA 3W4KA 3SJBA 3H1AA 3CRMA 2NN3C 1FMFA 1X87A 3UY4A 4GNRA 9LDBA 2GCIA 4C06A 1CQWA 4RDCA 3WGHA 1KPHA 2R2AA 3CS3A 3MQ4A 4PX9A 3TQSA 5JJKA 1P0PA 2A4MA 3PD0A 1P6UA 2ONKA 4IX9A 3EGVA 2O1WA 4OVKA 4WNYA 3ZYCA 1IIBA 2JIOA 1WMSA 2NYRA 4R1QA 1V4BA 1HXHA 3EX7C 2GO7A 5A7GA 5HJEA 5E6SA 3AM1A 2YZNA 3KR0A 3FKQA 4O8CA 3QEMB 4BE7B 4E5NA 3ZY2A 2Q9UA 7GPBA 1RT9A 1QE0A 2AE1A 3CNHA 3BEDA 1BEEA 4KBYA 3TTTA 2VN8A 3KJHA 3GJ4A 5AO9A 2FX5A 4MB0A 2BD0A 2FWAA 2CJWB 5I01A 4YYEA 3FJ1A 4FW9A 1GFSA 4QBTA 1XTQA 1W2HA 4RY9A 4DV4B 1HE5A 2AMFA 3WXMA 4H4DA 3W7VA 1ZK3A 2DFNA 4R68A 2QVCA 3PQ2A 1GUBA 1I2CA 1FA9A 3OLCX 4GW3A 2XRZA 1P5RA 4PFSA 4AZ3B 1TM7E 2AOTA 3RRNA 3H87A 3WKBA 4BMYA 1R5OA 3QEOA 3OY2A 2DBQA 1KMQA 1G3RA 2GZHA 3D3NA 4MEAA 1IUKA 5IT0A 2RGDA 2JZOA 1FDWA 1LS1A 3QXGA 1DX6A 4MVJH 1ZO8A 2I7XA 3E9CA 5DW3A 1U2GA 2RAVA 1OI7A 2GM3A 1E9FA 2NNWB 1XEFA 1R10A 3A25A 3RS0A 2GBCA 2MSNA 1A8IA 2NZUG 3FOCA 4HN4B 4NU8X 3CZCA 4TWAA 3FM9A 4LY9A 3INGA 3LYLA 4H7FA 4CIVA 4YRAA 5B1EA 3ORYA 1XNJA 2DFLA 4RPHA 1LFAA 5BNIA 2FW7A 3S29A 1TCUA 4G86A 4RD0A 4WOCA 5EJ2A 2QAIA 4GOLD 1Q3KA 4KMSA 2FQXA 4M6WA 1SEPA 3X1DA 5I7RA 3TCNA 5KNBD 1WWKA 5K3CA 1G42A 2TYSB 3EJ6A 1ADGA 3VHXA 1DBVO 4D56A 5ELXA 2FW0A 2QUAA 4UAJA 2O8CA 4LF7B 1TKRA 4BO1A 1XPJA 3E1KA 3B89A 4CF6A 2WPNA 2A35A 1NXSA 5EL0A 3RGWS 3VNAA 1ZMXA 1SXJC 1UT5A 3UG7A 2HMWA 4DG9A 3FFBA 4ZQEA 1YULA 4IDCA 5DIZA 4G23A 3IT3A 1P7ZA 3SR0A 4CLRB 1JFSA 3C43A 1N92A 2WJWA 2WHEA 2W2QA 1SPXA 2H4YA 4LJ4A 4P33A 5E2AA 3SFZA 3WRWA 1R6UA 1NJ5A 1Y0BA 1OMOA 2PBZA 2X14A 3S68A 4JLAA 5ICEA 3VR4A 1L5ZA 1NXXA 2HN9A 3ABZA 2I6XA 3C1TA 1AX9A 2CYCA 1X8KA 1FSFA 3TFOA 1V0JA 4URVR 5H5JA 1KYVA 3G5UA 1KXZA 2ZJ4A 4XXHA 1X3LA 3LC2O 2XUFA 3ABQB 2J07A 2ZSUA 1SUPA 2D0OB 4JVSB 5JAZA 4Q9HA 3SXPA 