1UK4A

Crystal structure of sars coronavirus main proteinase (3clpro) complexed with an inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
301
structure length
301
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title The crystal structures of severe acute respiratory syndrome virus main protease and its complex with an inhibitor
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 84
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1uk4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uk4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uk4A02
2YNBA 2BDIA 1UHBB 2UWLA 3ZVDA 3TNTA 4TPYA 1T7CA 1LO6A 4JZDH 4K8YA 1MD7A 4DGJA 3MO9A 4DOQA 1HAVA 4J1YA 2ZF0H 2EA3A 2GD4B 2ODQA 4YOGA 3M5MA 4AB9A 1O39A 3M36A 1MU6B 1IHTH 4AFUA 4ABHA 4DY7B 1LVOA 4ISNA 2BVXH 1FN6A 1PQ8A 3SJ8A 1UHBA 2ZI2H 1J16A 3ATIA 1AE5A 2FP7B 1QGFA 2XTTB 5G4BA 1PYTC 2ZKSA 2UUFB 3ATWA 3AW0A 4D9RA 3D62A 1O2VA 4XSKU 4B76A 1C1NA 1YGCH 2WUCA 1XUJA 3LC5A 4BAKB 3SUDA 5FAHA 2GZ9A 1P01A 3A7XA 2OC0A 1LHCH 4AYYB 4GAWA 4CRAA 3QN7A 1V6DA 4IN1A 1V2TT 1CU1A 1S85A 3QWCH 4NZLA 2DUCA 1VITH 3U1JB 2QGRA 1KTTB 1Z8GA 1HRTH 1TPSA 2W26A 3QTOH 2VVVA 1BMMH 2FWWA 4Q7YA 4X2VA 4MLFB 3RXOA 1BMNH 1MTNC 1VJ9U 4I31A 3MI4A 2HWLB 1TNKA 2ZWLH 1G2LA 1TMTH 2ESTE 2D2DA 1N6YA 2HOBA 1YP9A 2FI3E 1GJ6A 1Z6JH 3QK1A 4AOQA 1EXFA 5EODA 1FQ3A 1XUFA 5AHGH 2ANKH 3T26A 4D8NA 2AIQA 3QGNB 1V2QT 3DA9B 1K1MA 2V3OH 4GHTA 2IJOB 1ACBE 1ID5H 5BRRE 1FUJA 2C3SA 2QAAA 4ABGA 4FUDA 2NU1E 4IS5A 3GCTF 3SQHE 2LPRA 3LONA 3O8BA 4I8GA 4Y76A 4ZKRU 4CR5A 3LT3A 4IMQA 1S6HA 3TH4H 3QZRA 3I77A 4IC5A 4A7IB 5HYOA 1UMAH 2R2MB 3BG8A 1C4Y2 1LCYA 4ZAEA 1ZLRA 1K1PA 4SGBE 1VGCB 3R0FA 5ABWA 1GI3A 3SZNA 2FX4A 4Q7ZA 3FZZA 3CENA 3EGKH 5CHAB 2OLGA 2Y7ZA 1HJAC 1LVMA 5EXNA 2HNTC 5C1UA 2W3IA 5JB8S 3ATMA 3LOXA 2ANWA 2RA3A 1G3BA 1HAGE 1Y8TA 2FOMB 2BLQA 1C5RA 2VWLA 5DPAA 3SBKA 2BQ6B 4ISIH 4UFDH 3UQOA 1LDTT 4LOYH 3SOSA 1JIMA 1O5EH 4NG9H 3W94A 2TPIZ 1GG6B 3UFAA 2ZQ1A 2ZDVH 5EW1H 3SU6A 1H9IE 3MNBA 3STJA 4ZHMU 5PTPA 1QNJA 2G8TA 3UPEA 1SLUB 1UCYK 4NA9H 1UK4A 1QQ4A 1SB1H 3Q3YA 4M7GA 4MNWA 4CRDA 2BLOA 3MNCA 1ELEE 4LXBH 1TFXA 1GMHG 3CS0A 1D9IA 2IPHA 1VITF 2Z9GA 2PUXB 4GUXA 4ABAA 1GPZA 1TNIA 3P92A 2XWBI 3LC3A 3UQVA 1EJAA 2Y80A 1QRXA 3TH3H 4WXVA 2P93A 1AFQC 3DUXH 4DG4A 1QB9A 2PKSC 3PLKA 2R3UA 1QJ7B 1OX1A 1BA8B 1GBAA 1T8OA 5GCHG 3V12A 1Y3XA 2OC7A 2G5VA 1W14U 4NZQA 2FDAA 3A81A 1LHFH 1XUIA 3UTUH 1C2MA 1H9HE 1UTPA 1SFIA 1ZOMA 1PQ5A 2Q6GA 2OXSA 3NUMA 3P95A 1NRSH 3VXFH 1GJBB 5DP4A 4YLQH 2P59A 3RXVA 4ABFA 1OWEA 1K1JA 1LVYA 4LK4A 1Y3WA 2H5DA 1O3CA 4OS5A 1GCTC 1GCDA 1V2UT 1MTVA 1O2RA 2EEKA 4XOJA 3SU4A 1ZTKA 2AEIH 1P9SA 1FDPA 1YLDA 2FOEA 1L1GA 2J38A 1ELBA 2F83A 4O3TA 4YM9A 1MQ5A 2ZQ2A 1EP5A 1Y5BT 2ZGCA 4YZUA 1TX7A 4MPXA 3TK6A 1V2KT 2HALA 3FVFB 4JYTA 1SGQE 1C5OH 4OS1A 1J15A 1ZPBA 2FTMA 1K1OA 3SO3A 3RLYH 1GL1A 3GY2A 8GCHF 3Q3XA 4JZEH 2C8YB 2F9OA 3P8OA 3KQCA 1WV7H 2PTCE 5JBTA 5EXLA 1ESTA 4ZKSU 4WXIA 4ISHH 2AGEX 4X6NA 1AIXH 1D6RA 4OS2A 1A0JA 5T6FA 2QF3A 1AKSA 3ZVGA 2NWNA 3F6UH 4ZXYH 3SV7A 1GGDB 4THNH 2H5CA 1KXEA 2QA9E 1C5MD 1C1OA 3RXBA 3W95A 3AAVA 1MAYA 5JBAS 1GMDF 1YC0A 1YPEH 3PV4A 2BLVA 2CN0H 3RXSA 1KLIH 9LPRA 1PPZA 1F0UA 1DPOA 1RTKA 1VR1H 2OD3B 5LPFA 3G01A 3RXTA 2F9VA 2Y5FA 4HTCH 3HK6B 2Y5HA 1A2CH 2BDBA 3RXGA 3NK8A 1ETTH 1QIXB 2FOHA 1S84A 1OWDA 2F9NA 3HK3B 2WUBA 3MMGA 2BXTH 4I33A 4INKA 1O2IA 1W11U 1W2KH 3ZZ6A 3U8TH 2HVXA 1DT2A 1HAIH 1J8AA 1TE0A 1KXAA 4CH8B 1V2PT 1IQFA 2XBYA 2VIVA 2ZGXH 4Z0KA 1UTQA 1EAWA 1BJVA 1DY8A 4YTAA 1E35B 1G9IE 1ZHPA 1E37B 1WAYB 2FX6A 1ELGA 4WJG2 1DWDH 2GCHG 1ZMLA 1D4PB 2FS8A 2XXLA 2B7DH 5EW2H 2WPLS 2V35A 1IQMA 1QA0A 6GCHF 2BVRH 4NSVA 1O2GH 6LPRA 1ZRBA 1D3QB 4O9VA 2BY5X 1GDQA 2BHGA 1TNHA 2BB4A 2HPPH 3GCHC 1ZR0A 4X2YA 5HM2A 4RSPA 5AFZH 3SJIA 1O5AB 1BRUP 2BX3A 1TBRH 2ZPSA 2Z9KA 1GMCG 1RS0A 2VIDA 5DP7A 5DP3A 1TRMA 3D65E 2ZDMA 1HBTH 2BD2A 1YCPH 1WOFA 1EZSC 1O0DH 2H1UA 4FVBA 4XBBA 1V2VT 2AGGX 2FOAA 1OP2A 2A4OA 4WY3A 1O3NA 3PWBA 2XCFA 2WINI 4ZKOU 3URCA 5C2ZA 3ELAH 1D3TB 4BAOB 2A31A 2VH0A 4AFZA 4B2CA 3PMJA 1JMOH 2FESH 2BD4A 3KQEA 3O8RA 1TX6A 2CJIA 2QXHA 1O3AA 3F9HA 3BTKE 2DE9A 5DG6A 1UVSH 3U8RH 3ZZ3A 1GHAG 3S0NA 1C2KA 3UR6A 1FZZA 1ARCA 1HXEH 3A8DA 2FOBA 4GSOA 1CT0E 2OUAA 4JYUH 4K2YA 1EATA 1O3IA 1QTFA 4IMZA 1CVWH 3BTFE 2QV1A 4DJZB 3VB5A 2BY6X 4CRGA 1NFWA 4ABIA 5BPEA 1JRTA 4ABJA 1QJ1B 4ZXXH 2PSYA 4RN6A 1UTJA 3MNXA 3BEIB 1P04A 1WTHD 1C5SA 4GPGA 1GI5A 1YPMH 1ZTLA 2AIPA 4NIYA 1B0EA 1HAZB 4JK6A 2PSXA 5CHAC 3EA7A 1MKXH 2ZU1A 2A2XH 4FUGA 2ODYB 1RGQA 1SLXB 1ZMJA 1P02A 3BSQA 4D7FA 3VB3A 1TGBA 4QT8C 2J92A 1O34A 3BTTE 1J17T 1GI6A 1W7XH 1EKBB 3RXFA 2SGEE 1OWIA 2AH4X 5E0JA 1K28D 1KY9A 3SN8A 2Y5GA 4JZFH 1V3XA 4ZHAA 3F9EA 1QL8A 5LPRA 4CR9A 4ISLA 3ODFA 2PKAB 3DFJA 7ESTE 2OC1A 1EB1H 4U01A 4AYVB 3TJVA 1TONA 1LQDB 1GDUA 1GI7B 5A8YA 5E8EH 3MU1A 4PROA 1ZPZA 1ELCA 4ABBA 1ZHMA 1P10A 4WVPE 2GP9B 3A8AA 1AFQB 1LHEH 5FBIA 2PKSB 4X8VH 1VCPA 5F03A 3EAJA 1CHOF 2A4QA 4AG1A 2ASUB 2PKAA 2BQWB 4X1QU 1DDJA 1G36A 2ZGHA 2BD9A 3OSYA 2HGTH 4NWLA 1L4ZA 3A7WA 1OYQA 1NRQH 1MAXA 1O2JA 1T4VH 2P3UB 1IQLA 