1UK4A

Crystal structure of sars coronavirus main proteinase (3clpro) complexed with an inhibitor
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
301
structure length
301
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of severe acute respiratory syndrome virus main protease and its complex with an inhibitor
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords 3C-like proteinase
total genus 84
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1uk4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uk4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uk4A02
3E90B 1O2NA 5GCHG 4OGXA 2ZPQA 4ZKOU 1EZUC 2Q1JA 1K9OE 1BHXF 1BRUP 4NSYA 3T62A 1GG6C 1C2DA 4E7RG 1SL3A 1XUGA 2PGQB 1TIOA 4X6NA 4B74A 1G30B 3O8CA 1B0FA 2H2ZA 1V2LT 1TPSA 4IMZA 1O2IA 2GCHF 1AFQC 2OUAA 3RMLH 1GHBF 4ISNA 4GUXA 1YCPM 2XCFA 5EQRA 1K2I1 2V35A 1O2MA 4AFQA 1UTNA 1T7CA 4GAWA 3SOSA 3ZVGA 1CO7E 1KXDA 1P2QA 2VB0A 2ZFTA 1P05A 6GCHF 2ODYB 1HDTH 2AFQB 3TK9A 5T6GA 2HPPH 1V2MT 3TNTA 1BMNH 1AVWA 1A2CH 2XC0A 2VH0A 1HAIH 1Y8TA 3K2UA 3BTKE 3A8AA 3SHCH 4X6PA 1LHDH 5K0HA 1LKBA 1H4WA 3F68H 1WTHD 2UWOA 2HNTE 2Z9JA 3MU1A 2P59A 1N1LA 2J4IA 4X1SU 3U8RH 3NXPA 1UTKA 2ZFFH 1S0QA 3URDA 3AASA 5BRRE 1ANEA 4KGAA 1DWDH 3GISB 1SGRE 4U30A 1H9LB 2VGCC 1ZHRA 3A7WA 4R0IA 1BBRH 3OYPA 2FESH 1L1GA 2ZDMA 3B8JA 1C5MD 1NRSH 1C9TA 1C2FA 2THFB 3BG4C 2TBSA 3ATKA 3K6ZA 2XWAA 1LMWB 1KTTB 3FZDA 1FY8E 1UCYE 2SNVA 2Y7ZA 4AN7A 2AGGX 2LIZA 1K1LA 2FOHA 2BQ7B 1LPKB 4DIIH 1ESAA 2A5AA 2ZHFH 2BZ6H 1TX7A 1J15A 4O97A 1C5ZB 1GBFA 1C5XB 2ALVA 1O3AA 3A8CA 2LNCA 3LGVA 4AFUA 4GPGA 1EATA 1HJAB 1PPFE 3MNSA 1CT4E 2GP9B 1GHWH 4I8GA 8LPRA 1V6DA 1Y3YA 1L2EA 5FPSA 1KLIH 1TFXA 3UIRA 2FTLE 5FPTA 1OS8A 3RC4A 2RA3A 1MZAA 1AGJA 1AFEH 4FVBA 2HNTC 2A0QB 2R9PA 1O32A 4VGCB 3TVJB 1FV9A 3QO6A 1S81A 2QGRA 4ISHH 1QA0A 3GY5A 1TONA 1TA6A 4TWYA 1ZMLA 1Z71A 1L4ZA 3VXFH 2P3FH 1N6YA 1RGQA 1UTLM 4BTTB 1RRKA 3ITIA 4H4FA 3UNQA 2A4OA 3MO6A 4BAKB 1SGPE 1F5LA 3ZYEA 1F0RA 1Q2WA 1L1NA 1W11U 1GJ6A 2FOBA 1SGFG 2HPQH 3RXIA 1P06A 1EXFA 2Y6TA 2Q6GA 1W0YH 3GY3A 4CBNA 1TAWA 2P16A 1QL7A 3GCHC 3BF6H 1TMTH 3S9BA 1AB9B 3SHAH 1BBRK 4O3UA 1UK3A 3SN8A 1UTQA 3SGQE 5HXFA 1L4DA 3UFAA 2PLXA 1DLEA 2HLCA 2QXHA 1DXWA 3FAOA 1XUHA 1ZJKA 2VWLA 4JMYA 2W26A 4I8JA 5LPRA 3HKJB 4INKA 3SV2H 2H6MA 1AU8A 1QRZA 2V6NA 3PM3A 1AD8H 4HTCH 2PV9B 4IN1A 4E06H 1ESBA 1NPMA 3SV9A 3RXFA 1C1PA 2ZGXH 3SNCA 1LQDB 4MNXA 1BDAA 1GJ9B 1EAIA 2QXJA 1C5WB 3QX5H 1HAOH 2CV3A 3AAVA 5PTPA 4UFDH 2ZDKA 1GJ7B 1LPGB 4NFFA 1XKBC 3RXUA 2FP7B 2ZDVH 3F9HA 1O2GH 3RXAA 1THRH 4X8SH 2OINA 4BANB 1M9UA 3VGCB 5JYIA 1WSSH 1C2KA 1SR5C 3KHVA 3UOPA 3SNEA 1UCYK 1GVZA 1G3BA 1GMCG 2OTVA 3ZVDA 4AYYB 2SGPE 1SGDE 1N8OB 1D4PB 2OQUA 3ENSB 4NA9H 2GMTB 1AQ7A 3OY6U 3IITA 2FO9A 3Q3XA 3AVZA 1O5CB 3DUXH 5A8XA 4YM9A 3ATMA 1IHSH 1JRTA 3EBNA 2BLWA 1A0HB 1C1QA 3MMGA 4AZ2B 1VITH 4AYVB 5F8XA 1FY4A 1AKSB 3VB6A 2O8WA 1LTOA 5DG6A 1DY8A 4BXWA 3CP7A 3MH6A 2QYIA 1WQSA 1O2RA 1GJCB 3L6PA 4CRDA 1KIGH 1GI3A 2GT7A 4DT7B 3RXRA 2Z3EA 9ESTA 3STIA 3VEQB 1QNJA 2WUBA 3A85A 3TH4H 1KSNA 1QGFA 4BTUB 2GCHG 1C5YB 3GY6A 1MQ5A 3RXVA 1LVBA 2ZDLA 3T29A 1YCPH 4UEHH 3SU0A 5TCAA 1C1RA 2QIQA 1JWTA 1QL9A 1W10U 5E0JA 1UTMA 3BTHE 2BDHA 4GVUA 1ZSKA 3RU4D 3M61U 1FY5A 1KTSB 1OYQA 2ZPSA 1C1SA 1OP2A 3EA9A 2QXGA 1NC6A 3CENA 1AB9C 1RXPA 1QRWA 1GBAA 3M5MA 4INHA 1O34A 2PSYA 2TGDA 1FONA 1TA2A 2P93A 4Q2KA 2M5TA 1NTPA 1S0RA 3RXHA 3TITA 3MO9A 3RXCA 1MH0A 4XDEA 1HCGA 3PWCA 3PLPA 5T6DA 1GHVH 1LPZB 2NU4E 2XBXA 1SGTA 1O35A 2ZU4A 2A1DB 3KL6A 2J92A 1J14A 4XFQA 2WPKS 3SJIA 1OX1A 1BMMH 1SLVB 1GMDG 1ELAA 2RG3A 2AEIH 3KF2A 1MQ6A 5C1UA 3MU8A 1FNIA 1TX8A 1H9HE 4DJZB 1AI8H 1O2HA 2BB4A 1WCZA 1G3CA 1TE0A 2BLOA 2F83A 4ZMAH 4E05H 4NIWA 3M37A 3T2NA 1FQ3A 2VGCB 1MMJN 3GY4A 4KTSA 2VIOA 3ESTA 4NSVA 3P95A 2FS8A 1SOZA 1NRNH 2CHAC 2XWBI 3ATLA 2BDYA 1VGCB 3I29A 2TPIZ 1QR3E 4JK6A 2ZFPH 1S84A 4ISOA 4I8LA 4ZKSU 1GHYH 1DWCH 2WV5A 3UR9A 1V2ST 1LHCH 1ZPZA 1EKBB 1DOJA 2QV1A 4XOJA 3RU4E 1UTPA 1EJNA 3WY8A 4CRCA 1YC0A 2FDAA 2BXTH 1F0UA 1MD8A 2YNBA 4FUGA 3BEFB 1WTGH 1BTHH 1VCWA 3MU0A 3UNRA 1O33A 5DP5A 1BB0B 1TNLA 3RM0H 2PR3A 3HGPA 1OKXA 2ZDNA 4IC6A 1GBEA 1NU9A 2D1JA 1UJ1A 1HIAA 5LH8A 1CE5A 4MTBA 8KME2 4ZKRU 1UMAH 2SGAA 5I25A 1O3HA 2BDAA 1QQ4A 2FOAA 6LPRA 2ZG0H 1GJDB 2O8TA 4B2AA 3T25A 1S5SA 1GDUA 4A6LA 3RMOH 2OBQA 2BY5X 2ANYA 1AWFH 7KMEH 1Y59T 3U8OH 1TX6A 1NRRH 1MTSA 1QQUA 2VIQA 3RXSA 3P70B 6CHAC 3EDXB 2PKSB 2FODA 8GCHG 3UQOA 1TRYA 1HAPH 1BA8B 3ZVCA 3SNAA 4ABFA 1NRQH 1TABE 1AUJA 1OSSA 1E37B 3A7XA 4AB8A 3A8DA 1GBKA 1RIWB 4WY3A 1GJ5H 3P8NA 5EG4A 4MPWA 1EJAA 1P2OA 1C2JA 2Y5GA 1P3CA 2G4UA 3MYWA 1Z1JA 2JH5D 4YLQH 3S0NA 1H9IE 1EX3A 3SU5A 3M5LA 4O3TA 2AGEX 1T31A 4BOHA 2ZIQH 3UOUA 4F4OC 3SV7A 2F9PA 2JH6D 1TNHA 4KKDA 4D9RA 1SGQE 2J95A 1YF4A 3GDVA 2GTBA 1BZXE 3MHWU 3RXDA 5L6NH 1P10A 5JDUB 5FAHA 5DK1A 2YNAA 1B0EA 3A88A 1G9IE 1C2IA 1TOMH 5DO4H 1D3PB 4X8TH 2ZFSA 1K28D 1O30A 1DS2E 1A4WH 3UWIA 1IOEA 2K1QA 3GICB 1NESE 1SLUB 5FCRA 1AUTC 1V2PT 4MVNA 1C2GA 1EASA 1T4VH 3PTBA 4Y8YA 3SI4H 3SJKA 3M35A 1FN8A 3MH5A 1PPGE 1AWHB 1O5AB 4ZAEA 1MTWA 3MFJA 