1UK8A

Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-valerate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Series of Crystal Structures of a meta-Cleavage Product Hydrolase from Pseudomonas fluorescens IP01 (CumD) Complexed with Various Cleavage Products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
total genus 102
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2003-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uk8A00
4UHFA 4BZZA 3H0CA 1UK8A 5AK6A 5JAOA 4QWWA 3ZWQA 4YX9A 3AZPA 3AJAA 4CI9A 5JD6A 1XRLA 1DT3A 5JATA 4ZREA 2XMBA 5AJHA 5LYYA 5ALRA 1C7IA 1EB9A 1LBSA 2PVSA 4H7HA 3R0VA 3WL8A 5LKRA 2Z3ZA 2WUGA 4QEKA 4TPKA 5AI9A 2QT9A 2ZJ7A 2XUHA 5HQ3B 3HRHA 2BFNA 4HTAA 1JU3A 2IX9A 5AM2A 3ZI7A 1VXOA 5D6OA 5CXUA 1JU4A 4J0GA 3PF9A 3OG9A 2JGLA 4UBKA 3ZV7A 1KU6A 3B5EA 4CG3A 3FYUA 1B41A 2PU5A 3RK4A 4FFVA 5ALDA 3AFIA 4U2BA 4UUQA 4QE3A 2PBLA 3NUZA 1DQYA 3E0XA 3MUNA 1AGYA 3DKKA 1IMJA 1CUBA 4KAAA 4I4CA 1YS1X 4G8CA 4LIPD 2G5TA 4F21A 1GT6A 2EDAA 5CT4A 1CEXA 1E89A 3DDUA 4WCVA 2H7YA 4G4JA 1K6EA 4J0HA 5K3FB 3PE6A 2V97A 3IUQA 2BKLA 2J3QA 2X5XA 3G0GA 3NOXA 5HZGA 1XQWA 3L1JA 4GXNA 2PSHA 1EHYA 1ACJA 5ALEA 5ESRA 3RARA 1ZICA 3OM8A 3G0IA 5JZ9A 2GBCA 4KJXA 3OOSA 3R41A 5ALFA 2J4FA 5ISMA 3ANTA 4BDTA 4FDMA 5CBKA 3G0DA 1UXOA 3ZPXA 1P0IA 2G4LA 4E11A 2B20A 4X71A 5AO9A 1LZLA 1F6WA 1J1IA 3WKBA 4ZRDA 2ZSIA 3FYUB 3FOBA 3I6ZA 1B6GA 1O6GA 3STVA 2HFJA 1U2EA 1SCQA 1G66A 3M82A 5J3JA 5EIEA 4AXBA 2CJPA 3H18A 1R50A 4UBOA 1SOMA 4DNPA 1DINA 3D59A 3I2FA 1CUZA 5CT9A 1EVEA 1LPAB 2C58A 2PPLA 4C6HA 4XX1A 1XLUA 1N5MA 1VXRA 1A8SA 1CRLA 4GI1A 3I1IA 1J07A 4IO0A 4TVKA 4UHDA 2QKYA 1EXWA 3R3UA 1AURA 2O2GA 2WUDA 3C8DA 4BVJA 4OB6A 5BWCA 1BE0A 4DMHA 4DSZA 1YCDA 3EQ8A 4F0JA 3WK8A 3G9UA 1OILA 1R9NA 1CUUA 4ZV7A 4TGLA 3IUJA 3GZJA 3OTQA 4J0KA 4GEGA 4OB8A 2OAEA 1ZI9A 3IB3A 4K2AA 4IHAA 5IVKA 4AO8A 4X6UA 5CW2A 2Z5GA 4B0OA 2O2HA 4C89A 5K5EA 4JEIA 4KEAA 1OXMA 3IA2A 4UBMA 2OLEA 5HF6A 4RNCA 5KREA 2VJCA 1G4HA 3AIOA 4CIAA 5KBYA 1CUIA 3IULA 1QGED 2IIVA 1W6RA 1H22A 2H7CA 3HC7A 3BIXA 2B9VA 3D0KA 2HL6A 2BUAA 4MJ3A 1CUHA 4GHWA 4C88A 4C01A 5AK4A 1RP1A 4J0JA 2XQFA 1FFBA 3UMJA 1DT5A 5FKJA 1F8UA 4H7FA 2WLSA 4M0MA 2FX5A 2QVBA 2ACEA 4AZ3A 3NWOA 1XZMA 4GDMA 2O2IA 5C81A 3G9XA 1E8MA 2AJBA 3QM1A 4HRXA 4PF1A 1CUSA 2X76A 3FCXA 4BYMA 2GBFA 1CUFA 3WJ1A 4C4YA 1FJ2A 1ZD5A 1Q0RA 4MXDA 4H18A 1E66A 5A7GA 3WK6A 1Y7HA 1YASA 4LXIA 1XZEA 1GZ7A 1R3DA 4Y2JA 4QDUA 5I9IA 3V1LA 5LIPA 5EFZA 2Q0XA 5HF5A 4CIBA 3WZMA 1E8NA 2HFKA 5JALA 1QE3A 5AKXA 2FUKA 5FPQA 3LS2A 3K2IA 5HQ3A 3G0CA 2CMFA 4N8EA 1ACLA 4FBLA 4DLNA 4MWSA 3QBJA 4RGYA 4AQDA 3JWEA 1FFAA 2VT6A 3WWPA 3Q0TA 1AMNA 3JW8A 3W9UA 4EBBA 1UK6A 1CVLA 4N5IX 3HI4A 1P0QA 5AM1A 3M81A 2PL5A 2PSJA 4ITVA 5AM4A 4BZWA 1JJIA 2C0QA 5AKKA 2RHTA 3VJKA 4WJLA 5HK9A 4BRSA 2ORYA 3H1AA 4U2EA 1FFEA 4ZWNA 1HDEA 4FLMA 1QIFA 2AJCA 1WPXA 4UFNA 5AOAA 4Y2PA 5SYNA 1YB7A 3KOOA 5D3KA 1CV2A 4DMKA 3TEJA 5LZ7A 3QPCA 2HM7A 4Q34A 3H04A 3WL5A 1PFQA 2WQZA 1ORWA 4CCYA 3VKFA 3F9CA 3QPDA 5LZ8A 5AIAA 5EHQA 1ETHA 3Q8WA 1MAHA 4LYDA 3DKRA 3AILA 4BC0A 4K6GA 1EDBA 2WG0A 4XJVA 3SK0A 3STUA 1GKLA 2X8BA 1CUEA 5JD4A 1AX9A 4QLOA 1XZCA 4MEAA 3L1HA 3D3NA 4LHEA 2QRUA 2ONCA 5E4JA 5ALSA 5IH7A 5AOCA 1YA4A 5FXMA 1UZAA 3PUIA 3PFCA 2WG1A 2FJPA 2WU3A 4G9GA 2LIPA 3AUKA 3H2GA 3W06A 2XUKA 4X6XA 5CMLA 2W6CX 4BATA 1AZWA 1YB6A 4QLAA 2WKWA 5ALNA 5EI5A 1BN7A 3ZLUA 3FLAA 3N0TA 2QR5A 4EB0A 2HA3A 4W9RA 1CUYA 4E14A 3HYSA 4C87A 3YASA 3H1BA 3OPMA 1WOMA 5JAUA 4Z49A 4C4XA 1BEEA 2YH2A 4OU4A 3I2JA 1ZJ5A 1L7AA 3BL8A 3G8YA 5LKAA 3QPAA 4IH4A 3B12A 2WJ3A 3WIBA 1MN6A 4WY5A 3I2KA 3C6BA 3QMMA 3DD5A 2ZVDA 4XVCA 2BGNA 5AM0A 1GGVA 5AI8A 3WK9A 5JYCA 3FBWA 4U2DA 1N5RA 3D2CA 2PUHA 1ZD3A 4H77A 2VEOA 3FVTA 1VA4A 5DNWA 1VE7A 4Y2SA 1K5PA 4PQEA 5D3ZA 1LPMA 2OGTA 2YASA 1Y37A 4XWGA 3A6ZA 3MGAA 1UK7A 1ODTC 1THGA 5LZ4A 1EH5A 3F8SA 1EVQA 5JZBA 5I8PA 2G63A 3EIOA 5DYTA 3HJUA 2J3DA 3CCCA 5FOQA 4PNZA 3W04A 3WL7A 5A71A 1ZIXA 1WHTA 1JMYA 3DNMA 2PM8A 2RAUA 3G0BA 3DS8A 4Q3OA 1TRHA 3T52A 2DHDA 3TRDA 2JGEA 5ALIA 3DOHA 4BE9A 1ODSA 5H3HA 5E2IA 4Q3KA 3SC2A 4EY4A 1ZGCA 1T2NA 2PSDA 3M3DA 3MVEA 2EDCA 1JFRA 3DLTA 4ARAA 4PW0A 5D7BA 5CXXA 1VE6A 1MT3A 2QTBA 1JJFA 4AMZA 3EQ9A 2QXTA 1QO7A 3KSRA 2BCEA 4EY5A 4EY7A 2XMQA 3WZLA 3ZLVA 4FMPA 2CEKA 4B0PA 1MX9A 4X00A 4PSUA 2E3JA 1HQDA 4MQMA 1H2WA 5LZ9A 5JARA 5AKHA 5DNUA 3FSGD 1JJBA 1BCRA 4FNMA 4A23A 2I3ZA 2QS9A 1QTIA 1VLQA 1HBJA 4KAJA 2VF2A 3BJMA 4UBIA 4FBMA 1EI9A 3X3HA 3IDAA 2XQKA 1QLWA 1X2EA 3V1KA 2HRQA 1QIJA 4KE7A 3HABA 1LPNA 2OG1A 4CG1A 1KU0A 5ALMA 4BAUA 3EBLA 1BN6A 2Y6UA 3WJ2A 5JD5A 1WCYA 1TCCA 3QH4A 5K3CA 3EQ7A 3ESBA 2NW6A 4BBZA 4I3FA 4Q05A 2Y2UA 5C8XA 1KEZA 3F97A 3DQZA 1ORVA 4OD0A 1ZIYA 1W75A 2ZYIA 5CURA 2HRRA 2XQIA 4FTWA 4IH9A 5A62A 4EZIA 4U2GA 4H7KA 1W76A 3I6MA 3IVMA 5BV7A 1M33A 4DIUA 4U2CA 3OC0A 5T4FA 3C5VA 1R88A 1J2EA 5IVIA 1ZGBA 4ETWA 4JUIA 4G4GA 1L7RA 4B85A 1EX9A 5LLSA 3G9TA 1FFDA 4NVRA 5K3BA 3L1IA 2VAXA 4X3CA 3H2KA 2VTVA 5DWDA 4AMYA 2ZYRA 2HU8A 5E4TA 2WIKA 5DYYA 4D9JA 5BOVA 4J3JA 4A16A 1DX4A 2WIFA 1CUGA 4L0CA 5I7UA 