4U32A 2A7CA 3TGIE 3RXRA 2ZPRA 1UTLM 1O3FA 3BTEE 2VWNA 2ZECA 3ATKA 1B7XB 4DW2U 4AN7A 5A2MH 1EP6A 2BZAA 5DO4H 2QYIA 1Y59T 1L1JA 1O5DH 3KEEA 3QTVH 1DE7H 2EI7A 3TNSA 3KF2A 1GHBG 3GCTG 2FO9A 2VVUA 3RU4E 2ALPA 1SHHB 2Z6BD 4UEHH 5B6OA 1TAWA 4FXGH 1A61H 5A8ZA 3QUMP 2ZO3H 4XBCA 5JDUB 3SU0A 2WV4A 1DWBH 4ZKNU 3V0XA 2QXJA 4K1TA 2FYQA 1MBQA 2JH6D 2ZDKA 1P57B 1EOLA 5ETXA 1QB6A 1O3BA 2R2WU 1UVPA 1CQQA 1N8OB 5A8XA 4NFFA 4O3UA 1IOEA 1LPGB 1CA8B 1QFKH 1BDAA 1G3EA 1BTWA 3T2NA 1RXPA 1MQ6A 3IWMA 2FTLE 3SU1A 2AGIX 4A1XA 3F9FA 4OS7A 1F0RA 3PMBB 1GGDC 4H4FA 2AMPA 2V3HH 2BZ6H 4AFSA 2TIOA 1BHXF 1EX3A 3P6ZB 2UWPA 2PHBA 1W8BH 1KXCA 2F9PA 1P09A 5F8XA 1AB9C 4O97A 2KAIA 3TLOA 1C5NH 1C1MA 1CT2E 2J9NA 3A89A 5AFYH 2ZTYA 1TA6A 1G37A 1VITG 3NWUA 1B0FA 3BTQE 1G30B 1ELVA 1O31A 3H5CB 2XBXA 2AYWA 3SW2B 1BJUA 1SQAA 3SV6A 1OYTH 1RRKA 3UUZA 2NU4E 1EZXC 3OX7U 1TRYA 4X1PU 2ILNA 1Z1IA 1L0ZA 3STIA 1YPGH 1FIWA 1FY8E 1UVUH 1BRCE 1MBMA 3EA8A 1C4V2 2JKHA 1O2QA 1C2HA 3MH6A 4K1EA 1ZYOA 2AMDA 2QC2A 1ZHRA 1K1NA 1VCQA 4MPUA 3ZZAA 3VB4A 4ESTE 1ANBA 2GDDA 3E0PB 3QX5H 2ZDAH 1HAYB 4BTIB 3GCHB 3EDXB 2M5TA 2SGDE 1HAXB 3T25A 1O2MA 3UY9A 2BX4A 1UTOA 3K9XB 1GJ7B 3M7QA 1CE5A 3FP7E 2K7XA 2Y7XA 3LKWA 2D8WA 1S0QA 3M7TA 1BTZA 3A8CA 1ZSLA 5A0BA 2P16A 2G4UA 3CS7A 1UTMA 1SGYE 5EOKA 1KSNA 1AGJA 1LVBA 3E91A 3ODDA 1ZGVA 1T31A 1CGHA 1P2NA 3MU8A 4DT7B 4K69A 2HNTE 2A45B 2BY8X 4H42U 1QBVH 3M3SA 1O2SA 4AG2A 3C27B 4WF8A 1TIOA 1INCA 3UOUA 1MUEB 1BBRH 1RTLA 3F9GA 2XNIA 3RXEA 3TK5A 3ZYEA 2GMTB 3ZZ5A 8GCHG 2FLBH 2GGVB 1FNIA 4BNRA 2G00A 3SI3H 4SGAE 1BQYA 3D49H 4JMYA 4H6TA 1FXYA 1MMJN 3GYLB 1TALA 3I78A 3HATH 1LQEA 4IGDA 1MKWH 2CF9H 1O2NA 3BTGE 1BTUA 1DLEA 2VJ1A 1SGRE 3TIUA 1CHGA 1DY9A 1NM6A 1O3DA 5JBBS 4CBOA 1TBZH 1VJAU 5E2OA 1PPBH 2R0LA 2C8ZB 3SV2H 4YT7H 1SQOA 3S9BA 3O8CA 3RMLH 2D1JA 1NU7B 1XX9A 1O3GA 4OGXA 1HIAB 4Y0YE 3PO1B 2GV6A 2A5IA 3PYHA 1NZQH 4Q2KA 5EG4A 1CBWB 2ZEBA 3SUFA 1K2I1 2ZCHP 1ARBA 2I6SA 4E06H 1X7AC 1FV9A 1KXBA 3SGBE 2FI4E 2Z9LA 3EA9A 1G32B 3MHWU 1PFXC 3T29A 4A5TS 4FUEA 2WPKS 1HIAA 1MTWA 1JBUH 2ZPQA 3UOPA 3AAUA 5EGMA 1EB2A 3I29A 3JZ1B 2SGAA 1F2SE 2G55A 3RUOA 1U6QA 2PTNA 4AB8A 1ELFA 4XFQA 1AWFH 5F6MA 5JBCS 3VB7A 3A80A 1GI8B 1TQ0B 4AGKA 3LGIA 4GHQA 1KYNA 1SGTA 1JOUB 3PTBA 3V7TA 5LGOA 4XDEA 4X2WA 4BAMB 2ZDNA 1EZUC 2ZFTA 1C5XB 1CO7E 1XUGA 1CA0B 1TYNA 1C1RA 3DHKH 1QY6A 1C5ZB 2O8MA 1ZTJA 1FAKH 3H7TA 3KGPA 4Y11E 3BTME 1W10U 1CGIE 1C5QA 1EASA 4Y7AA 3RXIA 4I8HA 3ZZ7A 3U1IB 4Y8XA 5CMXH 3JZ2B 1TA2A 1BOQA 1C1SA 1N1LA 1P8VC 3SHAH 1YF4A 2JETB 1O2ZA 4I8JA 1OS8A 4NIVA 3M5NA 2A7HA 1UTKA 4WH6A 1QA7A 4JYVH 5DP8A 3ZYDA 1DLKB 5DJ7A 4DCDA 1TB6H 2XWAA 1GWAA 1DWCH 1TPPA 5T6DA 2VIPA 3GYMA 3U8OH 1SPJA 3ZZ4A 1B5GH 2ZCKP 2J2UA 3NXPA 4OGYA 2WPIS 5DP5A 8LPRA 4NA7A 1FONA 3E90B 2TGAA 1D6WA 3RXPA 5GXPA 4JCNA 4X0WU 2GV7A 1QB1A 2STBE 2EC9H 1AKSB 3IITA 1SL3A 2G51A 2OBQA 3BF6H 4I8LA 4R8TB 5F8ZA 4UDWH 4E7NA 2Z7FE 1C9TA 2ZFPH 3LGTA 2UUYA 2FOGA 3SNDA 1GHZA 1MTUA 8KME2 1N8OC 2LIZA 1ESAA 3U69H 1BTPA 1GBJA 5LH8A 2BOKA 2G81E 1HJ9A 3A85A 4D76A 1G2MA 1Y5AT 4A92A 1NTPA 1G3CA 2THFB 1BMLA 3ZVFA 2FOCA 1AB9B 1GBMA 2IN2A 2ZDLA 3HGNA 3RMMH 4YT6H 4Y10E 3O8DA 1WU1A 3VEQB 2FIRH 1P2KA 2C90B 1O36A 1GBTA 4OS6A 1ZSKA 2RG3A 2RCEA 2ZHDA 3SGQE 1O5CB 4U2WA 2W7SA 3T27A 4AFQA 5FPTA 2BDYA 3K6YA 1PPHE 2ZU4A 1ANCA 1T8MA 5K0HA 3SJOA 1CHOG 4WMEA 4GCHF 2YOLA 1NRPH 2B8OH 1EPTB 2GTBA 1NFUA 2I6QA 1T8NA 1O37A 4X6OA 3LH3A 1O32A 1O2PA 5C1YA 1TNJA 3K2UA 1GI1A 1S83A 2R3YA 1HB0B 1K22H 1P3CA 2ZTXA 4A1TA 4DIIH 1UO6A 3V3MA 1N6XA 2ZHQH 1C5PA 2Q6FA 1EPTA 4FUBA 4MQAA 2XRCA 1Q31A 4E7RG 4HZHA 1E34B 1ZSJA 2UUJB 2CHAB 2BVSH 1DX5M 4HGCA 1OSSA 1ABJH 1FMGA 3BTDE 1VZQH 4Y8ZA 1HAHH 3T62A 4NSYA 1W3CA 5DGJA 1ZMNA 5JPMH 1O3KA 2BXUH 2BTCE 4ZHLU 1Q3XA 1T4UH 1TGSZ 3RXCA 3SV8A 1OP8A 1SGCA 4X6MA 2W3KA 3UREA 3URDA 1GDNA 2HNTF 2ZP0H 4MNXA 3UNQA 1GBIA 3A88A 1IQGA 2F9BH 4X8UH 3SJKA 5GCHF 1NESE 2QXGA 1RIWB 2GMTC 3ZVCA 4NA8A 1XMNB 2O8UA 4BAQB 1V2WT 2J4IA 5IDKA 2Q6DA 2GCTB 1TRNA 3DT0H 3A82A 3EE0B 2FXRA 3A7ZA 1MKWK 1C2GA 3KCGH 2BY9X 2FM2A 2OBOA 2VWOA 3A86A 3E3TA 2SGQE 3T28A 2UWOA 4MDSA 3DFLA 1UJ1A 4IC6A 1AVWA 2ZGBH 1GBBA 5E0GA 2ZHFH 1BITA 1ZJDA 3MYWA 1HYLA 1AVGH 2FMJA 2ANMH 1NFYA 5L2YH 1HAPH 1V2MT 1GHVH 1OWKA 2AS9A 2VIWA 1AY6H 4KKDA 1V2LT 1P2QA 4DURA 1DXPA 3PO1C 1DWEH 3GDUA 1YPLH 1V2JT 3KNXA 4KTUA 2C8XB 2ZG0H 1W7GH 1SGIB 2GT8A 1HFDA 3ZV8A 4JK5A 4TY7A 3Q3KA 1IQJA 1QRWA 1CBWC 3UNRA 2BDHA 2P3TB 2FZZA 5JB9S 5C1XA 1F92A 1KTSB 1JIRA 2F9UA 4NCYA 7KMEH 3TGJE 3GY8A 3PWCA 4O03A 3PLBA 3SU2A 1AMHA 1TLDA 1O2OA 3FZDA 3S69A 1A4WH 1PPFE 3OU0A 4CBNA 5I46H 3MNSA 1RJXB 1K21H 4K8BA 1V2OT 1TNLA 4A1VA 1S6FA 1DICA 1CGJE 1RTFB 2A0QB 1GVKB 4VGCB 4Y79A 1WBGB 1SVPA 1P12E 1IQHA 4GVUA 5JYIA 1C2IA 1F5LA 1THRH 1QL9A 1UCYH 1TOCB 4UFFH 1Y3UA 2FLRH 1UK3A 3BTHE 1P2MA 1CA0C 2CF8H 1SI5H 5ESTE 2ZHEH 2G4TA 1GBDA 1J9CH 1DOJA 2NU3E 1LPKB 4IW4E 3PMAB 3SUEA 1BBRE 1Q2WA 2PR3A 4U30A 4JZIA 1C5VA 3AASA 1GBHA 4XBDA 3BG4B 1E38B 3RXKA 1YYY1 1GHYH 1AE8H 1O5BB 3V13A 1OOKB 1A3BH 1VCWA 2JETC 2BDGA 1BRBE 5FX6A 3RM2H 3Q76A 3BN9A 3RP2A 1EUFA 3KQDA 5EPYA 4CRBA 4B2AA 