1C5UA 3UY9A 1LHGH 2G81E 2ZA5A 1Q31A 1O31A 4KTUA 4NZLA 1CGIE 1SHYA 2B0FA 1K21H 1V2KT 2HOBA 1IQLA 2P3TB 1CHOG 3B23B 3RXPA 5E2OA 3GDSA 3MOCA 3RU4T 1AKSA 1SGCA 1T4UH 2ZI2H 1ZHMA 3B9FH 2NU1E 2FI5E 4ABGA 1NT1A 1UVOA 1SLXB 1QBOA 4MNVA 1GMCF 1KY9A 1Y3XA 1ETTH 1MD7A 1O3FA 4BXSA 2WPJS 1DSTA 3A80A 2C8WB 5JBTA 3CS7A 2AH4X 1C2MA 3STJA 3ZZ4A 1P09A 2FX6A 4IGDA 1W3CA 2I6QA 2QAAA 1GMDF 4DURA 3ZVEA 1C5NH 3LH3A 1P3EA 3PROA 1P04A 1PYTD 2A4GA 4TY7A 2ZQ1A 3BG8A 1EAUA 3ZVBA 5DP3A 2H9TH 4FUCA 4B2BA 4MQAA 3PMAB 1ZJDA 1QB9A 2ASUB 1O37A 1NFWA 3C27B 3PB1E 3GCOA 2GX4A 1EOLA 3SO3A 3FVFB 3BEUA 5EQSA 4I7YH 1TMBH 4VGCC 1K1OA 1UVSH 3QDZB 1W12U 3H7TA 1PPZA 1FMGA 1HYLA 1N8OC 3UPEA 3ZYDA 4K1EA 1MKXK 1DE7H 1OWIA 3A87A 1WUNH 4FVDA 2ESTE 1UVTH 2G55A 1H8IH 3RXEA 2R0KA 4IC5A 1J9CH 1EB2A 4X8UH 4TYDA 4DGJA 1BJVA 1PFXC 2FM2A 1UTOA 4ABIA 1GBMA 2ZGBH 1IQNA 4X2XA 4IN2A 1IQGA 1BCUH 1QJ7B 1TGCA 3U9AH 1HAXB 4WVPE 1CBWB 3QWCH 5AFYH 1GI8B 5GWZA 1O3OA 1ZHPA 3ZZ6A 1F2SE 2G52A 2ILNA 1CGJE 1W2KH 3KQBA 1HRTH 5FPYA 1RD3B 1WU1A 1MTUA 4LZ4B 1BTYA 3JZ1B 3BV9B 5EQQA 1O3JA 3E91A 5JPMH 3PLKA 4ASHA 1HXFH 1SGEE 1JXPA 4Y8ZA 1C5RA 4TPYA 3QGNB 3QZRA 2ZDAH 3PTNA 1W7GH 4I32A 2R2WU 1GBBA 3RC5A 3PWBA 1K22H 4ABHA 4Y11E 2UUFB 1DICA 5J4SA 5T6FA 2Y80A 4R8TB 4A5TS 1OWDA 3UWJH 4UFEH 2B7DH 1V2OT 2B8OH 5EXNA 1QB6A 4JYUH 4B73A 3RLYH 1ETRH 2PSXA 1QJ6B 4RKJB 1AVXA 3ZV8A 1BTWA 1QTFA 1ZMNA 4K1TA 2RCEA 3ZZAA 3KIDU 4FUFA 2A7HA 1CA0C 3IG6B 5HGGA 5AFZH 1UVUH 1C4V2 1JIMA 4FUDA 3QTVH 4GHTA 4J2YB 4CR5A 2C8XB 2EI6A 4CREA 1MKXH 3SNBA 2CXVA 2WV4A 4CR9A 5AVDA 4CBOA 1PYTC 1V2TT 1E36B 2ZPRA 2WPHS 2GCTB 4Y71A 1MCVA 1A1RA 4E7NA 1GI2A 2OD3B 5CHAB 1SSXA 3UUZA 4ABDA 1SFQB 3GOVB 3UREA 1AY6H 3E16B 3I77A 2C93B 1KYNA 2SFAA 7ESTE 1GBLA 1KXAA 1QRXA 3EAJA 1KLJH 2BDBA 4X6OA 1BTZA 2KAIA 4YOJA 1ELDE 4MNYA 3SNDA 3SORA 3P8OA 2VH6A 1S6FA 1MCTA 5EU8A 1BHXB 1GHAF 1FY3A 1SGIB 1E34B 1TGTA 2SNWA 4YOGA 3E3TA 1NFUA 1U6QA 3BTQE 4I33A 5BPEA 1EQ9A 1W13U 2GKVE 2RA0A 3KCGH 1O2XA 3F6UH 3MNBA 3LJJA 1TMUH 1MAXA 1XKAC 1A3EH 1MTNB 1SB1H 2GV6A 1GBIA 2BD4A 4ZH8A 2WYJA 2D2DA 2FIRH 1D3QB 1GI1A 4DVAU 1O2TA 4Q80A 3TJVA 3A89A 2A4RA 4JYTA 1AFQB 2BZAA 4UE7H 1IHTH 1ZTJA 3IWMA 4YTAA 5DPAA 1YPHC 1EJMA 3A86A 3MWIU 4GCHG 4J1YA 1YPMH 1CU1A 1Y5UT 3BEIB 2IJOB 3BTFE 1O2JA 2PW8H 1Z8JB 2OBOA 2NU2E 2O9QA 1C5SA 1GBJA 1NFXA 1NZQH 2AGIX 4IW4E 5FCKA 5TCCA 2ZTXA 2BM2A 5L30H 1INCA 1GDQA 3Q77A 1O3MA 1TALA 1XMNB 2F9NA 1QBVH 1C5OH 4NIVA 4ZHAA 2CF8H 1GVKB 2AMQA 1S82A 2WINI 1SC8U 4NGAH 1F0SA 1BTPA 1ELBA 1FAXA 3VB3A 3S69A 3SV8A 2BX4A 2ZHWH 2QY0B 4OGYA 4I8HA 5DP7A 2Z94A 1KXFA 5L2YH 2BD2A 3D23A 1CA0B 3A7TA 4NA8A 4K60A 1W14U 1RJXB 1ZMJA 1P9SA 1QA7A 2GDDA 4X1NU 2VIDA 2W3KA 4JYVH 2GGVB 3M7QA 3TJOA 3RP2A 1K1PA 3BN9A 1O3DA 1PQ7A 1UK4A 4D7FA 4X1RU 2AS9A 3D65E 2R2MB 2B9LA 3OSYA 2A45B 3KNXA 2CHAB 1ZRKA 3SV6A 1KXCA 3ZZ5A 3PO1B 1FXYA 4Z6AH 1Z6EA 4KP0A 1VR1H 1DITH 3GCNA 4X1QU 1GI5A 1IQMA 1PPHE 2JETC 1YPLH 3FP6E 2ZTZA 1WV7H 1W7XH 4I31A 4JCNA 2A5KA 1HJAC 2R3YA 1MBQA 1UHBA 1DPOA 2V3OH 5DP4A 3BIVH 3ODFA 3SU6A 3RXLA 1KLTA 1E0FD 2F9OA 1A5IA 2F9BH 2ZECA 1FI8A 1Z8IB 1P03A 4YO9A 3RLWH 3HGNA 3LPRA 2OC7A 2P95A 2ZO3H 1MKWH 4H6SB 4WXIA 1C2LA 1MTVA 3LGUA 3BTWE 2AIQA 5C5OA 1O5EH 9LPRA 1TNJA 3GDUA 3BTME 4YT7H 4NFEA 1A7SA 3LGYA 3SBKA 1D3TB 2I6SA 1KXBA 1O5BB 1QJ1B 1GHBG 1BMLA 1GI4A 3NCLA 1FY1A 1EOJA 5K7RA 1TRMA 1QB1A 1O3CA 5J4QA 1RIWC 2QA9E 4NG9H 1S85A 4PROA 5CE1A 2BMGB 2FOFA 4A1VA 3V7TA 1A3BH 2JETB 3TJNA 6CHAB 2BQWB 4FU8A 1GBTA 2Z3DA 2WPLS 5FX5A 1V2VT 5F8TA 1YPHE 1C1TA 1J8AA 2BY8X 3ZVAA 2VWMA 4XBCA 2ZKSA 4AX9H 1ABJH 2PGBB 3S9CA 1DDJA 3S7KB 3LU9B 3F9EA 5EXLA 2BD3A 2BDCA 1EPTC 1YPJH 4Z0KA 1KDQA 4O03A 2F9VA 1CHOF 5C5NA 2FYQA 2WYGA 5AHGH 4DIHH 1NRPH 3QZQA 1ZRBA 2Q6FA 1GL1A 1TPAE 4CRGA 4HFPB 3VGCC 1JOUB 1C4Y2 3HPTB 4OS6A 3Q76A 1FN6A 1GI7B 4B1TA 2BLQA 1B5GH 3M36A 1GI9B 1TBQH 3MU4A 2C8ZB 3GCTF 3U1IB 2BVSH 3OY5U 3SJ8A 4YOIA 1P12E 1YM0A 1LVOA 2UUYA 3NPSA 4OS2A 2H9HA 2J2UA 3KGPA 2TGAA 3U8TH 2ZU3A 1SLWB 1NO9H 2IN2A 3SUFA 2C8YB 2PKSC 1IQFA 3NZIA 2ZF0H 2BYAX 3Q3YA 2ZZUH 1DXPA 3OX7U 1ELVA 1UTJA 3BTGE 3SUGA 1GGDB 4X2YA 3RMNH 2H9EH 4X2VA 4WMDA 4GLYA 4H6TA 4MNWA 2EA3A 4RN6A 3QK1A 3A7VA 5F6MA 3A82A 4MPVA 1Z8RA 1ELCA 1PQAA 5A0CA 3PMHB 5ESBA 2OCVB 4XSKU 5T3HA 4X0WU 5GCHF 4AOQA 3SGAE 3SJOA 4B71A 2H5DA 1NM6A 1GI0A 1E35B 2C90B 4FUJA 4HGCA 4UFFH 1DSUA 3LH1A 2OC0A 3LKWA 3ZV9A 4UONA 1P2NA 1O2PA 4Y7BA 3RXOA 1G3EA 4K1SA 2BD9A 5A8YA 2AYWA 5E0HA 3SU2A 2BY6X 1O3LA 2VU8E 1THSH 2Z7FE 3OU0A 1ETSH 1GL0E 2ZGJA 5HM2A 3RMMH 1FZZA 3ZZCA 5IYTA 1DY9A 3BTDE 1ZGIA 2FLBH 4NIYA 3SI3H 3GCTG 3V3MA 1YP9A 1SQOA 1BTXA 4A1XA 3C1KA 1LVYA 3E0NB 4FUHA 1P0SH 4LOYH 4AG2A 3HK3B 1HV7A 2Z9LA 1FPHH 2BVXH 5LPFA 3L33A 4AB9A 2ANWA 4NWLA 3A8BA 4CRFA 1SOTA 1QFKH 1C5TA 5EW1H 1GVLA 3V0XA 1VCQA 2NWNA 1ZSLA 7LPRA 2QF3A 4FU9A 3DT0H 2PHBA 5GIBA 4A7IB 3F1SB 2F91A 2DE8A 5IDKA 5L2ZH 2GDEH 2O8MA 2WPIS 1MKWK 1ACBE 1O2UA 2FTMA 1G2MA 3RXKA 2HALA 3AAUA 1BRCE 2A7CA 1VZQH 2IPHA 1Y3WA 4JK5A 1ID5H 1XXFA 3G01A 2FYRA 2ZEBA 2ALPA 4UDWH 5JB8S 2HRVA 4FU7A 4ABEA 4AFZA 1IAUA 1GDNA 1GG6B 1UVPA 4LZ1H 1GHAG 3UNSA 1DM4B 