1UJNA

Crystal structure of dehydroquinate synthase from thermus thermophilus hb8
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
347
structure length
338
Chain Sequence
MQRLEVREPVPYPILVGEGVLKEVPPLAGPAALLFDRRVEGFAQEVAKALGVRHLLGLPGGEAAKSLEVYGKVLSWLAEKGLPRNATLLVVGGGTLTDLGGFVAATYLRGVAYLAFPTTTLAIVDASVGGKTGINLPEGKNLVGAFHFPQGVYAELRALKTLPLPTFKEGLVEAFKHGLIAGDEALLKVEDLTPQSPRLEAFLARAVAVKVRVTEEDPLEKGKRRLLNLGHTLGHALEAQTRHALPHGMAVAYGLLYAALLGRALGGEDLLPPVRRLLLWLSPPPLPPLAFEDLLPYLSLHWVVPLAPGRLVVRPLPEGLLREAFAAWREELKGLGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dehydroquinate synthase
publication title Crystal structure of dehydroquinate synthase from Thermus thermophilus HB8 showing functional importance of the dimeric state.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 111
structure length 338
sequence length 347
chains with identical sequence B
ec nomenclature ec 4.2.3.4: 3-dehydroquinate synthase.
pdb deposition date 2003-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01761 DHQ_synthase 3-dehydroquinate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1090.10 Mainly Alpha Up-down Bundle Dehydroquinate synthase-like, alpha domain Dehydroquinate synthase-like - alpha domain 1ujnA02
3.40.50.1970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ujnA01
5K8CA 1NUAA 3OKFA 3OX4A 3ZDRA 1JQAA 2D2XA 3CE9A 1DQSA 4QGSA 3QBDA 1RRMA 3IV7A 1O2DA 3JZDA 3OWOA 1NVEA 1OJ7A 4RGVA 1XAJA 3ZOKA 5EKSA 1NVBA 1KQ3A 1XAGA 4FR2A 1NRXA 1SG6A 1JQ5A 1XAIA 3BFJA 3CLHA 1XAHA 4RGQA 5HVNA 1NR5A 1NVFA 1NVAA 3RF7A 5BR4A 1VLJA 2BL4A 3W5SA 1TA9A 1NVDA 4RFLA 2GRUA 4P53A 4MCAA 5FB3A 3UHJA 1VHDA 3QBEA 1XALA 2BI4A 3HL0A 1UJNA 1JPUA
chains in the Genus database with same CATH superfamily
2CVOA 4X60A 1KKUA 1Q6ZA 2BKUA 2RHMA 3C8HA 3GLFE 2C7RA 3ITEA 1QGUB 1H4VB 1NW5A 1MQ8B 3R0ZA 3ROFA 4FGKA 3ROXA 5CFMA 1IUNA 2JKVA 3B9BA 1DT3A 1CF2O 4BPRA 5LM3A 4LCEA 4PGGA 4MDFA 4B34A 1K89A 3U4GA 3OPVA 3L3BA 1EG2A 3VVLA 2MSEB 5HJ7A 2FG5A 1D8AA 1PQ4A 4LZOA 4U7GA 4KLAA 1KIMA 2PD3A 3DMNA 3FTCA 1PR6A 5KC9A 3A9SA 5K6AA 4E32A 1PYGA 3A2KA 3SJAA 3UJBA 1T9CA 2O2GA 3ZHUA 1YKFA 3RNOA 1DQPA 1KS9A 1MRSA 1RQPA 1DO0A 5DYGA 2NPIA 5CM2Z 4A0SA 4I3GA 3BEOA 3MPUA 4Y7DA 2VNKA 5EYPB 3ZCRA 3N0VA 1HYHA 3LQFA 4UXIA 1C0EA 3RM3A 3GG2A 1FK8A 3G59A 5JANA 3GAFA 1N2IA 3DEFA 2M32A 1TEVA 4BFTA 4Q4HB 5C1OA 3CA8A 5K4GA 5KNCD 4PSVA 3U44A 5HJEA 4BNIA 3A3NA 2QX4A 4E5KA 1AH2A 1YD7A 2OTCA 2A9VA 4I81A 4E12A 1IN4A 3C7KA 3T4PA 3I12A 3U13A 4KAAA 5JS1A 2E5FA 5D01A 1WXDA 2OGZA 3ND9A 5T6BA 3U39A 2IDMA 4OLBA 3R9WA 2QLLA 3BB3A 1SWWA 3K96A 1DP4A 1LSJA 2YASA 3BK7A 3UB3A 4LJ6A 4KVZA 1TPYA 2Z1DA 3G9TA 2WYVA 1XZHA 2VDPB 1JNYA 5DHAA 3IERA 5L53A 1M76A 1RPJA 2FRDA 3AFGA 4MKIA 4PANA 5FTNA 1CZUA 1Z8HA 1YF3A 2VR1A 2QGNA 4OXKA 1O5IA 2FPUA 4IQFA 2FPRA 1YU6A 4X93A 2J6IA 3QWHA 4WPGA 4R16A 1SA0A 2IIBA 4GF5A 1C80A 4YMUA 1D04A 3IALA 3T9DA 4D9HA 2P35A 2HPVA 5LQSA 5CMLA 3FCEA 1WMDA 3L46A 4IKOA 3Q8WA 1IJEA 1JJBA 1UXIA 4BKQA 2BTEA 2YDYA 5EL0A 1K4KA 2VP2A 3BIJA 4GZMA 1GZUA 4TV8F 1UT8A 4AT1A 5LZ9A 3GIDA 1YNOA 3NHKA 1TF7A 5DHRA 4KUGA 5FYDA 2V7UA 3IQHX 3LWNA 3UMGA 1V26A 1KOFA 1WPGA 3NEAA 3CTPA 4LZWA 2ZAMA 4OFWA 1R0ZA 4W4TA 1SPXA 1QP7A 1TGVA 1RJDA 1L7VC 1UOOA 1H69A 5FL7D 1K7SN 2B7LA 5DX1A 1KE1A 4C29A 1T15A 2VRWA 1S2GA 2OXIA 1ID1A 5BW4A 1BXZA 2G76A 4GBED 4MVJE 4CIWA 1JWLA 2OGSA 2PTGA 1KQFA 1M2FA 4C01A 1FMLA 2CMDA 5DV9A 4IOMA 1QLHA 4S2EA 2D2IA 1K5HA 1QKKA 4ZQBA 4BCCA 4DIMA 3F5SA 1E1CA 3PJFA 4PG6A 4FT2A 5JVDF 3Q10A 1RTKA 3K5WA 2Q5IA 1HEIA 4D0NA 3NDIA 2OB1A 3ENVA 1G6HA 1CJVC 3ZCQA 2JJ1A 1Y8RB 4IY1A 1IATA 1KMHB 2OCKA 4V0QA 3LFTA 1RYZA 4FYPA 2GN0A 3GA0A 2XDQA 4ZI7B 2ZJYA 1KI2A 1WIWA 2B8WA 3I37X 3KYDB 3M2PA 4P80A 5CHEA 3W90A 4CV3A 3NB0A 2HR1A 3ROPA 1KJ8A 2ZRCA 3M34A 5FBZA 1U3DA 4A2WA 2H00A 2OENG 1TZBA 3NHUA 2PS9A 2BMFA 4LQCA 1YS6A 2Q3LA 4Z1OA 1F2UA 2OXFA 2XYGA 1AE1A 3IDFA 4RTRA 2I33A 4G8BA 5T64A 2IU3A 2OC9A 2QMOA 3E9NA 1QOZA 1EHCA 1QBKC 1WVIA 2HJVA 4XM2A 2XYRA 3U5TA 2G28A 2G40A 3IIJA 1GGKA 5A5DA 3FPGA 4MI3A 1RLJA 2QIOA 4LGVA 3AJAA 4M1QA 2Z8YA 5I8PA 3FLAA 3U3OA 4AMVA 2AQIA 1NPTO 4NQZA 3ZLBA 3VYRB 3EOZA 5FUQA 5LMCA 5B5SA 2X13A 3RU2A 3DE1X 2AR9A 4KN5A 4QOGA 1GTJ1 5IT9A 3THYA 2O8CB 3K9BA 4DC1A 1MP0A 1C1XB 3BGSA 1MB2A 2EF0A 4I1RA 1TJYA 2AR0A 2Q4OA 3GN2A 1TVCA 5FEMA 3GD7A 1QCCA 3PD7A 1YZKA 1E62A 1J90A 3A6ZA 4NC9A 3OZTA 3L6BA 4H6WA 4LHWA 1ZHOA 1JFLA 1NU8A 3UAYA 5DTRA 1EJ0A 3LUPA 5E6UB 1H93A 2R25B 2PLWA 2VZ0A 4A8JC 2CGEA 3OJWA 3EHEA 1TCAA 1TUBB 3TINA 1XDSA 3QYPA 2QLJA 3MWGA 3QSGA 1AQNA 2F1JA 3H86A 2HXSA 4CLOB 3KE9A 3UXYA 4BMXA 2YNMC 3OOHA 1DBSA 1Z73A 2NSHA 5MGNA 1UEJA 2L0XA 2YJGA 4IHKA 3ZH9B 2GCEA 1EUYA 2N46A 4W1QA 4D8YA 2H4XA 5I7WA 4DDTA 2WUVA 2ZJAA 4J29A 2JEZA 1C14A 1T9HA 1XU9A 2FZLA 2PDAA 4RLQA 2XYVA 3W5JA 2RKBA 3FPEA 3Q85A 4PYMA 4QEZA 3MB5A 2ZI7A 2AK3A 5FV4A 4IKPA 1KWGA 2YH2A 4X3PA 5EPOA 4MTCA 2PRYA 1UZUA 4M46A 2A1TR 2ZUTA 2XWQA 4A4DA 1NVKA 5TSDA 5DCWA 1YZ3A 3W8NA 721PA 5IXYA 1ONOA 4JUCA 3PEFA 1R0RE 2V4MA 4I5FA 3DHEA 3A9TA 4O0MA 1G6Q1 1YI0A 1YCHA 2YQZA 4KPFC 2G0AA 4CF4A 3VC2A 4TXMA 2JLYA 5ENDA 4CJXA 4P93A 2FN9A 1C1DA 1BX1A 4W1RA 3R76A 2MSNA 1ZD8A 