1JMKC 1K8QA 5ALJA 2I03A 3C70A 4QDTA 2B4KA 1DQZA 3R3ZA 5K3FA 3LP5A 1GPLA 2QMQA 3DEAA 4P93A 2XMRA 4B84A 4HZGA 4KAFA 4H35A 3KDAA 3H19A 5YASA 2WU4A 3DL4A 3A2LA 1WB6A 2QJRA 2GYVA 4YK7A 1AUOA 1XZGA 2D5LA 3R3YA 2AXEA 4UHHA 4Y2UA 3H2IA 1SFRA 5IVDA 2WUFA 5ALXA 5ALLA 3O0DA 5A6VA 2JGKA 3D7RA 4JNCA 3O95A 4W63A 4IH1A 3RM3A 4Y7DA 4EUSA 1QIGA 5CTAA 1QIEA 1OCEA 2OGSA 1QOZA 1DU4A 1ODCA 3E4DA 4HRYA 3RLIA 5K3EA 1EK2A 4EY8A 3C43A 1BS9A 1P0PA 5A7HA 1GQSA 4CG2A 4CCYB 2ZYSA 3R40A 4J03A 3BF8A 5ALUA 5AH0A 4B9AA 5DJ5A 3AIMA 1QIHA 4BVKA 1CUAA 5ALWA 3ANSA 4N5HX 1XZAA 4B81A 4QDXA 5CH3A 3D5EA 4KR0A 1TAHA 3R3XA 1SCKA 3A70A 5DTIA 2UZ0A 1MTZA 3KWFA 3U1TA 4DTCA 2C7BA 2Y1KA 3IURA 4KE8A 3V1MA 2PSEA 1TKRA 2WJ6A 2I3DA 3DYVA 1A88A 4S0XA 1PJAA 5K3AA 2RI6A 3H17A 4JH0A 1LNSA 5AK3A 4BCDA 1VZ3A 4U2FA 4E46A 1R4ZA 5HCUA 4YPVA 1WHSA 3CN9A 1DTEA 3WYNA 1QFSA 4G4IA 1MU0A 4G8DA 2XB6A 1W52X 2PU7A 4WDRA 3DYIA 2K2QB 5CH5A 3BF7A 3FWHA 4MEBA 5AOBA 4P08A 3FLEA 3ICVA 1MAAA 1F0PA 4X91A 3VDXA 3QYJA 1J06A 2ZSHA 3HACA 4OB7A 1NX9A 3N2ZB 3W2TA 1XZDA 2OCKA 5JASA 2YXPX 1MNAA 2R8BA 2XMGA 5JAPA 1RWQA 3IUMA 3WL6A 4W1QA 5HKBA 4OU5A 4Y9SA 2VAVA 2JGIA 5IVHA 1VOTA 1CUDA 2Z8ZA 1XLWA 1O6FA 4F60A 2XLCA 1F0NA 2O7RA 4EA6A 2Z8XA 4RE5A 2C0PA 5C7YA 3PI6A 1WB4A 1YS2X 5KWJA 2CUTA 5AKEA 1Q0ZA 4NZZA 4X92A 4QDOA 1VA5A 3PF8A 1XRQA 2WFLA 1U8EA 1H2YA 4KRYA 4KACA 4N8SA 3BIWA 3FNBA 1BU8A 1G5FA 2GYUA 2VATA 4G1FA 3STYA 2XMDA 3S2ZA 1IUPA 3BDVA 5AKZA 3QZUA 4LYEA 4ZI5A 3F98A 5HKAA 4BB0A 4JYMA 5A7FA 3H2JA 2XQJA 4GECA 4UFOA 3E3AA 1C7JA 3K9BA 4WFKA 4DNOA 1ZI8A 2JEYA 4Q3LA 4L9AA 4CFSA 1GPKA 5E4YA 2ES4A 1IUNA 1UOOA 1USWA 1X70A 4I19A 3FCYA 3WLAA 2XUQA 1Q84A 4X94A 2VSQA 4B82A 4X85A 1QO9A 4Y2VA 3BWXA 3AINA 4P9NA 3I2GA 1UWCA 4Q1VA 2P8SA 3WA7A 1E8DA 2G5PA 2HHAA 2I78A 1T4MA 1QIDA 3HLKA 2XQGA 1UOPA 2IITA 2XUDA 4DMCA 7YASA 1IUOA 5AP9A 3WK5A 4UHCA 3O4JA 4FLFA 2XI4A 4WFIA 3EF3A 3V1NA 4BC1A 5ALYA 5HF9A 3FAKA 1X2BA 5LP1A 4X90A 4WFJA 5AM5A 3WWCA 2QZPA 5JAHA 3F96A 2HU5A 5AKLA 5DTJA 3GA7A 3DCNA 3GFFA 1MPXA 2AJ8A 3VJLA 4HXFB 4EY6A 1JI3A 2BGRA 4J0IA 1BRTA 2B61A 2J4CA 1ZD4A 4E15A 1XRMA 3A2MA 4X93A 3LLCA 4ZGBA 1AC5A 2DHCA 5T4HA 3O4IA 3PUHA 2WIDA 1UKCA 4FLEA 1CUWA 3C6YA 2WIJA 3G02A 3KXPA 4AN1A 5ALVA 3SWWA 2QUBA 3WYDA 3GUUA 1GQRA 3T4UA 1YAHA 3I2HA 5CH8A 1E3QA 3QITA 1SC9A 2WIGA 3D2BA 2XLBA 1L7QA 5ALGA 3KWJA 5AKYA 4OPMA 1TK3A 4H0CA 1FSSA 4XIIA 5FP0A 3WKEA 1ISPA 2HA5A 1TCAA 1XRRA 2BUCA 1GXSA 3O9MA 2CBGA 3ILSA 2GBIA 1YSCA 4NMWA 4DSAA 1XZKA 5ALQA 5FPPA 4GWLA 1A8QA 2ACKA 4QNNA 2XUPA 5IKXA 2GBGA 3CN7A 4MWTA 2QM0A 2ZYHA 3F67A 3GELA 3WKAA 3STWA 3IUNA 6YASA 3VVLA 1NU6A 3WIOA 5CT8A 1LPOA 2HA4A 2HADA 4Y2QA 2AJDA 3FYTA 4PSDA 1XLVA 2QUAA 4KE6A 4BP8A 1CR6A 1Z68A 2XMSA 2WG2A 2HA6A 3VISA 1XROA 2ZJ6A 3ICWA 4WY8A 1CUVA 4G8BA 1DWPA 4UBNA 1VKHA 3A2NA 4WDQA 3V9AA 1DWOA 2WJ4A 2WM2A 1XZBA 5KWIA 1XFDA 4G5XA 5ALKA 2WHQA 1YAJA 5F4ZA 4UBJA 4MYSA 1IZ7A 5AICA 1K4YA 4BP9A 4P92A 2JGMA 1HKHA 2OGZA 1K63A 4DNQA 3BE8A 4PSCA 3BXPA 5SYMA 1R1DA 2OXEA 3VVMA 5AKJA 1C4XA 2JEZA 4RE6A 3TGLA 1R9MA 1U65A 4AO6A 4NS4A 1EA5A 2DFPA 4KRXA 2Y6VA 3D2AA 2CZQA 4QWMA 4B7ZA 1ZI6A 3WWDA 1ZD2P 3D4LA 4LXGA 2EEPA 4W1PA 3ESDA 3WWEA 5K3DA 2VJBA 3STXA 4BCCA 3M83A 2C5GA 1CUJA 1G42A 1A7UA 4GBGA 1YR2A 3I2IA 2C4HA 1D07A 1AKNA 3C5WP 3VXKA 3CCBA 4K5QA 2VJAA 1XKTA 1LPSA 1TQHA 5A2GA 1P0MA 2XT0A 3WMRA 5JIBA 2QJWA 4Y2TA 2RGUA 5CT6A 5BWBA 3HZOA 1FFCA 2XMCA 1S8OA 2XUGA 2JGJA 2BJHA 2HDWA 1HPLA 5AI0A 2WFLB 2HA7A 4QDZA 2WILA 3PICA 3QVMA 1IZ8A 3S8YA 2WTMA 1Y7IA 3UUEA 3CXUA 4PO3X 5T4EA 4BAZA 1XZLA 4BRZA 5LZ2A 4G9EA 2VJDA 2WHPB 4J0CA 4LKOA 1VJ5A 3BJRA 2DCMA 2ECFA 1CQZA 2OQIA 2HU7A 3W05A 1QIMA 1WPRA 5CRIA 3MUOA 1EDEA 2O7VA 2GZRA 1JT2A 4W1SA 4X95A 4B80A 2DQZA 4H7DA 4UFPA 4AX4A 1IVYA 4HS9A 4BCBA 1XQVA 3BDIA 3PFBA 3O9VA 3P2MA 1LPBB 4H7JA 3NGMA 1EB8A 2WHRA 5JZSA 3QMVA 2HA0A 4Y2XA 4V2IA 1PV1A 5DLPA 5FRDA 1LPPA 3FYUC 1CIJA 1QFMA 4HXEB 1EDDA 1MJ5A 2VQ6A 3PDCA 3SX4A 4MYDA 2JIDA 5AK5A 3WK7A 1H23A 1QIKA 4HVTA 4ARBA 5ALOA 1GKKA 2DR0A 2RIPA 4BTVA 2WSLA 2DHEA 3WI7A 4B83A 2OCLA 4KE9A 4UPDA 1MNQA 4OYYA 3C8HA 4F5ZA 5C8VA 4UBLA 5CT5A 2XUFA 5AM3A 1QZ3A 5AI4A 2QXUA 2HA2A 2OAGA 4N8DA 3IIIA 4DGQA 2VT7A 2XUAA 1W1IA 4W1RA 4X6YA 3GBSA 2H9YA 3U0VA 4IQ4A 1HLGA 4FKBA 4M0FA 4FNGA 2WHPA 5ALHA 3VJMA 4BDSA 4AN0A 2WFMA 5ALTA 4H7IA 1MX1A 3R3VA 3V48A 3ZLTA 3TJMA 5AI5A 1XQYA 2PUJA 1QTRA 1XZJA 3C45A 2JBWA 2WUEA 2V9ZA 4BTLA 1UK9A 4J7AA 5HFNA 3B3QA 4C4ZA 5EHNA 3I6YA 3ESAA 4INZA 4BAGA 4ZV9A 2C5FA 3WWOA 2YYSA 4M0EA 3AIKA 1UOQA 2VA9A 2AJLI 5C8ZA 3DJYA 3FLBA 3WK4A 3FVRA 3G9ZA 4BVLA 2R11A 1H2XA 4H7EA 1AQLA 5T4BA 2GYWA 4OCZA 4DM7A 1GPNA 4J0DA 1Q83A 2WTNA 4QZVA 4DMFA 4OSEA 3LCRA 3WKCA 4HAIA 5LZ5A 3ED1A 3OURA 4GLBA 4B6GA 5AKGA 3FSGA 4OUKX 3RKSA 2XUIA 3LIIA 1XZFA 3DL7A 4UHBA 5AKIA 2RHWA 1I6WA 1WM1A 5DNVA 1N8SA 3I28A 4FOLA 5FV4A 2DQYA 3I1YA 5AHXA 5ALPA 2OQVA 4OYLA 1H2ZA 4O08A 4X97A 5ALZA 1UFOA 4Y2YA 1QIIA 2OCGA 5EIHA 2XUJA 1XQXA 1U4NA 2Y2VA 1DWQA 4DNFA 2PX6A 1NU8A 2V98A 3R3WA 2ROQA 4DYHA 3W9BA 5HK8A 4FFWA 3JYHA 4LXHA 5JANA 4ROTA 2OPHA 4MQLA 2D0DA 1W4LA 3C6XA 2CB9A 