1SGNE 4WF8A 5I46H 1Z1IA 3QUMP 3UQVA 3ATIA 1GJAB 1NROH 3ELAH 4NWKA 7GCHF 6GCHG 2XC4A 1OWKA 1A5HA 3EA8A 1TQ0B 3M7UA 1O3NA 2GCTC 1EAXA 1LDTT 3QN7A 1BUIA 5A0AE 5GXPA 3E1XB 1QIXB 1G32B 3FANA 2GD4B 1D6WA 4GHQA 3ATWA 2VNTA 8GCHF 3D49H 5GPIB 4BTIB 3M5NA 1UCYH 1GI6A 1HAVA 1OOKB 1K1MA 1THPB 3RXTA 1NS3A 1HAGE 2VIWA 2XBVA 1EZSC 1NFYA 1WQVH 5A09A 3FP7E 1BBRE 1EUFA 4NZQA 3TK5A 5GDSH 1BITA 1Z7KA 3TK6A 1LQEA 1DUEA 3ODDA 5CHAC 3TIUA 4CHAB 3MTYA 4WXVA 1DLKB 1PQ8A 1C5VA 2ANMH 1C1MA 3URCA 4MDSA 4Y8XA 1O39A 1AN1E 2ZTYA 3S9AA 1QL8A 2ZP0H 2BXUH 1GCTC 2G51A 1WOFA 4Y0ZE 1PPBH 4CRAA 3TJUA 2PKAB 4UD9H 2Y5FA 1PPCE 3FP8E 2FI3E 1DT2A 4SGBE 4X2WA 1T8MA 2BY7X 2W7SA 1IQEA 1DWEH 5EOKA 2ZQ2A 4IMQA 2CJIA 4FUIA 1HAHH 2UWPA 2OXSA 3TGKE 5GJ4B 1BQYA 1AO5A 1YCPK 2GZ7A 1P02A 4M7GA 1ZR0A 4JZIA 1VGCC 1Y3VA 3DHKH 2C3SA 1Y3UA 2GZ9A 1ZTKA 2UWLA 1OWEA 1TWXB 2H5CA 2BTCE 2KAIB 2XW9A 1O5GH 2PUXB 4ABJA 2PTNA 3LGTA 3FFGA 2V0BA 4AGJA 3K65B 1TLDA 1V2NT 4BAHB 4JZEH 1SPJA 5ESTE 1SGFA 2A4QA 1FJSA 3SQEE 1DFPA 4INLA 3EGKH 1BJUA 4YZUA 1ELGA 1YKTA 4OS5A 1ORFA 4ZXYH 3ZZBA 3BTTE 4JZ1A 1A46H 3AW1A 1P57B 1OP0A 4ISLA 2VVCA 1P2KA 2EC9H 1SMFE 2EEKA 3JZ2B 1WYKA 2CF9H 3M3VA 1HAZB 3MH7A 4B2CA 3PLBA 2RDLA 3M5OA 4D7GA 2H1UA 1QY6A 4TY6A 3E6PH 1V2RT 1XM1A 3M7TA 4WJG2 1V2QT 3P8GA 3M3TA 1CT2E 1LCYA 1J16A 1O5DH 1TPOA 4IBLH 4XBDA 4ZHMU 1HBTH 2QXIA 4A1TA 4NIXA 1HJ9A 4KELA 2VIPA 5C3NA 1O2OA 3TGIE 1DX5M 5LGOA 4D9QA 1PQ5A 3MH4A 3A84A 2A2QH 2FOMB 2BDGA 2XBYA 1IQJA 1BRAA 5TJXA 2OLGA 1HXEH 1SVPA 2TIOA 4B75A 2YOLA 1ELTA 3F9FA 2F9UA 1P2JA 1OYTH 1KXEA 1G3DA 5FHTA 1MAYA 4NA7A 4YT6H 2FOCA 4CH2B 5E0GA 4WMEA 2FEQH 1K1IA 1FDPA 4TPIZ 1G2LA 4AFSA 1F7ZA 2ZGCA 1XVOA 4CHAC 4THNH 2J34A 1UK2A 2FLRH 1GBHA 2Y81A 4BAQB 5C20A 1ELEE 3P92A 1OWJA 1DVAH 1TOCB 1D3DB 3L3TA 2G00A 3TH2H 3A7YA 1HNEE 2FXRA 1SQTA 3ZVFA 1ABIH 2HVXA 2ZHDA 4U2WA 3LONA 1E38B 2F3CE 1ANCA 1BIOA 3PMBB 2A31A 3VB7A 3U69H 1QHRB 3RXMA 3O8RA 2A2XH 4Y10E 1FLEE 2W5EA 2ZC9H 1HLTH 5EPYA 5JB9S 1CT0E 1GCDA 1O2LA 2EI7A 1MZDA 3RDZA 1A61H 1AZZA 2ZGHA 1F5KU 1HGTH 2VIVA 4K5ZA 1GWAA 2Z9KA 2ZU5A 2O8UA 5DKMA 1VJ9U 3TGJE 4KTCA 1LVMA 5EW2H 4HI3A 1YBWA 1BTUA 1ZSJA 1SFIA 1C2HA 4K69A 3P17H 2GT8A 2WUCA 2AERH 2D8WA 2UUJB 1Z8GA 2W7UA 4SGAE 2O8LA 1BRBE 2NU0E 3ZZ9A 1OWHA 1O38A 3T28A 2Z3CA 2BD5A 3NK8A 4ZXXH 1IQIA 1BT7A 2A32A 1LHEH 2A7JA 1EP5A 4BNRA 1O3EA 2SGQE 1TNGA 1SHHB 4CRBA 1TBZH 3FZZA 3TNSA 2V3HH 3R3GB 2HNTF 1RTLA 2G5VA 5HYOA 1S83A 1T8LA 1AE5A 1RFNA 1Y5AT 1AIXH 1GCTB 1O2WA 3Q3KA 3GY2A 1AZ8A 4JZFH 2PKAA 1O2VA 3DFJA 1C1VH 4K8BA 3NUMA 4XE4A 5DGJA 4WH8A 1NY22 1O2KA 1GJ4H 1UHBB 2VVVA 1ANDA 3EA7A 1O3GA 4F49A 2BQ6B 1IQHA 4NCYA 2NU3E 1Q3XA 3BIUH 1PJPA 4UFGH 1KDQB 1NN6A 1TPPA 3KN2A 1TNIA 1AVGH 2G5NA 1AMHA 3OTJE 1O5FH 1AE8H 3KQEA 1C1NA 5G4BA 1ANBA 4CH8B 3Q00A 4X6MA 1H1BA 1EZQA 4D8NA 4X1PU 1GHZA 4IS5A 2BLVA 3LT3A 5C67A 3R0FA 4D76A 1ZZZA 3VB5A 3P8FA 3V12A 1O2YA 1CSOE 3LGWA 1TNKA 2ZU1A 4OS7A 5EGMA 1O0DH 2P8OB 5JBCS 2BOHB 1GJ8B 1D6RA 2Z9GA 2HGTH 5DP6A 3SGBE 2VWNA 3RXBA 1P2IA 1PPEE 1TQ7B 1EP6A 1VJAU 2LPRA 4WMFA 1MU6B 3KQCA 3PV4A 3RM2H 3H5CB 2Y82A 3GYLB 2PUQH 3P6ZB 3MNCA 3QTOH 1P01A 2P3UB 1V3XA 3PYHA 1EPTB 1EAWA 1CGHA 1HB0B 1MBMA 2J9NA 5CMXH 3QLPH 5DP8A 1C2EA 3ZZ3A 4OS4A 3RXQA 5LPEA 1O2QA 2D26C 4Y0YE 3MO3A 2OC1A 1AHTH 3BSQA 1SBWA 1FAKH 1QBNA 2BVRH 3GYMA 4DG4A 2Y5HA 3W94A 3LC5A 1F5RA 2Z6BD 1XXDA 2TGTA 1ESTA 4JZDH 5EODA 1C5QA 2P94A 2XC5A 3ZZ7A 1VITG 4AGKA 1YYY1 3ZZDA 2K7XA 1MUEB 1P11E 1YPKH 4MG3A 1ARCA 1C4U2 3TPIZ 4DCDA 1JIRA 2R0LA 1CBWC 5FBEA 3MI4A 2Q6DA 1X7AC 1BOQA 1HJ8A 1OXGA 2PWXA 1J17T 2GMTC 1CHGA 1GPZA 3LIWA 4FUEA 5HMAA 1K1JA 5FXLA 5ETXA 4MPXA 1A0JA 4YLUA 3TLOA 3O8BA 5EPNA 2PFEA 3RXJA 3S7HB 1VITF 1O3KA 3H7OA 4Y79A 4GSOA 2TRMA 8ESTE 1CQQA 3U1JB 2BDIA 1GMHF 1GMHG 2STBE 1HAVB 3K6YA 3EQ0H 2B5TB 4ISIH 2ZNKH 3EE0B 2DUCA 1V2WT 4U01A 4BAMB 4DY7B 1FPCH 1EPTA 1C5LH 2FWWA 4X8VH 3QGJA 4K3JA 3MNXA 1C5PA 2ULLA 3T5FH 3PMJA 1XUKA 4B76A 3A7ZA 2GZ8A 5E8EH 3GY8A 4ABBA 5HM9A 2VVUA 5ABWA 5C2ZA 3U98H 4RKOB 1O2SA 5JBAS 3LJOA 3VXEH 3LDXH 2FX4A 1JBUH 3K9XB 2XRCA 4Y76A 7GCHG 2FOEA 4DW2U 1GJBB 2FI4E 1FIWA 2JKHA 2XXLA 3I78A 2ODPA 5H4IB 5A8ZA 1W0ZU 2BD8A 1H8DH 2ZWLH 1JRSA 5EXMA 2EI8A 3VB4A 4A92A 1FUJA 2XTTB 1RTFB 4XBBA 3W95A 2HWLB 1SG8B 1T8OA 1GBDA 3SZNA 2ZHQH 2P8OC 4Q7ZA 2G4TA 4ZHLU 2GVFA 2SGFE 1ZYOA 4Y6DA 2FMJA 2OQ5A 1TGSZ 2OC8A 4BAOB 2J94A 5FX6A 4QT8C 2VWOA 1O3PB 3NWUA 2ZU2A 2IOTA 3DD2H 1ARBA 1A5GH 1V2UT 1YGCH 4LK4A 3SQHE 2XNIA 5DP9A 3D62A 2ANKH 1CA8B 1P8VC 1S6HA 5FBIA 4O9VA 4ABAA 3PO1C 4ESTE 1RS0A 1YLDA 1DUAA 1T32A 2BX3A 1ZLRA 3DA9B 3GY7A 1SGYE 2AIPA 4FUBA 1TB6H 1Y5BT 2ZHEH 2ZCKP 1ZGVA 3DFLA 2CGAA 2SGDE 5A2MH 1T8NA 3GCHB 1MU8B 1F92A 2FOGA 3E8LA 1C9PA 1ELFA 3CS0A 4WWYA 1DWBH 2ZCLP 1O2ZA 3T27A 2ZCHP 2GV7A 1HPGA 2BHGA 1XUJA 5F8ZA 4AG1A 1B7XB 2C4FH 4GCHF 5C1XA 4K8YA 1C1WH 1TGBA 3SUEA 1LHFH 2FZZA 1V2JT 3VPKA 2A5IA 1F0TA 3KEEA 1HFDA 2UUKB 5A0BA 5C1YA 3A83A 1ZPBA 2ODQA 2TGPZ 2ZFRH 1SQAA 1OPHB 3A81A 3SW2B 1W8BH 3N7OA 5DJ7A 1C1UH 2VINA 3HK6B 1QURH 3RXGA 2QF0A 3EYDA 4WH6A 5E2PA 2VJ1A 1GBCA 2G8TA 1TGNA 3VFEA 3BTEE 1XX9A 4K2YA 1LKAA 3T26A 1VCPA 