4EITA 3WB0A 3ILHA 2XYPA 2DTDA 4W7SA 2VP6A 3WNZA 1ZVMA 4UCXA 2Y0DA 4WVFA 3B70A 4ZQIA 2CFOA 4ZD6A 5JMWA 5BOSA 3L8EA 4YCSA 1BRTA 1XB2A 2W8BB 1SCQA 3CRVA 3R4VA 4TX1A 5TIIA 3O7WA 4C1BA 1DOZA 4CIAA 4W8OA 3KU4A 4J7CA 1U2TA 4D44A 2O0HA 2GJ4A 4JSRA 1WUHS 2AN5A 2OB1A 1YRLA 1JE1A 2W6JD 3F6SA 3H9JA 1LLDA 3V6LA 3WJ1A 4GBJA 3RASA 4D2IA 4F56A 3H2IA 1Z0JA 4DZZA 5F78A 3DMTA 4BY9E 3ZLJA 3ZLBA 4DXDA 1VCNA 1D8TA 4J9UE 3G9TA 1PF7E 1QFYA 1V4NA 2JFPA 1T9GR 3W77A 3WOVA 5A7FA 5KOJA 4MI3A 2GEUA 5INTA 3I73A 3RUDA 3JD4A 1GLNA 4YB8A 4C4PA 1XAHA 2OBXA 3B38A 4IDDA 4R3UC 5K0EA 2E21A 2GAJA 4P80A 2PX5A 3F1LA 2VHJA 3THOA 2JCGA 4EJSC 5HKBA 5J5VA 1N2OA 1EXMA 3R5SA 4B3RB 1XE3A 2PUEA 4IYRA 1EFVB 2WZBA 1PJ4A 4M1EA 4KE6A 2ZR9A 3PLNA 5BT9A 4MJLA 1G2PA 1NPDA 3FPKA 4TYPA 1V6AA 5C1BA 4WAUA 2QTVA 1EWTA 2XAUA 3PD1A 4LYGA 2BHRA 2GT1A 4Q5IA 5D1HA 1N2HA 5LA6F 1RYYA 3K9FC 1W6UA 2HJHA 5JYBA 3QPBA 3TINA 4AXXA 1I2AA 2P4SA 2VZLA 3CSDA 3UJPA 1WDWB 4PO9A 3NHKA 4E31A 4TZ6A 2IBTA 2ZYWX 3B3AA 1RFLA 1VBFA 2H48A 3HA5A 4MR8B 4W5TA 2CLOB 3UMMA 2FHPA 1KYTA 4RFSA 1HMPA 2NW6A 3NGLA 4M21A 4O2AA 3DMNA 3KPJA 1F9EA 4XVUA 1FNDA 1IH8A 3JQ8B 3FX2A 2DX7A 2XGGA 4CZ2A 2B34A 1YE5A 3A4NA 3ACBA 3O4RA 4DABA 3OEHA 1N6KA 4LNHA 5DCUA 4AP6A 3A6PC 2QXYA 2OG1A 5CYOA 1M8PA 2P0AA 2XVAA 2N1MA 3R3XA 4OX9Y 2OMEA 2AXNA 3GZTB 3TLYA 2WYOA 4C4XA 3RYCB 2ZRJA 2FAXA 3GLIB 1K8RA 1UPCA 1J2RA 3BHIA 1D2MA 4JBNA 3D6TB 1Z7EA 4Z4EA 5CAEA 2FN7A 4MV7A 1IQ0A 2X5XA 2CFIA 3MJFA 1HL3A 4HFJA 3ER9A 2VT3A 1HQKA 2WKWA 3DOFA 2JLZA 4MITA 5FV7A 5D3MA 1QV9A 3IPXA 3VJLA 3E58A 3UJDA 3PGA1 1RRVA 3M6FA 5E9QA 3U40A 1UPTA 1AK2A 4OATA 3SZGA 1U0SY 2Z5FA 4DR2B 4PVCA 3O8LA 2EHJA 4QC2A 5I3ZA 4K1XA 3UFXA 3EEIA 2IZ0A 1I33A 3FBWA 4RSHA 3T52A 1UOEA 3RJMA 1QYVA 5HFJA 4CQMD 