3O4GA 1ZOIA 4ZXFA 4A5SA 2ZJFA 2HIHA 2XE4A 4FWBA 2PKYX 3GROA 4L72A 1XRNA 3H2HA 2CKMA 4JYPA 2FJ0A 4RPCA 4L3WA 1DX6A 2QOEA 1E5TA 3AZQA 5EIAA 1HL7A 2BAGA 1LGYA 4UHEA 4K6KA 1UT6A 1ZJ4A 4CCWA 3K6KA 1TIBA 5AIBA 4FHZA 1QONA 2RONA 5FLKA 1THTA 3STTA 3IBTA 5HFAA 1CFJA 1CPYA 3ESCA 4B9EA 3HEAA 3C87A 4PV7A 3AZOA 1TCBA 4AZ0A 1CLEA 1YA8A 1QJ4A 3HSSA 4YASA 1XZIA 4AB1A 2DSNA 4BE4A 1UKBA 3WKDA 1MO2A 1LLFA 1LBTA 1UKAA 4K6HA 3WA6A 3DOIA 5EHXA 1SCIA 1RYYA 4QA9A 3WQHA 4EHBA 1BCSA 1MX5A 5FUMA 3G7NA 2WFZA 2XMZA 2V96A 4X7BA 4AO7A 1A8UA 4GW3A 3HXKA 1CUCA 1XRPA 3KD2A 1CQWA 2H1IA 2GZSA 1BROA 3E1GA 5EHZA 3LIPA 2Z3WA 3UUFA 1LZKA 3QMWA 1EK1A 5JADA 4HXGA 1EINA 2BUBA 2JGFA 1BEZA 5FDFA 2W22A 1WB5A 2H7XA 4Q82A 5DYWA 1N1MA 5HF8A 3C6ZA 1CUXA 2XDWA 4Y2RA 1XKLA 2JF0A 1JKMA 5EGNA 1XZHA 5AI6A 1VZ2A 3O4HA 2PSFA 2XUOA 2OCIA 4KYVA
chains in the Genus database with same CATH superfamily
4UHFA 1Y4SA 1Y1LA 2C4MA 1UK8A 3KHUA 2GXAA 3FKQA 4CQJA 3LDAA 1Z17A 1ZN8A 2ISSD 2C42A 2YN0A 2XXBA 3DZDA 4QPZA 5K8CA 1P17A 5C8YB 3AG6A 1XZPA 3HR8A 1QVWA 1ZJZA 2ZIXB 4TMVA 4UMEA 5EHGA 3ZWQA 2B4QA 4C76A 3AZPA 3AJAA 5BSKA 4QU8A 4CI9A 1JQBA 1DT3A 2GNPA 5IT0A 2YWFA 3KQTA 5K4HA 2YKGA 1SKYB 2ID9A 2FX3A 2J6CA 3VAZA 1VHWA 5CYFA 3T1QA 4AROA 1YQDA 4EHAA 5FADA 5M3BA 2WHXA 3RC9A 4D46A 1T0BA 2PN1A 2PVSA 4X63A 3SYTA 1ULTA 1CEEA 4HZIA 2XNHA 1UPCA 5T64A 3V1YA 3FFTA 4C0BA 1E7MA 2AD1A 4C0JA 3S5JA 3NM6B 5KWEA 2YQZA 2GESA 5TMDA 1L8OA 2XAAA 1QU3A 3GLFA 4WZAE 1Z4NA 4X0EA 1SC1A 2F59A 2O2DA 2NU9A 2V5VA 1C0LA 3CT6A 3GMIA 3OMWA 4TPKA 5AI9A 5EJMA 4IFTA 3Q5DA 3T7CA 4Q1CA 3EFHA 1FNSA 3MJFA 1S89A 3FUUA 5MF6A 1NMZA 4UTXA 4G37A 1YE3A 2UU9B 3FOAA 4FR2A 4B4UA 4LOIA 2G8LA 2Q1XA 2BFNA 4N3GA 4HTAA 3IOEA 4RPLA 3UWOA 3C7TA 1MXFA 4UAGA 1XHEA 1QRRA 3A6LA 3N86A 4X8MA 5AM2A 1P4AA 4XWWA 4JEMA 5K0SA 5JSKA 2C7OA 3PZBA 5I4IA 1ECPA 4M0PA 2CMKA 5H82A 3OG9A 4IXMA 3OKCA 3P9YA 4ZGGA 4RV9A 4YP5A 1EK5A 1DADA 3VYWA 2A0UA 2IYEA 1KU6A 4HDKA 4KVGA 1XMPA 3ZV7A 4DL9A 1X92A 2IYPA 2MJLA 2WMNB 2Z09A 2P9JA 4GVXA 1V5FA 3GAFA 2VG8A 4HWKA 4G1EB 4E33A 2CXXA 4AJHA 4LC1A 5LB4A 2IUUA 2FUNB 1JHXA 1DE0A 4Q4HA 3H1TA 5EEHA 1HE3A 3QX8A 3RK4A 3AJDA 3AFIA 2OV1A 3OIDA 5TNXA 2Q9CA 3WLHA 4Z4EA 5GJVC 1OD6A 1OX5A 3TX6A 4OLHA 4RPKA 1NYLA 3IQHX 3UWPA 1J09A 4M1OA 2VVTA 3NIWA 5IJ0A 1SMKA 1X0VA 4EPWA 1IWPB 3R44A 3TZ6A 1VTKA 2MR6A 4ZQEA 2QK4A 1U7DA 4FDLA 4MA4A 4C07A 2FCAA 5EG5A 2B4AA 1N2SA 2O8NA 1CUBA 1G8PA 2AOTB 3NUQA 4I55F 4I4CA 4R84A 4UXJA 1W5FA 3ZU6A 3TTXA 1I36A 1QE5A 2F00A 2I7TA 4HGRA 5IBRA 3SJZA 1OFUX 5CT4A 5B3AA 4PG7A 1G6KA 1CEXA 1O87A 4CDNA 4WCVA 4IYRA 1M2OB 1XTBA 3CLHA 1T0JB 3MT7A 5FOSA 3ZXSA 4YY3B 4GM0A 2FW7A 5K01A 3QU5A 1K6EA 3VYSB 3WLRA 1IHXA 1V5GA 4ZQIA 3SQLA 4R5MA 2YVQA 2V97A 1YA6A 3T6KA 4OGFA 5EE1A 3WLIA 3IUQA 2JFYA 3H8WA 1ZZEA 1T36A 2AQ8A 3L1JA 3TMYA 3OF5A 2PKXA 1GPUA 1NR7A 2NV0A 4FOTA 1M2KA 3EUFA 2P0YA 4G01B 3B3AA 1T3GA 2MMGA 4HYYA 5ESRA 3CISA 4FSXA 4WLNA 5KTNA 4WERA 3AI7A 5FD8A 2C1EA 4BUZA 2QNIA 2X9LA 3W8FA 3ZLJA 1YQXA 1SZJG 2NGRA 4MWZA 4N9WA 1U5AA 4RPHA 4KJXA 4QFBA 1NNLA 1X7ZB 4TVBA 5FX2A 3PNKA 4RJKA 3R41A 2I55A 5AW7A 2W9XA 5ISMA 5DNDA 4DJDC 1Z6XA 4GF5A 3QIAA 4BDTA 1KEWA 4TTPA 3LUDA 1KJ9A 2GPBA 3G2NA 3ZEAA 4KDEA 2Z6AA 4HFRA 2JVJA 1L5HA 5CBKA 5E2BA 5IXYA 2JFGA 4KUEA 1NULA 3LBNA 2EW1A 2Z0MA 3M1LA 3U5TA 3CO5A 3D8NA 1HM5A 4WOKA 4Q6BA 3OECA 1W4AA 4XD2A 1RKVA 3CW8X 4XD7D 4AJOA 3S3TA 4Y1GA 3W4IA 1H65A 1LZLA 2JD0A 3A04A 4MQ4A 5KO2A 3FX2A 2ZSIA 4OM7A 1KJYA 1L4FA 2J3IA 3A14A 1L3BA 3TLZA 3A26A 3ANLA 3T1HB 3I23A 1IVNA 2HFJA 1X38A 1U2EA 4BQEA 4HC4A 3ZBTA 1ZCZA 1XF1A 2FPGA 2C99A 3QHPA 1IRXA 5EIEA 4XGNA 5L4LA 5NLLA 4LJ6A 3DVAA 4R1NA 4KW7A 5FUWA 4Y6GB 2PFGA 2BBOA 2CJPA 1XOIA 2GI4A 1PW5A 2YNMC 4FR5A 3H18A 2ORWA 1DNPA 2J07A 4HH4A 4JGBA 2I91A 4EG7A 2GZAA 2JFQA 13PKA 3D59A 3PC7A 4JXKA 9ATCA 2EJWA 1CUZA 4GQAA 1FW8A 2NTVA 2FPKA 3FPKA 4OOFA 2BZGA 2ZG6A 1KXZA 3Q3IA 2PZAA 4L3OA 2BOVA 1LPAB 2J7PD 4GM1A 5FT9A 3WHIA 1YONA 1QRSA 1E94E 5L51A 2GD2A 3HYRA 2WDZA 1OBCA 4B87A 1GTJ1 4TV8F 1JVNA 4UM7A 3ZDXB 1EUZA 1S2DA 1R0YA 2VA8A 1VXRA 4YO8A 3PSAA 5A04A 1CDEA 3S70A 2GJ4A 1QO0D 4TL7A 2B5VA 3QV2A 3AVXA 2UDPA 2A3RA 3WNVA 1V39A 3CNNA 2QKYA 2INGX 1K8XB 2PA3A 3E7WA 1AURA 3R3UA 3NANA 4L8VA 1A5TA 4DPMA 1SUCA 4OB6A 2H4HA 4JBWA 1T4BA 2Q29A 4CBVA 5KYGA 1QAMA 3LWZA 4XVQA 2FVYA 4QUBA 1RXEA 1FRVA 3E9CA 3TCXB 4RDXA 4MWGA 5IT4A 1BU5A 1BXKA 2H52A 3EIUA 1PK9A 4F0JA 4RO0A 3EPLA 2PL9A 2AFHB 3G9UA 3CNHA 1N5IA 2PUWA 2QRZA 3IBYA 1UT8A 3UAZA 2IK8A 3FB4A 1T9CA 1N0IA 3IUJA 3K5PA 4K05A 1N2CB 4TGLA 4BNWA 3SHWA 5C4MA 1QHFA 1ZK1A 3NTRA 5H59A 5U9CA 1NW6A 3E6AA 3GQBA 5JAZA 4MRAA 2AN9A 2HUPA 4WESA 1TEXA 3WB0A 4JXXA 3WXMA 1HX7A 2XPCA 1B3BA 3TLBA 1JA9A 5JI3E 1R74A 5AVQA 3VPGA 4NCKA 3INNA 1H0SA 1LI7A 4K6CA 4DBLC 3O8QA 3ONWA 4MR8A 1RMQA 3ZY5A 5IVKA 1PJZA 5EC8A 2AWOA 1KIMA 3U37A 1U3CA 4AO8A 5FLEX 4X6UA 2ZETA 2Y68A 3B6ZA 2RARA 1OTXA 5K8LA 1C8KA 2XE6A 4B0OA 3W5BA 5JI2E 1RBZA 3ZIDA 4J75A 1T5OA 1P73A 3CVWA 2OBBA 4FHFA 1T3TA 3L6RA 4JEIA 2HWXA 1CB0A 5K5EA 4HO1X 3N2KA 1BYIA 4YRKA 1NHGA 4ER6A 3LDHA 2Q07A 2B5OA 4PIMA 3F9RA 4IRUB 1UMBB 