1GGDC 6ESTA 3TU7H 5SGAE 1UO6A 2Z9IA 1EB1H 1TRNA 4Q7XA 3F9GA 5B6OA 2XBWA 1XUIA 2WPMS 1XUFA 2PTCE 3SU4A 4FXGH 2QCYA 2W3IA 3LGIA 1WAYB 1ZOMA 1CVWH 1P2MA 2AMDA 4YESB 3O8DA 4Y7AA 1WBGB 2AMPA 1P9UA 2FS9A 1ZTLA 3AW0A 1O3IA 3BG4B 1L1JA 4HZHA 2XCNA 4ZKNU 2OP9A 1HAYB 1LO6A 2ZFQH 1YPEH 4MPUA 3M3SA 1YLCA 1FIZA 3MU5A 1NU7B 1HUTH 1O36A 1EZXC 1SI5H 1YPGH 3KQDA 1L0ZA 4U32A 2FPZA 2Y7XA 2BD7A 1A0LA 2J38A 5F03A 3SUDA 2DE9A 1Z6JH 1N6XA 3TH3H 5AF9H 2XYAA 2QC2A 4RSPA 4I8KA 1K1NA 4TWWA 1RTKA 3SU1A 4AORA 1XVMA 2JH0D 3UTUH 2STAE 1OP8A 1TYNA 1HIAB 1QCPA 4Q7YA 1DANH 2SGEE 3UR6A 3NKKA 3ZZ8A 3RUOA 3E0PB 3LC3A 2BY9X 4H42U 2CN0H 3SU3A 3LOXA 1ZPCA 4ZROA 1MTNC 1D9IA 3SJ9A 3RC6A 4ZUHA 1G36A 1O3BA 3HATH 2R3UA 5JBBS 1JMOH 2BOKA 1TBRH 1G37A 4LXBH 1IQKA 4OS1A 2CMYA 3V13A 1BMAA 1GHXH 3HKIB 1C1OA 4MLFB 2QN5T 4DOQA
chains in the Genus database with same CATH superfamily
3E90B 1O2NA 5GCHG 4OGXA 2ZPQA 4ZKOU 1EZUC 2Q1JA 1K9OE 1BHXF 1BRUP 4NSYA 3T62A 1GG6C 1C2DA 4E7RG 3DSOA 1SL3A 1XUGA 2PGQB 1TIOA 4X6NA 4B74A 1G30B 3O8CA 1B0FA 2H2ZA 1V2LT 1TPSA 4IMZA 1O2IA 2GCHF 1AFQC 2OUAA 3RMLH 1GHBF 4ISNA 4GUXA 1YCPM 2XCFA 5EQRA 5CHBA 5T1VA 1K2I1 2V35A 1O2MA 4AFQA 1UTNA 1T7CA 4GAWA 3SOSA 3ZVGA 1CO7E 1KXDA 1P2QA 2VB0A 2ZFTA 1P05A 6GCHF 2ODYB 1HDTH 2VBCA 3H09A 2AFQB 3TK9A 5T6GA 2HPPH 1V2MT 3TNTA 1BMNH 1AVWA 1A2CH 2XC0A 2VH0A 1HAIH 1Y8TA 3K2UA 3BTKE 3A8AA 3SHCH 4X6PA 1LHDH 5K0HA 1LKBA 1H4WA 3F68H 1SQRA 1WTHD 2UWOA 2HNTE 2Z9JA 3MU1A 2P59A 1N1LA 2J4IA 4X1SU 3U8RH 3NXPA 1UTKA 2ZFFH 1S0QA 3URDA 3AASA 5BRRE 1ANEA 4KGAA 1DWDH 3GISB 1SGRE 4U30A 1H9LB 2VGCC 1ZHRA 3A7WA 4R0IA 1BBRH 3OYPA 2FESH 1L1GA 2ZDMA 3B8JA 1C5MD 1NRSH 1C9TA 1C2FA 2THFB 3BG4C 2TBSA 3ATKA 3K6ZA 2XWAA 1LMWB 1KTTB 3FZDA 1FY8E 1UCYE 2SNVA 2Y7ZA 4AN7A 2AGGX 2LIZA 1K1LA 2FOHA 2BQ7B 1LPKB 4DIIH 1ESAA 2A5AA 2ZHFH 2BZ6H 1TX7A 1J15A 4O97A 1C5ZB 1GBFA 1C5XB 3UAIC 2ALVA 1O3AA 3A8CA 2LNCA 3LGVA 4AFUA 4GPGA 1EATA 1HJAB 1PPFE 3MNSA 1CT4E 2GP9B 1GHWH 4I8GA 1UW7A 8LPRA 1V6DA 1Y3YA 1L2EA 5FPSA 1KLIH 1TFXA 3UIRA 2FTLE 5FPTA 1OS8A 3RC4A 2RA3A 1MZAA 1AGJA 1AFEH 4FVBA 2HNTC 2A0QB 2R9PA 1O32A 4VGCB 3TVJB 1FV9A 3QO6A 1COWD 1S81A 2QGRA 4ISHH 1QA0A 3GY5A 1TONA 3OTPA 1TA6A 4TWYA 1ZMLA 1Z71A 1L4ZA 3VXFH 2P3FH 1N6YA 1RGQA 1UTLM 4BTTB 1RRKA 3ITIA 4H4FA 1FX0B 2A4OA 3MO6A 3UNQA 4BAKB 3NRLA 1SGPE 1F5LA 3ZYEA 1F0RA 1Q2WA 1L1NA 1W11U 1GJ6A 2FOBA 1SGFG 2HPQH 3F3BA 2WSSD 3RXIA 1P06A 1EXFA 2Y6TA 2Q6GA 1W0YH 3GY3A 4CBNA 1TAWA 2P16A 1QL7A 3GCHC 3BF6H 1TMTH 3S9BA 1AB9B 3SHAH 1BBRK 4O3UA 1UK3A 3SN8A 1UTQA 3SGQE 5HXFA 1L4DA 3UFAA 2PLXA 4F48B 1DLEA 2HLCA 2QXHA 1DXWA 3FAOA 1XUHA 1ZJKA 2VWLA 4JMYA 3W1EA 2W26A 4I8JA 5LPRA 4M9FA 3HKJB 3ZIAD 4INKA 3SV2H 2H6MA 1AU8A 1QRZA 2V6NA 3PM3A 1AD8H 2KFWA 4HTCH 2PV9B 4IN1A 5DN6D 3SYJA 2L6OA 1ESBA 4E06H 1NPMA 3SV9A 3RXFA 1C1PA 2ZGXH 3SNCA 1LQDB 2XOKD 4MNXA 1BDAA 1GJ9B 1EAIA 2QXJA 1C5WB 3QX5H 4F55A 1HAOH 2CV3A 3AAVA 5PTPA 4UFDH 2ZDKA 1GJ7B 2J98B 1LPGB 4NFFA 1XKBC 3RXUA 2FP7B 2ZDVH 3F9HA 1O2GH 3RXAA 1THRH 4X8SH 2OINA 4BANB 1M9UA 3VGCB 5JYIA 1WSSH 1C2KA 1SR5C 3KHVA 3UOPA 3SNEA 1UCYK 1GVZA 1G3BA 1YWUA 1GMCG 1BMFD 2OTVA 3ZVDA 4AYYB 1SGDE 2OQUA 1N8OB 1D4PB 2SGPE 3ENSB 4NA9H 2GMTB 1AQ7A 3OY6U 3IITA 2FO9A 3Q3XA 3AVZA 1O5CB 3DUXH 4RT1A 5A8XA 4YM9A 3ATMA 1IHSH 1JRTA 5KEDA 3EBNA 2BLWA 1A0HB 1C1QA 3MMGA 4AZ2B 1VITH 4AYVB 5F8XA 1FY4A 1AKSB 3VB6A 2O8WA 1LTOA 5DG6A 1DY8A 4BXWA 3CP7A 3MH6A 2QYIA 1WQSA 1O2RA 1GJCB 3L6PA 4CRDA 1KIGH 1GI3A 2GT7A 4DT7B 3RXRA 2Z3EA 9ESTA 3STIA 3VEQB 1QNJA 2WUBA 3A85A 3TH4H 1KSNA 1QGFA 4BTUB 4I86A 2GCHG 1C5YB 3GY6A 1MQ5A 3RXVA 1LVBA 2ZDLA 3T29A 1YCPH 4UEHH 3SU0A 5TCAA 1C1RA 2QIQA 1JWTA 1QL9A 1W10U 5E0JA 1UTMA 3BTHE 2BDHA 4GVUA 1ZSKA 4RI0A 2LELA 4DT4A 3RU4D 3M61U 2RDEA 4P02A 1FY5A 1KTSB 1OYQA 2ZPSA 1C1SA 1OP2A 3EA9A 2QXGA 1NC6A 3CENA 1AB9C 1RXPA 3OE7D 1QRWA 1GBAA 3M5MA 4INHA 1O34A 2PSYA 2TGDA 1FONA 1TA2A 2P93A 4Q2KA 2M5TA 1NTPA 1S0RA 3RXHA 3TITA 3MO9A 3RXCA 1MH0A 4XDEA 1HCGA 3PWCA 3PLPA 5T6DA 1GHVH 1LPZB 2NU4E 2XBXA 1SGTA 1O35A 2ZU4A 2A1DB 3KL6A 2J92A 1J14A 4XFQA 2WPKS 3SJIA 1OX1A 1BMMH 3KQ5A 1SLVB 1GMDG 1ELAA 2RG3A 2AEIH 3KF2A 1MQ6A 5C1UA 3MU8A 1FNIA 1TX8A 1H9HE 4DJZB 1AI8H 1O2HA 2BB4A 1WCZA 1G3CA 1TE0A 2BLOA 2F83A 4ZMAH 4E05H 4NIWA 3M37A 3T2NA 1FQ3A 2VGCB 1MMJN 3GY4A 4KTSA 2VIOA 3ESTA 4NSVA 3P95A 2FS8A 2KZ4A 1SOZA 1NRNH 2CHAC 2XWBI 3ATLA 2BDYA 1E79D 1VGCB 3I29A 2TPIZ 1QR3E 4JK6A 2ZFPH 5HKKD 1S84A 4ISOA 4I8LA 3FKSD 4ZKSU 3KYFA 1GHYH 1DWCH 2WV5A 3UR9A 1V2ST 1LHCH 1ZPZA 3OEED 1EKBB 1DOJA 2QV1A 4XOJA 3RU4E 1UTPA 1EJNA 3WY8A 4CRCA 1YC0A 2FDAA 2BXTH 1F0UA 1MD8A 2YNBA 4FUGA 5GNDA 4HG6A 3BEFB 1WTGH 1BTHH 1VCWA 3MU0A 3UNRA 1O33A 5DP5A 1BB0B 1TNLA 3RM0H 2PR3A 3HGPA 1OKXA 2ZDNA 4IC6A 1GBEA 1NU9A 2D1JA 1UJ1A 1HIAA 5LH8A 1CE5A 4MTBA 8KME2 4ZKRU 1UMAH 2SGAA 5I25A 1O3HA 2BDAA 1QQ4A 2FOAA 6LPRA 2ZG0H 1GJDB 2O8TA 4ACBA 4B2AA 3T25A 2K8IA 1S5SA 1GDUA 4A6LA 3RMOH 2OBQA 2BY5X 2ANYA 1AWFH 7KMEH 1Y59T 3U8OH 1TX6A 1NRRH 1MTSA 1YY3A 1E1RD 1QQUA 2VIQA 3RXSA 3P70B 6CHAC 3EDXB 2PKSB 2FODA 8GCHG 3UQOA 1TRYA 1HAPH 1BA8B 3ZVCA 3SNAA 4ABFA 1NRQH 1TABE 1AUJA 1OSSA 