2ZXEA 4W5JA 1SCNE 5SZIA 1IPEA 1H1LB 1H9BA 2WLSA 3CIFA 4JGIA 5BNTA 2GD0A 3RK1A 2GN6A 2QN9A 2W93A 4MP8A 4XRRA 4ESHA 1QH1B 2ORVA 1QB8A 1OFTA 2J5RA 1QSGA 3J81A 1NU6A 2F8SA 2C57A 1XN1A 4JR0A 4QBFA 1KYTA 1KEKA 4UDYX 1BDBA 3HVRA 3K9HA 2WIJA 1A72A 1DAOA 3GEGA 3G2HA 3ASYA 3QFSA 5KKAA 1MF7A 3D6NB 4DR2B 1EXNA 4N47A 3EE6A 1R5JA 3ECAA 5AKZA 1QDUA 3GCGA 3E9DA 1B93A 3ZWAA 4EZEA 4ZI3A 1QQAA 9ABPA 1CQPA 3CJQA 3OZFA 4YYEA 2VA8A 1YRBA 5JNLA 1K8XB 4FMDB 1XK7A 4KQWA 2OILA 4OFBA 5CX1A 3VUFA 4ALNA 4I66A 1A9TA 2NU6B 1GG8A 2OB2A 2RGNA 5CLFA 3PVCA 1DRUA 4Y2JA 3L0SA 5HKAA 2EEZA 3ETJA 4EEZA 4J4TA 3ZWKA 2P3QA 4B3XA 1J6UA 1PR0A 1EK5A 1JKJB 2AJCA 2FUCA 3D0OA 3OHPA 4GXNA 3UMSA 3K8OE 5BMOA 4IEFB 4RKYA 3PTAA 2ZJ2A 5JAZA 3CPEA 3F5FA 1YE8A 5FAXA 5CBKA 4L0QA 1N7JA 3BQ9A 1YL7A 2A3NA 1Y7IA 3CX7A 4A6PA 3WLHA 4LHEA 2NNLD 1VL0A 3E9QA 2WICA 3O0TA 3HJFA 4KI7A 2IHVA 3T3NA 1ZPDA 4M1SA 4YALA 4D3XA 3HEMA 1L2TA 5EWJB 5D1NA 5DXJA 3O8OA 4ND5A 2GFQA 3BXFA 3R5FA 5AKLA 4C0BA 3UMMA 4YP7A 3QI7A 5FTMA 1X87A 1YL5A 2VP6A 3OFND 4REQB 4W8HA 4ZMSA 4TMXA 2C94A 1M2EA 4LF7B 2HQOA 4Y2QA 3R3VA 4L73A 5J4HA 3OIWA 1OGYA 3W6UA 3OQOA 3NIGB 2FK7A 4C3VA 1BA3A 5EIHA 3CQ9A 2Q2QA 3A1UA 1Y0BA 1HNNA 3IAUA 3PRHA 1DAMA 4DY4A 2EQ5A 3K6JA 4ZEMA 4HMOA 1FFGA 3WL4A 2QZ4A 2FZKA 1I5OA 2F64A 4PO9A 4D57A 2Q1WA 2VYVA 5ICFA 3H4VA 1ULTA 3QUBA 2W6PA 4X1IB 4B0PA 1JGTA 4L4ZA 4C14A 1Z15A 2B36A 2H31A 2P7IA 3K15A 3PVSA 2V7VA 1R37A 2FRVA 1M6HA 2ZIZA 5ENVA 1KRHA 1L4FA 1Z0FA 2J4CA 5D1HA 3VQTA 3N6XA 2ZTMA 2I2XB 1GNPA 1TZMA 4IIJF 5JO0A 3KX2A 3ZD6A 4JT9A 3QU9A 4C4ZA 2G1UA 2PTHA 1CQJA 1AG9A 2PX6A 3ML1A 4RACA 4EVIA 3GJXC 4QLAA 5LKAA 1QCDA 1V3TA 2HWWA 2VDLB 2H3HA 2FQWA 4UVIA 4KXVA 3WXBA 4URXR 4CL3A 1EJ2A 3ND5A 1WJGA 4QPNA 2GVNA 4RSGA 9ATCA 3ZWMA 1N33B 3R6GA 3UGKA 3KJFA 3C41J 4RS3A 5LZ8A 5IX8A 4Y0AA 3MWDB 2P3SA 2DBQA 4PR3A 3AU8A 3OCCA 5DF1A 5F77A 2ZRGA 1TMKA 3HJBA 1QFXA 1MT3A 4AL4A 1VPVA 2WHEA 1XTPA 3GU3A 3WO1A 1J2TA 2J7PA 3ITNA 1Z37A 2HLDD 4I6JA 1QUFA 1SUDA 5BMVB 4BFCA 1RZUA 3IO5A 1BHO1 4AZVA 4KXFB 1PR1A 3DAFA 3KK0A 3DUFA 3FUWA 6LDHA 2WR8A 1W5FA 4I3FA 1VC2A 1YDMA 2XQFA 2IZ7A 1YE3A 3RJ5A 2J08A 1QDEA 2HSGA 3OE5A 3ZDRA 8ABPA 1SCBA 4V0ME 2REQA 3SU8A 2VK8A 4P4NA 3CE9A 3TTVA 2DHCA 1FRNA 4E1AA 2IYNA 4B7ZA 3EMVA 1BMFD 1CR6A 4QUBA 1KK1A 5K3AA 1X14A 3WKAA 1N3LA 2PD4A 4LNUB 1XTVA 3WFZA 5L95A 3UFXB 2YRWA 4WIAA 1D2RA 4ZYTA 2ERYA 2NU7B 3KV3O 1PI3A 4MB6A 3QXXA 1PVDA 2CLCX 1WS6A 2P4QA 5HCIA 1JHQA 1P19A 4JLJA 3NC4A 4BP8A 1JJIA 2WSSD 3OEED 2DPXA 2G70A 4I8IA 4Y1RA 3AB8A 2GYUA 2QVGA 5IC4A 2BI4A 2VNJA 4X7PA 3K09C 4YP0A 4M1KA 4X92A 1F38A 4G1CA 1DB3A 2VC2B 2HAEA 4WK2B 2HNKA 2FJ0A 1J56A 1W47A 4EY7A 2OFXA 2H1WA 3MD9A 3F47A 1OWLA 3K20A 2VDOB 3U9SA 2NPOA 2PSDA 3PDIB 1E9RA 3IODA 4MO9A 4B3JA 1RLUA 3AFIA 3NETA 5LCXA 1SVWA 1UPFA 1F60A 5FI1B 2Y93A 2PMWB 1O8BA 1AKUA 2EZTA 2WQ7A 3CUSA 4NBSA 1K1EA 1ZH4A 1KETA 5REQA 3OSUA 2G67A 4GMKA 4HC4A 4YCNA 1PQPA 4ZCMA 3TW0A 1Q7GA 2OVBA 3VKHA 5A9SA 1QZZA 5LKRA 2H65A 1I3MA 2PXHA 3AY3A 3LYAA 4F1WA 1MOSA 1DTSA 4R9NA 5AW9A 2I2CA 4FINA 3KJXA 1IY2A 1WUIS 2HHHB 4CEHB 1WRBA 5JQGA 1JLLA 3OQPA 1TIPA 2YNMD 3AF6A 3U80A 3PRKE 1NF9A 2ZIGA 1V6AA 2P2YA 1LEHA 1Y5NA 2FLKA 2Y0CA 3OTIA 4JKOA 3WP0A 4A8JA 4DHWA 4WGFA 2NO7A 1D5CA 1ZJZA 4ETMA 1VI6A 1EH5A 3L7AA 3OLXA 2BFMA 2HQSA 3FSRA 4FZVA 5BSUA 2P65A 1BE1A 1I10A 3BAFA 1XXHE 2Q28A 4HVTA 1ACLA 2GGSA 3L07A 3FVWA 5EKXA 1TT5B 4Q82A 1FP4B 1RWBA 1S2NA 4R4JA 3A05A 4M8KA 1FJ2A 2IS6A 2NZJA 4B4KA 2IYPA 1ZN9A 3JS5A 5E3IA 2VPTA 1EZ1A 3CR8A 1GA1A 1DOZA 1I4TD 1ORHA 3ASZA 3GT0A 1U7OA 4PC3A 4JN6B 4M0LA 4XQCA 1NHWA 4BB0A 1T4BA 1M6WA 1URPA 2WG2A 4KIFA 4NABA 5F7ZA 5B1SA 4ER7A 4ZHQB 5CDGA 2OV6A 3I5AA 3EPHA 1FF9A 2MYNA 4MUFA 1QTNA 1XNHA 1GAXA 3EMBA 3AZOA 3H11A 4B4OA 3AIMA 1A1SA 1Y4DE 3QKWA 4JLMA 1QQBA 4EBBA 3C5EA 4IIXA 1XD9A 2ST1A 3H8WA 5EGSA 1Z0KA 3LT2A 3TUJC 5JJCA 3T5PA 3MLAA 4X65B 4BJ3A 2JJMA 1S2LA 3IJPA 1VJRA 3GOHA 4OXXA 3RC1A 2GF2A 4MR8B 1QPBA 1M6VB 4H1WA 1OI7A 3EXHC 5ARCA 1LF5A 4M7WA 1YV9A 3RVBA 2QX8A 2R1TA 1A9SA 4R3NA 5ALQA 1RSZA 2ONJA 4EM6A 3LF2A 4O29A 1S01A 2JG3A 2JCYA 1JEAA 2C8LA 3I23A 2CLSA 3GJSA 4RIGA 3W0LB 4MW5A 3OWHA 1W5EA 3VNSA 3D4OA 7REQB 2EL7A 2W11A 3TQIA 2B0JA 3OCXA 3X1XA 5A0VA 5C31A 3GDWA 1AKTA 1AN0A 3GLRA 3I5YA 1BNCA 2XE7A 3RKSA 4POOA 3NHZA 3QPAA 2G9NA 3AUUA 2KBEA 2RFLA 4NCBA 1FL9A 2QL5A 4R54A 3AKCA 4RZXA 1JDTA 1TJPB 4HX2A 1TRKA 3SMQA 4CZ2A 5KYXB 3ELBA 3R8FA 4LYGA 3EVCA 2C4MA 1JIXA 4TVOA 3TSCA 4QU0A 1P1HA 1TCVA 3FKSD 1YZVA 3G5TA 3ZTYA 1VLLA 2AXPA 2DVMA 2JASA 4LG1A 1U9IC 4CUJA 5JNSA 4LX8A 2C77A 4JJKA 1EIZA 2ZB4A 2WUWE 3MS4A 2CSXA 4GH5A 4V0NA 2YWJA 2DSNA 4D4JA 3L1KA 3I01A 3ODGA 5DCLA 4DAEA 1M34B 2EKQA 4HGYA 4I4LA 3V46A 4D46A 3E0QA 2J5XA 1T9GS 1GAWA 1CRWG 3L8HA 3WIEA 3WK5A 5B30A 2J9YB 1Z25A 4RHEA 1VOTA 1ZK2A 3AVXA 4JQCA 5KQMA 3SSMA 3M6FA 4EMBA 3PUHA 4MGHA 3OPXA 2OVFA 2QWXA 5KQPA 1B8VA 1DCTA 5DGIA 2R8YA 2ZRLA 1RFGE 1O54A 2WJYA 2FDRA 4U6QA 4BQNA 1M8PA 2NTJA 2DRIA 3EAGA 3Q6NA 2HTEA 3BE8A 3LUHA 4LE1A 5C1BA 1YS2X 1YUMA 3CW2A 1QFJA 3KTFA 4TVSA 1GUDA 4MQMA 5FPPA 1FSPA 1QGED 2OV1A 2PZGA 3A4NA 2VHTA 2IDZA 2B78A 1UJCA 4LYJA 1H3FA 3N2GA 5DWDA 1BRMA 2X0RA 4R05A 5T6MA 1Z4QA 2R5WA 3VSBA 4EY5A 4P5DA 1ZRSA 