2P8OB 1Y3YA 3FAOA 5AF9H 3Q00A 2V6NA 3VXEH 1BB0B 3GCNA 3ZV9A 3F68H 3ZVAA 2R0KA 4INLA 2WYGA 4J2YB 2HRVA 1FPCH 2SNWA 2VH6A 2Z94A 1EAXA 1C1VH 5GPIB 4BAHB 1ETRH 1W12U 1C4U2 3OY6U 1S82A 2TGDA 3ZZ9A 3BEUA 1T32A 2AMQA 1PJPA 5TCCA 3RXUA 4X1RU 2W7UA 4I7YH 5HGGA 2F3CE 2KAIB 2J34A 4B75A 1O3JA 1QRZA 4GLYA 4K5ZA 3UWIA 3RC6A 4B2BA 1TMBH 4BANB 1GVZA 5SGAE 5A09A 2VB0A 1O2XA 4AORA 1NPMA 2PUQH 1C5YB 2OQUA 3K65B 3KIDU 2RDLA 4UONA 3KHVA 1SOZA 1TGCA 2JH0D 7GCHF 3MU0A 2ZGJA 3TJUA 3SNAA 1XUKA 3GY5A 3B9FH 2UUKB 1NFXA 2VWMA 1WTGH 2ALVA 4RKJB 3VGCB 4YESB 4INHA 5FXLA 1ANEA 1MZDA 2PLXA 1HDTH 5F8TA 1AUTC 1ELDE 1OKXA 1SSXA 1YPHC 1GJ4H 4ASHA 3MTYA 4MTBA 1HPGA 3FP6E 4BOHA 1O38A 2RA0A 1AWHB 3HPTB 1GJ5H 2PWXA 1F5KU 1O3HA 4TY6A 4FUJA 2WPMS 3S9CA 2H9TH 1EPTC 1FY1A 2H9EH 1BTHH 5FBEA 1Z1JA 4YOJA 3SV9A 1TGTA 1NS3A 3OTJE 3QGJA 1SGNE 4ISOA 1Z71A 2ZA5A 3TITA 1TOMH 3M61U 3UIRA 1GJAB 1NT1A 5GWZA 1QCPA 2HLCA 3S7KB 1C5WB 4ZUHA 1FJSA 5FHTA 3Q77A 3ZZ8A 1TBQH 2H2ZA 3F1SB 3LIWA 1NROH 2H9HA 1S0RA 1C2JA 1Y5UT 1NU9A 3ZVBA 4Y7BA 1OWJA 1HV7A 1K9OE 2OP9A 2BD3A 4X8TH 1BHXB 2CHAC 1A5HA 4AX9H 2FS9A 3GCOA 1NC6A 3QDZB 1LKBA 1HGTH 1NRRH 1GHXH 1H4WA 2B5TB 1FI8A 1YCPK 4UFGH 1C1TA 4D9QA 1PPCE 1XKBC 4B1TA 1P0SH 5EQRA 3RXAA 3U9AH 1C1WH 1JRSA 3NPSA 1SQTA 2ZFRH 3D23A 3EBNA 2BD8A 4TWYA 4YO9A 1FAXA 3T5FH 3MOCA 2FPZA 2ZNKH 4JZ1A 4FUHA 3SUGA 4K60A 3NKKA 1C1PA 1GI4A 3L33A 3MFJA 5DP6A 1YBWA 4X1SU 1GBCA 1LTOA 3A7YA 1MCVA 3P17H 1GL0E 1O3EA 1Y3VA 2GDEH 1SGDE 1AUJA 3PMHB 1RIWC 3TK9A 2G52A 3FFGA 4I8KA 4X6PA 1MU8B 3LJOA 1IQNA 2ZIQH 1EJNA 1XM1A 4D7GA 2HPQH 1GVLA 4Y71A 5LPEA 5EU8A 2GCTC 2VIQA 1O3OA 2FODA 1NRNH 1QBOA 1O30A 1ZGIA 5GDSH 2WPJS 3SU3A 3M3TA 1QHRB 1XVOA 2VNTA 3MO3A 2TBSA 1GMDG 3A83A 1F5RA 3B8JA 1GJ9B 2D26C 5CE1A 1O3MA 1GHBF 4NFEA 2BYAX 2BQ7B 5C5OA 1TPOA 3LGVA 1A5GH 3UNSA 3RC4A 1DVAH 1IQEA 1EJMA 1KLTA 1MKXK 1P9UA 2OTVA 1OXGA 3GY4A 3RDZA 1MD8A 1QQUA 4WMFA 3GY3A 1ZRKA 4CH2B 2VGCC 3U98H 1O2UA 1YKTA 7LPRA 4GCHG 1TWXB 1QL7A 1SG8B 5HXFA 3LPRA 1TQ7B 2QXIA 2Z3EA 3VFEA 2A5AA 4AGJA 5GJ4B 2PGBB 1EOJA 3EQ0H 8ESTE 3L3TA 1TGNA 1LKAA 4WWYA 1BIOA 1DANH 1S5SA 1SGFG 1H8DH 3SHCH 2XC0A 1KXDA 2PW8H 1EZQA 3ZZBA 5C3NA 1SFQB 1MH0A 2TGTA 2ZCLP 1RFNA 2O8WA 1A0HB 6GCHG 3RU4D 3PROA 4OS4A 2ZFSA 3GDSA 3C1KA 2J95A 1CT4E 2Z9JA 1OWHA 5C5NA 1HLTH 1YPKH 4VGCC 1EAIA 1NO9H 1AZ8A 2VU8E 1O35A 3OY5U 3A87A 1O2TA 3S7HB 4CHAB 1TMUH 1A7SA 1P3EA 4RKOB 1F0SA 3RXMA 1ELTA 4BXWA 2SFAA 4ABDA 1TNGA 5I25A 1EAUA 1XXFA 3E8LA 1A3EH 1O2HA 3BTWE 2BDAA 2P94A 6CHAC 3TU7H 4ZROA 2AERH 1UK2A 5T3HA 1O2KA 2V0BA 3SI4H 1OP0A 3BG4C 1L1NA 2P95A 1MCTA 1SMFE 3M3VA 2WV5A 1PYTD 3VPKA 4DVAU 3WY8A 2ODPA 1SGPE 1QR3E 1DUAA 2VINA 2P8OC 1IQKA 1PQAA 2P3FH 1CSOE 2QF0A 5TCAA 1DSTA 1P2OA 1XUHA 4NIWA 5ESBA 2GVFA 1JXPA 5L2ZH 3RXDA 1Z8RA 1KDQB 1F7ZA 4I32A 1F0TA 5HM9A 1D3DB 2ZU2A 4TPIZ 1TABE 1P2IA 1GBFA 3E6PH 1XVMA 3QLPH 1P03A 3SU5A 5FCRA 3RM0H 4A6LA 2A7JA 3GOVB 1AVXA 3CP7A 4MPWA 1O3PB 4NIXA 3TGKE 1O5GH 1QJ6B 2SGPE 1GHWH 2G5NA 1W0ZU 2LNCA 1BMAA 2ZTZA 3ZVEA 4MPVA 1GI2A 1C2DA 1C2FA 1MTSA 4Y6DA 1KDQA 4Z6AH 3RU4T 2CMYA 1AO5A 1T8LA 1A46H 3SNCA 1H1BA 1IAUA 2B0FA 3TPIZ 3GY6A 1KLJH 3SQEE 5HMAA 3RMOH 3AW1A 1A0LA 3KN2A 2FOFA 2NU0E 4Y8YA 1AD8H 2OCVB 1H8IH 6ESTA 1ESBA 4UD9H 1PQ7A 1SLWB 5A0AE 4LZ4B 2GX4A 1E36B 3H7OA 2C93B 2A5KA 2BM2A 2Q1JA 2STAE 3ENSB 1THPB 4FVDA 1GBLA 4BTTB 2NU2E 4AZ2B 3NZIA 3P70B 4F49A 3BIUH 1NN6A 3ZZCA 3ZZDA 3MH7A 2IOTA 1ZJKA 3VGCC 1WQVH 1O2YA 1WSSH 1GBKA 2XC4A 3RC5A 3E16B 1UCYE 1C5UA 1V2ST 1GI0A 1YCPM 2TRMA 2GZ8A 4CREA 1PPGE 2VIOA 2OC8A 1O2LA 2CGAA 5EPNA 4B73A 1DSUA 2PFEA 2GKVE 1GJ8B 1WQSA 3TVJB 1HAOH 3RMNH 3SGAE 4KGAA 3GISB 5E2PA 2OQ5A 3DD2H 5FPSA 4F4OC 5AVDA 3MU4A 1Z8IB 1SC8U 1QURH 4TYDA 2FEQH 2Y6TA 3RXQA 5IYTA 1ORFA 5C67A 1XKAC 5J4QA 3HGPA 3LGWA 3P8NA 1WYKA 1BCUH 4B71A 1WUNH 4FU8A 3PLPA 3LU9B 1GMHF 4K1SA 4UE7H 2ZZUH 4Q7XA 1O33A 1ABIH 1V2NT 1LMWB 4X2XA 3FANA 3SJ9A 2BD5A 3KQBA 1GBEA 2A2QH 1FY3A 1SHYA 1BBRK 2WPHS 3VB6A 1MTNB 2ZC9H 5DP9A 2B9LA 4IN2A 5FPYA 2BY7X 1YM0A 3P8GA 1L2EA 4R0IA 1D3PB 1O2WA 4X1NU 2XBVA 1A1RA 5GIBA 1ZZZA 1P11E 1FLEE 2VVCA 1KIGH 5E0HA 4Q80A 1PPEE 1BTYA 3MH5A 1BZXE 2A1DB 1E0FD 2W5EA 4NGAH 4MNVA 1GI9B 4KTCA 3S9AA 7GCHG 3GY7A 4HI3A 2ZFFH 2BOHB 1G3DA 1LPZB 2EI8A 2XCNA 1BT7A 4YOIA 1H9LB 5A0CA 3KL6A 4E05H 4ABEA 3HKIB 3SNEA 3ESTA 1SGFA 2SNVA 5EXMA 2ZU5A 2BD7A 3ATLA 4NWKA 2VGCB 1UTNA 1BUIA 4BTUB 2DE8A 1VGCC 4XE4A 1BTXA 1K1IA 1C2EA 1Z8JB 1HUTH 1AI8H 1HJAB 1AFEH 3M7UA 3MO6A 3TH2H 1P06A 1FN8A 1SOTA 1W13U 3PTNA 4ZH8A 2TGPZ 3B23B 1HJ8A 3BV9B 3A7TA 2GZ7A 2YNAA 2BMGB 4FUCA 3LJJA 1OPHB 1ZPCA 1ANDA 1DUEA 2AFQB 2XBWA 5C20A 3E0NB 1IQIA 2O8TA 3OYPA 1AQ7A 3RXJA 1AHTH 9ESTA 2JH5D 3ITIA 2Z3DA 1GG6C 3UWJH 1AN1E 1C1QA 5FCKA 1DM4B 1KXFA 2A4RA 3K6ZA 1HCGA 2XW9A 1EQ9A 1FY4A 4FU9A 3LGYA 3QZQA 1FPHH 1YLCA 3NCLA 4DIHH 3SORA 4CHAC 4KP0A 3M35A 5EQQA 3L6PA 2PV9B 3FP8E 1O5FH 3A8BA 2Z9IA 4K3JA 4MG3A 2OINA 1RD3B 2QY0B 1C1UH 1FIZA 2C8WB 4MNYA 6CHAB 4X8SH 4LZ1H 5DKMA 1W0YH 3M5LA 2CXVA 2Y82A 1HNEE 3E1XB 2Y81A 1IHSH 1M9UA 2J94A 1SR5C 1DXWA 5H4IB 1A5IA 1AU8A 3N7OA 3R3GB 3RXHA 2F91A 5T6GA 4CRCA 1C5TA 3EYDA 