1E37B 3A7XA 4AB8A 3A8DA 1GBKA 1RIWB 4WY3A 1GJ5H 3P8NA 5EG4A 4MPWA 1EJAA 1P2OA 1C2JA 2Y5GA 1P3CA 2G4UA 3MYWA 1Z1JA 2JH5D 4YLQH 3S0NA 1H9IE 1EX3A 3SU5A 3M5LA 4O3TA 2AGEX 1T31A 2K0QA 4BOHA 2ZIQH 3UOUA 4F4OC 3SV7A 2F9PA 2JH6D 1TNHA 4KKDA 4D9RA 1SGQE 2J95A 1YF4A 3GDVA 2GTBA 1BZXE 3MHWU 3RXDA 5L6NH 1P10A 5JDUB 5FAHA 5DK1A 2YNAA 1B0EA 4ASUD 3AK5A 5HIYA 3A88A 1G9IE 1C2IA 1TOMH 2EY4C 3F2HA 5DO4H 2WZQA 1D3PB 4X8TH 2J98A 2ZFSA 1K28D 1O30A 1DS2E 1A4WH 3UWIA 1IOEA 2K1QA 3GICB 4TT3D 1NESE 1SLUB 5FCRA 1AUTC 1V2PT 4MVNA 1C2GA 1EASA 1T4VH 3PTBA 4Y8YA 3SI4H 3SJKA 2W6ID 1FN8A 3M35A 3MH5A 1PPGE 1AWHB 1O5AB 4ZAEA 1MTWA 3MFJA 1C5UA 3UY9A 1LHGH 2G81E 2ZA5A 1Q31A 1O31A 4KTUA 4NZLA 1CGIE 1SHYA 2B0FA 1K21H 1V2KT 2HOBA 1IQLA 2P3TB 1CHOG 3B23B 3RXPA 5E2OA 3GDSA 3MOCA 3RU4T 1AKSA 2J97A 1SGCA 1T4UH 2ZI2H 1ZHMA 3B9FH 2NU1E 2FI5E 4ABGA 3FO8D 1NT1A 1UVOA 1SLXB 1QBOA 4MNVA 1GMCF 1KY9A 1Y3XA 1ETTH 4RT0A 1MD7A 1O3FA 4BXSA 2WPJS 1DSTA 3A80A 2C8WB 5JBTA 3CS7A 2AH4X 1C2MA 3STJA 3ZZ4A 1P09A 2FX6A 4IGDA 1W3CA 2I6QA 2QAAA 1GMDF 4DURA 3ZVEA 1C5NH 3LH3A 1P3EA 3PROA 1P04A 1PYTD 2A4GA 4TY7A 3F0OA 2ZQ1A 3BG8A 1EAUA 3ZVBA 5DP3A 2H9TH 4FUCA 4B2BA 4MQAA 3PMAB 1ZJDA 1QB9A 2ASUB 1O37A 1NFWA 3C27B 3PB1E 3GCOA 2GX4A 1EOLA 5EIYA 3SO3A 3FVFB 3BEUA 5EQSA 4I7YH 1TMBH 4VGCC 1K1OA 1UVSH 3QDZB 1W12U 3H7TA 1PPZA 1FMGA 2IPQX 4ACAA 1HYLA 1N8OC 3UPEA 3ZYDA 4K1EA 1MKXK 1DE7H 1OWIA 3A87A 1WUNH 4FVDA 2ESTE 1UVTH 3WWBA 2G55A 2GJGA 4Q63A 1H8IH 3RXEA 2R0KA 4IC5A 1J9CH 1EB2A 4X8UH 4TYDA 4DGJA 1BJVA 1PFXC 2FM2A 1UTOA 4ABIA 1GBMA 2ZGBH 1IQNA 4X2XA 4IN2A 1IQGA 1BCUH 1QJ7B 1TGCA 3U9AH 1HAXB 4WVPE 1CBWB 3QWCH 5AFYH 1GI8B 5GWZA 1O3OA 1ZHPA 3ZZ6A 1F2SE 2G52A 2ILNA 1CGJE 1W2KH 3KQBA 1HRTH 5FPYA 1RD3B 1WU1A 1MTUA 4LZ4B 1BTYA 3JZ1B 3BV9B 5EQQA 1O3JA 3E91A 5JPMH 3PLKA 4ASHA 1HXFH 1SGEE 1JXPA 3F2GA 4Y8ZA 1C5RA 4TPYA 3QGNB 3QZRA 2ZDAH 3PTNA 1W7GH 4I32A 2R2WU 1GBBA 3RC5A 3PWBA 1K22H 4ABHA 4Y11E 2UUFB 1DICA 5J4SA 5T6FA 2Y80A 4R8TB 4A5TS 1OWDA 3UWJH 5B6LA 4UFEH 2B7DH 1V2OT 2B8OH 5EXNA 1QB6A 4JYUH 4B73A 3RLYH 1ETRH 2PSXA 1QJ6B 4RKJB 1AVXA 2YMSB 3ZV8A 1BTWA 1QTFA 1ZMNA 4K1TA 2RCEA 3ZZAA 3EE7A 3KIDU 4FUFA 2A7HA 1CA0C 3IG6B 5HGGA 5AFZH 1UVUH 1C4V2 1JIMA 4FUDA 3QTVH 4GHTA 4J2YB 4CR5A 2C8XB 2EI6A 4CREA 1MKXH 3SNBA 2CXVA 2WV4A 4CR9A 5EJZA 5AVDA 1PYTC 4CBOA 1V2TT 1E36B 2ZPRA 2WPHS 2GCTB 4Y71A 1MCVA 1A1RA 4E7NA 1GI2A 2OD3B 5CHAB 1SSXA 3UUZA 4ABDA 1SFQB 3GOVB 3UREA 1AY6H 3E16B 3I77A 2C93B 1KYNA 2SFAA 7ESTE 1GBLA 1KXAA 1QRXA 3EAJA 1KLJH 2BDBA 4X6OA 1BTZA 2KAIA 4YOJA 1ELDE 4MNYA 3SNDA 3SORA 3P8OA 2VH6A 1S6FA 1MCTA 5EU8A 1BHXB 1GHAF 1FY3A 1SGIB 1E34B 1TGTA 2SNWA 4YOGA 3E3TA 5IK2D 1K0HA 1NFUA 1U6QA 3BTQE 4I33A 5BPEA 1EQ9A 1W13U 2GKVE 2RA0A 3KCGH 1O2XA 3F6UH 3MNBA 3LJJA 1TMUH 5C94A 1MAXA 1XKAC 1A3EH 1MTNB 1SB1H 2GV6A 1GBIA 2BD4A 3FOAA 4ZH8A 2WYJA 2D2DA 2FIRH 1D3QB 1GI1A 4DVAU 1O2TA 4Q80A 3TJVA 3A89A 2OK5A 2A4RA 4JYTA 1AFQB 2BZAA 4UE7H 1IHTH 1ZTJA 3IWMA 4YTAA 5DPAA 1WXRA 1YPHC 1EJMA 3A86A 3MWIU 4GCHG 4J1YA 1YPMH 1CU1A 1Y5UT 3BEIB 2IJOB 3BTFE 1O2JA 2PW8H 1Z8JB 2OBOA 2NU2E 2O9QA 1C5SA 1GBJA 1NFXA 1NZQH 2AGIX 4IW4E 5FCKA 5TCCA 2ZTXA 2BM2A 3MQKC 5L30H 1INCA 1GDQA 3Q77A 1O3MA 1TALA 1XMNB 2F9NA 1QBVH 1C5OH 4NIVA 4ZHAA 2CF8H 1GVKB 2AMQA 1S82A 2WINI 1SC8U 4NGAH 1F0SA 1BTPA 1ELBA 1FAXA 3VB3A 3S69A 3SV8A 2BX4A 2ZHWH 2QY0B 4OGYA 4I8HA 5DP7A 2Z94A 1KXFA 5L2YH 2BD2A 3D23A 1CA0B 3A7TA 4NA8A 4K60A 1W14U 1RJXB 1ZMJA 1P9SA 1QA7A 2GDDA 1H8HD 4X1NU 1W0JD 2VIDA 2W3KA 4JYVH 2GGVB 3M7QA 3TJOA 3RP2A 1K1PA 3BN9A 1O3DA 1PQ7A 1UK4A 4D7FA 4X1RU 2AS9A 3D65E 2R2MB 2B9LA 3OSYA 2A45B 3KNXA 2CHAB 1ZRKA 3SV6A 1KXCA 3ZZ5A 3PO1B 1FXYA 4Z6AH 1Z6EA 4KP0A 1VR1H 1DITH 3N99A 3GCNA 4X1QU 1GI5A 1IQMA 1PPHE 2JETC 1YPLH 3FP6E 2ZTZA 1WV7H 1W7XH 4I31A 4JCNA 2A5KA 1HJAC 2R3YA 1MBQA 1UHBA 1DPOA 2V3OH 5DP4A 3BIVH 3ODFA 3SU6A 3RXLA 2QF4A 1OHHD 1KLTA 1E0FD 2F9OA 1A5IA 2F9BH 2ZECA 1FI8A 1Z8IB 1P03A 4YO9A 3RLWH 3HGNA 3LPRA 2OC7A 2P95A 2ZO3H 1MKWH 4H6SB 4WXIA 2V7QD 1C2LA 1MTVA 3LGUA 3BTWE 2AIQA 5C5OA 1O5EH 9LPRA 2L74A 1TNJA 3GDUA 3BTME 4YT7H 4NFEA 1A7SA 3LGYA 3SBKA 1D3TB 2I6SA 1KXBA 1O5BB 1QJ1B 1GHBG 1KMHB 1BMLA 3PRBA 1GI4A 3NCLA 1FY1A 1EOJA 5K7RA 1TRMA 1QB1A 1O3CA 5J4QA 1RIWC 2QA9E 4NG9H 1S85A 4PROA 5CE1A 3WW7A 2BMGB 2FOFA 4A1VA 3V7TA 1A3BH 2JETB 3TJNA 6CHAB 2BQWB 4FU8A 1GBTA 2Z3DA 2WPLS 5FX5A 1V2VT 5F8TA 1YPHE 1C1TA 1J8AA 2BY8X 3ZVAA 2VWMA 5CDFE 4XBCA 2ZKSA 4AX9H 1ABJH 2PGBB 3S9CA 1DDJA 3S7KB 3LU9B 3F9EA 5EXLA 2BD3A 2BDCA 1EPTC 1YPJH 4Z0KA 1KDQA 4O03A 2F9VA 1CHOF 5C5NA 2JJ2D 2FYQA 2WYGA 5AHGH 4DIHH 1NRPH 3QZQA 1ZRBA 2Q6FA 2YMSD 1GL1A 1TPAE 4CRGA 4HFPB 3VGCC 1JOUB 1C4Y2 3HPTB 4OS6A 3Q76A 1FN6A 1GI7B 4B1TA 2BLQA 1B5GH 3M36A 1GI9B 2IJD1 1TBQH 3MU4A 2C8ZB 3GCTF 3U1IB 2BVSH 3OY5U 5DSFA 3SJ8A 4YOIA 1P12E 1YM0A 1LVOA 1H8ED 2UUYA 3NPSA 4OS2A 2H9HA 2J2UA 3KGPA 2TGAA 3U8TH 2ZU3A 1SLWB 1NO9H 2IN2A 3SUFA 2C8YB 2PKSC 1IQFA 3NZIA 1E1QD 2ZF0H 2BYAX 3Q3YA 2ZZUH 1DXPA 3OX7U 1ELVA 1UTJA 3BTGE 3SUGA 1GGDB 4X2YA 3RMNH 2H9EH 4X2VA 4WMDA 4GLYA 4H6TA 4MNWA 2EA3A 4RN6A 3QK1A 3A7VA 5F6MA 3A82A 4MPVA 1Z8RA 1ELCA 