1UKBA

Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with benzoate
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
271
structure length
271
Chain Sequence
NLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Series of Crystal Structures of a meta-Cleavage Product Hydrolase from Pseudomonas fluorescens IP01 (CumD) Complexed with Various Cleavage Products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase
total genus 104
structure length 271
sequence length 271
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2003-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ukbA00
5SYMA 1WB5A 5ALFA 1HBJA 5EIHA 4AQDA 2WG0A 1F6WA 5AM2A 3IUJA 5LZ4A 4BC0A 4IHAA 3I1IA 2JBWA 3MVEA 5HKBA 4W1QA 4LXGA 4J03A 3VISA 5JZSA 1A8SA 3BDIA 1DX4A 3O4IA 4K6KA 3FBWA 5JYCA 4H7IA 4WDRA 1UOOA 1XZEA 3KWFA 4EY5A 2H1IA 4HXGA 4BRZA 1UT6A 4G5XA 4CG3A 4OD0A 5DNWA 1CFJA 1ODTC 2XDWA 1XROA 3DL7A 5JD6A 4UHCA 2WKWA 1VZ2A 3R3WA 4UHFA 1QIIA 2QMQA 3C5VA 5EHXA 2JGLA 5CTAA 3KOOA 3QPDA 2BKLA 4Y2JA 2GZRA 3H2KA 2D0DA 5AM3A 2HADA 4LXIA 1LBSA 2PSDA 4Y2PA 4C87A 3GELA 3RK4A 6YASA 1E3QA 1R3DA 2RIPA 2XMBA 2XQIA 4N8SA 3K6KA 4GLBA 1DU4A 2H7CA 1XRQA 3D2BA 4XVCA 2XUIA 3ESCA 2XLBA 4AZ3A 4B9EA 3IB3A 4AB1A 4Y2YA 5DTJA 1XZCA 3G0DA 4QWWA 5JZ9A 4F5ZA 1M33A 2J3DA 1UOPA 5E4JA 4Y2TA 2HU5A 5CBKA 1L7QA 3E0XA 2ZSHA 5ALOA 4D9JA 4JYMA 5LLSA 1EHYA 1G42A 3QYJA 1XZBA 3A2NA 5F4ZA 3L1HA 1BU8A 3R3YA 3QZUA 3D2CA 5KREA 4B0OA 1CUJA 5AKIA 2B61A 5DYWA 3IULA 1K6EA 4WJLA 3ESBA 2OCKA 4W9RA 3G0CA 4N8DA 5AI5A 4B81A 3EQ9A 2ZJ6A 5JASA 4EBBA 2QRUA 5LYYA 2CMFA 4IH4A 5AO9A 3WK8A 4J0GA 1SCKA 4BCCA 1TCCA 2XMDA 4JEIA 2W6CX 2GBGA 5LZ2A 3GA7A 3WLAA 4BYMA 3W04A 5JARA 1CUBA 3FYUC 1EVQA 2OGZA 5KBYA 1T2NA 2GBCA 3BJRA 5ALWA 2Z8XA 4J0HA 5CT9A 1MAAA 1P0QA 4MXDA 3D0KA 2XQGA 4A23A 4FTWA 4UFNA 4UBLA 4GI1A 1FFAA 2I78A 1XRNA 3C43A 3KXPA 1AMNA 1P0IA 5AP9A 1A7UA 4IO0A 4H77A 3STTA 4PNZA 4EA6A 4CIBA 5AM0A 4DMCA 