1HXFH 5EQSA 2BDCA 2O8LA 1P05A 2A4GA 4Y0ZE 1YPJH 4BXSA 2FYRA 2CV3A 1Z7KA 1AZZA 2GCHF 3GICB 2BLWA 4TWWA 1SLVB 1TX8A 2K1QA 1MZAA 2QIQA 5DK1A 1O3LA 1LHGH 4KELA 3LH1A 1BRAA 2A32A 2ZU3A 1SGEE 3MU5A 1GCTB 2XYAA 4FU7A 3RLWH 3UR9A 1XXDA 3LGUA 5L30H 1YPHE 1V2RT 3P8FA 4H6SB 1FY5A 1DFPA 2EI6A 1GMCF 2GT7A 4UFEH 3HKJB 1LHDH 3SNBA 3PM3A 4YLUA 3TJOA 2SGFE 4ZMAH 1SBWA 1K1LA 3BEFB 2Z3CA 1UVOA 3RXLA 1Z6EA 2O9QA 4MVNA 1ETSH 1NY22 2C4FH 2R9PA 2ANYA 3M5OA 2ULLA 1WCZA 3GDVA 2QCYA 1QBNA 3TJNA 4CRFA 5FX5A 1P2JA 1THSH 1GJCB 3A84A 2ZHWH 2QN5T 4IBLH 4KTSA 3AVZA 5TJXA 5J4SA 2WYJA 1J14A 1GHAF 1C9PA 1UVTH 4FUFA 3QO6A 3PB1E 3IG6B 5K7RA 1DS2E 2ZFQH 5L6NH 1DITH 3BIVH 1GJDB 2H6MA 2PGQB 3M37A 4WH8A 1C5LH 3MWIU 4WMDA 3MH4A 4FUIA 1L4DA 1S81A 1TPAE 2FI5E 1C2LA 4HFPB 4B74A 1HAVB 2XC5A 1JWTA 1ELAA 3LDXH 3A7VA
chains in the Genus database with same CATH superfamily
2YNBA 2BDIA 1UHBB 2UWLA 3ZVDA 3TNTA 4TPYA 1T7CA 1LO6A 4JZDH 4K8YA 1MD7A 4RT0A 4DGJA 3MO9A 4DOQA 1HAVA 4J1YA 2ZF0H 2EA3A 2GD4B 2ODQA 4YOGA 3M5MA 4AB9A 1O39A 3M36A 1MU6B 1IHTH 4AFUA 4ABHA 4DY7B 1LVOA 2GJGA 4ISNA 2BVXH 1FN6A 1PQ8A 3SJ8A 1UHBA 2ZI2H 2KX4A 1J16A 3ATIA 1AE5A 2FP7B 1QGFA 2XTTB 5G4BA 1PYTC 2ZKSA 2UUFB 4ACBA 1H8HD 3ATWA 3AW0A 3DCLA 3D62A 1O2VA 4D9RA 4XSKU 4B76A 1C1NA 1YGCH 2WUCA 1XUJA 3LC5A 4BAKB 3SUDA 5FAHA 2GZ9A 1P01A 3A7XA 2OC0A 1LHCH 4AYYB 4GAWA 4CRAA 3QN7A 1V6DA 4IN1A 1V2TT 1CU1A 1S85A 3QWCH 4NZLA 2DUCA 1VITH 3U1JB 2QGRA 1KTTB 1Z8GA 1HRTH 1TPSA 2W26A 3QTOH 2VVVA 1BMMH 2FWWA 4Q7YA 4X2VA 4MLFB 3RXOA 1BMNH 1MTNC 1VJ9U 4I31A 3MI4A 2HWLB 1TNKA 2ZWLH 1G2LA 1TMTH 2ESTE 3F2FA 2D2DA 1N6YA 2WHXA 2HOBA 4ACAA 1YP9A 2FI3E 1GJ6A 5GNDA 1Z6JH 3QK1A 4P02A 1EXFA 4AOQA 5EODA 1FQ3A 1XUFA 5AHGH 2ANKH 3T26A 4D8NA 2AIQA 3QGNB 1V2QT 3DA9B 1K1MA 2V3OH 4GHTA 2IJOB 1ACBE 1ID5H 5BRRE 1FUJA 2C3SA 4Q4LA 2QAAA 4ABGA 4FUDA 2NU1E 4IS5A 3GCTF 3SQHE 2LPRA 3LONA 3O8BA 4I8GA 4Y76A 4ZKRU 4CR5A 3LT3A 4IMQA 1S6HA 3TH4H 3QZRA 3PV5A 3I77A 4IC5A 4A7IB 5HYOA 1UMAH 2R2MB 3BG8A 1C4Y2 1LCYA 4ZAEA 1ZLRA 1K1PA 4SGBE 1VGCB 3R0FA 5ABWA 1GI3A 3SZNA 2FX4A 4Q7ZA 3FZZA 3CENA 3EGKH 5CHAB 2OLGA 2Y7ZA 1HJAC 1LVMA 5EXNA 5C17A 4TSFD 2HNTC 5C1UA 2W3IA 5JB8S 3ATMA 3LOXA 2ANWA 2RA3A 1G3BA 1HAGE 1Y8TA 2L74A 2FOMB 2BLQA 1C5RA 2VWLA 5DPAA 3SBKA 2BQ6B 4ISIH 4UFDH 3UQOA 1LDTT 3U28C 4LOYH 3SOSA 1JIMA 1O5EH 4NG9H 3W94A 2TPIZ 1GG6B 3UFAA 2ZQ1A 2ZDVH 5EW1H 3SU6A 2EY4C 5FL7D 1H9IE 3MNBA 3STJA 4ZHMU 5PTPA 1QNJA 2G8TA 3UPEA 1SLUB 1UCYK 4NA9H 1UK4A 1QQ4A 1SB1H 3Q3YA 4M7GA 4MNWA 4CRDA 2BLOA 3MNCA 1ELEE 4LXBH 1TFXA 1GMHG 3CS0A 1D9IA 2IPHA 1VITF 2Z9GA 3GS9A 2PUXB 4GUXA 4ABAA 1GPZA 1TNIA 3P92A 2XWBI 3LC3A 3UQVA 1EJAA 4DT4A 2Y80A 1UW7A 1QRXA 3TH3H 4WXVA 2P93A 1AFQC 3DUXH 4DG4A 1QB9A 2PKSC 3PLKA 2R3UA 1QJ7B 1OX1A 1BA8B 1GBAA 1T8OA 5GCHG 3V12A 1Y3XA 2OC7A 5CHBA 2G5VA 3OEED 1W14U 4NZQA 2FDAA 3A81A 1LHFH 1XUIA 3UTUH 1C2MA 1H9HE 1UTPA 1SFIA 1ZOMA 1PQ5A 2Q6GA 2OXSA 3NUMA 2V3MA 3P95A 1NRSH 3VXFH 1GJBB 5DP4A 4YLQH 2P59A 3RXVA 4ABFA 1OWEA 1K1JA 1LVYA 4LK4A 1Y3WA 2H5DA 1O3CA 4OS5A 1GCTC 1GCDA 1V2UT 4FOUC 1MTVA 1O2RA 2EEKA 4XOJA 3SU4A 1ZTKA 2AEIH 1P9SA 1FDPA 1YLDA 2FOEA 1L1GA 2J38A 1ELBA 2F83A 2KR7A 4O3TA 4YM9A 5EIYA 1MQ5A 2ZQ2A 1EP5A 1Y5BT 2YMSD 2ZGCA 4YZUA 1TX7A 4MPXA 3TK6A 1V2KT 2HALA 3FVFB 4JYTA 1SGQE 1C5OH 4OS1A 1J15A 1ZPBA 2FTMA 1K1OA 2QE7D 3SO3A 3RLYH 1GL1A 3GY2A 2M2AA 8GCHF 3Q3XA 4JZEH 2C8YB 2F9OA 3P8OA 3KQCA 1WV7H 2PTCE 5JBTA 5EXLA 1ESTA 4ZKSU 4WXIA 4ISHH 2AGEX 4X6NA 1AIXH 1D6RA 4OS2A 2EQNA 1A0JA 5T6FA 2QF3A 1AKSA 1SQRA 3F2HA 2NWNA 3ZVGA 3F6UH 4ZXYH 3SV7A 1GGDB 4THNH 2H5CA 1KXEA 2QA9E 1C5MD 1C1OA 3RXBA 3W95A 3AAVA 1MAYA 5JBAS 1GMDF 1YC0A 1YPEH 4F55A 3PV4A 2BLVA 2CN0H 3RXSA 1KLIH 9LPRA 1PPZA 1F0UA 1DPOA 1RTKA 1VR1H 2OD3B 5LPFA 3G01A 3RXTA 2F9VA 2Y5FA 4HTCH 3HK6B 2Y5HA 1A2CH 5HKKD 2BDBA 3RXGA 3NK8A 1ETTH 1QIXB 2FOHA 1S84A 1OWDA 2F9NA 3HK3B 2WUBA 3MMGA 2BXTH 4I33A 4INKA 1NBMD 1O2IA 1W11U 1W2KH 3ZZ6A 3U8TH 3EE7A 2HVXA 1DT2A 1HAIH 1J8AA 1TE0A 1KXAA 4CH8B 1V2PT 1IQFA 2XBYA 2VIVA 2ZGXH 4Z0KA 1UTQA 1EAWA 1BJVA 1DY8A 4YTAA 1E35B 1G9IE 1ZHPA 1E37B 1WAYB 1ELGA 2FX6A 4WJG2 1DWDH 2GCHG 1ZMLA 1D4PB 2FS8A 2XXLA 2B7DH 5EW2H 2J98B 2WPLS 2V35A 1IQMA 1QA0A 6GCHF 2BVRH 4NSVA 1O2GH 6LPRA 1ZRBA 1D3QB 4O9VA 2BY5X 1GDQA 2BHGA 1TNHA 2BB4A 2HPPH 4OM9A 3GCHC 1ZR0A 4X2YA 5HM2A 4RSPA 5AFZH 3SJIA 1O5AB 1BRUP 2BX3A 1TBRH 2ZPSA 2Z9KA 1GMCG 1RS0A 2VIDA 5DP7A 5DP3A 1TRMA 3D65E 2J98A 2ZDMA 2XOKD 1HBTH 2BD2A 1YCPH 1WOFA 1EZSC 3PRDA 1O0DH 2H1UA 4FVBA 2YMSB 4XBBA 1V2VT 2AGGX 2KM0A 2FOAA 1OP2A 2A4OA 4WY3A 1O3NA 3PWBA 2XCFA 2JDID 2HLDD 2WINI 4ZKOU 3URCA 5C2ZA 3ELAH 1D3TB 4BAOB 2A31A 2VH0A 4AFZA 4B2CA 3PMJA 1JMOH 2FESH 2BD4A 3KQEA 3O8RA 1TX6A 2CJIA 2QXHA 1O3AA 3F9HA 3BTKE 2DE9A 5DG6A 1UVSH 3U8RH 3ZZ3A 1GHAG 3S0NA 1C2KA 3UR6A 1FZZA 1ARCA 1HXEH 3A8DA 2FOBA 4GSOA 1CT0E 2OUAA 4JYUH 4K2YA 1EATA 1O3IA 1QTFA 4IMZA 1CVWH 3BTFE 2QV1A 4DJZB 3VB5A 2BY6X 4CRGA 1NFWA 4ABIA 5BPEA 1JRTA 4ABJA 1QJ1B 4ZXXH 2PSYA 4RN6A 1UTJA 3MNXA 3BEIB 1P04A 1WTHD 1C5SA 4GPGA 1GI5A 1YPMH 1ZTLA 2AIPA 4NIYA 1B0EA 1HAZB 5EJZA 4JK6A 2PSXA 5CHAC 3EA7A 1MKXH 3FOAA 