1PQAA 5A0CA 3PMHB 5EJLA 5ESBA 2OCVB 4XSKU 5T3HA 4X0WU 5GCHF 4AOQA 3SGAE 3SJOA 4B71A 2H5DA 1NM6A 1GI0A 1E35B 2C90B 4FUJA 4HGCA 4UFFH 1DSUA 3LH1A 2OC0A 3LKWA 3ZV9A 4UONA 1P2NA 5C17A 1O2PA 4Y7BA 3RXOA 1G3EA 4K1SA 2BD9A 5A8YA 2AYWA 5E0HA 3SU2A 2BY6X 2AHME 1O3LA 2VU8E 4XD7D 1THSH 1VKYA 2Z7FE 3OU0A 1ETSH 1GL0E 2ZGJA 5HM2A 3RMMH 2J5UA 1FZZA 3ZZCA 5IYTA 1DY9A 3BTDE 1ZGIA 3CNRA 2FLBH 4NIYA 3SI3H 3GCTG 3V3MA 1YP9A 4B6FA 1SQOA 1BTXA 4A1XA 3C1KA 1LVYA 3E0NB 4FUHA 1P0SH 4LOYH 4AG2A 3HK3B 1HV7A 2Z9LA 1FPHH 2BVXH 5LPFA 3L33A 4AB9A 2ANWA 4NWLA 3A8BA 4CRFA 1SOTA 1QFKH 1C5TA 5EW1H 1GVLA 3V0XA 1VCQA 2NWNA 1ZSLA 7LPRA 2QF3A 4FU9A 3DT0H 2PHBA 5GIBA 4A7IB 2WV9A 3F1SB 2F91A 2DE8A 5IDKA 5L2ZH 2GDEH 2O8MA 2WPIS 1MKWK 1ACBE 1O2UA 2FTMA 1G2MA 3RXKA 4ZCNA 2HALA 3AAUA 1BRCE 2A7CA 1VZQH 2KR7A 2IPHA 1Y3WA 4JK5A 1ID5H 1XXFA 3G01A 2FYRA 2ZEBA 2ALPA 4TSFD 4UDWH 5JB8S 2HRVA 4FU7A 4ABEA 4AFZA 1IAUA 1GDNA 1GG6B 1UVPA 4LZ1H 1GHAG 3UNSA 1DM4B 1SGNE 4WF8A 5I46H 1Z1IA 3QUMP 3UQVA 3ATIA 1GJAB 1NROH 3ELAH 4NWKA 7GCHF 6GCHG 2XC4A 1OWKA 1A5HA 3EA8A 1TQ0B 3M7UA 1O3NA 2GCTC 2QE7D 1EAXA 1LDTT 3QN7A 1BUIA 5A0AE 5GXPA 3E1XB 1QIXB 1G32B 2YMSC 3FANA 2GD4B 1D6WA 4GHQA 3ATWA 2VNTA 8GCHF 3D49H 5GPIB 4BTIB 3M5NA 1UCYH 1GI6A 1HAVA 1OOKB 1K1MA 1THPB 3RXTA 1NS3A 1HAGE 2VIWA 2XBVA 5HIZA 1EZSC 1NFYA 1WQVH 5A09A 3FP7E 1BBRE 1EUFA 4NZQA 3TK5A 5GDSH 1BITA 1Z7KA 3TK6A 1LQEA 1DUEA 3ODDA 5CHAC 3TIUA 4CHAB 3MTYA 4WXVA 3F0PA 1DLKB 1PQ8A 1C5VA 2ANMH 1C1MA 4P00A 3URCA 4MDSA 4Y8XA 1O39A 1AN1E 2ZTYA 3S9AA 1QL8A 2ZP0H 2BXUH 1GCTC 2G51A 1WOFA 4Y0ZE 1PPBH 4CRAA 3DSGA 3TJUA 2PKAB 4UD9H 2Y5FA 1PPCE 3FP8E 2FI3E 1DT2A 4SGBE 4X2WA 1T8MA 2BY7X 2W7SA 1IQEA 1DWEH 2KCOA 5EOKA 2ZQ2A 4IMQA 2CJIA 4FUIA 1HAHH 2UWPA 3N7DA 2OXSA 3TGKE 5GJ4B 1BQYA 1AO5A 1YCPK 2GZ7A 5KECA 1P02A 4M7GA 1ZR0A 4JZIA 1VGCC 1Y3VA 2F43B 2C3SA 3DHKH 1Y3UA 2GZ9A 1ZTKA 2UWLA 1OWEA 1TWXB 2H5CA 2BTCE 2KAIB 2XW9A 1O5GH 2PUXB 4ABJA 2PTNA 3LGTA 3FFGA 2V0BA 2QF5A 4AGJA 3K65B 1TLDA 1V2NT 4BAHB 4JZEH 1SPJA 5ESTE 1SGFA 3U28C 2A4QA 1FJSA 2JDID 1DFPA 4INLA 3EGKH 3SQEE 2JJ1D 1BJUA 4YZUA 1ELGA 1YKTA 4OS5A 1ORFA 4ZXYH 3ZZBA 3BTTE 4JZ1A 5EJ1A 1A46H 3AW1A 1P57B 1OP0A 2F4LA 4ISLA 2VVCA 1P2KA 2EC9H 1SMFE 2EEKA 3JZ2B 1WYKA 2CF9H 3M3VA 1HAZB 3MH7A 4B2CA 3PLBA 2RDLA 3M5OA 4D7GA 2H1UA 1QY6A 3F2FA 4TY6A 3E6PH 1V2RT 1XM1A 3M7TA 4WJG2 1V2QT 3P8GA 3M3TA 1CT2E 1LCYA 1J16A 1O5DH 1TPOA 4IBLH 4XBDA 4ZHMU 1HBTH 2QXIA 4OM9A 4A1TA 4NIXA 1HJ9A 4KELA 4Q4LA 2VIPA 5C3NA 1O2OA 3TGIE 1DX5M 5LGOA 4D9QA 1PQ5A 3MH4A 3A84A 2A2QH 2FOMB 2BDGA 2XBYA 1IQJA 1BRAA 5TJXA 2OLGA 3DCLA 1HXEH 1SVPA 2TIOA 4B75A 2YOLA 1ELTA 3F9FA 2F9UA 1P2JA 1OYTH 1KXEA 1G3DA 5FHTA 1MAYA 4NA7A 4YT6H 2FOCA 4CH2B 2KCYA 5E0GA 4WMEA 2FEQH 1K1IA 1FDPA 4TPIZ 1G2LA 4AFSA 1F7ZA 2ZGCA 2V3MA 1XVOA 4CHAC 4THNH 2J34A 1UK2A 2FLRH 1GBHA 2Y81A 4BAQB 3PV2A 5C20A 1ELEE 3P92A 1OWJA 1DVAH 1TOCB 1D3DB 3L3TA 2G00A 3TH2H 3A7YA 1HNEE 2FXRA 1SQTA 3GS9A 3ZVFA 1ABIH 2HVXA 2EQNA 2ZHDA 3FN8A 4U2WA 3LONA 1E38B 4FETA 2F3CE 1ANCA 1BIOA 3PMBB 2A31A 3VB7A 3U69H 1QHRB 3RXMA 3O8RA 2A2XH 4Y10E 2W6JD 1FLEE 2W5EA 2ZC9H 1HLTH 5EPYA 5JB9S 1CT0E 1GCDA 1O2LA 2EI7A 2KCPA 1MZDA 3RDZA 1A61H 1AZZA 2ZGHA 1F5KU 1HGTH 3PRDA 2VIVA 4K5ZA 1GWAA 2Z9KA 2ZU5A 2O8UA 2HLDD 2LP6A 5DKMA 3KYGA 1VJ9U 3TGJE 4KTCA 1LVMA 5EW2H 4HI3A 1YBWA 1BTUA 1ZSJA 1SFIA 1C2HA 4K69A 3P17H 2GT8A 2WUCA 2AERH 2D8WA 2UUJB 1Z8GA 2W7UA 4SGAE 2O8LA 1BRBE 2HVYB 2NU0E 3ZZ9A 1OWHA 1O38A 3T28A 2Z3CA 2BD5A 3NK8A 4AC9A 4ZXXH 1IQIA 1BT7A 1WDIA 2A32A 1LHEH 2A7JA 1EP5A 4BNRA 1O3EA 2SGQE 1TNGA 1SHHB 4CRBA 1TBZH 3FZZA 3TNSA 2V3HH 3R3GB 2HNTF 1RTLA 2G5VA 2XNDD 5HYOA 1S83A 3OEHD 1T8LA 1AE5A 1RFNA 1Y5AT 1AIXH 1GCTB 1O2WA 3Q3KA 3GY2A 1AZ8A 4JZFH 2PKAA 1O2VA 3DFJA 1C1VH 4K8BA 3NUMA 4XE4A 1MABB 5DGJA 4WH8A 1NY22 1O2KA 1GJ4H 1UHBB 2VVVA 2WPDD 2KM0A 1ANDA 3EA7A 1O3GA 4F49A 2BQ6B 1IQHA 4NCYA 2NU3E 1Q3XA 1S6LA 1PJPA 3BIUH 4UFGH 1KDQB 1NN6A 1TPPA 3KN2A 1TNIA 1AVGH 2G5NA 1AMHA 3OTJE 1O5FH 1AE8H 3KQEA 1C1NA 5G4BA 1ANBA 4CH8B 3Q00A 4X6MA 1H1BA 1EZQA 4D8NA 4X1PU 1GHZA 4IS5A 2BLVA 3LT3A 5C67A 3R0FA 4D76A 1ZZZA 3VB5A 3P8FA 3V12A 1O2YA 5F53A 1CSOE 3LGWA 1TNKA 2ZU1A 5C0TA 4OS7A 5EGMA 1O0DH 2P8OB 5JBCS 4YXWD 1NBMD 5KGOA 2BOHB 1GJ8B 1D6RA 2Z9GA 2HGTH 5DP6A 3SGBE 2VWNA 3RXBA 1P2IA 1PPEE 1TQ7B 1EP6A 1VJAU 2LPRA 4WMFA 1MU6B 3KQCA 3PV4A 3RM2H 3H5CB 2Y82A 3GYLB 2PUQH 3P6ZB 3MNCA 3QTOH 1P01A 2P3UB 1V3XA 3PYHA 1EPTB 1EAWA 1CGHA 1HB0B 1MBMA 2M2AA 3DSPA 2J9NA 5CMXH 3QLPH 5DP8A 1C2EA 3ZZ3A 4OS4A 3RXQA 5LPEA 1O2QA 2D26C 4Y0YE 3MO3A 2OC1A 1AHTH 3BSQA 1SBWA 1FAKH 1QBNA 2BVRH 3GYMA 4DG4A 2Y5HA 3W94A 3LC5A 1F5RA 2Z6BD 1XXDA 2TGTA 1ESTA 4JZDH 5EODA 1C5QA 2P94A 2XC5A 3ZZ7A 1VITG 4AGKA 3SZEA 1YYY1 3VG8A 3ZZDA 2K7XA 1MUEB 1P11E 1YPKH 4MG3A 1ARCA 1C4U2 3TPIZ 4DCDA 1JIRA 1W0KD 2R0LA 1CBWC 5FBEA 3MI4A 2Q6DA 1X7AC 1BOQA 1HJ8A 1OXGA 1QZ8A 2PWXA 1J17T 2GMTC 1CHGA 1GPZA 3LIWA 4FUEA 5HMAA 1K1JA 5FXLA 5ETXA 4MPXA 1A0JA 4YLUA 3TLOA 3O8BA 3OAAD 5EPNA 2PFEA 3RXJA 3S7HB 1VITF 2RFKC 1O3KA 3H7OA 4Y79A 4GSOA 2TRMA 8ESTE 1CQQA 3U1JB 2BDIA 1GMHF 1GMHG 2STBE 1HAVB 3K6YA 3EQ0H 