4L50A 3JQDA 4IJKA 2O2CA 1C9JA 1N57A 2XDAA 3ZD6A 5LDGA 2GN6A 1YFKA 4XFKA 2G80A 1G4HA 1MIOA 2BJWA 2VDJA 1NYRA 3K8ZA 4LRTB 3UJHA 1FUIA 1YOVB 1RC1A 4C06A 3HU2A 3SLGA 1M5RA 4MINA 4C0SA 1CYDA 3X2FA 2G67A 1JZSA 3B78A 1UAAA 4G5YA 1PO7A 5JLAA 4NK4A 1HQKA 2VXBA 1ESNA 2VNJA 4IIJA 2Q1SA 2H2DA 3ACDA 4RTRA 1H22A 3EIQA 2HL6A 1NDUA 1D6NA 3FCSB 3IRVA 2R3SA 3M5DA 5DRYA 3IS3A 2R7LA 4JSYA 3LW8A 5AK4A 3E5HA 3T99A 4OM8A 1ILEA 2ZRBA 3FR7A 4IILA 5IJZA 3HCPA 4Y6PA 4J0JA 3LUKA 3MGCA 5F1PA 1SCDA 4BMZA 1VIVA 2XQFA 3DO8A 2QM3A 3EIXA 3HA3A 1SCAA 1KK0A 3PL1A 1GG2A 3AHEA 3V1UA 5J4VA 2LP4Y 2NVOA 4DKJA 2Q4BA 1V3QE 3TB6A 2VLIA 2FX5A 4EHFA 1KGSA 3DR5A 3DAYA 5AVXA 3FKSA 2QP3A 3ZZ0A 4AZ3A 3THYA 2PD6A 3AU8A 2ATIA 3C7DB 3ESQA 3OCYA 4OHRA 1UBJS 1XZMA 3VZRA 4ETMA 4GDMA 2Q5FA 5C81A 2YDYA 4RVUA 3G9XA 5FFMA 5KDDA 3GLFE 1TMYA 1NF3A 2QRQA 1CXZA 2O2JA 3CF4A 1E8MA 1ZGAA 3DDNA 2AJBA 3M6XA 1C0KA 1GTG1 1TW3A 2ZSJA 3D4BA 4HRXA 4IOKA 4NDNE 3ZYZA 1YR3A 1N7IA 2BHRA 1Q7TA 1HDYA 2QJFA 1OZHA 3FMGA 2NU7B 3MJRA 3S2EA 4DVGA 1JTVA 1YFLA 3FCXA 3ICCA 2PD4A 4RIHA 4HDAA 3RUPA 5CYOA 4RKWA 2DUMA 4AY4A 2NIPA 1IH8A 1XEFA 2CFOA 2QTHA 4DLWA 1IAQA 1TLLA 4YP6A 3CH4B 2FRVA 4E7OA 3HYLA 4WCFA 3TECE 1KBZA 1Q0RA 3FKSD 4CN8A 1E66A 4H3HB 2Q4TA 4NWIA 3TQQA 4F3RA 2HI0A 2GF9A 5I9LA 3WK6A 2CV0A 3DW3X 3FVVA 3QLVC 3HB9A 2E0IA 3NKFA 3OZWA 1KDYA 3E9ZA 3T9CA 3AVWA 2OZLB 3E9NA 5B1HA 4G6ZA 1PGNA 1R3DA 2P0EA 4RVCA 5G1PA 3UFXB 2AFVA 5TQJA 1VG8A 5BVGA 3O4VA 3BILA 4YJ3A 1Q5PA 2JJ8A 3AB8A 1LF5A 3DBRB 3C39A 5TT0A 3W2FA 3WL3A 5ICCA 4AQYB 5AW2A 3CH5A 3VV2A 4EHIA 3EARA 1UXHA 3D0OA 3WX0A 1KJZA 1E8NA 4L4UA 2OG2A 4FGWA 3WZMA 4PWZA 4U7GA 4HDMB 3I3OA 1F9EA 1ULUA 2ODPA 2XHZA 3VO8A 4DWJA 4YAKA 3QYAA 4UMVA 1LTQA 2JJYA 3I39X 4JN6B 4BV2A 3KQLA 3F3SA 4LHVA 1V43A 3T38A 2AN3A 5J1TB 3M2PA 1B8PA 3VVBA 3R9XB 5C7OO 1G7CA 3PGMA 1ID8A 4FBLA 1JDBB 4DLNA 1F51E 3D7SA 2I66A 3M7IA 4PYJA 2HLHA 1PNVA 5CEJA 3QBJA 4IGKA 2O0HA 1FTSA 2WF8A 3JWEA 5M7EA 1HNZB 1IM5A 3TLGB 2VCHA 3GJRA 3SQOA 1Q7BA 2JAUA 4P86A 5CFPA 3QVVA 2J09A 2ZUEA 1NI4B 4A6EA 2VBCA 3L4BC 4OF4A 4EWLA 1NVAA 1RI2A 4FMDB 1K06A 2P1RA 4IS2A 4ZT7A 1XX6A 4NFYA 1L8XA 3LVBA 3M81A 3BXEA 2QLNA 3OOEA 3OZXA 1VKNA 1FDSA 1I9GA 1H4VB 1ZA1A 4YT2A 5LU9A 1YL7A 1ID1A 2PS3A 2UYOA 5E1DA 5K20A 4NSNA 5KWVA 3B1YA 4OKIA 4BZWA 1YRLA 5HKKA 1TZ2A 2A2ZA 2C2WA 2QVGA 2VN8A 3IOBA 3LC2O 5IFKA 3Q1LA 1HKUA 3RRBA 3SOPA 3DV2A 3TNLA 1NRIA 1GDDA 2B3DA 1WDMA 1U8UA 1QIFA 2M98A 4J7XA 4RZUA 1WPXA 3KKQA 1NATA 3KOOA 2H0QA 3CRMA 1XNJA 4F5WA 4YV1A 1CV2A 3TFOA 1XTPA 2E5FA 3FE2A 2RHOA 1C3VA 5C34B 1FP4B 1P1IA 1CTQA 1L8QA 1XTJA 3TTUA 1F6DA 1I4WA 1RWVA 1YJAA 2E49A 1PYDA 1PFQA 1W94A 2VKTA 1SVNA 5G3YA 2WQZA 1M5UA 1Z0UA 4AJPA 2FG6C 1EEXB 3VKFA 1TEVA 1IZYA 3F9CA 4R83A 2O5EA 2X2OA 2Z1MA 3FCCA 3LHFA 5LZ8A 2F64A 4YR9A 4Y3UA 1ETHA 1BX0A 1L4LA 2BKUA 3Q8WA 5GY7A 4NCHA 4PRKA 1EX1A 1IBSA 3DKRA 2QX6A 3IPCA 5E9WA 4MQUA 3SCZA 3EXEB 4BC0A 3LW7A 1OKKD 1LI5A 4TKZA 4MDFA 1EDBA 4RHYA 5J59A 4KO2S 4A8JA 2WG0A 2BFBA 1T1RA 1U94A 4XJVA 2PQ6A 2YHUA 2OXTA 1Z38A 2C8LA 4EVRA 4Z3OA 3DV0B 1L4YA 4B34A 3GJYA 5CLJA 3SZOA 3D6TB 2B69A 3ZIAA 4RXTA 1ND6A 3GCDA 2FQXA 3IIMA 1U0SY 3M49A 5GGXA 1TU4A 1LU9A 1ITZA 4BIMA 2GZ3A 2D62A 1R6UA 3SLRA 1HF3A 3IJPA 1A76A 3FHLA 3K73O 1WQ4A 4ZYUA 1AX9A 3AIIA 2QMYA 4QDKA 2EBUA 4R2WA 3GVHA 3TSOA 4BGUA 4MEAA 3L1HA 3NWPA 5JZMA 1R5OA 1SA0B 3DE1X 2OZPA 2B4YA 2VDMB 2QRUA 3CYFA 2O7NA 3L0DA 5KKCA 2CL0X 1EUYA 2Y77A 2B30A 1Z2DA 2WYOA 1FVOA 1T25A 3QUAA 4B6RA 2G82A 4JP8A 3ZWYA 4KGZA 3ZDAA 3EVDA 5HCIA 1AY0A 1Q3TA 4GPAA 1E4YA 2NU9B 5IH7A 4MQ5A 1VIAA 4HUQA 1N1EA 5FXMA 4JT9A 1L7NA 1U2GC 1UEIA 4BVFA 2VYCA 4C5CA 4DIDA 1H9CA 2PH7A 4NHEA 5K2OA 4O3MA 1GPH1 2C5HA 1KFJB 1NW8A 2BI7A 3DMNA 1QDLB 4URWR 2YBDA 4DIKA 3D5TA 4DLAA 1N25A 4O2AA 3PQ4A 4F6CA 2QRLA 1NN0A 3H2GA 5FYDA 4ED9A 2O5RA 4DEYA 2R86A 2JIMA 4DLTA 1RXYA 1LW7A 4BATA 3CH6A 1X0XA 3PDJA 1NLZA 4R81A 3U4CA 1VDMA 4HH1A 4W5OA 4QLAA 1I3NA 5EI5A 1BN7A 1WA5A 4IHQA 4OAPA 4RPGA 3TGWA 3ZLUA 4ER0A 4YAIA 5C2JB 2R1VA 3G8AA 4ETNA 1Z47A 4EB0A 5L4SA 2JZNA 1IB6A 2P2YA 1CUYA 1QC5A 2W6ZA 3CJRA 4W9RA 4E14A 4EF4A 2VJOA 2SKDA 1QHXA 1KO7A 2CW5A 2NSLA 1IXRC 4NBRA 3YASA 3GLKA 2CVPA 1Y5LA 1FTGA 2PUVA 1M74A 4IDQA 1IHYA 4IJ5A 4OGKA 3U9LA 4ENWA 1XBTA 1UBHS 1TW2A 2VUSA 3ABQB 3QF4A 3NHBA 4R0NA 1L6IA 5IM4A 4OU4A 2XTAA 4C7OA 1XJ0A 1JIKA 3I2JA 3CWQA 4I08A 3BL8A 3BZWA 4WZZA 3J7AC 3KTFA 1N6PA 5FB3A 3FF4A 4PXSA 3QPAA 5LKAA 5TQ2A 2IPOA 3PU6A 1MN6A 3PEFA 4M88A 1W59A 4MS3A 1FTNA 5LP6B 3AI2A 1J24A 2NZWA 3D2LA 4JT4A 1ZMOA 2Y05A 1KI4A 1D8TA 1ZNZA 1DBQA 1S9HA 3IEXA 3IMEA 5BUZA 1JB9A 3GRKA 5CJJA 1UAGA 2BI8A 3MT9A 1JBEA 4QU5A 1P1FA 2QG6A 2QM8A 2VDQB 2QTZA 4CIDA 4EF5A 2FU5C 2PUEA 4YHHB 1SBHA 3MT0A 3J81k 1Z3CA 3WGNA 3BDAA 3I09A 1E5VA 1NLUA 2E21A 2GLXA 1N5RA 1NMYA 3AF2A 3RQIA 4BX9A 3EBPA 3L06A 2G4VA 1ZD3A 2OECA 4V03A 3WLLA 4D9HA 1M75A 4AKTA 2VEOA 3ILHA 3R20A 3K8QA 2O19A 1M34B 3T3OA 4PHFA 1SWWA 3IEMA 2C9BA 2C00A 2ZKLA 5AR1A 1G8MA 1VA4A 4UD2A 2XTJA 3NEYA 2KSQA 3WGHA 1DCTA 4CMAA 1M54A 2V3CC 3GJ3A 3LBIA 1TCUA 1ZH4A 5CNKA 2FH5B 5KSOA 1EWVA 1CDOA 2VF4X 2WBLC 4YBRA 