3IHWA 4QBIA 4BP3A 1CNFA 1H2RS 1OFUX 3F74A 4HWOA 4KWEA 3D54D 4HMPA 1PRYA 4FX5A 3HJHA 3IEPA 4DUGA 1TECE 4BZPA 1E2IA 1MRNA 4CMJA 3ZE9A 1D9XA 1W4AA 2CJFA 3GIWA 3KIPA 4GR4A 3HGTA 3BCUA 3LBAA 4URZR 1C4KA 5GJCA 2WHPA 1EB8A 3M1LA 2ECQA 4V24A 4Q18A 5JSQA 4G0WA 3BWYA 3RYIA 2AA3A 1SRQA 3FETA 1FDTA 1WEKA 4DJJA 5BURA 1OXUA 4L3VA 2I6SA 1CZRA 3ZDAA 4JITA 4X5OA 3UMFA 4EG0A 2H2DA 3C43A 5IMBA 2Z95A 5EGNA 1B0PA 1NUQA 2W00A 5L4SA 5AO9A 1HQKA 4YQYA 1SC1A 1K97A 1ZMRA 4EZIA 1SKYB 5JRDS 4B1FA 1XEFA 3WWOA 5H70A 4DA8A 3L7DA 4KO4S 1WMSA 2Z4RA 3GD5A 4HPWA 2TRSB 5FQNA 3GBVA 1CJSA 4F4IA 2XKAA 1L8OA 2PLNA 3UTCA 2HC9A 3WA6A 2ABWA 1L6RA 2VPXA 4OOFA 5LMZA 3CLVA 5H3CA 4TZ6A 4P54A 3EZLA 4L9SA 3KEOA 1NYRA 2O2XA 4NAHA 4XVCA 3TIFA 3ZK8A 5I7SA 4B48A 2G6TA 1P1BA 1JA1A 4KIJA 3UN1A 1MGOA 2SKCA 1O89A 2FGKA 3IOMA 1NJFA 3DUWA 1R0KA 2X8AA 2K2QB 2VCHA 5F52A 2UXCB 3OZAA 1ECFA 2ZR0A 3NBXX 3RUEA 4DDHA 1NNLA 4JT4A 3VVCA 2JLAA 4FMDF 3BXPA 5EZQA 3V5NA 4ZOLF 2HFJA 2PMBA 4OL9A 1Q11A 3QVTA 4KK3A 4EY6A 2HJWA 5CEJA 3MOSA 1MV8A 2ZSUA 3IURA 4Q6WA 4S0XA 3ZE6A 4KFTA 5AW1A 4LJ7A 3TMYA 1N2CA 1UT6A 3SZRA 1D4AA 1JIQA 3CUYA 2I6UA 4WZBB 3ICWA 2Q1UA 2EP7A 1BW9B 1Y1RA 5IVIA 2GKGA 3IPYA 4W5HA 1JXQA 3DBLA 3HXKA 4J4BA 1F2DA 1P29A 2VNSA 4NBVA 1KEVA 5CURA 1VG1A 4Q7JB 3CZMA 1WCV1 2H9IA 5E95A 5IAOA 2BKLA 5DYWA 4D9NA 3MUFA 4NZMA 2BMVA 5KQGA 3U7QA 3WL3A 1G7SA 1RQXA 4Y1EA 4N01A 4F46A 1J0DA 2WV9A 1T8RA 1HKHA 2BEUA 2UZ1A 5DW3A 4CN9A 1XHLA 2H11A 4TXNA 2WM9B 1TGYA 1QYRA 1M1YB 2DY1A 3IRUA 3H19A 2JKZA 3G1TA 4RHYA 4BFSA 1MA0A 4OHZA 3U31A 3UPTA 1KZ7B 2QSJA 3ISTA 3K09A 3FGPA 2A78A 5JDCA 5KS2A 5TIIA 2UYGA 3PUZA 3EULA 1M83A 4D42A 3D8SA 2G77B 1Q22A 2DY0A 2BFFB 1P75A 1HFWA 4P8RA 5KVSA 1GNSA 2IHJA 3FI0A 1GDHA 4X20A 4AM8A 4NDAA 1WUJS 3DOOA 5CFLA 4JYPA 2XDAA 3IUNA 5D3QA 4YDSA 3PR2B 3FLBA 4M1TA 4OKSA 4OKNA 3CKMA 4F7WA 5C7IO 2H7CA 4V0RA 4Q9JA 3SP1A 5KKCA 1KK3A 2AYXA 2DQZA 3L4BA 2D74A 1HDXA 1RWVA 1UK8A 1M1ZA 1ZJ6A 2YXBA 1N6RA 2H1HA 4H1UA 3DQPA 4TTJA 1L5GB 1PZXA 1EK0A 2GM9A 1J20A 2KPOA 3KUKA 3L41A 4LOLA 4IDAA 3RQSA 2Z8ZA 3ZYCA 2B6NA 3H5TA 2O7QA 4HDKA 2ZJZA 4LVOA 1QE5A 4BO7A 4EJSC 3GPDG 1KDZA 4Z3KA 1ZGJA 4IAOA 4UU0A 2PHZA 2TMDA 2WV7A 1EVJA 4NE7A 5FL3A 2HWXA 5CVCA 2O4CA 6NULA 1DAGA 4ZC8A 3OY2A 3AX6A 5CCDA 4QBGB 1ADBA 2P9ZA 4ZT5A 1JDSA 2FW8A 2OHOA 5FKJA 1Q44A 1NW7A 2Q3DA 4DCOA 1DEHA 1UJ4A 3ZV5A 1FMCA 1VIDA 4M0DA 4R84A 4ZIRB 3NOVA 3ZXSA 3VU9B 2NQ2C 4QYTA 3COVA 3SJZA 4QUIA 3ADPA 1B00A 3II6X 4US2R 1I3LA 1MNAA 1ICIA 3PQ7A 1ULUA 4MS3A 4X7BA 4OQ4A 3CVWA 1K92A 2JFYA 2NZ8A 3KQKA 3EWIA 3MUOA 5AHKA 1TVMA 2GPYA 2ZTSA 4NU0A 1S3SA 1WCIB 1HL7A 3IOEA 3QX8A 2GAOA 2B4KA 5BMVF 1T6XA 3VOSA 5K3BA 4PQYA 4AP9A 3VKGA 3PXEA 4RPIA 2FFJA 4RX1A 1JBKA 1TKBA 1I6WA 1SOVA 1EE2A 5A3JA 3SWWA 4UTXA 2OO5C 3FDXA 4QHTA 3TRJA 3K31A 3H5WA 4G24A 4KRXA 2FHSA 2HCTA 4UE2A 1RWPA 5ALPA 3D81A 1GCIA 2MIIA 2RE8A 4AQYB 3HBFA 1EYZA 1KZ9A 2ZIXA 3R7FA 2VSNA 3BAZA 1AKRA 1JDUA 2JHPA 2CYAA 5U4XA 4CUZA 2C5FA 2OWDA 3NHBA 2QKYA 2HEIA 3DNFA 3DE0X 3L8CA 4B79A 1G63A 1ONSA 2GJ8A 1VIAA 2IP2A 5CX4A 1GN8A 3H1GA 4B6PA 2FNAA 4YGYA 3TX6A 5A2GA 2GWRA 1MHPA 1JG3A 4H7EA 5CFNA 2X0NA 3QRWA 4JUBA 5LLDA 2I4LA 2EWMA 5ALSA 4XWAA 4K6FA 4QYIB 5J1TB 1V96A 1YVUA 3PD1A 4ZWNA 3OHSX 5DIFA 5B3AA 5KX5B 2HRRA 2Z30A 1YFLA 1Q57A 4BAZA 1Q12A 4CKXA 3FJOA 2COEA 2YWHA 2Q5HA 3WJ2A 1MTZA 3CISA 1B0AA 3HNOA 3COJA 4K1LA 2B2NA 2YS6A 2HZ7A 1FNDA 2IYOA 4MLPA 1WTAA 1A9RA 3MMPA 1U9IA 3ZV7A 1YR8A 1H05A 4FEGA 2BP7A 1WXQA 3H2JA 3KSUA 2QVCA 3S29A 1X8JA 4PO1A 4M1WA 1AY0A 4YRZA 4ZKDA 4CQMB 2CMFA 2ACKA 3IX7A 3PXUA 3R20A 1R5BA 3HB9A 3GLIA 5HG0A 1L5SA 1CUWA 3BGVA 1FSZA 3M9LA 4ZPJA 4OYLA 1T3GA 5AFSA 1XTTA 2PNFA 2PY6A 3A9WA 4BLVA 1SIUA 2PXXA 3U61B 1G21E 1L9KA 1CK4A 1IYZA 2CXUA 2HM7A 4C4AA 5HM6A 1OA0A 2H0AA 2PUTA 2R4UA 1YB4A 5E7IA 1Z6AA 1PZHA 5KOYA 1AV7A 4HUQA 5I6DA 1YJ8A 3Q5GA 2A92A 5FBHA 3I5UA 1WCWA 1IM2A 2FZWA 4P3KA 2VJCA 2ZDHA 3GUYA 3D8HA 1K0UA 2QP9X 3E5NA 1ICEA 1KQNA 4EYKA 5A0TA 1EG7A 4HPJB 4WESB 1ONNA 1EA7A 1N7IA 1W4LA 4G9BA 3LC0A 4CIYA 5JNUA 3F4KA 2Y76A 4GMGA 4IBOA 1Y63A 4IUCS 3ZE7A 5CA1B 1EJ6A 1E9VA 2WTEA 2F59A 2GAFA 3BMQA 3I4CA 3KZKA 3TD9A 4DCCA 2VTEA 5CDHA 1JS1X 2DPGA 2BM0A 5EWMA 1E2LA 1PUIA 4R71A 1UBEA 4LHZA 5T4BA 3QXJA 2VSOA 1NUHA 2NADA 3MG9A 4E1VA 4LJLA 1YBHA 2BCEA 2YXPX 4XM0A 3KT3A 4GR5A 3LVBA 3VJMA 3JARA 4M6WA 3N53A 3H1PA 4CLRA 1V1MA 2PWAA 1BHQ1 3HKDB 2DECA 1P7ZA 2CNOA 4JA0A 1ZUD1 4XDZA 5GM1A 4D1YA 4ZHQF 3D7NA 2I66A 4AG6A 1B0UA 3FMFA 2IVZA 1KYWA 1J70A 1K7CA 1SOMA 3DBVO 1YE5A 3UAWA 2WBLC 3WSWA 1TZCA 1YK1A 4IJKA 1H0KA 2YOHA 1LWNA 3FPJA 4ODIA 1RAFA 3C8UA 5K7SA 2RH4A 4RVHA 1X70A 3AEKA 1N9GA 3TRKA 3WFIA 1IWPB 1CJUC 4P3NA 4EGAA 2XUPA 2X8LA 1NBEA 4AY5A 1ZGCA 1R3DA 2WMYA 3DZIA 1FFWA 3ND7A 3DE4X 2XMPA 1AGPA 2H85A 3IHKA 1KBQA 1F4LA 2XDYA 1CW2B 1XB2A 5DU2A 3IBCA 4K0KB 3HA2A 3TR0A 4AW9A 1ZRMA 2Z2IA 2E0IA 3BMXA 1G6KA 1IG0A 2BGRA 2FSHA 4IINA 4M7RA 5F35A 1W6UA 4I9FA 4RD0A 1P1RA 5ECWA 2YJZA 3EN0A 2VQFB 3B6EA 1ZX1A 2WABA 3E9ZA 1RYEA 1H2AS 1TTPB 3PPYA 4Q03A 4TTQA 3N5CA 1GR1A 3G9UA 3G88A 3NKLA 1JIJA 1GKLA 2HYIC 2CXNA 5ALTA 5KYUB 3A3OA 3AVTA 1BU8A 1ISIA 1SHJA 1SOAA 1TYDE 1EZ4A 4OJTA 5A4JA 4YCCA 1JJ7A 2AWOA 1OHHA 5TT0A 1XAJA 1HT2E 1YCGA 