4UFPA 1TQHA 4M0MA 3FCXA 3F8SA 3MUNA 3HEAA 2PKYX 1E89A 3WL8A 2QJWA 4Q05A 2K2QB 3D5EA 2GYWA 5HFNA 3H1AA 1MT3A 2XUGA 4PSUA 3G02A 3BXPA 2PVSA 4INZA 1SCQA 1TAHA 4X00A 3ZPXA 4F21A 2C58A 5AKZA 4FMPA 5JAPA 3F9CA 1UXOA 3WI7A 4IH1A 2HA3A 5BWBA 1UK7A 1YCDA 5ESRA 3I28A 4X92A 2HM7A 1JJIA 3O95A 3IUQA 1GT6A 4KACA 4DMKA 3AZPA 2VAXA 1JJBA 5EI5A 1ODSA 1LPOA 4AMZA 1YASA 5A71A 4UPDA 5ALDA 5LZ7A 1UFOA 5E4TA 3B3QA 1CUEA 1GPKA 1XZDA 3WKAA 4ARBA 2XUHA 2QXUA 1YA8A 2XUOA 1JJFA 7YASA 1THGA 2HFKA 3EIOA 4NZZA 4H7FA 1R9NA 2OGTA 2AJ8A 3NOXA 2XMCA 3AIKA 5ALYA 4Q82A 5HKAA 3DL4A 4KRYA 3WKDA 3R41A 5C8VA 3N2ZB 3L1JA 4MEBA 2HA2A 2WUGA 1MNQA 3ESDA 5AKLA 3R3UA 1X2EA 4Q3LA 3WWEA 1R1DA 4ZV7A 2PU7A 2VJBA 2OGSA 1EK2A 2WTMA 1GKLA 4Y2XA 3BF8A 5IKXA 1XZJA 2D5LA 4J0KA 2QZPA 1N5MA 3FLAA 4FNMA 3FAKA 4EUSA 4KE6A 1CQZA 2ZYSA 5D7BA 4ZRDA 1BS9A 4QLOA 5AKKA 2WUDA 1QGED 1VA5A 5I9IA 1EK1A 3R3VA 3PUIA 2PUHA 5HK8A 1G66A 4G8DA 4BTVA 4E15A 1HDEA 2WG1A 1EH5A 4MJ3A 1ACLA 5DLPA 1K4YA 5EGNA 1CR6A 2XE4A 1W76A 3AIMA 2GYVA 2H9YA 4L0CA 4ROTA 3SC2A 4BZWA 4CCYA 2NW6A 3AZOA 1DT3A 5JIBA 1CLEA 3I1YA 2XQJA 4KAJA 4GXNA 1LPAB 4CI9A 4W63A 2HHAA 4BDSA 3S8YA 3B12A 3D59A 2Z8ZA 3Q0TA 2XMQA 2AJCA 2VA9A 1C7JA 3M83A 2Y2VA 2QVBA 4QWMA 4B0PA 3STWA 4AMYA 2UZ0A 4FBMA 4M0EA 4DLNA 4G9GA 4X6XA 5DWDA 3H17A 1UK6A 4C6HA 1ACJA 4RPCA 3GZJA 1CPYA 2XI4A 3E3AA 3ICWA 1AX9A 1X2BA 3CCBA 2OCIA 4X6UA 2VSQA 4WFIA 4TPKA 5ALNA 3F98A 4H7KA 4PF1A 1CEXA 1H2WA 4PSCA 2BJHA 3C5WP 1LPMA 1ZJ4A 4Q1VA 3UMJA 3OM8A 1Z68A 2GYUA 2WIDA 4QNNA 1H2ZA 1MJ5A 2QTBA 4Q34A 1LLFA 3FSGA 4X7BA 3A70A 1U65A 1PV1A 4C01A 4U2DA 1AKNA 4UHDA 5AOAA 3STYA 1EDEA 1C7IA 5CURA 4BVKA 3DOHA 1UKBA 5CT5A 1ZD4A 1K63A 2AJBA 2ZYIA 3HZOA 2WIFA 1R4ZA 4BDTA 1W4LA 4BP9A 3WK9A 1G5FA 1VXOA 1CUIA 2B20A 3WYNA 4KR0A 3PF8A 1J2EA 1EDDA 1YS1X 5AOCA 4AN0A 2BAGA 5AH0A 4J7AA 1UKAA 4L3WA 3IDAA 1ZOIA 2ACEA 4O08A 3V1LA 2WG2A 1MX1A 4U2CA 3UUEA 4U2GA 3OTQA 1ORVA 1QO7A 5AK4A 3C6BA 1K5PA 