2ZU1A 4AC9A 2A2XH 4FUGA 2ODYB 1RGQA 1SLXB 1ZMJA 1P02A 3BSQA 1E1QD 4D7FA 3VB3A 1TGBA 4QT8C 2J92A 1O34A 3BTTE 1J17T 1GI6A 1W7XH 1E1RD 1EKBB 3RXFA 2SGEE 1OWIA 2AH4X 3W1EA 5E0JA 1K28D 1KY9A 3SN8A 2Y5GA 4JZFH 2OK5A 1V3XA 4ZHAA 3F9EA 1QL8A 5LPRA 4CR9A 4ISLA 3ODFA 2PKAB 3DFJA 7ESTE 2OC1A 4FETA 1EB1H 2AHME 4U01A 4AYVB 3TJVA 1TONA 1LQDB 1GDUA 1GI7B 5A8YA 5E8EH 3MU1A 4PROA 1ZPZA 1ELCA 4ABBA 1ZHMA 5DSFA 1P10A 4WVPE 2GP9B 3A8AA 1AFQB 1LHEH 5FBIA 2PKSB 4X8VH 1VCPA 5F03A 3EAJA 1CHOF 2A4QA 4AG1A 2ASUB 2PKAA 2BQWB 4X1QU 1DDJA 1G36A 2ZGHA 2BD9A 2XNDD 3OSYA 2HGTH 4NWLA 1L4ZA 3A7WA 1OYQA 1NRQH 1MAXA 1O2JA 1T4VH 2KFWA 2P3UB 1IQLA 4U32A 2A7CA 3TGIE 3RXRA 2ZPRA 1UTLM 1O3FA 3BTEE 2VWNA 2ZECA 3ATKA 1B7XB 4DW2U 2V7QD 4AN7A 5KEDA 5A2MH 1EP6A 2BZAA 5DO4H 2QYIA 1Y59T 1L1JA 1O5DH 3KEEA 3QTVH 1DE7H 2EI7A 5DN6D 3TNSA 1FX0B 3KF2A 1GHBG 3GCTG 2FO9A 2VVUA 3RU4E 2ALPA 1SHHB 3FKSD 2Z6BD 4UEHH 5KGOA 5B6OA 1TAWA 3OE7D 4FXGH 4RI0A 1A61H 5A8ZA 3QUMP 2ZO3H 4XBCA 5JDUB 3SU0A 2WV4A 1DWBH 4ZKNU 3V0XA 2QXJA 4K1TA 2FYQA 1MBQA 2JH6D 2ZDKA 1P57B 1EOLA 5ETXA 1QB6A 1O3BA 2R2WU 1UVPA 1CQQA 1N8OB 5A8XA 4NFFA 4O3UA 1IOEA 1LPGB 1CA8B 1QFKH 1BDAA 1G3EA 2RFKC 1BTWA 3F0PA 3T2NA 1RXPA 1MQ6A 3IWMA 2FTLE 3SU1A 2AGIX 4A1XA 3F9FA 4OS7A 1F0RA 3PMBB 1GGDC 3OFND 4H4FA 2AMPA 2V3HH 2BZ6H 4AFSA 2TIOA 1BHXF 1EX3A 3P6ZB 2UWPA 2PHBA 3KQ5A 1W8BH 1KXCA 2F9PA 1P09A 5F8XA 1AB9C 4O97A 2KAIA 3TLOA 1C5NH 2L6OA 1C1MA 1CT2E 2J9NA 3A89A 5AFYH 2ZTYA 1TA6A 1G37A 1VITG 3NWUA 1B0FA 3BTQE 1G30B 1ELVA 1O31A 3H5CB 2XBXA 2AYWA 3SW2B 1BJUA 1SQAA 3SV6A 3N7DA 1OYTH 1RRKA 3UUZA 2NU4E 1EZXC 3OX7U 1TRYA 4X1PU 2ILNA 1Z1IA 1L0ZA 3STIA 1YPGH 1FIWA 4Z1MD 1FY8E 1UVUH 1BRCE 1MBMA 3EA8A 1C4V2 2JKHA 4ZCNA 1O2QA 1C2HA 3MH6A 4K1EA 1ZYOA 2AMDA 3UB0A 2QC2A 1ZHRA 1K1NA 1VCQA 4MPUA 3ZZAA 3VB4A 4ESTE 1ANBA 2GDDA 3E0PB 3QX5H 3PRBA 2ZDAH 1HAYB 4BTIB 3GCHB 3EDXB 2M5TA 2SGDE 1HAXB 3T25A 1H8ED 1O2MA 3UY9A 2BX4A 1UTOA 3CNRA 2K8IA 3K9XB 1GJ7B 3M7QA 1CE5A 3FP7E 2K7XA 2Y7XA 3LKWA 2D8WA 1S0QA 2HVYB 3M7TA 1BTZA 3A8CA 1ZSLA 5A0BA 2P16A 2G4UA 3CS7A 1UTMA 1SGYE 5EOKA 1KSNA 1AGJA 1LVBA 3E91A 3ODDA 1ZGVA 1T31A 1CGHA 2YMSC 1P2NA 3MU8A 3N7EA 4K69A 2HNTE 4DT7B 2A45B 2BY8X 4H42U 1QBVH 3M3SA 1O2SA 4AG2A 3C27B 4WF8A 1TIOA 4XRNA 1INCA 3UOUA 1MUEB 1BBRH 1RTLA 3F9GA 2XNIA 3RXEA 3TK5A 3ZYEA 2GMTB 3ZZ5A 8GCHG 2FLBH 2GGVB 1FNIA 4BNRA 2G00A 3SI3H 4SGAE 1BQYA 3D49H 4JMYA 4H6TA 3OAAD 1FXYA 1MMJN 3GYLB 1TALA 3I78A 3HATH 1LQEA 4IGDA 1MKWH 2CF9H 1O2NA 3BTGE 1BTUA 1DLEA 2VJ1A 1SGRE 3TIUA 1CHGA 1DY9A 1NM6A 1O3DA 4I86A 5JBBS 4CBOA 1TBZH 1VJAU 5E2OA 1PPBH 2R0LA 2C8ZB 3SV2H 4YT7H 1SQOA 3S9BA 3O8CA 3RMLH 2D1JA 1NU7B 1XX9A 1O3GA 4OGXA 1HIAB 4Y0YE 3PO1B 3SZEA 2GV6A 2A5IA 3PYHA 1NZQH 4Q2KA 5EG4A 1CBWB 2ZEBA 3SUFA 1K2I1 2ZCHP 1ARBA 2I6SA 4E06H 1X7AC 1FV9A 1KXBA 3SGBE 2KCPA 2FI4E 2Z9LA 3EA9A 1G32B 3MHWU 1PFXC 3T29A 4A5TS 4FUEA 2WPKS 1HIAA 1MTWA 1JBUH 2ZPQA 3UOPA 3AAUA 5EGMA 1EB2A 3I29A 3JZ1B 2SGAA 1F2SE 2G55A 3RUOA 1U6QA 2PTNA 4AB8A 1ELFA 4XFQA 1AWFH 5F6MA 5JBCS 3VB7A 3A80A 1GI8B 3MQKC 1TQ0B 4AGKA 3LGIA 4GHQA 1KYNA 1SGTA 1JOUB 3PTBA 3V7TA 5LGOA 4XDEA 2J5UA 4X2WA 2ZDNA 4BAMB 1EZUC 2ZFTA 1C5XB 3OTPA 1CO7E 1XUGA 1CA0B 1TYNA 1C1RA 3DHKH 1QY6A 1C5ZB 2O8MA 1ZTJA 1FAKH 3H7TA 3KGPA 4Y11E 3BTME 1W10U 1CGIE 1C5QA 1EASA 4Y7AA 3RXIA 4I8HA 3ZZ7A 3U1IB 4Y8XA 5CMXH 3JZ2B 1TA2A 1BOQA 1C1SA 1N1LA 1P8VC 3SHAH 1YF4A 2JETB 1O2ZA 4I8JA 1OS8A 2F4LA 3M5NA 4NIVA 2A7HA 1UTKA 4WH6A 1QA7A 4JYVH 5DP8A 3ZYDA 1DLKB 5DJ7A 4DCDA 1TB6H 2XWAA 1GWAA 1DWCH 1TPPA 2QF4A 5T6DA 2VIPA 3GYMA 3U8OH 1SPJA 3ZZ4A 1B5GH 2ZCKP 2J2UA 3NXPA 4OGYA 2WPIS 5DP5A 8LPRA 4NA7A 1FONA 3E90B 2TGAA 1D6WA 3RXPA 5GXPA 4JCNA 4X0WU 2GV7A 1QB1A 2STBE 2EC9H 1AKSB 3IITA 1SL3A 2G51A 2OBQA 3BF6H 4I8LA 4R8TB 5F8ZA 2K0QA 4UDWH 4E7NA 2Z7FE 1C9TA 2ZFPH 3LGTA 2UUYA 2FOGA 3SNDA 1GHZA 1MTUA 8KME2 1N8OC 2LIZA 1ESAA 3DSPA 3U69H 1BTPA 1GBJA 5LH8A 2BOKA 2G81E 1HJ9A 3A85A 4D76A 1G2MA 1Y5AT 4TT3D 4A92A 1NTPA 3DSOA 1G3CA 2THFB 3FO8D 1BMLA 3ZVFA 2FOCA 1AB9B 1GBMA 2IN2A 2ZDLA 3HGNA 3RMMH 1K0HA 4YT6H 4Y10E 3O8DA 1WU1A 3VEQB 2FIRH 1P2KA 2C90B 1O36A 1GBTA 4OS6A 1ZSKA 2RG3A 2RCEA 2ZHDA 3SGQE 1O5CB 4U2WA 2W7SA 3T27A 4AFQA 5FPTA 2BDYA 3K6YA 1PPHE 2ZU4A 1ANCA 1T8MA 5K0HA 3SJOA 1CHOG 4WMEA 4GCHF 2YOLA 1NRPH 2B8OH 1EPTB 2GTBA 1NFUA 2I6QA 1T8NA 1O37A 4X6OA 3LH3A 1O32A 1O2PA 5C1YA 1TNJA 3K2UA 1GI1A 1S83A 2R3YA 1HB0B 1K22H 1P3CA 2ZTXA 4A1TA 4DIIH 1UO6A 5B6LA 3V3MA 3WWBA 3UAIC 1N6XA 2ZHQH 1C5PA 2Q6FA 1EPTA 4FUBA 4MQAA 2XRCA 1Q31A 4E7RG 4HZHA 1E34B 1ZSJA 2UUJB 2CHAB 2KCYA 2BVSH 1DX5M 4HGCA 1OSSA 1ABJH 1FMGA 2IJD1 3BTDE 1VZQH 4Y8ZA 1HAHH 3T62A 4Q63A 4NSYA 1W3CA 5DGJA 5CDFE 1ZMNA 5JPMH 1O3KA 2BXUH 2BTCE 4ZHLU 1Q3XA 1SKYE 1T4UH 1TGSZ 3RXCA 3SV8A 1OP8A 1SGCA 4X6MA 2W3KA 3UREA 3URDA 1GDNA 2HNTF 2ZP0H 4MNXA 3UNQA 1GBIA 3A88A 1IQGA 2F9BH 4X8UH 3SJKA 5GCHF 1NESE 2QXGA 1RIWB 2GMTC 3ZVCA 4NA8A 1XMNB 2O8UA 4BAQB 1V2WT 2J4IA 5IDKA 2Q6DA 2GCTB 1TRNA 3NRLA 3DT0H 3A82A 3EE0B 2FXRA 3A7ZA 1MKWK 1C2GA 3KCGH 2BY9X 2FM2A 2OBOA 2VWOA 3A86A 3E3TA 2SGQE 3T28A 2UWOA 4MDSA 3DFLA 1UJ1A 4IC6A 1AVWA 2ZGBH 1GBBA 