3QXSA 5C9ZA 5G1OA 4DSUA 3NGMA 1KEWA 2R1ZA 2NU8A 1IIBA 5JMPA 3G0HA 1RXIA 1T4CB 1EFTA 5E9JA 2V7QD 3N3AC 1ZUNB 3EXEA 3E22A 2PRSA 1ZD1A 2PBFA 1SB8A 4Q1FA 3OEYA 3QGMA 1BS9A 3DLCA 1P45A 4HNHA 4PCVA 2WTMA 2DLCX 2P1DA 2IGTA 4QUGA 3H1TA 5J2TA 2IITA 3I9LA 4FPXA 2JCXA 5TQ2A 4L0MA 3UICA 1KAHA 1R6TA 2A1UA 2NVUA 3EXIA 4OI1A 1GU1A 2JIMA 5FFMA 4DDWA 4FSXA 3URKA 4UFPA 3A26A 1TK2A 4M49A 3P45A 2OEPA 2GYYA 3KTOA 4N4AA 4V1CI 1Z2AA 5CD9A 1CRLA 4H7IA 2P6RA 5FA5A 3PNOA 1EFAA 1HE4A 2HN9A 4REOA 2H51A 3PEEA 3R6TA 2J46A 4PLPA 3T94A 2AD1A 2OT3B 5FNVB 1U0OC 2A35A 4CR6A 1QVAA 4DQLA 4DV4B 1DIGA 2O20A 5ECYA 1C3EA 1PTJC 3ZBQA 4YP6A 4IMRA 1R0YA 1PDWA 1BCRB 3TB6A 1R2QA 3B1FA 5GMOA 4ND1A 1SUCA 3OPQA 1BJKA 3TSWA 1Q14A 4CMAA 4BECA 4JLPA 3P4UA 4U9HS 2V9CA 2O3UA 3EFOA 5HKKD 1JX6A 4GPZA 1FNBA 2CJWA 2BMWA 2ZB8A 4KSYA 3GNSA 3NHRA 4QJBA 5EPEA 4E22A 1PYOA 4MZDA 1J24A 4PQRA 1F2TB 4ZZ0A 2GF0A 1WV0A 1Z4JA 1IHDA 3RV4A 3TLJA 1H2ZA 5IVHA 4I4TF 5F2OA 2J9FB 5HRUA 4FB5A 3KDSE 2UVPB 2PX2A 1I30A 3P9RA 1YKGA 3L1JA 4C08A 2VDRB 1E9DA 3GLVA 5JTTA 2D5AA 2QI9C 4D6PA 1KMCA 3ZPXA 2R8PA 3PYLA 4HQKA 1E60A 3KB2A 1VHQA 1W0KA 1THMA 2IPXA 3PRYA 5HQ3A 1IK6A 2N42A 1E64A 3BERA 3KLNA 7ABPA 1D4ZA 4TQGA 2K7FA 4GFDA 3RT1A 4BXOB 2QZZA 4H6PA 3AC0A 4XIYA 5JDIC 1KTIA 2FH5B 1W6RA 2INGX 4JBYA 2WLTA 4UM9D 1H6CA 3VPCA 3ERCA 1IZZA 1P2TA 3R40A 2ZYVX 4ZT6A 5IF3A 1R9JA 5JNTA 1A69A 1XHEA 3GVCA 1A5SB 1D2NA 2D54A 2W5UA 3DXYA 3FE2A 2Q9CA 3O5AA 4LZJA 3ZWBA 2XYPA 2IY8A 4JEMA 3EPKA 4DCTA 3FOFC 2XQJA 4R81A 4XYLA 5H3LA 1LDBA 4CKCA 1GOTA 4PYKA 2FPIA 3IV6A 3FJYA 2VJQA 4CUKA 1FZQA 1G6OA 3ISVA 1MJGM 3HO1A 3GK3A 3SXUB 1PFQA 1SCKA 1J00A 4ISCA 1PS0A 6CHYA 2XF2A 3SIRA 5IBRA 3P9XA 4BBZA 2IFTA 3RFXA 3RSHA 1KQOA 1L4UA 1FDSA 1ADCA 2CL5A 2WHRA 3MPOA 3QKUA 3I2KA 5CNIA 4CIBA 1GPUA 1FMTA 1ODTC 1YR2A 1X7HA 1G7CA 1V8PA 3IILA 4K2AA 4PLYA 2HBYA 1I2AA 4US0R 1NLUA 5EJ7A 4N3BA 2BJVA 2Q4BA 3D02A 1EGQA 4OIMA 4LJSA 421PA 2JZOA 1LGYA 3ASUA 3EG5A 3LPLA 5IULC 1GP2A 1A50B 1BWPA 1NTRA 2VDKB 4H7JA 2JAXA 3NOOA 1ESDA 3LO5A 2VDUE 3NYQA 1XMOB 1AGYA 5D51S 3LVFO 3NASA 2YINC 3NU1A 1LVHA 4MIYA 4OSPA 4HRVA 3P9YA 1KDPA 1XQWA 2W2TA 3M6LA 1E1MA 2PO5A 2XNDA 1XNRB 3WMXA 3QF4A 3UXHA 4YWHA 5KCMA 5C8YA 4QUEA 3ZTTA 4ALKA 5JAUA 3AMVA 5CLJA 5JI3E 4KQJA 5KYYB 2ZSBA 1EWKA 1YR3A 2OZLA 4BMYA 1EHYA 4BNDA 2EQAA 4PY2A 4CMGA 4D4GA 2MYTA 2VHJA 1VL1A 2WF5A 3VVMA 4KPYA 3O8BA 3Q3IA 3HCDA 4L75A 3KLMX 1ZJYA 5KJFA 1X80B 4W5WA 2J9XB 1GNRA 1HYQA 1XQYA 3FCSB 4GEKA 3RJZA 1VBNA 4TLAA 4QIHA 1KI4A 4XB2A 4D9IA 1PQWA 3F9CA 3R6WA 4Q39A 2JGNA 4RY2A 5H16A 4B85A 3WV4A 2VT6A 4TT3A 3U3XA 5IKEA 1EHIA 4LN1A 4ZVLA 4RC9A 5G0VA 3TD6A 2CL0X 4MRSA 2NXNA 4L72A 2Q1YA 4PYRA 4C7BA 4IV0A 2QVBA 4H18A 2FZ4A 1XZIA 2RHLA 2QPLA 4WOJA 2IXFA 1KY3A 3WGKA 1HF3A 2GFIA 2YHIB 5HJ5A 1EIWA 1X7XB 4PYJA 4XDGA 2E85A 3CLUD 4O2AA 2MINB 3QUAA 1UDCA 2TECE 4YH1A 2JAUA 3UA3A 3R5SA 1NXOA 1GEGA 1H1TA 1RWQA 2GARA 1R3UA 2IEBA 3S6JA 4PO3X 2XEDA 2CV2A 1ZP6A 4XIGS 2Y9PB 2GZRA 3DVAA 3U5ZB 1L8AA 4YPFA 3SC4A 4Y2UA 3A9RA 3TQFA 5KTOA 3GUZA 2JGIA 3KPUA 4UE6A 2IUUA 1N6OA 4UQPA 4FW9A 1V5EA 4DCSA 2Z8XA 3VSEA 1JQKA 4LXQA 4E1BA 2WT9A 3RLIA 1S5PA 2XRFA 4QJ3A 1TADA 1E3EA 1EGAA 2VHVA 4YRFA 2G82A 4MCAA 3NALA 5KSPA 1ZIPA 4IZIA 1H0SA 2IEZA 4KE7A 1XBTA 3GOQA 4G36A 5FFFA 3WIBA 3ZVRA 4M89A 3F90A 5CVUA 3DW1X 4IO1A 1GXSB 5JPIA 1ORWA 2O0JA 1XLTA 1G17A 3O73A 4GG1A 2NSYA 4LTDA 2WFLB 1CUSA 1WDLA 4RJ2A 4TPKA 5EKDA 1X7WB 1EK6A 1QVVA 3P2KA 4JGGA 4OM7A 4TL6A 1AS0A 5JT1A 1WF3A 3L6EA 1X8XA 3KKNA 1PCXA 3CLTC 1ZI9A 4Q4AA 3FOWA 5AW7A 1RM4A 4K5QA 1NT2A 1K0FA 2P3LA 2ERXA 4QTTB 4C7OA 5CLHA 2QP3A 3OZDA 4PONA 1OPRA 1GGFA 4LWPA 3BWBA 2WRZA 2B1IA 4K87A 3FUCA 1O6FA 3A32A 1WETA 1XCLA 2CE2X 1BC5A 2IOHA 1Z5GA 4QAJA 3RARA 3V8VA 5JYBA 3NQ41 2QYSA 1N5DA 5IABA 1RQGA 1PUXA 2WNHA 1ANKA 1NJ6A 2AK2A 4A5OA 4L5YA 4CM9D 3FHOA 1P4GA 4DNPA 4UQLA 1I3OA 3AIIA 1RT9A 1JH8A 4H1TA 1RBZA 1F20A 4PO8A 3DMRA 5JTUA 2IHZA 1HDOA 4JWKA 3SEQA 1YA6A 1RCTE 4DMHA 2VS1A 3OJXA 4CMBA 2E37A 2ZJBA 3JSAA 2YL2A 3KUCA 1C9DB 1MC5A 3G5UA 3K4QA 5EMHA 3PUVA 1T25A 5M7EA 1XQVA 3MQFA 3IT0A 1EWRA 3HL0A 2HCBA 1Y34E 3BIOA 2BVNA 3GELA 2JGJA 4D9KA 1K3FA 1G66A 1OC2A 1XMSA 3L7NA 4BLOA 1OIVA 2Q0QA 3B6ZA 4BUCA 2O3QA 3N0WA 4HNAB 2DH6A 1Q95A 2YZNA 1UUFA 1KOLA 3V4OA 1E6MA 5DX8A 5DZSA 2Q4RA 3RIEA 1DEAA 1NZJA 2FQQA 3HGQA 5ILGA 2ZJ5A 1ZM7A 2AC4A 1LLCA 1BXRA 1ZA1A 2QIPA 2R7AA 1NJ1A 3D3JA 1SU7A 1KJYA 4J7AA 4JSRA 3TR5A 4ARIA 1EEHA 3QWBA 3ZWDA 2FEMA 3RF7A 3FMVA 5DASA 2OV8A 2ONKA 4HBZA 4D41A 1JH9A 3W5SA 2AC2A 4G5GA 5BN5A 4HDSA 5KDLA 1XF9A 1TT7A 2OAGA 1ZNYA 4PLWA 3SF0A 3GLGA 1V35A 4UHJA 4EB8A 2H48A 5HRAA 1XTJA 1JWAB 1XVTA 4QT4A 3IBFA 1QRSA 2WTUA 1HMPA 4TKVA 1MB9A 4IMJB 3SZ3A 4CM6A 1N7GA 3BD6A 1ADGA 4RYLA 3ZKWA 3HKCB 4QGSA 1K4YA 5F5NA 2GO7A 5AVSA 3GZNB 4NCIA 1MRZA 3CZ5A 1FYFA 5LQCA 4MRNA 2JEYA 1O77A 5AHOA 2JAOA 1NDHA 3TL3A 1CY8A 4LVUA 4E15A 2XMCA 1PJTA 3TJMA 3AV0B 3BIWA 4OHCA 5CA1F 4DEYA 1YB1A 3HABA 2HGZA 3AW8A 3MTAA 2WKSA 4M87A 5CJ2A 3K70D 2ROQA 1K8QA 1RWNA 1TW2A 5CB8A 1A1VA 4DB2A 5HWSA 1W2WB 3IAXA 1T36A 1CD5A 3DOCA 3NAZA 2VLBA 4GOXA 1GDTA 3WB0A 1ZK1A 3UV3A 3KJQA 2PMCA 3LX4A 4LRQA 2C2ZA 4MUHA 4P82A 1KE2A 1TKRA 2Y6VA 3KTDA 4QJIA 3PUIA 2C2BA 5ALKA 