1HYEA 1OLUA 4ZYTA 4ID9A 3TQIA 3VTZA 3NASA 3PBKA 4C2BA 5HIAA 1GZ6A 3MWFA 2YASA 1U04A 4L1KA 5G41A 4G36A 3X1MA 4CTJA 5KINB 2OO5C 4P4GA 4FMBB 4G26A 3V9PA 3A6ZA 1ZGZA 5DFAA 1KMMA 2C1XA 3DWEX 3MGAA 5A0TA 4GWKA 5J5AA 5SICE 3E05A 3LYLA 3BM5A 4YWJA 1X14A 1MFPA 1NMSA 1FF9A 3HYCA 4CM4A 3USCS 2PMCA 1OX4A 4Q1DA 3MG9A 4JK3A 1A9PA 2XITA 1UJMA 3F8SA 4AS1A 1EVQA 4PFKA 1RAAA 1GRQA 2ALJA 3E7FA 3QY0A 4AJKA 2AK2A 3NEAA 1GAQA 1BE1A 1Z4IA 2O5VA 4X54A 5M04A 2J3DA 1NW4A 4G63A 3CCCA 3KZNA 1O95D 4KBYA 3W04A 3P0RA 3WL7A 3R6LA 5COBA 1ZIXA 1QBGA 1ZD8A 2P9CA 1WHTA 2Q6VA 4Y67A 4MVYA 4NPAA 4P22A 3SXJA 3HJFA 3AHCA 2HSJA 2YQ5A 4IIUA 1E64A 4MKRA 2HK6A 1P6UA 1ZUWA 2I1WA 2I2AA 4W7SA 2GEUA 2P75A 5EIBD 4CR7A 4FB5A 4WK6A 3CLRC 4HVAA 3I9FA 3JQAD 3UJ9A 2DHDA 2IDJA 3GOQA 2NZXA 2BGLA 3OE4A 1P80A 3TRDA 2NSHA 5ED4A 2NYVA 3BIFA 4QM6A 1RAGA 4R0MA 2GSDA 2FZGA 1UBTS 2AWNA 5GP1A 1BE8A 3O2JA 3ZY4A 1FYDA 1WV0A 4DMUB 4EIWA 4BZPA 2E7ZA 3TINA 3F90A 4M7PA 3E03A 3PD0A 3MCZA 5DMXA 1OY1A 2BI4A 2D0IA 4QAQA 4B71A 5SZKB 3UIEA 3DLTA 1AD2A 1JN0A 1G6Q1 1V8OA 1KMHA 1Y7LA 2CF5A 2IF0A 3BWVA 3N8IA 5D7BA 3TH5A 3VBEA 2VJPA 5B64A 1EP2B 3WC4A 1G64A 2YYYA 3PGKA 521PA 2QTBA 1RAFA 3QNMA 1JTFA 4CM9D 5MGBA 2J9RA 1W5BA 4AMZA 1R6AA 5DHQA 1K27A 3KQKA 3BB3A 3LV8A 4CV3A 5L7TA 1E4EB 2QGZA 1PDOA 1QMGA 3QNUA 5DGDA 5ES3A 3TAXA 1KPGA 4DLUA 1GILA 2PLWA 4EY7A 4XAQA 4BE7B 2ISQA 5CNIA 2ZZNA 1S8NA 4KTTE 2AR0A 4MZDA 1JW9B 2DFLA 3OFSA 1Y81A 2OYRA 1UBGA 3QVUA 2ZDGA 4K86A 1LBIA 4NLLA 5KJCA 1XK6A 1XAGA 1FBTA 1RWOA 2GAOA 3F5FA 2RGEA 4YJGB 3OWHA 3PTZA 3RS5A 4YMIA 4URVR 3I62A 1J0DA 4EFMA 4B0PA 3AEUA 3LVFO 3TRIA 4B40A 1MX9A 1DAGA 1GUYA 3RU9A 3RADC 2BSXA 1XXHA 5ECGC 3KKMA 1XIVA 2V6GA 2BL4A 5JXJA 4GXRA 2ZAOA 2A1UB 2Q5OA 3LXXA 5ADVA 1Z29A 3O0TA 3U7EB 2P9BA 1Z75A 5LOVA 2X9VA 3L84A 3NDJA 1H2WA 1UFRA 4HDNB 3TI7A 4RFLA 3TXYA 3GT0A 5AKHA 1KMNA 3UT0A 4JJIA 4MVJI 3FSGD 4PR0A 1Q2XA 4UCWA 2BTOA 3THOA 2OHHA 1NAHA 3DQQA 2FVXA 1BCRA 5I9TA 1MJGA 3G5LA 1SD5A 3ROFA 1P45A 4A8HA 2IHNA 1JSZA 1ZLYA 2I3ZA 4XM1A 4RMGA 1U8FO 1XB2A 4IFBA 4Y9UA 4XEHA 3PQFA 1OXBB 3LTEA 4KMSA 5A3SA 1VLQA 4KGVA 5H68A 4ZGWA 9LDTA 3Q9SA 2ONZA 1YXMA 3N8KA 4YP0A 4KAJA 2V8OA 2VF2A 3TMAA 1GT91 3KWMA 2Z58A 4IPTA 2VQFB 1L1QA 3PHIA 1EHCA 3V6MA 5HM8A 2NU8A 1X15A 3BD9A 4C04A 2V4MA 1MT0A 4FGLA 2FMTA 2WJPA 1AK2A 1UPBA 3MBKA 3A2KA 3RYHB 2OBYA 3QKSB 3LDUA 1X2EA 1J21A 1YHNA 1QUFA 1RHMA 4HQRA 1Y8ZA 3MTQA 1QIJA 2KBEA 3SIRA 4QM7A 2E89A 3ZR4B 4YMHA 4UKDA 3ZQKA 1N5OX 4MICA 2Q8NA 4KTVE 1LPNA 2OG1A 4BNYA 1HT2E 1WSDA 2OSVA 4TSKA 5LA6B 2YHBA 4M1TA 5E7IA 4AYTA 2G06A 3O2NA 3JQBA 1KFCB 5DLYA 3KPUA 3IH5A 3DP9A 1D6JA 1UDBA 4IXWA 4IIFA 5K3CA 1EVLA 4D5GA 2AZXA 3DHWC 3ESBA 5IDVA 4BRUA 3ZW8A 1GPAA 5BQFA 4FMCF 1T2UA 3B9PA 2WD9A 2WZCA 4OP3A 2HHJA 1MOQA 2AKYA 2XRFA 3KDSE 3Q7IA 2C57A 2ZWIA 4UQOA 4LA4A 2A0XA 2VPWA 1RI4A 4TZTA 4HGZA 1HFJA 1TZMA 4JLWA 1PUXA 4PX2A 2UVPB 2QZ4A 1UQUA 3OO0A 3L18A 5KYUA 2ZIZA 3S2YA 1SU8A 1W75A 5ITZB 2GEBA 1JDJA 1FYVA 2HRRA 5FWXA 1VG9B 5BSTA 3DLHA 2WJWA 3LF2A 2XADA 2WWHA 2IXDA 3GJ4A 4EZIA 3VHLB 1U2SA 2WTAA 3C3BA 5CPBA 1FXWA 2CVOA 4L5CA 1GCIA 4H7KA 4B7AA 4Q9JA 3GXBA 5KX5B 3IVMA 2HRBA 2YVUA 3SZLA 2JRCA 3B1VA 3TIVA 5C7LO 1J7JA 4W5WA 1MB3A 4CEHA 4V0OA 3MWEB 4CL8A 3QMPA 3LX6A 2EP8A 1I2BA 3ZQ6A 2DUUA 2VHVA 2F67A 4YCAA 1IEQA 3ROTA 2VUUA 2FLWA 3K7EA 3A4YA 1UMKA 1RQGA 3WBKA 2XKJE 2ZJ8A 3ZGXA 2KJQA 4ETWA 4R9SA 1SBZA 4X8LA 2RAVA 1L7RA 1PJSA 4FKZA 4K7JA 5LLSA 1F1JA 3X43A 4ARZA 2IVZA 3AWDA 3O8OA 4DG5A 5AD1A 2QX7A 5I01A 2AMVA 1OTHA 5HTKA 3GT3A 3ETNA 3L82B 4Z4HA 3H9GA 4PRZA 5CVTA 1Q74A 1YI0A 3KX2A 5MN6A 3WGVA 2BMWA 2FR0A 1LF0A 1X13A 3QFSA 3S99A 5LQKA 5JWHA 5BNZA 4ZMBA 1ZNXA 3G5TA 3VHXB 4RHFA 3GNSA 4QJ5A 1DUSA 2TMKA 4IVPA 4UOZA 2G0AA 4RCVA 4JBXA 5DWDA 3R7SA 2FHPA 2X0IA 3MWDA 3IJRA 2BFCA 3MRSA 4UAVA 4Z7OB 3KTDA 2I5PO 4N6GA 1Z8DA 4AP5A 5JAMA 1Y6FA 4XRRA 4F9GA 3AO0B 2JAHA 1LD3A 2FGJA 2CVQA 2X4GA 5E4TA 4BEBA 3M8KA 1QPBA 4RK0A 3HLYA 1MABB 2QF7A 2QYHA 3D8SA 3WVNA 3CWZA 2HIMA 4NU6A 3D8TA 5L7YA 5K0JA 3IE0A 3QLUC 1BDMA 3AEQA 1DX4A 5KYYA 2CLIB 3KAKA 2WIFA 4LZWA 4D3DA 3QE2A 4OL0A 2GETA 2OD2A 3HH8A 2HQ1A 3F7NA 3WGZA 3WRWA 2J33A 4C6RA 2FDRA 5I48A 1UMBA 1B6RA 1QH1B 2PT9A 1DQZA 1XLTC 2B99A 3BSFA 5CFLA 1OV6A 1H2RS 3OUUA 5K3FA 3MJEA 3FYSA 1GSAA 2QMQA 3L7MA 2IU4A 4ZHQB 2VFAA 1X74A 4HZGA 4JJGA 2PGOA 3GJ5A 4RA6B 4NNPA 4PZ9A 1SQFA 4MRPA 2VJMA 3ZHSA 4K0RA 2ZVJA 1SCNE 1II0A 3DE6X 4ZYVA 1LDNA 4QXOA 2BSQA 4LZZA 1OLXB 2I2CA 4RVDA 4F06A 1GGFA 4MCHA 2W8ZA 3LF1A 4FYIA 1UP6A 2RGRA 3A2LA 2PKQO 5EKUA 2C7VA 2B8EA 4YK7A 1LNQA 1U9CA 4IHJB 4WAUA 3RABA 3CVXA 4CMCA 4JIMA 3R3YA 4BN4A 3H7AA 1L5LA 2UXBB 3H2IA 1SFRA 4NICA 3CPHA 3KYDA 3QOXA 5ALXA 3KKEA 4YRSA 5DK6A 5ALLA 4LJ8A 5JRZA 4P36A 4M8KA 3A25A 2XD4A 1KJQA 2I4IA 2QRHA 4MCAA 1C9KA 1D04A 1IE3A 1Z5GA 1ZUNB 2JGKA 4GL4A 4LHYA 1U3FA 1S9DA 4NMLA 4W63A 2CUNA 2MSKA 4MKXA 2V3VA 4IH1A 5E6UA 3WO1A 2RI0A 4B5LA 3RM3A 4C08A 4ES6A 3ZBQA 3Q7EA 1X1DA 1B15A 3R09A 1UDAA 1E4VA 3ZDRA 4EUSA 2D5BA 5FA6A 2OY0A 2QL5A 3AUTA 4QBIA 1LTHR 3V4OA 4DDHA 2CSUA 5JH7F 1QIEA 2QTLA 1THMA 2BR4A 3NS7A 2OGSA 1IBLB 4CKCB 