5E0GA 2ZHFH 3PV2A 1BITA 1ZJDA 3MYWA 1HYLA 1AVGH 2FMJA 2ANMH 1NFYA 5L2YH 1HAPH 1W0KD 1V2MT 1GHVH 1OWKA 2AS9A 2VIWA 2JIZD 1AY6H 4KKDA 1V2LT 1P2QA 4DURA 1DXPA 3PO1C 1DWEH 3GDUA 1YPLH 1V2JT 3KNXA 4KTUA 2C8XB 2ZG0H 1W7GH 1SGIB 2GT8A 1HFDA 3ZV8A 4JK5A 4TY7A 3Q3KA 1IQJA 1QRWA 1CBWC 3UNRA 2BDHA 3FN8A 2P3TB 2FZZA 5JB9S 5C1XA 1F92A 1KTSB 1JIRA 2F9UA 4NCYA 5IK2D 7KMEH 3TGJE 3GY8A 3PWCA 4O03A 3PLBA 3SU2A 1AMHA 1TLDA 1O2OA 3FZDA 3S69A 1A4WH 1PPFE 3OU0A 4CBNA 5I46H 3MNSA 1RJXB 2CK3D 1K21H 4K8BA 1V2OT 3F0OA 1TNLA 4A1VA 1S6FA 1DICA 1CGJE 1RTFB 2A0QB 1GVKB 4VGCB 4Y79A 1WBGB 1SVPA 1P12E 1IQHA 4GVUA 5JYIA 1C2IA 1F5LA 1THRH 1QL9A 1UCYH 1TOCB 2WPDD 2KCAA 4UFFH 1Y3UA 2FLRH 1UK3A 3BTHE 1P2MA 1CA0C 2CF8H 1SI5H 5ESTE 2ZHEH 2G4TA 1GBDA 1J9CH 1DOJA 2NU3E 5C94A 1LPKB 4IW4E 3PMAB 3SUEA 1BBRE 1Q2WA 2PR3A 4U30A 4JZIA 1C5VA 3AASA 1GBHA 4ASUD 1YWUA 3BG4B 4XBDA 1E38B 3RXKA 1YYY1 1GHYH 1AE8H 1O5BB 3V13A 1OOKB 1A3BH 1VCWA 2JETC 2BDGA 2LELA 1BRBE 1W0JD 5FX6A 3RM2H 3Q76A 3BN9A 3RP2A 1EUFA 3KQDA 5EPYA 4CRBA 4B2AA 2P8OB 1Y3YA 3FAOA 5AF9H 3Q00A 2V6NA 3VXEH 1BB0B 3GCNA 3ZV9A 3F68H 3ZVAA 2R0KA 4INLA 2WYGA 4J2YB 2HRVA 1FPCH 2SNWA 4P00A 2VH6A 2Z94A 1EAXA 1C1VH 5GPIB 4BAHB 1ETRH 1W12U 1C4U2 3OY6U 1S82A 2TGDA 3ZZ9A 3BEUA 1T32A 2AMQA 1PJPA 5TCCA 3RXUA 4X1RU 2W7UA 4I7YH 5HGGA 2F3CE 2KAIB 2J34A 4B75A 1O3JA 1QRZA 4GLYA 4K5ZA 3UWIA 4F48B 3RC6A 4B2BA 1TMBH 4BANB 1GVZA 3KYGA 5SGAE 5A09A 2VB0A 1O2XA 4AORA 1NPMA 2KCOA 1C5YB 2PUQH 2OQUA 3K65B 3KIDU 2RDLA 4UONA 3KHVA 1SOZA 1TGCA 2JH0D 7GCHF 3MU0A 2ZGJA 3TJUA 3SNAA 1XUKA 3GY5A 3B9FH 2UUKB 1NFXA 2VWMA 1QZ8A 1WTGH 2ALVA 4RKJB 3VGCB 4YESB 4INHA 5FXLA 1ANEA 1MZDA 2PLXA 1HDTH 5F8TA 4HG6A 1AUTC 1YPHC 1ELDE 1OKXA 1SSXA 1GJ4H 4ASHA 3MTYA 4MTBA 1HPGA 3FP6E 4BOHA 1O38A 2RA0A 1AWHB 2WZQA 3HPTB 1GJ5H 2PWXA 1F5KU 1O3HA 4TY6A 4FUJA 2WPMS 3OEHD 3S9CA 2H9TH 1EPTC 1FY1A 1COWD 4B6FA 2H9EH 1BTHH 5FBEA 1Z1JA 4YOJA 3SV9A 1TGTA 1NS3A 3OTJE 3QGJA 1SGNE 4ISOA 1Z71A 2ZA5A 3TITA 1TOMH 3M61U 5T1VA 3UIRA 1GJAB 1NT1A 5GWZA 1QCPA 2HLCA 3S7KB 3VG8A 1C5WB 4ZUHA 1FJSA 5FHTA 3Q77A 3ZZ8A 1TBQH 2H2ZA 1E79D 3F1SB 3LIWA 1NROH 2H9HA 1S0RA 1C2JA 1Y5UT 1NU9A 3ZVBA 4Y7BA 1OWJA 1HV7A 1K9OE 2OP9A 2BD3A 4X8TH 1BHXB 2CHAC 1A5HA 4AX9H 2FS9A 3GCOA 1NC6A 3QDZB 1LKBA 1HGTH 1NRRH 1GHXH 1H4WA 2B5TB 1FI8A 1YCPK 4UFGH 1C1TA 4D9QA 1PPCE 1XKBC 4B1TA 1P0SH 5EQRA 3RXAA 3U9AH 1C1WH 4RT1A 1JRSA 3NPSA 1SQTA 2ZFRH 3D23A 3EBNA 2BD8A 4TWYA 4YO9A 1FAXA 3T5FH 3MOCA 2FPZA 2ZNKH 4JZ1A 4FUHA 3SUGA 4K60A 3NKKA 1C1PA 1GI4A 3L33A 3MFJA 5DP6A 1YBWA 4X1SU 1GBCA 1LTOA 3A7YA 1MCVA 3P17H 1GL0E 1O3EA 1Y3VA 2GDEH 1SGDE 1AUJA 1WXRA 3PMHB 1RIWC 3TK9A 2G52A 1NBME 3FFGA 4I8KA 1MU8B 4X6PA 3LJOA 1IQNA 2ZIQH 1EJNA 1XM1A 4D7GA 2HPQH 1GVLA 4Y71A 5LPEA 5EU8A 2GCTC 2KZ4A 2VIQA 1O3OA 2FODA 2JJ2D 1NRNH 1QBOA 1O30A 2QF5A 1ZGIA 5GDSH 2WPJS 3SU3A 3M3TA 1QHRB 1XVOA 2VNTA 3MO3A 2TBSA 1GMDG 3A83A 1F5RA 3B8JA 5F53A 1GJ9B 2D26C 5CE1A 1O3MA 1GHBF 4NFEA 2BYAX 2BQ7B 5C5OA 1TPOA 3LGVA 1A5GH 3UNSA 3RC4A 1DVAH 1IQEA 1EJMA 1KLTA 1MKXK 1P9UA 2OTVA 1OXGA 3GY4A 3RDZA 1MD8A 1QQUA 4WMFA 3GY3A 1ZRKA 4CH2B 2VGCC 3U98H 1O2UA 1YKTA 7LPRA 4GCHG 1TWXB 1QL7A 1SG8B 5HXFA 3LPRA 1TQ7B 2QXIA 2Z3EA 4B6EA 3VFEA 2A5AA 4AGJA 5GJ4B 2PGBB 1EOJA 3EQ0H 8ESTE 3L3TA 1TGNA 1LKAA 4WWYA 1BIOA 1DANH 1S5SA 1SGFG 1H8DH 3SHCH 2XC0A 1KXDA 2PW8H 1EZQA 3ZZBA 5C3NA 1SFQB 1MH0A 2TGTA 2ZCLP 1RFNA 2O8WA 2WV9A 1A0HB 6GCHG 3RU4D 3PROA 4OS4A 2ZFSA 3GDSA 3C1KA 2J95A 1CT4E 2Z9JA 1OWHA 5C5NA 2VBCA 3DSGA 1HLTH 1YPKH 4VGCC 1EAIA 1NO9H 1AZ8A 2VU8E 1O35A 3OY5U 3A87A 1O2TA 3S7HB 4CHAB 1TMUH 1A7SA 1P3EA 4RKOB 1F0SA 3RXMA 1ELTA 4BXWA 2SFAA 4ABDA 1TNGA 5I25A 1EAUA 1YLNA 1XXFA 3E8LA 1A3EH 1O2HA 3BTWE 2BDAA 2P94A 6CHAC 3TU7H 4ZROA 2AERH 1UK2A 5T3HA 1O2KA 2V0BA 3SI4H 1OP0A 3BG4C 1L1NA 2P95A 1MCTA 1SMFE 3M3VA 2WV5A 1PYTD 3VPKA 4DVAU 3WY8A 2ODPA 1SGPE 1QR3E 1DUAA 2VINA 2P8OC 1IQKA 1PQAA 2P3FH 1CSOE 2QF0A 5TCAA 1DSTA 1P2OA 1XUHA 4NIWA 5ESBA 2GVFA 1JXPA 5L2ZH 4M9FA 3RXDA 1Z8RA 1KDQB 1F7ZA 4I32A 1F0TA 5HM9A 1D3DB 2ZU2A 4TPIZ 1TABE 1P2IA 2W6ID 1GBFA 3E6PH 1XVMA 3QLPH 1P03A 3SU5A 5FCRA 3RM0H 4A6LA 2A7JA 3GOVB 1AVXA 3CP7A 4MPWA 1O3PB 5C0TA 4NIXA 3TGKE 1O5GH 1QJ6B 2SGPE 1GHWH 2G5NA 3ZIAD 1W0ZU 2LNCA 1BMAA 2ZTZA 3ZVEA 4MPVA 1GI2A 1C2DA 1C2FA 1MTSA 4Y6DA 1KDQA 4Z6AH 3RU4T 2CMYA 1AO5A 1T8LA 2PP6A 1A46H 3SNCA 1H1BA 1IAUA 2B0FA 3TPIZ 3GY6A 1KLJH 3SQEE 5HMAA 3RMOH 3AW1A 1A0LA 3KN2A 2FOFA 2NU0E 4Y8YA 1AD8H 2OCVB 1H8IH 6ESTA 1ESBA 4UD9H 1PQ7A 1SLWB 5A0AE 4LZ4B 2GX4A 1E36B 3H7OA 2C93B 2A5KA 2BM2A 2Q1JA 2STAE 3ENSB 1THPB 4FVDA 1GBLA 4BTTB 2NU2E 4AZ2B 2RDEA 3NZIA 3SYJA 3P70B 4F49A 3BIUH 1NN6A 3ZZCA 3ZZDA 3MH7A 2IOTA 1ZJKA 3VGCC 1WQVH 1O2YA 1WSSH 3H09A 2JJ1D 1GBKA 2XC4A 3RC5A 3E16B 1UCYE 1C5UA 1V2ST 1GI0A 1YCPM 2TRMA 2GZ8A 4CREA 1PPGE 2VIOA 1OHHD 1O2LA 2OC8A 2CGAA 5EPNA 4B73A 1DSUA 2PFEA 2GKVE 1GJ8B 1WQSA 3TVJB 1HAOH 3RMNH 3SGAE 4KGAA 3GISB 5E2PA 2OQ5A 5HIYA 3DD2H 2F43B 5FPSA 4F4OC 5AVDA 3MU4A 3F3BA 1Z8IB 1SC8U 1QURH 4TYDA 2FEQH 2Y6TA 3RXQA 5IYTA 1ORFA 5C67A 1XKAC 5J4QA 3HGPA 3LGWA 3P8NA 1WYKA 3KYFA 1BCUH 4B71A 1WUNH 4FU8A 