1J99A 3T5AA 1H6DA 1MABA 3TBHA 3ZOZA 3U4QB 3FTQA 1CXZA 1EM6A 3ZGNA 1XXLA 4P0PB 4Y2HA 3ISJA 4E14A 4IZHA 4YGXB 4EUSA 2ARKA 2CUKA 5EQDA 1CUJA 1EEXB 3AM3A 5FF9A 5JDIA 3WJ7A 1R16A 1T2UA 1B23P 4KUEA 4JJAA 2ZYSA 3JD1A 4P3PA 3PKZA 5HDQA 2D0PB 3CUEF 1UDXA 2QRJA 2YIVX 5AW4A 1GUAA 3IAFA 1KERA 5AK4A 3VZQA 2JCBA 2QN1A 2P9CA 4AZWA 3R3WA 3C8MA 4HPXB 1N1EA 2ETXA 3ZXIA 5MGBA 1PNVA 2Q3JA 4GNKA 3PFKA 4UBIA 1DQRA 5EYPA 3T9FA 1M33A 1FUYB 2FZGA 2J45A 1X1TA 4MV5A 1WHTA 3WI7A 5JJKA 4R1TA 3GMDA 3K8YA 2I4MA 4EPYA 4OMDA 3O4JA 4QSHA 2WHYA 4O4IA 4AZ0B 4Q4HA 1R18A 2XW6A 5T8KC 4R2HA 4Z7OB 3F5QA 2ZJ3A 1R0WA 4D9GA 2E3JA 2EEPA 4YMIA 2DFVA 4WA8A 1L5NA 5M29A 2J4DA 3D4PA 4JYBA 4NXNB 4ZJZA 3HXTA 2HJSA 4YRCA 5IAEA 4GSLA 2Z1MA 3T5MA 4ZAXA 1YJXA 1MA3A 2RK6A 1ZQ9A 1R8XA 1U2GC 2AZ4A 3C1AA 4KRYA 1NFQA 2ET6A 4IDEA 4L08A 5HDBB 1AK9A 3PFCA 5IN5A 3R7AA 4MHOA 2JK0A 2AR7A 1Q92A 1SBZA 2CCJA 2VSQA 3JQBA 2QN3A 4NEGA 1V41E 1UBNA 2OE2A 3CNBA 1JUDA 2HUNA 4S1VA 3WL7A 3E7DA 1EWQA 3Q41A 4Q9HA 1KI9A 1MX1A 3U81A 2Z83A 4FOTA 1B73A 4MYRA 1YVRA 3HLYA 3QBDA 1W9MA 5DO9A 5LYJA 1ZQ1A 3QLEA 4MRVA 4DYVA 2G71A 3RUPA 1ZNZA 2HA7A 2BSAA 2WAYA 3MIIA 3DXZA 5HF5A 3V55A 5IHXA 1SJ9A 3C6BA 3DP7A 4MMZB 4E5MA 4OVKA 4MUBA 2BJHA 1EFRA 5IAJA 3O9ZA 3UH0A 2O7RA 1U1GA 3OTHA 1OAOA 4F5EA 2G5TA 2I7TA 1FTSA 2YIDA 5FNVF 4BJ1A 4C6HA 3FPAA 5BOSB 4AX4A 2O19A 3B52X 5AIAA 4FMCF 4RBNA 1KQGA 5EZYA 3GJQA 3H42B 5HE8A 4CIDA 2Q6KA 5JSUA 4PEVA 4DDVA 4QOHA 3E5RA 3GEBA 3KB6A 4BPBA 4CN8A 5CIQA 2ADOA 3FYHA 2EYUA 2ZE7A 1KYZA 4F93B 1ZOLA 3CUWA 3V1KA 3G9QA 3ZW7A 1CY4A 4BNUA 5BVHB 1Q1ZA 4DMGA 4LI0A 4E2ZA 4EHIA 4GAEA 4G97A 1DINA 2IX9A 4AN0A 3Q8KA 3TQTA 4A8HA 2GJ4A 3CINA 4PFSA 1K3TA 1Y8RA 1EGHA 1YQGA 4Z1MA 2DULA 1ZN2A 2GOYA 2C82A 3T95A 4CT0A 4ZI7A 4ER3A 6REQA 3IEMA 1RQ2A 2XT0A 4C4XA 2R3SA 2Y0DA 3HUDA 2A9PA 3I05A 1KYXA 3LT0A 4TZTA 4ZZ3A 3PL1A 1HQDA 1EXWA 1KO1A 4JHLA 5HE9A 1R6XA 1QK3A 3DT9A 4PXYA 3OJEA 3I9FA 4IYRA 4N8SA 3V2HA 3ZV3A 1KPHA 4RKEA 4OHBA 4HFMA 4DIEA 2X8BA 4JLDA 4MV0A 3UT6A 2H2AA 4E09A 2PWZA 4WK6A 3MGBA 1XQXA 1REQA 2I3AA 2QTZA 2WAOA 4H1VA 1WU7A 4LV8B 4OAOA 4UNQA 3UMJA 4CT5A 4ETNA 1TU4A 4EDHA 1R8QA 2TMKA 2CVQA 4UDNA 4GUDA 2XCSB 4G23A 1I94B 5TEVA 4UM8B 1LF0A 1V1RB 2EQBA 5HKOA 1KY5A 1UMDB 2OXCA 3SSOA 1UOPA 1VHDA 3LAWA 1B1CA 4JY7A 3T15A 2Q4TA 4H3VA 2EX0A 2PUBA 4GQAA 1SIBE 1E0JA 3RTEA 1YS4A 1JXMA 2O8CA 4KP7A 3RUDA 4HTFB 1U0SY 1M73E 4LV6A 3TMAA 4F38A 5F51A 1ZH8A 3ZHBA 1U2ZA 2VF5X 4QQNA 1WWKA 4RNCA 1PWXA 3MRTA 1KU6A 2V3VA 3K5HA 2VUSA 1FFDA 2X9NA 3CUKA 3NKFA 4LPKA 5B3KA 3IL2A 1QF7A 4UEKA 2Z5LA 4Y2YA 3T3MB 4EY3A 4B80A 2ZB7A 3D6JA 1K8RA 1QHYA 3UKDA 3DTYA 3OZBA 4FYWA 1L4EA 1C7IA 1PGOA 4FQ5A 1TUBA 2FX2A 3K6KA 3VC1A 3H4IA 1KRWA 3OQ1A 1WXWA 2PS0A 2F8TA 5CT9A 3IDQA 1NOJA 4DPMA 1B26A 1ZW1A 3GNLA 2QZ9A 3NWBA 3WK4A 3WRWA 5KU1A 3V42A 1V95A 2CL6X 4NV3A 2WFMA 3JYQA 1ZXLA 3ZNNA 1FS6A 1AKMA 1E9FA 1LB1B 4MRRA 5C8VA 3R3YA 5AUPB 2RHDA 3WDLA 4QA9A 4O2LA 5IUKC 1ZBDA 4ZYWA 2ZKIA 1JG6A 1HDZA 1WXFA 5K2MA 1XWIA 4BMPB 4JB0A 5K0SA 2QBYB 2XXBA 1ZMBA 3A6DA 3NVDA 3ON5A 2XRYA 1FP2A 3HMKA 1LX6A 1FTNA 3MYRA 1GNQA 3UA4A 2OV4A 4NS1A 1UKCA 2JGMA 1Y5MA 5F1KA 1DOAA 1YR9A 1J9ZA 3CM0A 1HQCA 3ECSA 3FAZA 1J9GA 3CT6A 1IM5A 3L0YA 4DLPA 2B92A 1O95D 1H1LA 4Q5IA 2V7TA 3ETDA 1WW8A 2F48A 3DOJA 3MT0A 4IS3A 2JLSA 3IEXA 1QH9A 4J90A 5MN6A 1OH7A 2D2EA 1Y1LA 4H6XA 3O2QB 3QK7A 2B8EA 5DWQA 3RJ9A 5A5FA 2PRIA 4FVTA 4YMGA 2QRUA 5F9FA 1CEYA 3TLBA 4B32A 4PZDA 1MFZA 4Y30A 3UJNA 2C2KA 2AUNA 1CC1S 5EESA 2DR2A 1CR2A 2PZMA 1OLXB 1G2OA 4F8EA 4ZYVA 3BHIA 4BYGA 3UBTA 3PBKA 1X15A 1CUYA 1SKUA 4GMXA 4WZAB 3O95A 3S8EA 1T2DA 1VMAA 3A1NA 5DSZA 3SZOA 3QIVA 3SKYA 1UANA 4B84A 1SAYA 2PLAA 3INGA 4X44A 5AKEA 2BFPA 3PXGA 1Y42X 1ABEA 3OCYA 1GR0A 1M2VB 2FSVA 4B3FX 2P9EA 4FCTA 2YR0A 3TH5A 4BNMA 1B74A 2X42A 2NU6A 3NAQA 3UWDA 2GZMA 2HF9A 1KARA 2AG8A 3L4KA 1BMQA 2VAVA 3QPVA 1LSSA 5CIYA 1ZHFA 4KQ9A 1NBWB 1VKZA 2J0UB 5C4GB 4AJPA 4G2TA 1UKYA 2B5VA 4UVHA 1RPTA 4LJ9A 5PNTA 1MCZA 2VBFA 1O94D 1UBCA 4MR9A 1T5BA 1V6CA 5H5JA 3FYCA 3RVPA 1PJCA 4Y3UA 5G3YA 3DM9B 2R8BA 1QO0D 5ELMA 2GHTA 5CVDA 3QXCA 3Q3CA 4XSVA 3SN6A 4A8TA 1E3LA 4B4DA 2E7ZA 3DYIA 4RY0A 3T3GA 3E05A 5BQFA 3H2YA 2CJPA 2BF4A 2DPYA 3S2EA 4GE0A 5LL6P 3W2IA 5DSXA 1EXMA 3D3NA 3WAKA 5JO9A 3DPUA 3LLMA 4O2RA 1V5IA 5JATA 1AV6A 1J1IA 4MQLA 4CGYA 2FJUA 5EWJA 1F0KA 3BIFA 1RRPA 3BFXA 4DQDA 4ER0A 1W36B 1V8BA 3TNLA 2FSIA 5ISMA 1VJ1A 2GDJA 4LIPD 4A2PA 2ZI6A 4CKEB 1IHUA 1Z82A 1IAVA 2WQZA 2XWSA 3OM9A 1D6JA 1H2FA 2C07A 5TMEA 1F8GA 2HH9A 1AS3A 3LUDA 5AJUA 1TJ3A 1ZAYA 1JG1A 2AXQA 3KKMA 1R9GA 1YDEA 3DAHA 4D7AA 5ERYA 4R0MA 3S2FA 4J8PA 3UQZA 3E81A 2D62A 3OTOB 3FPKA 5AVRA 1Z36A 4KB5A 3SOZA 4R5MA 3ITKA 1C9YA 4HH4A 1QHGA 4JASB 4LYAA 4JXZA 3I9JA 5IRCD 4EYQA 4MW0A 1VLHA 2XD9A 1XP5A 2O14A 2HF7A 5ULLA 4A6XA 2UUCB 1BXGB 3IQWA 3DDNA 1V2HE 1VRCA 5T8KA 1FYDA 4XLLA 4JLWA 3TS1A 4K9SA 4NICA 3N8KA 1TM5E 4LCJA 3DKPA 2IXBA 4YCAA 3PPXA 4AD8A 1ZJ5A 4HXGA 1CCWA 1E2BA 1XFAA 4M9UA 4UHEA 3DZDA 3FOEC 4M9RA 5FHRA 4G07A 1J8MF 4IWNA 3TZCA 1YOVA 3K9GA 5J40A 1ZIXA 4OQEA 3O4FA 2JIDA 3AUAA 3BHNA 5JXWA 4U4AA 2NO6A 2O8VA 2H0RA 4H7PA 4ZAVA 3PGJA 1DMSA 3SQMA 2IGBA 4LK3A 1BQ4A 3OPYA 2IBMA 2JLCA 1ODSA 2J3HA 4G1EB 4OATA 