2NN3C 1X94A 1QOZA 1EXMA 4P5EA 1KC1A 4YXWD 3L1KA 1R0KA 5HRCA 3EIFA 5BT9A 5IG2A 4DJEC 5P8WA 2V58A 2P3SA 3W34A 4CF4A 1EK2A 4EY8A 4IUDS 5J2UB 4RTMA 1UODA 1B1AA 2ZIEA 1P0PA 2P6OA 5AXCA 2FRDA 3OZCA 4EGFA 3EC2A 3D3WB 5E9JA 4CG2A 2Y1WA 2QLLA 2AXNA 5DSTA 3SM9A 3GDHA 5EWLB 1Q14A 3DL0A 4NOJA 4O4HB 2W11A 3TKYA 4RH1A 5AH0A 4CUZA 1COWA 4BO3A 1Z73A 3J7TA 4REQA 2PYIA 1OTYA 1QIHA 1AKRA 2W37A 4DCSA 1BQEA 4JI8B 3R7BA 4BRWA 2RKWA 2EZ9A 3V42A 2Z4RA 1NAIA 4HLNA 4PO1A 1PTKA 1I10A 4N5HX 3QEOA 3SSNA 1XZAA 1AV6A 1QS0B 1EFRA 2XAUA 1NUUA 1SVWA 1MDFA 3I0MA 3LO8A 4EI2A 2C3YA 2NO9A 1KQFA 4GDFA 3HN6A 4EAQA 1PJBA 4RW0A 1JEAA 2F3UA 3FTEA 2EZ4A 1MJGM 4HX9A 4JBYA 1OX4B 2O1SA 3SEQA 2GVNA 3CTPA 3FIJA 4IDGA 1FL9A 4D9NA 1J49A 5IAAA 5H0IA 2Y1KA 3IURA 3L6EA 3AG5A 5KVSA 2I3DA 1GA4A 2OILA 4PNPA 3GPBA 4X65B 1HMPA 2OBNA 4KWHA 4DARA 5LDHA 4CKEA 3FSJX 2DHRA 3P0JA 3UJAA 5I3ZA 4JL5A 4K3UA 4S0XA 2FW9A 5HXAA 3AUFA 1NFRA 3JD1A 1WKBA 4R31A 4CF3A 5CG2A 4B3CA 4LSGA 4YI5A 1KBOA 2QEQA 5CFNA 4QXRA 2AC7A 2DFVA 3NGXA 4JLUA 1DCFA 2OFWA 5HCUA 3DTVD 3OQJA 4CDMA 3OE5A 4DZZA 2FEXA 4ZXPA 1KDVA 5KNBA 3TNFA 1B74A 1WHSA 1DTEA 1RBMA 5AK0A 3HCRA 2QTVB 4MUJA 3IOMA 5E1MA 5TARA 4J7CA 4UXIA 1TOAA 4F2GA 5LWQA 7MHTA 3L6UA 1PBTA 1MU0A 2QUHA 4NCXA 5JVDF 3FAZA 1QFJA 4IY1A 4L27A 4X45A 3ND6A 5HE9A 1LJLA 1QHIA 4AF6A 2QAGA 1T9AA 4ZT3A 4JLDA 4AG6A 3BF7A 2ZR7A 1OH6A 1CNEA 2CYAA 4P08A 3TXXA 2BONA 4EYKA 1P75A 2AG8A 4Q9AA 2GYYA 3NHJA 3VDXA 3LTNC 1QKIA 1SXIA 5LJIA 1ECLA 2JJ1A 4Y1RA 2A1TS 3NHAA 3A1EA 2ZSHA 5FI3A 4DV7B 3THYB 2O0MA 1NQ5A 3DWFA 1CS0B 2CN1A 3F6YA 3NBZC 1WMBA 1JIXA 2Q99A 1S01A 3OE7A 4L57A 5F21A 3QKTA 1V35A 1W47A 4OGLA 4J49A 4G0VA 3Q40A 3S2GA 3V6LA 4CIYA 4HVCA 1X9IA 1HE8B 2ODAA 4K1LA 4B3TB 4GMFA 2YXPX 1Q17A 1G38A 4HMPA 2R8BA 4LF6B 1EFHA 1N2XA 3WP1B 4ENSA 1DO8A 3C5EA 3C15C 5EJEA 3K0SA 1FEZA 4U3JA 4MR9B 2ZB8A 1KAQA 3GRYA 5CGZA 1QGDA 1QXSA 3TX2A 1DQRA 2ZUBA 1RZ3A 1YDWA 3LSTA 1YQEA 1WU7A 2J9XB 2HYDA 5IVHA 2JLUA 1TU0A 1HFKA 1L8LA 1A2QA 3P9PA 3HZHA 5HOEA 2F55A 4PYMA 4YRJA 1Y8RB 5HIKA 3IT2A 221PA 1WQ1R 2PTHA 1EG2A 4O2LA 3GWGA 3TQFA 2XGSA 3JALB 4S1PA 4B6PA 5AHWA 3RVJA 1XCGB 1Z7GA 2GCNA 3NHZA 3JYOA 3BK2A 1P2UA 3DHNA 3BRCA 4RE5A 1HQCA 3RTDA 1UXIA 1J0BA 3IOCA 4JJZA 2PZFA 1H8EA 4BKUA 4RIEA 6ABPA 1TJYA 5LN1A 3G88A 1HTTA 4U6NA 3OSZA 3KB8A 3CF0A 3K2QA 3KJHA 1DDOA 4X60A 3WYFA 2PKEA 4QG7A 3UPUA 4NZZA 5LMUB 1VA5A 1C8BA 4K40A 1XRQA 2QLMA 1UFKA 4KRYA 5DN9A 4QYWA 3DEZA 9MHTA 2BHTA 2OENG 1GPWB 4KQ1A 4N0EA 1RJEA 4YRMA 1VYHA 2VATA 3P2YA 2BE7A 1DTSA 4HWGA 3STYA 1JBQA 1VMKA 4FYMA 1RJ9A 3OQ6A 1TF5A 4OHBA 4RA9A 3KQNA 3NPMA 3P4YA 1G9SA 5CVVA 5AKZA 4C7MA 5FL7A 3UJCA 5I7AA 4YRZA 1MO6A 2FZ4A 2Q62A 2YWJA 1QS0A 1VPTA 5JCOA 4L0MA 5IYZA 4L9RA 3F98A 3IMKA 2RH4A 5EINA 5JQGF 4PGFA 2NSJA 2VUIB 3GEPA 2JPDA 3KALA 4JYMA 2VHUA 3H2JA 3LHSA 1K86A 4GECA 3MA0A 2F62A 2RHHA 1RT9A 4UFOA 1SBQA 4CKBB 1UMCB 4LUCA 3KE9A 4GX2A 1Z6PA 3FUCA 3TTVA 2VNSA 1L3IA 2IEDA 3ETLA 3BB1A 2PVCA 1T8SA 2VPIA 2RHLA 2GFQA 2SBTA 2ANCA 1MA3A 1QOQB 4FYKA 1J0XO 2V59A 5CA0B 1IG3A 4LYJA 3L7JA 1R18A 2YY6A 5E4YA 2J9YB 4G5RA 5JRDS 2NO4A 3IUBA 2AFRA 2VSYA 4I66A 4DDMA 1H3EA 2CCGA 3W5AA 1DQPA 3LUCA 3N05A 4QECA 1OREA 2DPXA 1T9DA 4Z8YA 5SYAA 1E32A 1C0IA 1JQAA 5C5CA 2W42A 3RVRA 4L5YA 4F1JA 4LXYA 5EPEA 3TSWA 4BGDA 2GPAA 4EW3A 5KS2A 5KU1A 3FCYA 4F3NA 3H3JA 1NQUA 3QE3A 4BB5A 3WLAA 4QQFA 4TYQA 3OPVA 3RE1A 1ESDA 5J43A 2NQTA 2B0CA 2WPDD 3ZOZA 1OBOA 1J22A 2HLDA 3M4YA 4JD5A 3W8EA 2ZRFA 4C4OA 2NZ8A 3CSUA 2NYUA 2YJ3A 3QWIA 4X85A 2R8EA 2BFPA 3H2BA 1WETA 1KOFA 1DKUA 4R68A 1TYAE 1DIAA 5F9FA 4QUKA 1LS1A 2CWDA 4GLJA 3T61A 2H06A 3IT0A 4J1TA 4GZ5A 5IJ9B 4LAFA 1JEEA 3LPAA 3U60B 1OH8A 4O0MA 4RTNA 4L0QA 1RHJA 3QVXA 3EVCA 2I78A 2O1WA 4JJEA 5DKFA 3OY2A 3CNLA 1QR6A 2BHLA 3HLKA 3DDSA 1HLFA 5BRNA 2O57A 3DKVA 1TUGA 1SM4A 1T6BY 2ACVA 2XUDA 4MCJA 3TW8B 4PZCA 4DWVA 1R64A 3EFOA 3UB2A 4O33A 4Y0VA 3GNLA 3LBFA 4Q47A 1WS6A 2OWDA 4UJ3A 4UHCA 4A91A 5BWMA 5IXJA 3MS4A 4DRYA 5BNTA 3HP7A 3W5SA 3N0XA 5ENDA 4RLHA 1MQAA 4HNGA 4DR1B 1X2BA 3K0BA 3MSCA 3IR7A 4O4JA 1Y34E 1W44A 1YI8A 1SXJE 2REOA 4WFJA 4O8CA 1LLDA 4E4TA 1CVRA 1I3KA 3DZ8A 3MJTA 4D56A 3LFTA 5I8ZA 4BEVA 2W6MA 3R5KA 4YGYA 5DW0A 5CDSA 1E20A 1V5EA 1NW9B 2FE4A 2IPXA 2ZRNA 5TX7A 3RSQA 1T36B 2CL5A 3N3AC 2LZ0A 3GFFA 2HY7A 4C4SA 3B1WA 1M1ZA 4YALA 2Y27A 4R1UA 1GQ2A 2VCEA 1SBNE 4JT2A 2CUZA 2J4CA 4X61A 3H9QA 3RS2A 1XEXB 5AMXA 2AUNA 2WYHA 4B6OA 2R0QC 3RSCA 3CUKA 4TL9A 4V02A 2E85A 2FPRA 4EJ6A 5SV2A 1FX0A 2WF9A 3IE2A 4J2TA 3E53A 1OFHA 4ZGBA 1OJ7A 2RJ3A 5J47A 3FGOA 1Y7PA 3I72A 4L9SA 5FUYA 3RRMA 4CL2A 2NVUB 3V8MA 2R6JA 1I7PA 1P18A 2W00A 2HR1A 2OA0A 4MVJF 1VL6A 2LCQA 3OFND 4GOND 2J6IA 4U8GA 1CUWA 3G0HA 1VECA 4OJMX 3MWLA 1U98A 1AF7A 1USVA 3M5CA 1CQIA 5C1OA 1KDRA 2O4CA 2IXAA 3EJWA 3F1KA 1A27A 5BSWA 3K9WA 5JDIC 3SWWA 5F23A 2WWVD 3EAQA 2G1JA 3DHYA 3P9NA 4YAUA 3URMA 2FEKA 3ZCTA 1TU3A 2R8XA 3A1SA 5I7OA 3D8BA 4YT5A 3RQSA 4D9FA 2EIXA 2YFKA 3BJIC 4YJHA 4YB8A 4RD4A 3VYVA 1UH5A 4YXWA 5JS8A 3K8OE 3G2OA 3NRJA 4UTVA 2D2XA 3QITA 4DXAA 3DEHA 5HUJA 1B0ZA 3D2BA 2XLBA 3UAGA 5AW4A 1X1AA 4J8PA 1N6LA 2PUDA 