2HMUA 1GR0A 1U8YA 1NXQA 1V8OA 1UWCA 3V8VA 4PF1A 4N9WA 3HO1A 2VPQA 4RPCA 4H16A 2B1RA 1LX7A 4MQ4A 1VBKA 2IDMA 4S35A 3FUTA 1K08A 4AJ1A 4V3BA 2IYTA 3IB6A 4GFDA 2VTBA 2PS0A 3Q6IA 3SS8A 4DG8A 1R0CA 4PN3A 2AEFA 4YLEA 1V26A 1AQIA 4AY3A 1RRCA 4PLHA 4TXMA 1HM5A 3MTAA 1EYZA 5KAMA 2XSZA 3LK6A 4NFSA 3T7KA 4V3CA 5A9RA 1VCHA 3NNDA 3KTDA 3TLKA 1OXKB 1TKBA 3DTVD 2QYSA 3ZJTA 1OXUA 2R6R1 5J4LA 2OCXA 1N2SA 1KXJA 2QQ5A 3O4VA 4K9DA 5IKMA 5FYDA 5U4QA 1C9NA 1KI6A 3AZOA 1GHTA 2O8BB 1EESA 1VHDA 3RARA 1RE1A 2I87A 1L7OA 2YVKA 4A5OA 2WHYA 1AZSC 5LWHA 1YJAA 2C8LA 3IERA 1ZN7A 3PC6A 3PXEA 4H6PA 5IYZA 5KYWB 3IKTA 4HNSA 2VJNA 2W6ZA 3BTUA 1CUJA 4HAYA 1NW7A 2JJ2A 2HJ9A 2ZCVA 4X20B 3TW6A 4WTOA 1M67A 2E4ZA 1RMTA 3I01A 4FYVA 2VXYA 3SM3A 4AZVA 5FFMA 3S2YA 1TIBA 5DH9A 5T4HA 2G9RA 2HA7A 3G5MA 4HDMB 1TUBA 3JVUA 5AVQA 3AIOA 2ZUEA 1RQRA 2FKNA 3L0OA 2HBQA 1H2WA 2KX7A 2Z4TA 2L82A 3E0XA 3WB9A 1DRUA 1HOTA 2O5VA 5KMGB 1Q14A 1UBCA 1CYDA 2YMMA 4URHA 1U0FA 3H3JA 1TTPB 1JHXA 4WE3A 1KIFA 4DARA 1N5IA 1JP7A 3AK4A 5AI8A 3OM1A 3M9LA 4H0FA 4JBWA 1C7EA 2A1UB 2JAPA 3TK1A 3V8BA 2OPBA 3P9QA 4S04A 1X1TA 4YROA 1E4YA 3UG6A 3IAS6 1XVLA 4LCJA 2ZWPA 4DQDA 1USKA 2X0JA 5K8VA 5CURA 4FN4A 4NMLA 3ZPXA 4C89A 5KSPA 1Z6QA 2YOGA 3BQMB 3AXTA 4Q9NA 5CEJA 2VDPB 2GPWA 4YRCA 3SS7X 2HCBA 4NABA 1FMTA 1GQOA 3S81A 3N75A 4O2LA 3WYNA 2WAMA 2G28A 1K2WA 3PSHA 1X7ZB 1GNRA 1NPYA 3PYMA 4OFXA 4PLGA 4QTTB 1PJLA 3SHFA 3W9SA 5I45A 3E15A 4BZQA 4EJMA 4KN6A 1PJAA 3U80A 5L8VA 4F7WA 3EQ8A 5TPZD 1W36C 1GPBA 3PQ4A 3OCWA 2OV4A 1ZNZA 3ONVA 4I46A 3DO5A 4HOYA 3GZNB 3IVAA 4PPQA 1GZ7A 4DANA 1CRLA 1HA3A 1WCXA 3CCBA 3HDHA 2R25B 3LU1A 1AXGA 4CDNA 4UW9A 4XJVA 3BMNB 4JIMA 2GD0A 1VHJA 2GZDA 3L0ZA 5AJHA 5D3QA 3WTCA 1KI3A 4FM9A 3OY7A 1OXBB 1GPMA 2BEWB 2C5BA 2ZM6B 