3DGEC 3EIHA 1ADFA 1QM5A 4N8EA 2HO4A 1P0QA 2MOKA 1BROA 2XQVA 2R1UA 4XD7A 1OSNA 4Z0HO 1WG8A 2FMUA 1IBRA 3LMKA 3T8YA 2NXWA 3MT7A 4J3JA 1KPGA 3N2KA 2ZUBA 1PG5A 2ZAGA 3R8CA 3T3EA 4EQZA 5C5EA 3KWJA 1RAIA 1ID8A 2PIAA 3CR3C 4RVOA 4KFRA 2Y0PA 4I36A 1Q7CA 4RHXA 4C5BA 3ZS9A 4DZRA 3RYCB 2G0NA 4N3GA 4U9UA 2IYTA 3EGXB 4BTVA 3E7FA 2VYVD 1QOQB 1GPJA 2DQYA 4JLSA 2WTBA 1YQWA 3K0FA 5LD2B 4DWJA 3LQYA 3W8FA 4KQCA 5AI5A 5I7RA 1SCIA 4KTVE 4Z8XA 3V7NA 1BYUA 3K73O 2D1QA 4JUAA 1B7GO 3PC8A 4UOEA 2W2KB 4YJFB 2QQEA 4JMPA 4ID9A 1E94E 3WK8A 1UXHA 1E5XA 4PZZA 3FUVA 1RKBA 1RACA 3PIDA 3DYBA 3FXAA 1DDIA 4LNUA 2Z1NA 3M6XA 4HEA1 3DO6A 3PC2A 2QL6A 1DKLA 1UIMA 2O5VA 3B78A 1HR0B 3CX4A 3T3IA 1QQTA 3S1AB 3BJRA 4DM7A 2UUAB 4F4UA 4QXRA 5CEFA 1MX5A 3TTXA 1KEUA 4CKZA 3MQ4A 2UYYA 3OT1A 5KYWB 2Y8EA 2J0SA 4P4TA 5FORA 3M70A 3V6MA 5LLTA 4IJ6A 2V54A 3ZVNA 4Q16A 3ZZUA 5JD3A 2WKQA 2Y1LA 1GZVA 2WW8A 2OORC 4TWIA 4BNWA 1W48A 4EB6B 3D8BA 1U7PA 3STHA 4D4KA 2COKA 3PDIA 2OXRA 1LKZA 2NQ8A 4N5MA 4NYMQ 4QYSA 4HAWA 3DYVA 4LMAA 4UHDA 5DI9A 1PV1A 3U56A 4R2LA 4GNRA 1KU0A 2PEYA 4C3ZA 4PLZA 4JC5A 4Y9TA 4C7JA 3EPRA 3TD2A 1BS1A 1QNLA 1SUFA 10MHA 4XD2A 1VLJA 3EEFA 5CJPA 3PCRB 4FILA 4E07A 8GPBA 1O0CA 3PI7A 1GT91 4UEOA 3LDHA 4FQ8A 1QR6A 1IQRA 5HTOA 1WUHS 1PZGA 1O6CA 5JUWA 2BY4A 1YDHA 3I09A 1YIDA 4BX8A 1X9GA 3DONA 1GGEA 3FSGA 3O1HB 2ILTA 4FNOA 5HTKA 2B69A 4OREX 4CKBB 1M2WA 1Z35A 1OREA 1IEVA 2X8JB 1IN6A 3E4CA 2FCRA 3Q0TA 3MBOA 3ZXYA 4Q9IA 3RU7A 2EBHX 4L4XA 2CLFB 4RJIA 5EIBD 5INTA 1H0RA 1PK9A 2QVYX 2WIBA 4XQGA 5K0BA 4YA6A 4H3HB 3I9NA 3LCRA 4KLCA 1XTIA 1WW3A 5HK8A 4DMRA 1ZIYA 4EA6A 5A7FA 1Y5RA 5LQUA 3R23A 1TT5A 2YZMA 2BGJA 2AZTA 2H1IA 5CGQB 1J2RA 2EG5A 1G21B 1G9XA 2DQSA 1M0TA 1YQTA 2JC3A 4IMIB 2AW3A 3DFUA 4X95A 4NJMA 5D7BA 1TF2A 4OB7A 4EFKA 1YBFA 4BJ6A 3GQVA 1ISFA 3SJBA 4HGZA 4KXMA 4KFUA 1EDOA 5TRTA 3TEFA 1T1IA 5CDTA 4GU5A 1FQOA 1BD4A 1P80A 4YIKA 4TWAA 3JQ6A 3H87A 3MA0A 3OQIA 4RF5A 2ZRJA 3ER8A 2UVDA 4NULA 4DNXA 4TXHA 5IC6A 3FDJA 4OJQA 5PGMA 3QA3E 3GRUA 1AF4A 4MR8A 1KI6B 2P2GA 2GTHA 3DMPA 1N2BA 3JQDA 5JBNA 1KFBB 3ZGOA 1X7DA 4O4IF 3ADBA 3V48A 1VSUA 2DPMA 3I30X 2VSYA 1ISJA 3G02A 5I48A 3OE4A 1S89A 1BGVA 4BGVA 3SR4A 3MMSA 2PCLA 2VEDA 3AWDA 1RKQA 1D2AA 4OQQA 4AXBA 1P7VA 3NHWA 4JOBA 2VG8A 4AS1A 1UPTA 3ED1A 7REQA 1IXYA 1RE0A 4I50B 1ZH0A 5U1PA 4ZCRA 4NH4A 4Z3OA 5CK4A 2Y1KA 1BVHA 3ONDA 1JEDA 1NBAA 1FFXA 1L5VA 1Q91A 2G5PA 2PXCA 2R751 4NFSA 5JS2A 3TL6A 4ND8A 1IL0A 1A76A 1XZMA 3LX6A 3ZCUA 1Z06A 2JAWA 2L17A 5LB4A 1IUOA 5KYXA 4LDAA 1J8QA 2JLWA 1YB2A 2P9JA 3GDHA 3M1YA 3MJHA 1JHDA 2ZYUX 4X8OA 3TLZA 3WX0A 3DVRX 3KXPA 3DTVB 4LYEA 2IP1A 4B6OA 1G3IA 3QPCA 1VI2A 4JR2A 2ZATA 1PKEA 4LRXA 4O4LB 2C1ZA 3CH7A 4M4SA 4UXHA 3H3FA 4EEKA 4PC7A 4DADA 1ISHA 3GGPA 1KAEA 3L82B 1HLDA 5BV8A 1JR3D 3MJFA 1CIJA 4EDFA 1RRGA 2ZVJA 4N7MA 3HL4A 5EPUA 5ESDA 3WQSB 5KBYA 5CW1A 4JI6B 2Q62A 4KSCA 4ASUA 3KOYA 1BKYA 2FPSA 3S44A 4GVLA 2HA0A 3JQ7B 3I64A 3HACA 2ZUVA 1YJ5A 3DDCA 1T3HA 2C9BA 3AP3A 3ZJTA 1MTOA 5K3DA 3PHBE 1CY1A 4FHGA 5EIWA 5JXJA 5KNLA 4RHFA 3PJDA 3HR8A 3CT4A 1JU4A 1PNTA 1YHZA 5EMMA 2XIJA 4HNQA 1KIFA 1NM5A 2FFRA 5THXA 4FX2A 4DZTA 1CFZA 4NXMB 1IZ8A 4CKYA 4DR6B 2C2WA 1ZLYA 1XL0A 5EOVA 3WDSA 3LWDA 5H83A 2ZCVA 3K9FC 1ZOIA 2D1FA 4PN3A 2CMHA 4JEIA 1A88A 2BYTA 4MGZR 4NH0A 5HUHA 4Z4FA 1FVOA 2GDZA 1YIOA 1YRAA 3VNVA 5KNDA 2JBHA 4NCHA 3UUFA 1GTSA 2XE8A 1Z3IX 4NBNA 4I8DA 1KMQA 3CN7A 3CPJB 4RZSA 5JH7F 3BT7A 3L6RA 2I91A 1Y7TA 3I4LA 1N4AA 2YJ6A 4ZTZB 1BQ3A 5FI3A 1LQUA 4LHXA 4YAKA 5GJVC 1E1QA 4AS2A 3R3JA 3GLHE 2FEAA 1WHSB 2A59A 3D6TB 3V1LA 2QJRA 5K8CA 2IBSA 4JI7B 4XVHA 2JPDA 4N7RA 4WV3A 1XO1A 3F97A 4CDRA 4DIDA 1JG7A 1AHIA 2UVQA 3AUFA 3CMCO 2IYSA 3KL2A 3PX2A 4RD4A 3B1JA 4RLSA 5P8WA 2O23A 4AS3A 1YHYA 3H9EO 1RPZA 3GRCA 3GPLA 2WSIA 1QP8A 3HVIA 4N3CA 4DKXA 4M8LA 2X4IA 4F4JA 3T41A 2FZCA 4GRDA 2WU8A 4RIHA 2FF5A 1CQIB 2NUAA 3GC6A 4XIJA 3KFVA 2XVZA 4MIEA 3DAPA 2PAAA 3BD8A 3FLMA 1VI5A 4XGQA 4RTJA 1U5BA 3K72B 4NZYA 5AHWA 1RIIA 4QFCA 2ZRMA 2AEMA 2GD1O 2H0QA 1SU6A 4J9UE 2JFGA 4LHYA 3OQNA 2XCIA 4X63A 1BDIA 1U8XX 2ENUA 3DULA 3LS2A 4NOKA 4L8LA 4L8YA 4UEWA 1SUAA 1Z68A 1ZR2A 2CK3D 4YT8A 2AI2A 4WOKA 4BLRA 1W7AA 5HW0A 5HZGA 1DGQA 1MO4A 3OZWA 1VG8A 3O7WA 4MA0A 4MWCA 1TD9A 4RE5A 4YRTA 4D79A 1QBGA 2W2LA 4XFJA 5LNK1 4XJTA 5DB4A 3WYBA 4EOGA 3BXHA 1MAUA 3NBQA 4QUHA 1BFUA 4X45A 3JYHA 1L5HA 3UHPA 5LP1A 2J6CA 4R5HA 3M5PA 3LRPA 4EO7A 2VUHB 3G2JA 2FEPA 1W5SA 4OCZA 1U11A 221PA 3O9VA 4QGGA 4Y2SA 1PZMA 2F9MA 4US1R 1CRQA 4ZXFA 2XB9A 2V7WA 4PAMA 2WUFA 2XT9A 3PJGA 1CUFA 3W5IA 2A0WA 2E5LB 5IM4A 3EIUA 1JR4A 2CHVA 1DUSA 4L0CA 4KDRA 5E6RA 3MOGA 4WZBA 4C4RA 3AKYA 1BW9A 2GJAA 3M4YA 4MINA 4UAGA 3L77A 4RESA 3VYUB 1E5DA 4EI7A 3CRNA 2J7KA 5I7UA 1KH2A 1BFDA 2HK9A 4HS9A 3EZYA 1QGOA 3QQPA 2V9ZA 2A9JA 4YVFA 3FGZA 3DBIA 4GZ3A 4N0MA 3IPCA 1J2JA 2B1GA 2C1EA 3IP8A 4GBJA 4JNKA 5CDFA 3FR8A 3RGWS 2AS0A 3RYFA 2AV6A 3Q5DA 3JRWA 2RC5A 3ZYZA 4OK5A 1V45E 3DL0A 2W2MA 4G4SP 5D86A 3GG9A 1SVLA 1ZBQA 1ZM2A 3F8TA 3N0TA 1I01A 3QVLA 3O74A 4ZV4A 4KQKA 5AM4A 1P2GA 1V8DA 1X7YB 2OORA 2XV1A 3A4TA 3OF5A 1MVOA 1TVKA 4XTRA 2QX9A 5A4FS 1X2BA 3T99A 5LQJA 4L4RA 5KB3A 2G80A 4QUDA 4KGXA 2NU9B 5JALA 1UC4B 4POAA 4KUHA 2Q6OA 4A92A 4BNVA 