3HG7A 1LI4A 1WAMA 2GCIA 3N53A 2GNAA 3NBUA 5AKYA 4BFUA 4OPMA 5A5FA 1VFPA 3EN0A 2DUNA 2IXEA 1TK3A 4H0CA 4QOEA 4N9QA 1ODJA 1ISPA 3NU1A 4WEOA 3ZV6A 3NR2A 1ZX1A 3I5MA 1AGXA 3UHAA 5JUWA 1LRJA 3ZDBA 5FBLB 3FCAA 1ZBDA 1W1WA 1XVVA 4MUGA 3RW9A 1QK4A 1P2VA 1ONOA 3Q6IA 4WN9B 4EKGA 2EHJA 2CBGA 2FP3A 2VKQA 4ZOLB 1PNQA 3GARA 1FMJA 1RQ7A 3A3PA 3E8MA 2XXAB 1IY9A 1XTIA 2BRUA 3E82A 1PK8A 4NMWA 2FE1A 3C74A 2NV2B 1DDGA 2QRGA 3CUEF 5F3RA 4B4OA 1B8NA 4DSAA 5GGYA 1WLYA 4YIHA 1OYYA 2J3HA 1J8MF 4MUKA 2VTBB 1PFYA 4GWLA 2BR5A 3AXSA 4NDAA 4ZTBA 2YS6A 2Q2VA 3AX6A 3WGGA 4AKIA 4RIIA 4QNNA 2Z98A 5IJ0B 4PSVA 3BGSA 3GVCA 1Z6GA 2RBGA 4MWTA 3NHMA 3UVEA 1EM8A 3AJRA 3F67A 3GELA 3STWA 3IUNA 4MVJH 4TQGA 3WKAA 4ISBA 2OGWA 5E9QA 6YASA 1NU6A 5CT8A 3O4RA 5KSYA 2HA4A 1H2BA 5LCXA 4UZEA 4QBHA 3W79A 5JSFA 3ROKA 4Y2QA 3R7WB 1K7XB 2I71A 3FYTA 3TRHA 1W5SA 1ZJ6A 1XLVA 4CL0A 1D9ZA 2QUAA 1OSNA 1ONBA 1XRJA 3GPDG 4WCDA 3WGTA 4X64B 5B30A 5EVJA 5H3CA 4M1YA 4RWEA 5CX4A 2Z3VA 2XCSB 4FYJA 4CMBA 3J81A 4L07A 5BQOA 1EBBA 4MAAA 2VF8A 3T7EA 2PX2A 3H16A 5I7SA 2WJYA 3KSUA 4WINA 1S2GA 4EMUA 1O0CA 4LC9A 1IB0A 2VNIA 2Y1OA 2ZJBA 4MWCA 3OHSX 2HA6A 3F6BX 1C1DB 2EFYA 3MPUA 4B3GA 4CKEB 2ZJ6A 4GI5A 3RYTC 2ZULA 1RM5A 1QO0A 3QE0A 3AL3A 2A9JA 3U4QB 2EQBA 3LG2A 4DIBA 5JFGA 1VBMA 4WKPA 3BGOS 3QJ5A 2J41A 1SZDA 3NYRA 4G8BA 4YCNA 1WCIB 1JEYA 2FSVA 3H9UA 4PO8A 1HT3A 3FPHA 1V8ZA 3UCXA 3EXG2 3UT5B 2NTNA 3V9AA 1BW9A 3BBPA 2WJ4A 1G7SA 2WM2A 2CHUA 4EECA 2GKOA 3CWCA 4LY6A 4J3NA 5HZKA 1XVUA 1TTHA 1UFQA 2HNAA 5IEJA 1PW7A 4Q1FA 2WHQA 5ALKA 3V4FA 3TL2A 3F5MA 1IOLA 1YAJA 4CT4B 1M6EX 3QENA 1ECBA 2DX7A 3CZ4A 2H2AA 2QLTA 4NI5A 4TS4A 1Z4LA 5TPWA 4F4FA 3E27A 2H1RA 3QVGB 1Z63A 1H1TA 3W1VA 4F4UA 4BX0A 4LRSB 1Q2UA 4NJOA 1VYVA 5AICA 4LSZA 1RPAA 1I2MA 1VE9A 1C4KA 2IV3A 3R5FA 3ZD8A 4DBLE 4YQFA 1EQ2A 3RYCA 3L8CA 2JGMA 5JQGB 3LD9A 2HJRA 4TRRA 4EO4A 2OGZA 1GZVA 2OHOA 3NETA 4ITUA 1MC1A 3BE8A 1GPJA 4LX0A 1P0FA 3EXEA 4PSCA 4ECAA 1PLKA 2JIQA 3K5WA 1FQJA 3ISTA 2QRNA 4HTFB 1JR3D 1R1DA 2OXEA 4RETA 2RGNC 3VVMA 4DMGA 1C4XA 2JEZA 4RE6A 2VTDA 5C1BA 1YR7A 4JI0B 3G5AA 3LOQA 4KQKA 1DC7A 5FLYA 1F5SA 2GBPA 1M8GA 3EAGA 1PG5A 2Q5EA 3RO7A 1PVOA 2JJ2A 4AKHA 3ER6A 4NP6A 4WWHA 4NS4A 1DLIA 1EA5A 3UENA 2BMFA 4DR7B 4GPD1 3UWDA 4X24A 5LQJA 2AT1A 2Y6VA 2O54A 4COKA 1J9EA 1V1MB 3RT1A 3VU3A 5TLSA 2R8RA 2HXGA 3TKLA 3DVAB 4WX2B 1JEJA 1ZI6A 1HNNA 5EL0A 4DJFC 4V0MA 2DZDA 4PO9A 3RU3A 1C4WA 2PKWA 3SKXA 1OXUA 5AVYA 1KOLA 2V6IA 2ZATA 4OUDA 5DDIP 1LX7A 2CFTA 4W6QA 4X1OA 4ARSA 1NLFA 1I2DA 3DVRX 3DBHB 1EM6A 3CT4A 3LBYA 3MBIA 2Q3LA 4Q4AA 5F2NA 3ESDA 5I7FA 2V6JA 3QSYA 4ZT4A 5JEDA 5CPFA 4GMHA 3CRVA 5BURA 4OXNA 3VOTA 1BJRE 1ZQ9A 2OCXA 2OGUA 4PM4A 3IHLA 3UN1A 1T5BA 2PS9A 4BO2A 3ZU5A 3L5OA 3RC8A 1FP7A 1YC2A 3DWIA 1CUJA 3Q41A 4PLZA 4UXHA 3IELA 4PRLA 4K2HA 3REQB 2JAPA 2FHSA 3Q4GA 5LQRA 1WHTB 2NU6A 2K2WA 4RSRA 2R4UA 5MFPA 4G85A 1D07A 3TVYA 2EWMA 2KI5A 4LNHA 2COEA 4BV8A 2NTEA 3QELA 4LK3A 4KQCA 4TM7A 5BY2A 1ULAA 3SD7A 1H69A 1XDBA 2OC4A 3AQ4A 1QSGA 3C5WP 4RY0A 1KZ7B 3CCBA 4K5QA 4N7RA 3H86A 3N9IA 1E18A 1EQAA 2VJAA 2DAPA 4XPIA 5LBIA 5JHHB 4F3CA 1NUAA 2EFGA 2ZU0C 3QF7A 2Q6TA 3A4IA 3L0PA 1TQHA 5A2GA 2C7PA 1P3JA 4PONA 3TE7A 1N9ZA 2IUSA 5JIBA 2VRWA 5IMBA 4CLOB 4TTRA 2UYQA 4ZHQA 4GC5A 4RYLA 5BWBA 3VPXA 2XMCA 2JIRA 4B3DA 2XOXA 2QTGA 4PHHA 4DCOA 1UPAA 2XUGA 4JLVA 4KP7A 5IZ4A 1TO6A 2I3BA 4KQ9A 4D6XA 4XWAA 1QMPA 1DPFA 4V0SA 5FCDA 4LVOA 4TZKA 1D2EA 4UU8A 4BECA 5HBGA 1SIWA 1JF8A 3GZ4A 1QUEA 2W4QA 4J29A 3TL6A 2JLXA 1L7EA 4XLTA 1JH9A 1C8LA 4CQNA 1ICIA 3MWYW 1KKMA 1WBBA 2O48X 2VAWA 3S0JA 4BEWA 3IPRA 1E99A 1BA3A 4DSUA 4WI1A 1XCOA 4F3TA 4BBPA 3JV7A 1C9DB 2WILA 2FI1A 3RVSA 2X0DA 2D74A 2GARA 1IZ8A 2YJTD 3FMFA 3QVMA 1V41E 3S8YA 1X7HA 1PI3A 1P81A 3PEVA 4DIEA 1Y7IA 2GMWA 1H2AS 4WADA 4R98A 5B4UA 4CM3A 3CEHA 2X0JA 4ZAYA 1XZLA 1U11A 2WWWA 2ZB3A 3K1AA 4BRZA 1EVJA 4MW7A 2WT4A 1OYWA 4AG5A 5LVAA 1ZUNA 4JODA 4G9EA 1SKUA 1RLUA 1I0LA 4WHMA 4FCWA 4YAEA 2I9KA 1XAIA 4FFOA 5J40A 1KYTA 1Q44A 1T1GA 5KMGB 3CX7A 2FLKA 1E2IA 5GV8A 3MWEA 1GV0A 3BK7A 4E31A 2L69A 3DVQX 3MZ0A 4GKKB 4IRXA 4Y9TA 3H2YA 4LKOA 3O94A 1VJ5A 5FI1B 2DR3A 2VYQA 3G6KA 3NVDA 4O4LB 2ZOSA 3DBHA 3KOYA 4HWRA 4MX8A 2NNWB 5CK5A 3UAVA 2KW5A 3H87A 4B48A 2XB8A 1ST2A 4H08A 2RMKA 3PGVA 4INOA 2QMUA 2RG7A 4Y1FA 3U3RA 4DXDA 3ESRA 3QW2A 2Q0SA 2OQIA 2QM7A 3IAM6 3L9WA 2B7BA 2HU7A 2XYQA 2VP9A 1U02A 1WPRA 3QF4B 4DLSA 3IQZA 1CJUC 5AUPB 4LX8A 3THWB 3L7BA 3N0VA 4RM3A 4YJKA 4NQRA 4Z4QA 4PG5A 4RV4A 1II8B 2ODTX 3CSDA 3KQVA 4ZOBA 3TLCA 1ZUHA 2VSNA 3PNYA 1FXSA 4F46A 3B85A 4CDGA 1XDSA 5AVVA 4YAFA 4OA5A 2R48A 1O9BA 4H7DA 3HM2A 3GJTA 4BJ6A 1XQ6A 2N0SA 3K9HA 2M6SA 3ZY2A 4BCBA 1Q6ZA 1XQVA 3W4JA 3BDIA 1YKSA 2BFCB 3PFBA 3PCXA 1Q3HA 4KIWA 3KFVA 3VUFA 3QEAZ 4LRUA 4UNIA 4EHKA 4KRFA 1TM7E 1DHTA 3C85A 4KXFB 1CG6A 3CMCO 1AT1A 1YB1A 4H7JA 4UUPA 5MN5A 3FYDA 2XRMA 4I4TB 2NXEA 2DPYA 1ND5A 4LVCA 4ERNA 3QMVA 2J59A 5A9RA 3OJCA 1LJUA 2HLNA 3WJAA 1LVUA 4RVFA 2HA0A 4WIAA 4BMOB 4Y2XA 1R9GA 3A1WA 3G5MA 3U9SA 4B46A 4REMA 4TM8A 3TZQA 4ZCTA 3R3SA 2VXCA 1RLJA 1AJEA 3U09A 5GZ1A 3EDQA 3AB7A 3HCNA 2PWPA 5HR5A 1Y9ZA 