2B5TB 1NBME 4ISIH 2ZNKH 3EE0B 2DUCA 1V2WT 4U01A 4BAMB 4DY7B 1FPCH 1EPTA 1C5LH 2FWWA 4X8VH 3QGJA 4K3JA 3MNXA 1C5PA 2ULLA 3T5FH 2JIZD 3PMJA 1XUKA 4B76A 3A7ZA 2GZ8A 5E8EH 3GY8A 4ABBA 5HM9A 2VVUA 5ABWA 5C2ZA 3U98H 4RKOB 1O2SA 3OFND 5JBAS 3LJOA 3VXEH 3LDXH 2FX4A 1JBUH 3K9XB 2XRCA 4Y76A 7GCHG 2FOEA 4DW2U 1GJBB 2FI4E 1FIWA 2JKHA 2XXLA 3I78A 5FL7D 2ODPA 5H4IB 5A8ZA 1W0ZU 2BD8A 1H8DH 2ZWLH 1JRSA 1EFRD 5EXMA 2EI8A 3VB4A 4A92A 1FUJA 2XTTB 1RTFB 4XBBA 3W95A 2HWLB 2KX4A 1SG8B 1T8OA 1GBDA 3SZNA 2ZHQH 2P8OC 4Q7ZA 2G4TA 2PP6A 4ZHLU 2GVFA 2SGFE 1ZYOA 4Y6DA 2FMJA 2OQ5A 1TGSZ 2OC8A 4BAOB 2J94A 5FX6A 1SKYE 4QT8C 2VWOA 1O3PB 3NWUA 2ZU2A 2IOTA 3DD2H 1ARBA 1A5GH 1V2UT 1YGCH 4LK4A 2CK3D 3SQHE 2XNIA 5DP9A 3D62A 2ANKH 1CA8B 1P8VC 1S6HA 5FBIA 3N7EA 4O9VA 4ABAA 3PO1C 4ESTE 1RS0A 1YLDA 1DUAA 1T32A 2BX3A 1ZLRA 3DA9B 3GY7A 1SGYE 2AIPA 4FUBA 1TB6H 1Y5BT 2ZHEH 3UB0A 2ZCKP 1ZGVA 4FOUC 4B6EA 3DFLA 2CGAA 2SGDE 5A2MH 1T8NA 3GCHB 1MU8B 1F92A 2FOGA 3E8LA 1C9PA 1ELFA 3CS0A 4WWYA 1DWBH 2ZCLP 1O2ZA 3T27A 2ZCHP 2GV7A 1HPGA 2BHGA 1XUJA 5F8ZA 4AG1A 1B7XB 2C4FH 4GCHF 5C1XA 4K8YA 1C1WH 1TGBA 3SUEA 1LHFH 2FZZA 1V2JT 3VPKA 2A5IA 1F0TA 3KEEA 1HFDA 2UUKB 5A0BA 5C1YA 3A83A 1ZPBA 2ODQA 2TGPZ 2ZFRH 1SQAA 1OPHB 3A81A 3SW2B 1W8BH 3N7OA 5DJ7A 1C1UH 2VINA 3PV5A 3HK6B 1QURH 3RXGA 2QF0A 3EYDA 4WH6A 3WWFA 5E2PA 2WHXA 2VJ1A 1GBCA 2G8TA 1TGNA 3VFEA 3BTEE 1XX9A 4K2YA 1LKAA 3T26A 1VCPA 1GGDC 6ESTA 3TU7H 5SGAE 1UO6A 2Z9IA 1EB1H 1TRNA 4Q7XA 3F9GA 5B6OA 2XBWA 1XUIA 2WPMS 1XUFA 2PTCE 3SU4A 4FXGH 2QCYA 2W3IA 3LGIA 1WAYB 1ZOMA 1CVWH 1P2MA 2AMDA 4YESB 3O8DA 4Y7AA 1WBGB 2AMPA 1P9UA 2FS9A 1ZTLA 4Z1MD 3AW0A 1O3IA 3BG4B 1L1JA 4HZHA 2XCNA 4ZKNU 2OP9A 1HAYB 1LO6A 2ZFQH 1YPEH 4MPUA 3M3SA 1YLCA 1FIZA 3MU5A 1NU7B 1HUTH 1O36A 1EZXC 1SI5H 1YPGH 3KQDA 4XRNA 1L0ZA 4U32A 2FPZA 2Y7XA 2BD7A 1A0LA 2J38A 5F03A 3SUDA 2DE9A 1Z6JH 1N6XA 3TH3H 5AF9H 2XYAA 2QC2A 4RSPA 4I8KA 1K1NA 4TWWA 1RTKA 3SU1A 4AORA 1XVMA 2JH0D 3UTUH 5C0UA 2STAE 1OP8A 1TYNA 1HIAB 1QCPA 4Q7YA 1DANH 2SGEE 1YLNA 3UR6A 3NKKA 3ZZ8A 3RUOA 3E0PB 3LC3A 2BY9X 4H42U 2CN0H 3SU3A 3LOXA 1ZPCA 4ZROA 1MTNC 1D9IA 3SJ9A 3RC6A 4ZUHA 1G36A 1O3BA 2KCAA 3HATH 2R3UA 5JBBS 1JMOH 2BOKA 1TBRH 1G37A 4LXBH 1IQKA 4OS1A 2CMYA 3V13A 1BMAA 1GHXH 3HKIB 1C1OA 4MLFB 2QN5T 4DOQA
chains in the Genus database with same CATH topology
3E90B 1O2NA 5GCHG 4OGXA 2ZPQA 4ZKOU 1EZUC 2Q1JA 1K9OE 1BHXF 1BRUP 4NSYA 3T62A 1GG6C 1C2DA 4E7RG 1SL3A 1XUGA 2PGQB 1TIOA 4X6NA 4B74A 1G30B 3O8CA 1B0FA 2H2ZA 1V2LT 1TPSA 4IMZA 1O2IA 2GCHF 1AFQC 2OUAA 3RMLH 1GHBF 4ISNA 4GUXA 1YCPM 2XCFA 5EQRA 1K2I1 2V35A 1O2MA 4AFQA 1UTNA 1T7CA 4GAWA 3SOSA 3ZVGA 1CO7E 1KXDA 1P2QA 2VB0A 2ZFTA 1P05A 6GCHF 2ODYB 1HDTH 2AFQB 3TK9A 5T6GA 2HPPH 1V2MT 3TNTA 1BMNH 1AVWA 1A2CH 2XC0A 2VH0A 1HAIH 1Y8TA 3K2UA 3BTKE 3A8AA 3SHCH 4X6PA 1LHDH 5K0HA 1LKBA 1H4WA 3F68H 1WTHD 2UWOA 2HNTE 2Z9JA 3MU1A 2P59A 1N1LA 2J4IA 4X1SU 3U8RH 3NXPA 1UTKA 2ZFFH 1S0QA 3URDA 3AASA 5BRRE 1ANEA 4KGAA 1DWDH 3GISB 1SGRE 4U30A 1H9LB 2VGCC 1ZHRA 3A7WA 4R0IA 1BBRH 3OYPA 2FESH 1L1GA 2ZDMA 3B8JA 1C5MD 1NRSH 1C9TA 1C2FA 2THFB 3BG4C 2TBSA 3ATKA 3K6ZA 2XWAA 1LMWB 1KTTB 3FZDA 1FY8E 1UCYE 2SNVA 2Y7ZA 4AN7A 2AGGX 2LIZA 1K1LA 2FOHA 2BQ7B 1LPKB 4DIIH 1ESAA 2A5AA 2ZHFH 2BZ6H 1TX7A 1J15A 4O97A 1C5ZB 1GBFA 1C5XB 2ALVA 1O3AA 3A8CA 2LNCA 3LGVA 4AFUA 4GPGA 1EATA 1HJAB 1PPFE 3MNSA 1CT4E 2GP9B 1GHWH 4I8GA 8LPRA 1V6DA 1Y3YA 1L2EA 5FPSA 1KLIH 1TFXA 3UIRA 2FTLE 5FPTA 1OS8A 3RC4A 2RA3A 1MZAA 1AGJA 1AFEH 4FVBA 2HNTC 2A0QB 2R9PA 1O32A 4VGCB 3TVJB 1FV9A 3QO6A 1S81A 2QGRA 4ISHH 1QA0A 3GY5A 1TONA 1TA6A 4TWYA 1ZMLA 1Z71A 1L4ZA 3VXFH 2P3FH 1N6YA 1RGQA 1UTLM 4BTTB 1RRKA 3ITIA 4H4FA 3UNQA 2A4OA 3MO6A 4BAKB 1SGPE 1F5LA 3ZYEA 1F0RA 1Q2WA 1L1NA 1W11U 1GJ6A 2FOBA 1SGFG 2HPQH 3RXIA 1P06A 1EXFA 2Y6TA 2Q6GA 1W0YH 3GY3A 4CBNA 1TAWA 2P16A 1QL7A 3GCHC 3BF6H 1TMTH 3S9BA 1AB9B 3SHAH 1BBRK 4O3UA 1UK3A 3SN8A 1UTQA 3SGQE 5HXFA 1L4DA 3UFAA 2PLXA 1DLEA 2HLCA 2QXHA 1DXWA 3FAOA 1XUHA 1ZJKA 2VWLA 4JMYA 2W26A 4I8JA 5LPRA 3HKJB 4INKA 3SV2H 2H6MA 1AU8A 1QRZA 2V6NA 3PM3A 1AD8H 4HTCH 2PV9B 4IN1A 4E06H 1ESBA 1NPMA 3SV9A 3RXFA 1C1PA 2ZGXH 3SNCA 1LQDB 4MNXA 1BDAA 1GJ9B 1EAIA 2QXJA 1C5WB 3QX5H 1HAOH 2CV3A 3AAVA 5PTPA 4UFDH 2ZDKA 1GJ7B 1LPGB 4NFFA 1XKBC 3RXUA 2FP7B 2ZDVH 3F9HA 1O2GH 3RXAA 1THRH 4X8SH 2OINA 4BANB 1M9UA 3VGCB 5JYIA 1WSSH 1C2KA 1SR5C 3KHVA 3UOPA 3SNEA 1UCYK 1GVZA 1G3BA 1GMCG 2OTVA 3ZVDA 4AYYB 2SGPE 1SGDE 1N8OB 1D4PB 2OQUA 3ENSB 4NA9H 2GMTB 1AQ7A 3OY6U 3IITA 2FO9A 3Q3XA 3AVZA 1O5CB 3DUXH 5A8XA 4YM9A 3ATMA 1IHSH 1JRTA 3EBNA 2BLWA 1A0HB 1C1QA 3MMGA 4AZ2B 1VITH 4AYVB 5F8XA 1FY4A 1AKSB 3VB6A 2O8WA 1LTOA 5DG6A 1DY8A 4BXWA 3CP7A 3MH6A 2QYIA 1WQSA 1O2RA 1GJCB 3L6PA 4CRDA 1KIGH 1GI3A 2GT7A 4DT7B 3RXRA 2Z3EA 9ESTA 3STIA 3VEQB 1QNJA 2WUBA 3A85A 3TH4H 1KSNA 1QGFA 4BTUB 2GCHG 1C5YB 3GY6A 1MQ5A 3RXVA 1LVBA 2ZDLA 3T29A 1YCPH 4UEHH 3SU0A 5TCAA 1C1RA 2QIQA 1JWTA 1QL9A 1W10U 5E0JA 1UTMA 3BTHE 2BDHA 4GVUA 1ZSKA 3RU4D 3M61U 1FY5A 1KTSB 1OYQA 2ZPSA 1C1SA 1OP2A 3EA9A 2QXGA 1NC6A 3CENA 1AB9C 1RXPA 1QRWA 1GBAA 3M5MA 4INHA 1O34A 2PSYA 2TGDA 1FONA 1TA2A 