3EMKA 5GY7A 4WUTA 4J3NA 4EECA 2QN6A 4FFNA 3PEVA 3ZU3A 2LTAA 3B1YA 2EATA 3CH6A 4P58A 2BHNA 2J0EA 2ZT8A 3PU6A 3A1FA 2EOAA 4DS3A 3WNCA 4NZZA 2ECFA 5KOJB 2XZTA 3SNKA 3ONFA 1RWWA 1V5WA 4DKJA 2BH2A 1AA6A 4ZCPA 1ES9A 4QULA 4AK9A 4LGMA 1T8PA 4UW9A 4WFJA 1RHKA 1YHNA 3SEZA 2GAJA 4PGFA 2OQVA 1PNQA 4HN2A 5THQA 1H42A 4UAVA 2VKQA 4II2A 4PYOA 5UKDA 3RC3A 1YQ9A 4ZQEA 2H9AA 2JAHA 1CNMA 4EG8A 1BDJA 3NC1C 1T4MA 3RS7A 4N9WA 4MV7A 3DB1A 5BOVA 5C1PA 3F71A 5TGTA 1LFDB 1WV1A 5CA0B 4H6VA 5FPQA 2ZRDA 1TC2A 3CSDA 1FLAA 5LXTF 3VU9A 5JD5A 4XX0B 3VH1A 4QM6A 3PC3A 1YASA 4RPGA 1UFKA 2JK1A 3AFMA 2C84A 1UBJS 1IVNA 4DARA 1BSVA 1VG0B 2YV1A 4YCSA 4Q7MB 3KZVA 8OHMA 4B45A 5TQJA 3SG0A 2YWFA 1L7QA 3PFFA 4P2GA 4G09A 3ZJ5A 1ZMXA 4TWBA 1GV0A 2DUUA 2AFIE 1OI4A 2AH5A 1J07A 1TYCA 2VK4A 1HE1C 4R0NA 5BSKA 5I5EA 1M54A 4KGZA 3VGJA 4BMDA 1C0PA 1YT5A 4RPHA 2X3UA 1X8KA 1JQ5A 2WVAA 1Z4KA 1CKEA 1Y1QA 1GNTA 2QOEA 1P9RA 1TAGA 3DEJA 3F6RA 3VR3D 1MU0A 2H2WA 2OMKA 4DG8A 5K0ZA 4CTMA 5GVSA 2I03A 4KQHA 5BPHA 2KBFA 3KHSA 4RSRA 3GP3A 3O84A 2BGTA 1DPFA 2I87A 2PL3A 4D8XA 2VQDA 2DBZA 2IZOA 4Y2PA 4R7GA 5WRFA 5BR1A 5EJ5A 4TSKA 5J58A 3LDUA 4AU1A 3N75A 3IDZA 2B83A 1NE7A 4URUR 4AYXA 3Q12A 5ERGB 2VF4X 1OE0A 1FTWA 3FZQA 5KX5A 4GYJA 2G08A 1R0SA 3AQ4A 3IP7A 3U62A 5I47A 3QV2A 4U3JB 1CIPA 1AC5A 1M75A 1NI4B 2FOLA 2YQ4A 4GPD1 4PZ9A 4WEOA 3U9LA 3HA7A 5JPCA 1WBJB 1MQAA 3EYAA 1ISPA 3BQMB 1VJ0A 1RKVA 4QDXA 3FGOA 5KOHB 1GA6A 1SBNE 1YB5A 3A37A 2EGUA 3KSDO 4P3YA 5FOSA 2XNHA 2QDKA 1JE0A 4CHTA 4TYQA 1VLQA 2H18A 1WXGA 1JMVA 1WB4A 1YZUA 3F1KA 3GRFA 4MWDA 4QFDA 1ZJ4A 4YT2A 3L9WA 1OYVA 5IN4A 2CNBA 1TIKA 2D0DA 2QJOA 3KYIB 5IKMA 4F4HA 5CB4B 1Z6YA 4FOPA 1A5TA 3W2HA 1ILEA 1DWPA 1D1TA 4BFZA 3FDFA 1GG5A 1JYSA 4GDMA 2CWWA 3INYA 4ZU3A 3ZLVA 4GGMX 3AHEA 4J3FA 1N2OA 4IX9A 1NF2A 2ECKA 3RAEC 4B3SB 2EKBA 3JQAA 3MM4A 2IRWA 2YBDA 2A1IA 1YNSA 2QSUA 1SXGA 2YCBA 3P94A 1ZL2A 3FOCA 1EFVB 1KS2A 2NSJA 3D2BA 4IIUA 4M1ZA 3UATA 3WLNA 1DJOA 2A3RA 2ZIFA 4KO8A 1FTYA 1KVUA 4OHWA 4WESA 1BE0A 5JADA 2GB4A 1O03A 1JDZA 3KLBA 4ZT7A 3SY8A 1UBUS 3DVQX 5L6MB 2V6MA 1IXZA 2OHIA 2WZBA 5AXBA 3QIAA 1IULA 3MAGA 4W99A 3OIGA 4E5DA 4DY6A 4YRAA 5E9WA 5B7GA 3W05A 1C29B 1L5LA 2NZVG 3BZWA 4HVLA 2GPAA 1EE9A 1EFHA 4UMDA 3KLOA 3ZZNA 1COWA 3VDXA 3I3SR 4PHHA 3RU3A 2HLPA 5GZ3A 2VTKA 3H7IA 3HKDA 1RXSA 5CHYA 4RF3A 3ZVMA 3PD0A 3VYTB 1DC8A 2YC4C 1EJBA 4IL5A 4Q7QA 1Y3CE 4I55A 2B98A 4TMVA 2IEDA 3ORRA 4HAZA 1VE7A 1Z4OA 2HDNB 2W8ZA 2YMLA 4F4DA 4CIAA 3DLTA 1T6NA 1WMBA 1U5CA 2EIHA 1GL6A 2GK6A 2RHCA 3C85A 4LRTB 5CM8B 3T5GA 4A9AA 4DLKA 2VJOA 1RKUA 2O4UX 3I61A 4K9DA 3OOYA 3WWCA 1NLYA 4CQLA 3P0FA 3ETLA 4E7OA 4YV0A 3BD9A 4K6CA 4TTIA 5LSAA 2NAFA 2PR2A 3KO8A 3QMPA 3PPWA 4DR5B 2QX6A 3PGKA 3T9AA 4ZCIA 5AW8A 3ZXXA 3RSSA 1XMQB 4Q66C 4K8OA 1DJPA 1DTWB 3MCTA 4GI2A 3GLFA 1Z62A 1Y5IA 4OQZA 4P5EA 5H4HA 4DXHA 1P2UA 2AZDA 2GD6A 4CM7A 3NJRA 1Y6FA 5BPFA 1A7KA 1S1MA 1NC3A 2BMJA 4I50F 3LSTA 4ZO6A 1C3OA 1KKLA 2MJLA 3DDUA 3FVRA 3PZRA 1DO8A 4IVPA 1AUQA 4DLVA 3SQNA 1R1DA 1KEEA 2UUOA 2XOEA 5EMJA 2JCSA 5KYUA 2I55A 1MG5A 2XZPA 5CYGA 1NV9A 4HNTA 1MENA 1P17A 5HBRA 4HJXA 1KDRA 3ABQB 3TGPA 3EDCA 1QYVA 1Q1QA 1MOPA 1P2BA 2GN8A 4KQFA 4OP3A 3TLYA 1Y6GA 4J7UA 5FLYA 5EP3A 2ZOSA 3G0DA 3TVTA 1EFDN 1P0CA 1ZUNA 2V65A 1R50A 1I5RA 1N2HA 2G5CA 1E20A 3BMNA 3R44A 1LDMA 1ST3A 2WHXA 4G41A 2CMKA 1S2MA 4HDAA 4LQDA 5ALYA 1QORA 1JXOA 1B8PA 1KXZA 2ATIA 3WMRA 4EW2A 2FWMX 4B40A 1G5QA 4EYOA 4HZUA 2F1HA 3T3OA 1IBSA 1N77A 4AIRA 3ZH2A 4BV2A 4PG4A 1QH8B 1X19A 2QSYA 5IU6A 4RV9A 2YVLA 2ZT5A 1N2SA 5TB5A 2I2AA 1OXBB 2WA2A 3ZGXA 2IYYA 1WZEA 2XJ9A 3OEWA 4D2IA 2R68A 4AN1A 1E92A 2G8LA 3R4CA 1E32A 1SN7A 3H5AA 4EHFA 2H08A 1USVA 5F9MA 3PWZA 1EVQA 1DBRA 1RMTA 2I7VA 2QQ5A 4MWBA 1YAJA 3A6JA 3BFJA 4OHMA 4KR9A 2P7HA 4IXWA 4AMUA 5FI0B 4B6GA 4TTVA 2CUTA 1L4HA 3L7JA 1DQYA 4TYMA 1YBAA 1YZGA 1U0JA 3PR3A 3R0XA 5DNVA 1B6RA 1QTIA 3GBSA 1XCOA 3E58A 1RPAA 1X7GA 4R8SA 4OV6B 1TZKA 4I1OA 3T35A 2Y77A 1X39A 4BUJA 1AF7A 3RS9A 3CX6A 3PHGA 4P84A 3TFOA 1YR7A 2JH8A 3HDQA 1YZNA 1ZESA 3QBTA 2OMEA 2WA1A 5CYPA 2XVMA 3ESAA 3OM0A 2J9FA 4CL2A 1XDGA 2O8FB 1NWCA 2HCJB 4OFZA 2HUPA 1Q0PA 3B70A 4I1SA 1JEYB 5E38A 1ILWA 1AGXA 1G4HA 2X2PA 3KQQA 4E6EA 2I1WA 3ABZA 3IQFA 4BQEA 5HOEA 2VHWA 4M9CA 4FNAA 1CULC 3BWDD 4XGKA 2JF0A 3DL2A 4LSWA 4ROTA 4CDNA 2DUJA 1R6DA 2WKRA 3L05A 2B20A 3U4IA 4MVJA 4G5HA 1FFAA 1GT6A 1QIGA 3CJRA 3MWJA 4Q1VA 1HDEA 4PGAA 3NAMA 4GZLA 4PLTA 1G64A 1Y3DE 3BN3A 3SJ7A 1T0HB 3AZPA 2G0TA 4R3UC 2DXIA 1QIFA 3D3QA 4A27A 5K3FA 4F9GA 2FR1A 5I7HA 1Z5VA 2O1EA 4MEJA 3ZY6A 5DBEX 2Q9BA 2YWXA 1FBTA 1CUCA 2IIQA 3E3AA 5AKYA 3UJAA 1RC0A 2F7SA 3ZHZA 2ZZNA 4E08A 3Q7QA 4FBLA 1N0UA 3DPSA 3Q11A 3U49A 1WTCA 3UEOA 3ZY4A 2ZUFA 4XGRA 3Q1KA 2V3WA 5ESXA 1QK4A 1Z88A 1A2QA 1GKYA 3EHDA 3TTSA 3TBKA 4BEVA 1HFKA 3MSXA 4JC4A 4YRQA 1TU3A 1QPGA 4E88A 2NZXA 3ONEA 4ZD6A 3WGGA 1V7PC 5DW0A 2D2VA 2YYAA 2KS6A 4NCXA 2Q50A 1ISGA 4L8VA 3W4IA 4AMYA 1H3EA 3PWTA 3HSSA 1CDDA 3KC2A 4M7PA 4I4NA 5TMDA 1IBMB 1NBMD 3LT5A 4Q48A 4FCVA 2PE5A 4KHZA 2Q5OA 4BEBA 3T54A 1TTQB 1SR8A 2J5BA 3K0KA 4JP8A 3UJHA 1OZ0A 4Q93A 3C48A 1UAGA 3U40A 5A62A 4X8MA 3S2UA 4AUNA 3TK1A 3GCWA 3L7BA 1PWHA 2QR3A 1TNDA 2WPNA 1XU4A 3QV1A 2AEEA 4U8HA 3VH3A 3ZE8A 