3KSDO 2IXAA 1T2NA 3DBVO 3TO5A 1ECCA 1QMPA 1P4RA 1VGQA 3WL7A 5I9LA 3IV9A 1A71A 1E0JA 2H8KA 1I1NA 2AV6A 3KJGA 4ERXA 1TX4B 3GI1A 1ECJA 2BGJA 2FSVC 4I1VA 5TT1A 3T3IA 4ITRC 4O8ZA 3VNSA 4WJKB 4ID9A 4DLNA 1H4VB 5KSWB 1USIA 3A14A 3DKVA 1K8QA 3N07A 4YP9A 4ZEMA 2CCKA 5ALQA 4J43A 2Y4NA 1VXRA 4H7PA 1RAIA 4HUTA 4LFAB 5JHGB 1IPFA 1J9ZA 4AWXA 3KV3O 2ZSFA 4UATA 2HM7A 3RSQA 3TMYA 1FBNA 2EJUA 3VKGA 3LY7A 3GNTA 3L1JA 3NWBA 1A5BB 4J3FA 3D7LA 3H1GA 4I81A 3FNQA 4GF5A 5FWYB 1JGTA 2YZ7A 5I7EA 1E1RA 2W4QA 2I3ZA 5DEIA 3WIUA 1JDVA 1TTQB 3I9FA 4FX2A 4UMFA 3GDWA 5B3LA 1Z0ZA 2JJ8A 2QBYB 1RI1A 2G09A 4F38A 4R2HA 4FYKA 3BWDD 1LQUA 4FNAA 2FB9A 4U2CA 1E32A 1H6AA 1E58A 3MCTA 4FN5A 4ZT3A 3AOGA 1D6NA 5AI6A 2ZTHA 3S28A 5JY1A 2QLJA 3CJQA 3CY6A 2A9FA 5A0FA 1QLWA 2NUTB 2QX9A 2CZGA 3AHIA 3E9NA 2MJLA 4NX2A 4C0AC 1QANA 2FZVA 5B6IA 1E1QA 5K3EA 1BA3A 1CJSA 4RHTA 1N2GA 3F0TA 2YWHA 3M6XA 4R1SA 1SO8A 1ZC4A 4PHFA 1KY3A 1TCBA 2VPPA 2X7HA 2Z1MA 3EVAA 4D3DA 1C0EA 3E9RA 2WJZB 4BMZA 1Z8DA 2H1IA 2Q4BA 4LVUA 4B2PA 2C94A 1XVTA 1VG1A 3ESRA 3ZQUA 4UUMA 3ETLA 5LP6C 3UEOA 3QLJA 3MVEA 1YAHA 4H3SA 4YUZA 3KPYA 1XO1A 1E9AA 1DIRA 1J5PA 1U2GC 2F1OA 4R40A 5DBIA 1OSNA 2AYZA 4WGGA 4ZPXA 4CNQA 1NUQA 4KW7A 3ZWYA 5FPHA 2AMJA 2AQ8A 4WW0A 1KEKA 4ZJYA 2NVUA 4IRMA 4MYHA 4Q00A 3C8UA 4BATA 1C8BA 2IP2A 1QB7A 1BXGB 5HFAA 1SXJD 3I6YA 5HS6A 2WFAA 1WUYA 2VHEA 3PJRA 4CM9D 3IQHX 1J06A 3R75A 3IH5A 4GI5A 4GI1A 1UIRA 3H8JA 1CFZA 1W0JA 2BJVA 4RZXA 1K68A 1DXHA 3U3MA 3VJRA 5KNCD 1UPUA 4MIEA 4I19A 1WDLA 3P0RA 2HKIA 2EJTA 1PFYA 1VTKA 2WJHA 1FJ2A 3M6AA 4OL0A 3P1JA 5DSTA 2NGRA 3U4AA 3NAGA 1GPWB 1XZMA 2CMDA 2VAMA 5EWJB 2HV8A 2CB9A 1ZC3A 2RGXA 3EHDA 4H1UA 2CE7A 1DE0A 1Y1SA 5FAXA 1BE8A 1E79D 3BGOS 3QU4A 4JUFA 4CT4B 1S2GA 1NF9A 2HPHA 2B4YA