2P93A 4Q2KA 2M5TA 1NTPA 1S0RA 3RXHA 3TITA 3MO9A 3RXCA 1MH0A 4XDEA 1HCGA 3PWCA 3PLPA 5T6DA 1GHVH 1LPZB 2NU4E 2XBXA 1SGTA 1O35A 2ZU4A 2A1DB 3KL6A 2J92A 1J14A 4XFQA 2WPKS 3SJIA 1OX1A 1BMMH 1SLVB 1GMDG 1ELAA 2RG3A 2AEIH 3KF2A 1MQ6A 5C1UA 3MU8A 1FNIA 1TX8A 1H9HE 4DJZB 1AI8H 1O2HA 2BB4A 1WCZA 1G3CA 1TE0A 2BLOA 2F83A 4ZMAH 4E05H 4NIWA 3M37A 3T2NA 1FQ3A 2VGCB 1MMJN 3GY4A 4KTSA 2VIOA 3ESTA 4NSVA 3P95A 2FS8A 1SOZA 1NRNH 2CHAC 2XWBI 3ATLA 2BDYA 1VGCB 3I29A 2TPIZ 1QR3E 4JK6A 2ZFPH 1S84A 4ISOA 4I8LA 4ZKSU 1GHYH 1DWCH 2WV5A 3UR9A 1V2ST 1LHCH 1ZPZA 1EKBB 1DOJA 2QV1A 4XOJA 3RU4E 1UTPA 1EJNA 3WY8A 4CRCA 1YC0A 2FDAA 2BXTH 1F0UA 1MD8A 2YNBA 4FUGA 3BEFB 1WTGH 1BTHH 1VCWA 3MU0A 3UNRA 1O33A 5DP5A 1BB0B 1TNLA 3RM0H 2PR3A 3HGPA 1OKXA 2ZDNA 4IC6A 1GBEA 1NU9A 2D1JA 1UJ1A 1HIAA 5LH8A 1CE5A 4MTBA 8KME2 4ZKRU 1UMAH 2SGAA 5I25A 1O3HA 2BDAA 1QQ4A 2FOAA 6LPRA 2ZG0H 1GJDB 2O8TA 4B2AA 3T25A 1S5SA 1GDUA 4A6LA 3RMOH 2OBQA 2BY5X 2ANYA 1AWFH 7KMEH 1Y59T 3U8OH 1TX6A 1NRRH 1MTSA 1QQUA 2VIQA 3RXSA 3P70B 6CHAC 3EDXB 2PKSB 2FODA 8GCHG 3UQOA 1TRYA 1HAPH 1BA8B 3ZVCA 3SNAA 4ABFA 1NRQH 1TABE 1AUJA 1OSSA 1E37B 3A7XA 4AB8A 3A8DA 1GBKA 1RIWB 4WY3A 1GJ5H 3P8NA 5EG4A 4MPWA 1EJAA 1P2OA 1C2JA 2Y5GA 1P3CA 2G4UA 3MYWA 1Z1JA 2JH5D 4YLQH 3S0NA 1H9IE 1EX3A 3SU5A 3M5LA 4O3TA 2AGEX 1T31A 4BOHA 2ZIQH 3UOUA 4F4OC 3SV7A 2F9PA 2JH6D 1TNHA 4KKDA 4D9RA 1SGQE 2J95A 1YF4A 3GDVA 2GTBA 1BZXE 3MHWU 3RXDA 5L6NH 1P10A 5JDUB 5FAHA 5DK1A 2YNAA 1B0EA 3A88A 1G9IE 1C2IA 1TOMH 5DO4H 1D3PB 4X8TH 2ZFSA 1K28D 1O30A 1DS2E 1A4WH 3UWIA 1IOEA 2K1QA 3GICB 1NESE 1SLUB 5FCRA 1AUTC 1V2PT 4MVNA 1C2GA 1EASA 1T4VH 3PTBA 4Y8YA 3SI4H 3SJKA 3M35A 1FN8A 3MH5A 1PPGE 1AWHB 1O5AB 4ZAEA 1MTWA 3MFJA 1C5UA 3UY9A 1LHGH 2G81E 2ZA5A 1Q31A 1O31A 4KTUA 4NZLA 1CGIE 1SHYA 2B0FA 1K21H 1V2KT 2HOBA 1IQLA 2P3TB 1CHOG 3B23B 3RXPA 5E2OA 3GDSA 3MOCA 3RU4T 1AKSA 1SGCA 1T4UH 2ZI2H 1ZHMA 3B9FH 2NU1E 2FI5E 4ABGA 1NT1A 1UVOA 1SLXB 1QBOA 4MNVA 1GMCF 1KY9A 1Y3XA 1ETTH 1MD7A 1O3FA 4BXSA 2WPJS 1DSTA 3A80A 2C8WB 5JBTA 3CS7A 2AH4X 1C2MA 3STJA 3ZZ4A 1P09A 2FX6A 4IGDA 1W3CA 2I6QA 2QAAA 1GMDF 4DURA 3ZVEA 1C5NH 3LH3A 1P3EA 3PROA 1P04A 1PYTD 2A4GA 4TY7A 2ZQ1A 3BG8A 1EAUA 3ZVBA 5DP3A 2H9TH 4FUCA 4B2BA 4MQAA 3PMAB 1ZJDA 1QB9A 2ASUB 1O37A 1NFWA 3C27B 3PB1E 3GCOA 2GX4A 1EOLA 3SO3A 3FVFB 3BEUA 5EQSA 4I7YH 1TMBH 4VGCC 1K1OA 1UVSH 3QDZB 1W12U 3H7TA 1PPZA 1FMGA 1HYLA 1N8OC 3UPEA 3ZYDA 4K1EA 1MKXK 1DE7H 1OWIA 3A87A 1WUNH 4FVDA 2ESTE 1UVTH 2G55A 1H8IH 3RXEA 2R0KA 4IC5A 1J9CH 1EB2A 4X8UH 4TYDA 4DGJA 1BJVA 1PFXC 2FM2A 1UTOA 4ABIA 1GBMA 2ZGBH 1IQNA 4X2XA 4IN2A 1IQGA 1BCUH 1QJ7B 1TGCA 3U9AH 1HAXB 4WVPE 1CBWB 3QWCH 5AFYH 1GI8B 5GWZA 1O3OA 1ZHPA 3ZZ6A 1F2SE 2G52A 2ILNA 1CGJE 1W2KH 3KQBA 1HRTH 5FPYA 1RD3B 1WU1A 1MTUA 4LZ4B 1BTYA 3JZ1B 3BV9B 5EQQA 1O3JA 3E91A 5JPMH 3PLKA 4ASHA 1HXFH 1SGEE 1JXPA 4Y8ZA 1C5RA 4TPYA 3QGNB 3QZRA 2ZDAH 3PTNA 1W7GH 4I32A 2R2WU 1GBBA 3RC5A 3PWBA 1K22H 4ABHA 4Y11E 2UUFB 1DICA 5J4SA 5T6FA 2Y80A 4R8TB 4A5TS 1OWDA 3UWJH 4UFEH 2B7DH 1V2OT 2B8OH 5EXNA 1QB6A 4JYUH 4B73A 3RLYH 1ETRH 2PSXA 1QJ6B 4RKJB 1AVXA 3ZV8A 1BTWA 1QTFA 1ZMNA 4K1TA 2RCEA 3ZZAA 3KIDU 4FUFA 2A7HA 1CA0C 3IG6B 5HGGA 5AFZH 1UVUH 1C4V2 1JIMA 4FUDA 3QTVH 4GHTA 4J2YB 4CR5A 2C8XB 2EI6A 4CREA 1MKXH 3SNBA 2CXVA 2WV4A 4CR9A 5AVDA 4CBOA 1PYTC 1V2TT 1E36B 2ZPRA 2WPHS 2GCTB 4Y71A 1MCVA 1A1RA 4E7NA 1GI2A 2OD3B 5CHAB 1SSXA 3UUZA 4ABDA 1SFQB 3GOVB 3UREA 1AY6H 3E16B 3I77A 2C93B 1KYNA 2SFAA 7ESTE 1GBLA 1KXAA 1QRXA 3EAJA 1KLJH 2BDBA 4X6OA 1BTZA 2KAIA 4YOJA 1ELDE 4MNYA 3SNDA 3SORA 3P8OA 2VH6A 1S6FA 1MCTA 5EU8A 1BHXB 1GHAF 1FY3A 1SGIB 1E34B 1TGTA 2SNWA 4YOGA 3E3TA 1NFUA 1U6QA 3BTQE 4I33A 5BPEA 1EQ9A 1W13U 2GKVE 2RA0A 3KCGH 1O2XA 3F6UH 3MNBA 3LJJA 1TMUH 1MAXA 1XKAC 1A3EH 1MTNB 1SB1H 2GV6A 1GBIA 2BD4A 4ZH8A 2WYJA 2D2DA 2FIRH 1D3QB 1GI1A 4DVAU 1O2TA 4Q80A 3TJVA 3A89A 2A4RA 4JYTA 1AFQB 2BZAA 4UE7H 1IHTH 1ZTJA 3IWMA 4YTAA 5DPAA 1YPHC 1EJMA 3A86A 3MWIU 4GCHG 4J1YA 1YPMH 1CU1A 1Y5UT 3BEIB 2IJOB 3BTFE 1O2JA 2PW8H 1Z8JB 2OBOA 2NU2E 2O9QA 1C5SA 1GBJA 1NFXA 1NZQH 2AGIX 4IW4E 5FCKA 5TCCA 2ZTXA 2BM2A 5L30H 1INCA 1GDQA 3Q77A 1O3MA 1TALA 1XMNB 2F9NA 1QBVH 1C5OH 4NIVA 4ZHAA 2CF8H 1GVKB 2AMQA 1S82A 2WINI 1SC8U 4NGAH 1F0SA 1BTPA 1ELBA 1FAXA 3VB3A 3S69A 3SV8A 2BX4A 2ZHWH 2QY0B 4OGYA 4I8HA 5DP7A 2Z94A 1KXFA 5L2YH 2BD2A 3D23A 1CA0B 3A7TA 4NA8A 4K60A 1W14U 1RJXB 1ZMJA 1P9SA 1QA7A 2GDDA 4X1NU 2VIDA 2W3KA 4JYVH 2GGVB 3M7QA 3TJOA 3RP2A 1K1PA 3BN9A 1O3DA 1PQ7A 1UK4A 4D7FA 4X1RU 2AS9A 3D65E 2R2MB 2B9LA 3OSYA 2A45B 3KNXA 2CHAB 1ZRKA 3SV6A 1KXCA 3ZZ5A 3PO1B 1FXYA 4Z6AH 1Z6EA 4KP0A 1VR1H 1DITH 3GCNA 4X1QU 1GI5A 1IQMA 1PPHE 2JETC 1YPLH 3FP6E 2ZTZA 1WV7H 1W7XH 4I31A 4JCNA 2A5KA 1HJAC 2R3YA 1MBQA 1UHBA 1DPOA 2V3OH 5DP4A 3BIVH 3ODFA 3SU6A 3RXLA 1KLTA 1E0FD 2F9OA 1A5IA 2F9BH 2ZECA 1FI8A 1Z8IB 1P03A 4YO9A 3RLWH 3HGNA 3LPRA 2OC7A 2P95A 2ZO3H 1MKWH 4H6SB 4WXIA 1C2LA 1MTVA 3LGUA 3BTWE 2AIQA 5C5OA 1O5EH 9LPRA 1TNJA 3GDUA 3BTME 4YT7H 4NFEA 1A7SA 3LGYA 3SBKA 1D3TB 2I6SA 1KXBA 1O5BB 1QJ1B 1GHBG 1BMLA 1GI4A 3NCLA 1FY1A 1EOJA 5K7RA 1TRMA 1QB1A 1O3CA 5J4QA 1RIWC <