4BO8A 2WSLA 4DJDC 4II3A 4UBJA 4JI5B 4TQUS 1W5AA 1VQ1A 2AX4A 3GZ4A 5BV0A 4I4CA 1EX7A 1TEXA 4M0UA 4QG7A 5FI5A 4KR7A 3OQBA 2QB5A 1WXHA 5LQKA 3OG9A 3QOWA 3OKCA 5ICEA 5BN4B 1OIWA 1C3XA 4M9QA 1QIMA 1FUUA 1S02A 2DR0A 3ILHA 3CF4G 3KBOA 1N8SA 1JPJA 2MDTA 3M4JA 1QGZA 4G25A 1P39A 2Z4SA 4L74A 3S7ZA 3PHIA 4P32A 2C95A 3N2EA 4R9RA 5IBPA 5EJ8A 4ZJUA 1TKCA 4B76A 5DNWA 1T2NA 5A03A 1R9NA 2FEOA 1MC1A 2DCMA 3QE2A 5J2UA 1I2ZA 4FHCA 1M72A 4KPUA 3AI1A 5CPFA 3Q8MA 3PUJA 1RHQA 4ICIA 1EFLA 1E2DA 4U7JA 3R5TA 4YN3A 3ZCTA 3I9V6 2B34A 3OIYA 2R79A 5JXGA 1IZ9A 4UUMA 1WR8A 3PKJA 2FWJA 3TZHA 2Z8YM 4Y6SA 1HFEL 4DCVA 4O4HB 1IMOA 1OX5A 1ZDMA 3GJYA 4QXMA 3E8SA 2RG1A 1M1UA 3BSYA 2ISSD 4BYMA 1XPJA 2EC5A 5G02A 2IKSA 1M0SA 5CNKA 3REQB 2D8MA 1F06A 3FKQA 1Q0UA 2VZLA 4QYXA 3S2YA 2ID8A 2C96A 4J16A 4KVAA 4OY3A 2C5HA 4PNHA 1PGQA 5J5VA 3S7TA 3O4HA 1MH9A 1C2TA 4LE0A 1DLIA 1FXWA 1RJ9A 1YK0A 2GCPA 3GRVA 3H8SA 3TOCA 2WMOB 4MQFB 1A8HA 1HDRA 1T34A 1WA5A 1XLWA 1AT1A 4URYR 4HDCA 5HIJA 1H23A 2AMJA 1Z56C 2REXB 2VPWA 2XNDD 2N9UA 2H5IA 3OD1A 3MCWA 1T1JA 4IZOA 3ROGA 3SQXA 1XZNA 2VHCA 2W98A 5IM4F 4JZYA 5KHOC 1CF4A 2YN4A 2W2OA 3FVQA 3L0IB 1BU5A 5JJLA 4EA8A 5ARBA 3HZZA 2DFPA 1QC5A 3M2TA 3RFCA 4B81A 3IPLA 5F2NA 4B4UA 4Z4IA 2PANA 5ICCA 2BEWB 4ZOAA 1YI8A 1A4IA 2ZROA 3JAMA 2GESA 1LTQA 3HUTA 1T9KA 3X1KA 4EGQA 2GCOB 2P0EA 2A58A 2W2NA 1U3TA 3CZAA 5AM5A 5L3VA 3C45A 4OHPA 3TQOA 4LYFA 2B7BA 3LK7A 1ZKMA 5DTEA 2EJTA 1AD2A 2WFLA 2OO7A 4XVQA 1AHNA 1E66A 2BFOA 4L3WA 4A7PA 3Q88A 1X7WA 5HOQA 1ZC3A 3V8BA 2WP8J 4MHSA 2HGSA 5CAEB 4ZJYA 3DTNA 2Y1EA 4UHBA 2CW5A 4B6JA 4B7UA 4UMEA 4C4TA 4PBSA 1OWNA 1G2PA 4RTNA 3LHFA 3ESZA 3NH9A 2YJ3A 1EMDA 1G0OA 1FS4A 1VJ5A 1Z83A 3L7MA 4FE4A 4TGLA 4TL8A 2CLIB 3H7AA 1DG9A 1CUZA 3QKSB 4L4UA 4ZHSA 4ETIA 4BZZA 1PR3A 2RHWA 2B61A 3RASA 3AHDA 2Y1DA 1GTZA 3HV2A 4Z2YA 3N8GA 3FFAA 4IXMA 1I4OA 3RIXA 1I2DA 4TTRA 2VDJA 4OLFA 2PM8A 3F4LA 4BV8A 1Z47A 3WHKA 4I2NA 2H4JA 4Q7EA 1NLZA 2XMQA 4M9XA 1PJ8A 3CE6A 2ZUEA 4ARZB 1SEPA 2XCLA 2R5NA 4EPWA 1A8UA 1HI9A 2W6MA 1KJ9A 2X4DA 4P3XA 3TYXA 2RGCA 3CXUA 1E9AA 5GJBA 4E31A 4RQTA 1M8KA 4RFSB 4CMCA 2QRNA 3VU1A 1N6PA 1MC8A 2BEJA 3F46A 1Z45A 2Z04A 1U9ZA 5FAKA 2X3FA 3JD0A 2Y99A 1O6BA 1E9EA 4RVCA 4BLWA 1SULA 3GRPA 5MFPA 3QA9A 2QMYA 5C7LO 3Q7IA 4FHEA 1SKBA 2FPGA 1Y8QA 3CCFA 2XXJA 5DVZA 2WWIA 4BN4A 5IJ9A 5F64A 4WLVA 2P9QA 3C5WP 3WDMA 4L9WA 4J49A 5KAPA 5IJ0B 4AJEA 1RFLA 5CB4F 1KVSA 3EIEA 3V33A 4ARBA 3C3EA 3EODA 2I4IA 3TTTA 4JVNA 1XWFA 3PR1A 4KH1A 5DP1A 3UT5B 1UP6A 4D0SA 2WM8A 3CRZA 2FPLA 3W5CA 2ZXUA 4UNRA 1L5QA 1F8UA 2OZEA 4PS1A 1USWA 1JZTA 3AU9A 1I32A 2I7DA 3PXXA 3VR2A 5DRYA 3FVTA 3EUEA 3OZ7A 4EFMA 3HKCA 3T34A 4EGFA 4KHPB 3GZNA 3O21A 3W8RA 1TK3A 1UH5A 3KZCA 3S70A 1NATA 1DOHA 2DTXA 1DKMA 1Y8AA 5I45A 3KPVA 1GCOA 3AR4A 3QPDA 1F0NA 2M2IA 2HU8A 3HP4A 4KODA 4RVNA 2PNJA 2PVSA 3EQ8A 2GBLA 4L1KA 2A2ZA 5KYKA 2B4YA 2RI0A 1G8GA 3IE0A 3K9QO 4BVFA 5FR1A 3C7AA 1Y6RA 3IS3A 5EAIA 4F3CA 3C3XA 1JZSA 3HJAA 1NRWA 3SLGA 4I1IA 1E7SA 3UOWA 4OGKA 3CF6R 4KIUA 3QZUA 3QLUC 4EJFA 4OK3A 2VP0A 1KFCB 2P68A 2QTHA 3ADDA 1QR2A 4ERXA 3TCKA 1PP4A 3E2IA 4XR9A 3PTZA 1ORIA 2CUNA 4PR0A 1RR6A 2CMGA 2WJGA 4J2HA 4OM8A 4XM1A 5HS4A 2IF0A 3I6QA 3OKPA 4LKRA 1W36C 1XEXB 3CW8X 1Z38A 3ENQA 4QDJA 1JEJA 1T6ZA 1U7UA 1ZXXA 3DWIA 3O83A 4J75A 4LXGA 5FPSA 3ZNPA 4GOJA 3HK2A 2J0VA 4Q4JB 1P7CA 1WXEA 5BSWA 5ITZB 1V11B 4V0MA 1F3LA 1QF6A 4FC7A 4WLNA 2PCJA 2FPPA 4KNYA 2C5EA 1RRKA 5F1PA 1NV8A 5AKHA 2HA6A 5ER6A 4OGFA 5CXUA 3JAKB 1G60A 2VPQA 4MRMA 1CEQA 5T3UA 1Y9EA 3OU7A 4JLBA 5TLSA 1ZVJA 2WPDA 1JQLB 1LRKA 4CCYA 3F9IA 3UPUA 1R27A 4Z4GA 4P4LA 3PHHA 1HE2A 1DCKA 1P5FA 2A30A 1P0IA 4XUCA 2XAAA 4QJ4A 1XF1A 1GZ5A 1DFIA 3L6DA 3NJ4A 3I2YX 1EM8B 1PD0A 1MX9A 4KQIA 1EUCB 2AE2A 4FZJA 1ZOOA 3MGAA 1CF9A 3RTCA 1R4ZA 3HSYA 2X9QA 2H8GA 3KNZA 5EERA 5F2EA 1Z07A 5CLIA 1F8YA 4PFJA 5BSVA 3LC2O 5AVTA 4KU4A 2WYWA 4Z54A 2QPTA 1CEXA 4OQPA 4GI1A 4YJ2B 1PJQA 3WLAA 1ZZGA 3HLKA 3LOPA 3ETHA 1RJFA 5ETJA 2EZ9A 3G5MA 1MEEA 1VKNA 2LE0A 3QJGA 4F56A 3T1HB 5HF8A 2YICA 3GLUA 4D0GA 1OYOA 2J9RA 3GA5A 4MJLA 1XDWA 4MS4B 3MIZA 3PF8A 2EKLA 2YY6A 3C97A 4LS3A 5CFZA 2ZPTX 5F76A 1CETA 3D7LA 5EIEA 3AY7A 2IUYA 3ORFA 5JFOA 2YC2C 1SB9A 2IT1A 1S3FA 4PZAA 4DLYA 4F91B 4DFDA 1HRDA 4Y2TA 4C76A 3EZ6A 5B2EA 1LPPA 4PLCA 4UTPA 3N0XA 3EARA 1ZA2A 2PJUA 2XVAA 3RS2A 5A6SA 4DILA 4UPVA 4LOAA 5LD2C 2N1BA 1GTMA 1JQ3A 3ACCA 4G0NA 4D3YA 3ZD7A 4JKIA 1E3IA 1EAMA 2E4XA 4H1HA 3ELDA 3ROZA 1NNUA 2SHKA 3VNUA 3T7KA 1YL6A 4QUAA 4OUDA 1M5TA 3KTAB 1XXHA 4CLXA 4EKEA 5A4DA 3A36A 3U19A 2B1QA 1B2LA 3QKRB 4XIIA 1GSIA 1KZ6A 2J8ZA 3KAKA 1XAIA 2X5XA 3IDSA 3CPHA 1V39A 3LT4A 3V2UA 4RZIA 2HCRA 4F45A 5BVHA 5JAIA 2YFYA 1OASA 4UCQA 2GHQA 3GP8A 1GQ2A 1EDEA 4DRYA 1U31A 1U4NA 4O4JF 5B3LA 3OCZA 4XWGA 3UKJA 5K09A 1SKMA 1FP1D 4TLEA 4X8HA 1C7ZA 3GFBA 1TFUA 4AF7A 4DG9A 3MNFA 3IVGA 2X1VA 2ZVDA 3MUNA 1A3CA 2G25A 1W94A 3H6GA 1JI0A 3RC2A 4JL5A 2EU8A 3X1ZA 4DIFA 1L7PA 1M8JA 1Y7LA 3BF7A 1JIIA 1NURA 3CSSA 4RKRA 3KSRA 1RCUA 3B9PA 2BTOA 4OHVA 1N5IA 1EFRD 1FYWA 5I9NA 2OLKA 4P7FA 1JFRA 2BZGA 4WERA 2W6ID 2BGLA 2BZ1A 3ORHA 1FVFA 1T4DA 2XB4A 4QECA 4UU1A 1ECPA 5AKKA 3C6YA 3LTNC 1DBWA 1OFHA 1Q0HA 3HJRA 3OPNA 3GR6A 4I9NA 4QPPA 3LLUA 1UEXC </