3LQYA 4HDMA 1EIWA 5A2QA 3ZHYA 4XEUA 3QXHA 2JCXA 3ELDA 3HVJA 1ADBA 1JSXA 2HHCA 3IVAA 3PHJA 5EWLA 4B3FX 5BRAA 2X6QA 3B6JA 3D6HA 2QQ0A 2C2HA 1EDDA 2R6DA 4LZNA 4OAQA 2WYUA 4BQIA 3ZHTA 3NHFA 3TQHA 4HOYA 1RHKA 3PDCA 3IUSA 4MYDA 2NQ8A 2F3PA 4P3NA 4LFCB 1PJQA 1YU9A 5AK5A 4FDVA 5C37A 3WK7A 1Y1PA 4LN1A 2NO6A 4EKYA 3FPSA 1QIKA 1Z6YA 2LTAA 4D79A 3BWEA 3F5SA 2H17A 4L6IA 4I46A 2W70A 3THWA 3DMRA 1SVMA 5ALOA 3TVTA 2C2BA 1N2HA 3LQ2A 4OQPA 5JC8A 5DW3A 4A0QA 2JH3A 1ZIDA 4RJJA 1T8PA 3UGQA 4GXQA 1EVZA 2WSLA 1EFPB 2O52A 4C6TB 1D8AA 2ZRJA 5FQOA 5AXBA 4KSYA 5DEOA 5HIIA 2HJWA 5C3MA 1OLOA 3WAKA 4A9AA 1R4MB 4IDPA 4NYJQ 5GADl 4FM9A 5IAOA 2V7BA 3G89A 1TCVA 3OPYA 2ZYDA 3A7EA 4Y0NA 3WLJA 3HDHA 4M0DA 3UB3A 4ODIA 1ZH8A 2C9DA 3G68A 3H05A 2CHVA 3EPJA 3A37A 1YFJA 5AM3A 3KZ1E 1QZ3A 2ZXUA 4TLCA 2QMZA 3PX7A 4QUJA 2C29D 4UHKA 4D0LB 2JKZA 5K0TA 2Q2WA 5LMCA 4OLAA 3IIIA 3E8XA 2AZ4A 1NDQA 5GZ3A 1DKMA 1F2UA 2GPSA 2VT7A 3OQ1A 4G25A 4JB8A 4X6LA 5C35A 5LYJA 5IZCA 3NQ41 1QYCA 3K31A 4HX2A 4X6YA 5JNLA 4FYPA 1Q22A 4B09A 2QLFA 5AW1A 1BMDA 4UU0A 5F5LA 4ZKDA 1V5IA 4IQ4A 4IVNA 4S1NA 2JIZA 4FI3C 4N5DA 3TZHA 3FPGA 4FNGA 3GJSA 4MVJA 2IKQA 2C5AA 3H2SA 4EPTA 4XD7A 5BUSA 4H7IA 5GAJA 4F96A 5IVPA 2Z5VA 3N6VA 4HSEA 4I50A 5DISB 3UAYA 4BXOB 3LFHA 1SR8A 3MAGA 2CXRA 1TQDA 4MLDA 4MV9A 4LCJA 2AV6A 4RKFA 1L1EA 3ZLTA 5B6IA 3GA0A 1WF3A 2PUJA 4H15A 1QTRA 1XCMA 2XA1A 1M3SA 1REQB 2HSZA 1D2GA 1JLHA 1WMDA 1BS1A 3MRTA 4RGBA 3W2GA 2OMEA 3O7WA 4ND5A 3AWIA 1YL5A 3RHFA 1WF6A 3G6WA 3BL6A 2PZKA 4J7AA 4CNQA 2HXYA 4EW1A 3AFNA 3VAYA 4EZEA 3BD7A 1V8FA 3RB8A 3PX3A 3CLSC 4KV7A 5DHSA 1C9YA 1P77A 2HMUA 2UYYA 2C5FA 3DONA 2JD1A 3DAGA 4JS0A 4ZV9A 3WWOA 2NUAA 4AECA 4PCLA 4M0EA 2FFRA 2P7HA 1FFGA 1AUVA 1AG9A 5CX1B 2G5GX 3KKLA 4KDCA 4PQGA 5FPTA 4E0BA 1WTAA 1DC6A 4NXMB 3U49A 3UHPA 1QM5A 1CT9A 1U0NA 5D5HA 3VZSA 1GN9A 1ZRHA 2TECE 3EH2A 3R7WA 2R11A 1CZOA 1H2XA 1I3MA 2HMVA 1AQLA 2PGDA 2ZWMA 2ZJAA 4MQEA 4W9NA 4N47A 3JD4A 4D97A 5JAIA 5KSZA 4PZYA 5D1HA 1G0OA 1F2VA 2UUCB 4U9UA 1U28A 3ZCQA 3LQ1A 5JS1A 1GL3A 1J25A 1GPNA 4MKGA 1H6CA 1VE5A 2O8DA 4BBJA 3DZIA 2X9QA 5JDCC 2B1RA 3D8HA 4P32A 5A5GA 1GRCA 2CFCA 1ZRNA 4XQEA 4NYMQ 2DGDA 3ND9A 3WRXC 1ODLA 1U3WA 3LCRA 3M3HA 4HAIA 3K05A 4BGIA 3CZQA 1X42A 1U2ZA 3JRNA 5EMJA 3OU6A 4QHTA 3KSBC 4ZQHA 4RTLA 1WXWA 1PG2A 2YWDA 3PQ7A 1OHHA 2IODA 1V1RB 2Q1TA 2GBLA 3JATB 2GK4A 2KB0A 3BJZA 3KVOA 4DIOA 2JGDB 2XUIA 3RKSA 5BQPA 3AF1A 5AVTA 5EIXA 2JLRA 2F3QA 1XZFA 1S2MA 4ANFA 1ZITA 2RHWA 2QUKA 5DGXA 2EIHA 4H9GA 4I1RA 2QXYA 5CDHA 2DCUA 1D4FA 2XY4A 1VJ0A 1OT5A 3JYLA 3GUHA 1YHZA 3KE8A 3T7DA 3CVUA 5DNVA 2YRWA 4RZSA 1XTVA 3IUYA 4JLKA 4GYYA 4BWVA 3RJ9A 3E5RA 3QVJA 2XDQB 1JA0A 1W36D 1ULHA 1N8SA 2JB9A 3AERA 2GCOB 1OFVA 2C9CA 3DYBA 2DQYA 3X1DA 1GP2A 1NXQA 2Q3JA 5GIPE 4BNTA 1GTSA 3NTUA 3SMQA 4OYLA 1B26A 1S2LA 4GO1A 4GE3A 4LV8B 3DQPA 1TL7C 1SUIA 3CVYA 3G8CA 5F5NA 2PKQP 4YECA 2CHGA 4C6TA 1KR2A 1E7WA 2RB5A 2IC5A 3OCWA 4WNAB 4OV6B 2YNMA 4N6OA 3AKYA 1TA0A 1XQXA 2DLNA 4CNBA 5K2MA 1RBYA 1ZMRA 5T7BA 1DWQA 1VJGA 2AFHA 1B14A 3IEUA 4OSPA 1DAMA 5F7JA 3VH4A 2JHCA 2AHOA 2R6GA 3FCOA 3PC3A 2MSDB 1Y3CE 3RK1A 1SVSA 1X7DA 2V98A 1QWOA 3A4NA 4HQKA 4EAAA 5FI5A 1CR0A 1OQAA 3T5DA 5DF1A 3IAM1 3KU1A 1I01A 2V7UA 2W6ID 3M1AA 4LXHA 1U1IA 4R16A 1AN9A 5JANA 4LWQA 3NOQA 4MQLA 2D59A 1S1MA 4DIFA 1PR3A 1P31A 2I3AA 3LUFA 3SF8B 1YZVA 3HBNA 3HJGA 4CKBA 2ZXFA 4O4JB 1AK9A 1TC2A 1G20A 4BL5A 3S1AB 3K5IA 2Q6LA 1KZYC 1VBFA 2J8ZA 3I58A 3P0IA 4RHUA 1J4AA 4Q4DA 3DOEA 3GY0A 1R0BA 3BE4A 3C1OA 4NHOA 3RAPR 1ZLXA 2CB9A 2XCOA 4WL0A 4WBNB 4WVLA 1CFZA 1UBNA 1O95C 1PT7A 3IUEA 4MYCA 4Z7NB 4IDNA 3KHKA 1A5BB 1LUAA 5FF9A 3D7LA 4C0AC 2HIHA 1E1QD 4BJ5A 4JWTA 2H2IA 2FSVC 1K7FB 3GROA 4L72A 4U2KA 5JMOA 1QKKA 1XRNA 2CKMA 3W8RA 3QWAA 2XWPA 4L3WA 4BLUA 2QSUA 2YTZA 3RSHA 3FPLA 4QJ3A 4J3FA 3EOAI 1XL0A 1IHPA 1N0WA 2PH5A 3ESXA 4LSMA 4P5DA 2TMYA 4UTRA 1NKVA 3DE5X 4NKRA 4KREA 3MB8A 1QCCA 2E4AA 1M2WA 2IEIA 3V4RA 3VA7A 2VJYA 1OYOA 1V9SA 4NAVA 3H9CA 4QVKA 3UA4A 2VHTA 3K6KA 3V97A 2QZSA 5HGJA 1B7GO 3P9ZA 2H8KA 3R5XA 4HEQA 4BHTA 1E1NA 2C9MA 1AF4A 3CURA 1IJKA 1V95A 3QE9Y 1U2TA 2BFDA 3MJVA 2X0KA 3KSZO 4KXNA 3NT4A 4CXMA 3CS3A 4KI7A 5FLKA 2IZ0A 4L3VA 5F76A 5IJ9A 2RGNA 5K7SA 5MGNA 2NT4A 4EGCB 3O75A 2H48A 4W5HA 4D9CA 4JHXA 4YFVA 5A4KA 4E1AA 5EIOA 1HOTA 2PHZA 4CKZA 3AZOA 3AEYA 5BVHB 1QQ7A 4FNOA 1EPUA 2MYNA 2OV6A 2YZGA 2PQMA 3GN2A 1Z5UA 3ZE6A 4EO7A 2NUPB 1DQSA 2WIAA 3TD6A 3VC2A 4EPRA 2EFCB 2OT3B 3HK2A 1PR5A 2NT3A 1QDUA 1YA8A 1N3IA 1UMDA 5G40A 2VO1A 5H8WA 3FPJA 1XZIA 4AB1A 2JARA 3TKAA 2WR8A 3IQXA 1T8WA 3LK7A 2LNDA 3I6IA 2XNJA 1OMOA 4LS3A 5EYPA 3WKDA 1CNMA 3JSAA 4AZVA 2JFBA 4MYUA 2GUGA 5E4FA 1LBTA 1KP9A 2C5LA 3D1VA 3V7NA 4NG5A 4TXMA 3B48A 4K46A 3CLTC 3NHYA 3WA6A 4AN4A 1UPUA 2PQ0A 4NJEA 4R69A 4XUDA 3IKLA 3P97A 4QA9A 5I51A 1RDFA 3OLCX 3K20A 1BCSA 4XYMA 2EC5A 1WV1A 3GK3A 4ZAFA 3EXAA 5E9AA 2WFZA 5FUMA 1NJGA 3NORA 3D54D 2ETVA 2QSJA 1YJXA 3WBBA 1YZKA 4KFRA 1OIXA 3HL4A 2ID7A 4LSWA 4OQDA 3RVKA 3NTVA 4CI0B 3HB5X 1JFSA 1S3FA 3KPWA 1A8UA 1E2PA 4GW3A 4I8DA 1PT8A 2GAAA 5TS3A 3BMQB 5D3QA 4MCIA 2FFAA 2H1IA 4RGQA 5BWOA