3PLPA 3LU9B 1GMHF 5KECA 4K1SA 4UE7H 2ZZUH 4Q7XA 1O33A 1ABIH 1V2NT 1LMWB 4X2XA 3FANA 3SJ9A 2BD5A 3KQBA 1GBEA 2A2QH 1FY3A 1SHYA 1BBRK 2J97A 3VB6A 1MTNB 2WPHS 2ZC9H 2B9LA 5DP9A 4IN2A 5FPYA 2BY7X 5C0UA 1YM0A 3P8GA 1L2EA 4R0IA 1D3PB 1O2WA 4X1NU 2XBVA 1A1RA 5GIBA 1ZZZA 1P11E 1FLEE 2VVCA 1KIGH 5E0HA 4Q80A 1PPEE 1BTYA 3MH5A 5EJ1A 1BZXE 2LP6A 2A1DB 1E0FD 2W5EA 4NGAH 4MNVA 1GI9B 4KTCA 3S9AA 7GCHG 3GY7A 4HI3A 2ZFFH 2BOHB 1G3DA 1LPZB 2EI8A 2XCNA 1BT7A 4YOIA 1H9LB 5A0CA 1YY3A 3KL6A 2IPQX 4E05H 4ABEA 3HKIB 3SNEA 3ESTA 1SGFA 2SNVA 5EXMA 2ZU5A 2BD7A 3ATLA 4NWKA 3AK5A 3N99A 2VGCB 1UTNA 1BUIA 4BTUB 2DE8A 1VGCC 4XE4A 1BTXA 1K1IA 1C2EA 2W6JD 1Z8JB 1HUTH 1AI8H 1HJAB 1AFEH 3M7UA 1VKYA 3MO6A 3TH2H 1P06A 1FN8A 1SOTA 1W13U 3PTNA 4ZH8A 2TGPZ 3B23B 1HJ8A 3BV9B 3A7TA 2GZ7A 2YNAA 2BMGB 1S6LA 4FUCA 3WWFA 3LJJA 1OPHB 1ZPCA 1ANDA 1DUEA 2AFQB 2XBWA 5C20A 3E0NB 1IQIA 2O8TA 3OYPA 1AQ7A 3RXJA 1AHTH 9ESTA 2JH5D 3ITIA 2Z3DA 1GG6C 3UWJH 1AN1E 1C1QA 5FCKA 1DM4B 1KXFA 2A4RA 3K6ZA 1HCGA 2XW9A 1EQ9A 1FY4A 4FU9A 3LGYA 3QZQA 1FPHH 1MABB 1YLCA 3NCLA 4DIHH 3SORA 4CHAC 4KP0A 3M35A 5EQQA 3L6PA 2PV9B 3FP8E 1O5FH 3A8BA 2Z9IA 4K3JA 4MG3A 2OINA 1RD3B 2QY0B 1C1UH 1FIZA 2C8WB 4MNYA 6CHAB 4X8SH 4LZ1H 5DKMA 1W0YH 3M5LA 2CXVA 2Y82A 1HNEE 3E1XB 2Y81A 1IHSH 1M9UA 4YXWD 2J94A 1SR5C 1DXWA 5H4IB 1A5IA 1AU8A 3N7OA 3R3GB 3RXHA 2F91A 5T6GA 4CRCA 1C5TA 3EYDA 1HXFH 5EQSA 2BDCA 2O8LA 1P05A 2A4GA 4Y0ZE 1YPJH 4BXSA 2FYRA 2CV3A 1Z7KA 1AZZA 2GCHF 3GICB 2BLWA 4TWWA 1SLVB 1TX8A 2K1QA 1MZAA 2QIQA 5DK1A 1O3LA 1LHGH 4KELA 3LH1A 1BRAA 2WSSD 2A32A 2ZU3A 1SGEE 3MU5A 1GCTB 2XYAA 4FU7A 3RLWH 3UR9A 1XXDA 3LGUA 5L30H 1YPHE 1V2RT 1EFRD 3P8FA 4H6SB 1FY5A 1DFPA 2EI6A 1GMCF 2GT7A 4UFEH 3HKJB 1LHDH 3SNBA 3PM3A 4YLUA 3TJOA 2SGFE 4ZMAH 1SBWA 1K1LA 3BEFB 2Z3CA 1UVOA 3RXLA 1Z6EA 2O9QA 4MVNA 1ETSH 1NY22 2C4FH 2R9PA 1BMFD 2ANYA 3M5OA 1WDIA 2ULLA 1WCZA 3GDVA 2QCYA 1QBNA 3TJNA 4CRFA 5FX5A 3F2GA 1P2JA 1THSH 1GJCB 3A84A 2ZHWH 2QN5T 4IBLH 5EJLA 4KTSA 3AVZA 5TJXA 5J4SA 2WYJA 1J14A 1GHAF 1C9PA 1KMHB 1UVTH 3QO6A 4FUFA 3PB1E 3IG6B 5K7RA 1DS2E 2ZFQH 5L6NH 1DITH 3BIVH 1GJDB 2H6MA 2PGQB 5HIZA 3M37A 4WH8A 1C5LH 3MWIU 4WMDA 3MH4A 4FUIA 1L4DA 1S81A 1TPAE 2FI5E 1C2LA 4HFPB 4B74A 1HAVB 2XC5A 1JWTA 1ELAA 3LDXH 4XD7D 3A7VA 3WW7A
chains in the Genus database with same CATH topology
2YNBA 2BDIA 1UHBB 2UWLA 3ZVDA 3TNTA 4TPYA 1T7CA 1LO6A 4JZDH 4K8YA 1MD7A 4DGJA 3MO9A 4DOQA 1HAVA 4J1YA 2ZF0H 2EA3A 2GD4B 2ODQA 4YOGA 3M5MA 4AB9A 1O39A 3M36A 1MU6B 1IHTH 4AFUA 4ABHA 4DY7B 1LVOA 4ISNA 2BVXH 1FN6A 1PQ8A 3SJ8A 1UHBA 2ZI2H 1J16A 3ATIA 1AE5A 2FP7B 1QGFA 2XTTB 5G4BA 1PYTC 2ZKSA 2UUFB 3ATWA 3AW0A 4D9RA 3D62A 1O2VA 4XSKU 4B76A 1C1NA 1YGCH 2WUCA 1XUJA 3LC5A 4BAKB 3SUDA 5FAHA 2GZ9A 1P01A 3A7XA 2OC0A 1LHCH 4AYYB 4GAWA 4CRAA 3QN7A 1V6DA 4IN1A 1V2TT 1CU1A 1S85A 3QWCH 4NZLA 2DUCA 1VITH 3U1JB 2QGRA 1KTTB 1Z8GA 1HRTH 1TPSA 2W26A 3QTOH 2VVVA 1BMMH 2FWWA 4Q7YA 4X2VA 4MLFB 3RXOA 1BMNH 1MTNC 1VJ9U 4I31A 3MI4A 2HWLB 1TNKA 2ZWLH 1G2LA 1TMTH 2ESTE 2D2DA 1N6YA 2HOBA 1YP9A 2FI3E 1GJ6A 1Z6JH 3QK1A 4AOQA 1EXFA 5EODA 1FQ3A 1XUFA 5AHGH 2ANKH 3T26A 4D8NA 2AIQA 3QGNB 1V2QT 3DA9B 1K1MA 2V3OH 4GHTA 2IJOB 1ACBE 1ID5H 5BRRE 1FUJA 2C3SA 2QAAA 4ABGA 4FUDA 2NU1E 4IS5A 3GCTF 3SQHE 2LPRA 3LONA 3O8BA 4I8GA 4Y76A 4ZKRU 4CR5A 3LT3A 4IMQA 1S6HA 3TH4H 3QZRA 3I77A 4IC5A 4A7IB 5HYOA 1UMAH 2R2MB 3BG8A 1C4Y2 1LCYA 4ZAEA 1ZLRA 1K1PA 4SGBE 1VGCB 3R0FA 5ABWA 1GI3A 3SZNA 2FX4A 4Q7ZA 3FZZA 3CENA 3EGKH 5CHAB 2OLGA 2Y7ZA 1HJAC 1LVMA 5EXNA 2HNTC 5C1UA 2W3IA 5JB8S 3ATMA 3LOXA 2ANWA 2RA3A 1G3BA 1HAGE 1Y8TA 2FOMB 2BLQA 1C5RA 2VWLA 5DPAA 3SBKA 2BQ6B 4ISIH 4UFDH 3UQOA 1LDTT 4LOYH 3SOSA 1JIMA 1O5EH 4NG9H 3W94A 2TPIZ 1GG6B 3UFAA 2ZQ1A 2ZDVH 5EW1H 3SU6A 1H9IE 3MNBA 3STJA 4ZHMU 5PTPA 1QNJA 2G8TA 3UPEA 1SLUB 1UCYK 4NA9H 1UK4A 1QQ4A 1SB1H 3Q3YA 4M7GA 4MNWA 4CRDA 2BLOA 3MNCA 1ELEE 4LXBH 1TFXA 1GMHG 3CS0A 1D9IA 2IPHA 1VITF 2Z9GA 2PUXB 4GUXA 4ABAA 1GPZA 1TNIA 3P92A 2XWBI 3LC3A 3UQVA 1EJAA 2Y80A 1QRXA 3TH3H 4WXVA 2P93A 1AFQC 3DUXH 4DG4A 1QB9A 2PKSC 3PLKA 2R3UA 1QJ7B 1OX1A 1BA8B 1GBAA 1T8OA 5GCHG 3V12A 1Y3XA 2OC7A 2G5VA 1W14U 4NZQA 2FDAA 3A81A 1LHFH 1XUIA 3UTUH 1C2MA 1H9HE 1UTPA 1SFIA 1ZOMA 1PQ5A 2Q6GA 2OXSA 3NUMA 3P95A 1NRSH 3VXFH 1GJBB 5DP4A 4YLQH 2P59A 3RXVA 4ABFA 1OWEA 1K1JA 1LVYA 4LK4A 1Y3WA 2H5DA 1O3CA 4OS5A 1GCTC 1GCDA 1V2UT 1MTVA 1O2RA 2EEKA 4XOJA 3SU4A 1ZTKA 2AEIH 1P9SA 1FDPA 1YLDA 2FOEA 1L1GA 2J38A 1ELBA 2F83A 4O3TA 4YM9A 1MQ5A 2ZQ2A 1EP5A 1Y5BT 2ZGCA 4YZUA 1TX7A 4MPXA 3TK6A 1V2KT 2HALA 3FVFB 4JYTA 1SGQE 1C5OH 4OS1A 1J15A 1ZPBA 2FTMA 1K1OA 3SO3A 3RLYH 1GL1A 3GY2A 8GCHF 3Q3XA 4JZEH 2C8YB 2F9OA 3P8OA 3KQCA 1WV7H 2PTCE 5JBTA 5EXLA 1ESTA 4ZKSU 4WXIA 4ISHH 2AGEX 4X6NA 1AIXH 1D6RA 4OS2A 1A0JA 5T6FA 2QF3A 1AKSA 3ZVGA 2NWNA 3F6UH 4ZXYH 3SV7A 1GGDB 4THNH 2H5CA 1KXEA 2QA9E 1C5MD 1C1OA 3RXBA 3W95A 3AAVA 1MAYA 5JBAS 1GMDF 1YC0A 1YPEH 3PV4A 2BLVA 2CN0H 3RXSA 1KLIH 9LPRA 1PPZA 1F0UA 1DPOA 1RTKA 1VR1H 2OD3B 5LPFA 3G01A 3RXTA 2F9VA 2Y5FA 4HTCH 3HK6B 2Y5HA 1A2CH 2BDBA 3RXGA 3NK8A 1ETTH 1QIXB 2FOHA 1S84A 1OWDA 2F9NA 3HK3B 2WUBA 3MMGA 2BXTH 4I33A 4INKA 1O2IA 1W11U 1W2KH 3ZZ6A 3U8TH 2HVXA 1DT2A 1HAIH 1J8AA 1TE0A 1KXAA 4CH8B 1V2PT 1IQFA 2XBYA 2VIVA 2ZGXH 4Z0KA 1UTQA 1EAWA 1BJVA 1DY8A 4YTAA 1E35B 1G9IE 1ZHPA 1E37B 1WAYB 2FX6A 1ELGA 4WJG2 1DWDH 2GCHG 1ZMLA 1D4PB 2FS8A 2XXLA 2B7DH 5EW2H 2WPLS 2V35A 1IQMA 1QA0A 6GCHF 2BVRH 4NSVA 1O2GH 6LPRA 1ZRBA 1D3QB 4O9VA 2BY5X 1GDQA 2BHGA 1TNHA 2BB4A 2HPPH 3GCHC 1ZR0A 4X2YA 5HM2A 4RSPA 5AFZH 3SJIA 1O5AB 1BRUP 2BX3A 1TBRH 2ZPSA 2Z9KA 1GMCG 1RS0A 2VIDA 5DP7A 5DP3A 1TRMA 3D65E 2ZDMA 1HBTH 2BD2A 1YCPH 1WOFA 1EZSC 1O0DH 2H1UA 4FVBA 4XBBA 1V2VT 2AGGX 2FOAA 1OP2A 2A4OA 4WY3A 1O3NA 3PWBA 2XCFA 2WINI 4ZKOU 3URCA 5C2ZA 3ELAH 1D3TB 4BAOB 2A31A 2VH0A 4AFZA 4B2CA 3PMJA 1JMOH 2FESH 2BD4A 3KQEA 3O8RA 1TX6A 2CJIA 2QXHA 1O3AA 3F9HA 3BTKE 2DE9A 5DG6A 1UVSH 3U8RH 3ZZ3A 1GHAG 3S0NA 1C2KA 3UR6A 1FZZA 1ARCA 1HXEH 3A8DA 2FOBA 4GSOA 1CT0E 2OUAA 4JYUH 4K2YA 1EATA 1O3IA 1QTFA 4IMZA 1CVWH 3BTFE 2QV1A 4DJZB 3VB5A 2BY6X 4CRGA 1NFWA 4ABIA 5BPEA 1JRTA 4ABJA 1QJ1B 4ZXXH 2PSYA 4RN6A 1UTJA 3MNXA 3BEIB 1P04A 1WTHD 1C5SA 4GPGA 1GI5A 1YPMH 1ZTLA 2AIPA 4NIYA 1B0EA 1HAZB 4JK6A 2PSXA 5CHAC 3EA7A 1MKXH 2ZU1A 2A2XH 4FUGA 2ODYB 1RGQA 1SLXB 1ZMJA 1P02A 3BSQA 4D7FA 3VB3A 1TGBA 4QT8C 2J92A 1O34A 3BTTE 1J17T 1GI6A 1W7XH 1EKBB 3RXFA 2SGEE 1OWIA 2AH4X 5E0JA 1K28D 1KY9A 3SN8A 2Y5GA 4JZFH 1V3XA 4ZHAA 3F9EA 1QL8A 5LPRA 4CR9A 4ISLA 3ODFA 2PKAB 3DFJA 7ESTE 2OC1A 1EB1H 4U01A 4AYVB 3TJVA 1TONA 1LQDB 1GDUA 1GI7B 5A8YA 5E8EH 3MU1A 4PROA 1ZPZA 1ELCA 4ABBA 1ZHMA 1P10A 4WVPE 2GP9B 3A8AA 1AFQB 1LHEH 5FBIA 2PKSB 4X8VH 1VCPA 5F03A 3EAJA 1CHOF 2A4QA 4AG1A 2ASUB 2PKAA 2BQWB 4X1QU 1DDJA 1G36A 2ZGHA 2BD9A 3OSYA 2HGTH 4NWLA 1L4ZA 3A7WA 1OYQA 1NRQH 1MAXA 1O2JA 1T4VH 2P3UB 1IQLA 4U32A 2A7CA 3TGIE 3RXRA 2ZPRA 1UTLM 1O3FA 3BTEE 2VWNA 2ZECA 3ATKA 1B7XB 4DW2U 4AN7A 5A2MH 1EP6A 2BZAA 5DO4H 2QYIA 1Y59T 1L1JA 1O5DH 3KEEA 3QTVH 1DE7H 2EI7A 3TNSA 3KF2A 1GHBG 3GCTG 2FO9A 2VVUA 3RU4E 2ALPA 1SHHB 2Z6BD 4UEHH 5B6OA 1TAWA 4FXGH 1A61H 5A8ZA 3QUMP 2ZO3H 4XBCA 5JDUB 3SU0A 2WV4A 1DWBH 4ZKNU 3V0XA 2QXJA 4K1TA 2FYQA 1MBQA 2JH6D 2ZDKA 1P57B 1EOLA 5ETXA 1QB6A 1O3BA 2R2WU 1UVPA 1CQQA 1N8OB 5A8XA 4NFFA 4O3UA 1IOEA 1LPGB 1CA8B 1QFKH 1BDAA 1G3EA 1BTWA 3T2NA 1RXPA 1MQ6A 3IWMA 2FTLE 3SU1A 2AGIX 4A1XA 3F9FA 4OS7A 1F0RA 3PMBB 1GGDC 4H4FA 2AMPA 2V3HH 2BZ6H 4AFSA 2TIOA 1BHXF 1EX3A 3P6ZB 2UWPA 2PHBA 1W8BH 1KXCA 2F9PA 1P09A 5F8XA 1AB9C 4O97A 2KAIA 3TLOA 1C5NH 1C1MA 1CT2E 2J9NA 3A89A 5AFYH 2ZTYA 1TA6A 1G37A 1VITG 3NWUA 1B0FA 3BTQE 1G30B 1ELVA 1O31A 3H5CB 2XBXA 2AYWA 3SW2B 1BJUA 1SQAA 3SV6A 1OYTH 1RRKA 3UUZA 2NU4E 1EZXC 3OX7U 1TRYA 4X1PU 2ILNA 1Z1IA 1L0ZA 3STIA 1YPGH 1FIWA 1FY8E 1UVUH 1BRCE 1MBMA 3EA8A 1C4V2 2JKHA 1O2QA 1C2HA 3MH6A 4K1EA 1ZYOA 2AMDA 2QC2A 1ZHRA 1K1NA 1VCQA 4MPUA 3ZZAA 3VB4A 4ESTE 1ANBA 2GDDA 3E0PB 3QX5H 2ZDAH 1HAYB 4BTIB 3GCHB 3EDXB 2M5TA 2SGDE 1HAXB 3T25A 1O2MA 3UY9A 2BX4A 1UTOA 3K9XB 1GJ7B 3M7QA 1CE5A 3FP7E 2K7XA 2Y7XA 3LKWA 2D8WA 1S0QA 3M7TA 1BTZA 3A8CA 1ZSLA 5A0BA 2P16A 2G4UA 3CS7A 1UTMA 1SGYE 5EOKA 1KSNA 1AGJA 1LVBA 3E91A 3ODDA 1ZGVA 1T31A 1CGHA 1P2NA 3MU8A 4DT7B 4K69A 2HNTE 2A45B 2BY8X 4H42U 1QBVH 3M3SA 1O2SA 4AG2A 3C27B 4WF8A 1TIOA 1INCA 3UOUA 1MUEB 1BBRH 1RTLA 3F9GA 2XNIA 3RXEA 3TK5A 3ZYEA 2GMTB 3ZZ5A 8GCHG 2FLBH 2GGVB 1FNIA 4BNRA 2G00A 3SI3H 4SGAE 1BQYA 3D49H 4JMYA 4H6TA 1FXYA 1MMJN 3GYLB 1TALA 3I78A 3HATH 1LQEA 4IGDA 1MKWH 2CF9H 1O2NA 3BTGE 1BTUA 1DLEA 2VJ1A 1SGRE 3TIUA 1CHGA 1DY9A 1NM6A 1O3DA 5JBBS 4CBOA 1TBZH 1VJAU 5E2OA 1PPBH 2R0LA 2C8ZB 3SV2H 4YT7H 1SQOA 3S9BA 3O8CA 3RMLH 2D1JA 1NU7B 1XX9A 1O3GA 4OGXA 1HIAB 4Y0YE 3PO1B 2GV6A 2A5IA 3PYHA 1NZQH 4Q2KA 5EG4A 1CBWB 2ZEBA 3SUFA 1K2I1 2ZCHP 1ARBA 2I6SA 4E06H 1X7AC 1FV9A 1KXBA 3SGBE 2FI4E 2Z9LA 3EA9A 1G32B 3MHWU 1PFXC 3T29A 4A5TS 4FUEA 2WPKS 1HIAA 1MTWA 1JBUH 2ZPQA 3UOPA 3AAUA 5EGMA 1EB2A 3I29A 3JZ1B 2SGAA 1F2SE 2G55A 3RUOA 1U6QA 2PTNA 4AB8A 1ELFA 4XFQA 1AWFH 5F6MA 5JBCS 3VB7A 3A80A 1GI8B 1TQ0B 4AGKA 3LGIA 4GHQA 1KYNA 1SGTA 1JOUB 3PTBA 3V7TA 5LGOA 4XDEA 4X2WA 4BAMB 2ZDNA 1EZUC 2ZFTA 1C5XB 1CO7E 1XUGA 1CA0B 1TYNA 1C1RA 3DHKH 1QY6A 1C5ZB 2O8MA 1ZTJA 1FAKH 3H7TA 3KGPA 4Y11E 3BTME 1W10U 1CGIE 1C5QA 1EASA 4Y7AA 3RXIA 4I8HA 3ZZ7A 3U1IB 4Y8XA 5CMXH 3JZ2B 1TA2A 1BOQA 1C1SA 1N1LA 1P8VC 3SHAH 1YF4A 2JETB 1O2ZA 4I8JA 1OS8A 4NIVA 3M5NA 2A7HA 1UTKA 4WH6A 1QA7A 4JYVH 5DP8A 3ZYDA 1DLKB 5DJ7A 4DCDA 1TB6H 2XWAA 1GWAA 1DWCH 1TPPA 5T6DA 2VIPA 3GYMA 3U8OH 1SPJA 3ZZ4A 1B5GH 2ZCKP 2J2UA 3NXPA 4OGYA 2WPIS 5DP5A 8LPRA 4NA7A 1FONA 3E90B 2TGAA 1D6WA 3RXPA 5GXPA 4JCNA 4X0WU 2GV7A 1QB1A 2STBE 2EC9H 1AKSB 3IITA 1SL3A 2G51A 2OBQA 3BF6H 4I8LA 4R8TB 5F8ZA 4UDWH 4E7NA 2Z7FE 1C9TA 2ZFPH 3LGTA 2UUYA 2FOGA 3SNDA 1GHZA 1MTUA 8KME2 1N8OC 2LIZA 1ESAA 3U69H 1BTPA 1GBJA 5LH8A 2BOKA 2G81E 1HJ9A 3A85A 4D76A 1G2MA 1Y5AT 4A92A 1NTPA 1G3CA 2THFB 1BMLA 3ZVFA 2FOCA 1AB9B 1GBMA 2IN2A 2ZDLA 3HGNA 3RMMH 4YT6H 4Y10E 3O8DA 1WU1A 3VEQB 2FIRH 1P2KA 2C90B 1O36A 1GBTA 4OS6A 1ZSKA 2RG3A 2RCEA 2ZHDA 3SGQE 1O5CB 4U2WA 2W7SA 3T27A 4AFQA 5FPTA 2BDYA 3K6YA 1PPHE 2ZU4A 1ANCA 1T8MA 5K0HA 3SJOA 1CHOG 4WMEA 4GCHF 2YOLA 1NRPH 2B8OH