1QTIA 4G9EA 4FDMA 1DQZA 4DSZA 1VLQA 3I2IA 3UUFA 4J0IA 2XQKA 4B85A 1MN6A 2VQ6A 1XZKA 4XJVA 2VATA 1E8DA 1X70A 2XUFA 3O9MA 3IUMA 4H18A 1CUGA 2IITA 1KU0A 4M0FA 5AKJA 2XUJA 4BAZA 4P92A 1N5RA 5JZBA 3WZLA 1K8QA 1LPNA 1QONA 5EHNA 5FXMA 3HI4A 1WM1A 5D3KA 5LP1A 4UBJA 1ZIYA 2ECFA 5EHZA 5AJHA 4ZWNA 4X85A 4H35A 1MAHA 1SFRA 2WJ4A 1BEEA 1LGYA 2WLSA 5HF6A 4J0DA 3G0IA 4H7DA 3H2IA 4J0JA 1QIJA 1EVEA 1YB7A 4C88A 5FKJA 4OSEA 3HACA 4ITVA 4A5SA 3WL5A 1PJAA 2WJ6A 2EEPA 1QIDA 3HJUA 3WA6A 2G63A 2Y2UA 3WWOA 4X94A 3NUZA 1MO2A 5AK6A 2WM2A 5ALTA 1U2EA 5CW2A 1WB4A 1CRLA 1CUYA 3ILSA 2PU5A 5HFAA 1DINA 1HKHA 4BAUA 3VVLA 5AIBA 3DS8A 4Y7DA 4QEKA 4Y9SA 2OQIA 3DDUA 2DHCA 5AKXA 2HIHA 2Z3WA 3STUA 2FJ0A 5ALHA 3I6MA 5ALZA 3BJMA 5K3CA 1ZD5A 3FOBA 4FLFA 2ORYA 1IZ7A 2HFJA 1IUOA 4GEGA 2XQFA 4HAIA 4WY5A 3OPMA 2PSHA 2V97A 1CUVA 1S8OA 1CUXA 1HL7A 2OCGA 4UBNA 5BV7A 4BVLA 1IMJA 1JMYA 3O4HA 2IX9A 2ZJ7A 3CCCA 1Q84A 3WA7A 3ZLVA 2DHEA 2R8BA 4JH0A 4HRYA 2BUAA 4WY8A 2C5GA 4HXFB 3I6ZA 3IBTA 4AXBA 3M3DA 5CXXA 1Q0RA 5AKEA 1A8QA 1XZFA 2C0QA 3H2JA 4GW3A 4X90A 1AQLA 4PV7A 3W9UA 3AINA 1QOZA 3G0BA 2I03A 4X93A 5HQ3A 3W06A 3B5EA 2I3ZA 3DYIA 3FWHA 5AM1A 1XFDA 2JGMA 1GZ7A 3GFFA 2HRQA 3A6ZA 1QIEA 5D6OA 1JKMA 4EB0A 5EIAA 5AIAA 1VJ5A 4J3JA 4OYYA 4U2BA 4LHEA 5A7FA 2VAVA 2PSFA 1XKLA 4EY4A 2PPLA 4Y2VA 2FUKA 4G8BA 2AJDA 3HC7A 5ALPA 4OPMA 3FNBA 3KSRA 4XX1A 1EXWA 3AZQA 2RAUA 4GHWA 5IH7A 1ZIXA 1LZLA 4N5IX 3G8YA 2WHPB 4YASA 2VF2A 4X71A 1XKTA 4FOLA 4MYDA 5ALEA 1CUUA 1MPXA 4FLEA 2CUTA 4BAGA 4QZVA 5ISMA 5LZ5A 1TKRA 2HA5A 4UFOA 4TVKA 4RE6A 3R3ZA 3SK0A 1ZI8A 3MUOA 4F60A 4G4IA 3WK7A 1B41A 1N8SA 3WJ1A 3EBLA 5ALIA 2OXEA 2QM0A 4NMWA 1XZAA 1EINA 2X8BA 1Y7IA 4BCBA 4C89A 3VDXA 4I4CA 1GQSA 3G7NA 4HRXA 1WOMA 1MX5A 1I6WA 3JWEA 2O7VA 4K2AA 4X91A 1XLUA 1RP1A 3G0GA 4E14A 2JIDA 1T4MA 4WFJA 2QJRA 2QR5A 3WJ2A 1U4NA 2H7XA 4X95A 3W05A 2ZYRA 1BN7A 1YS2X 3FCYA 3MGAA 2OAGA 2WU3A 3CXUA 2DSNA 2VJCA 2JGKA 3DCNA 1NU8A 1RYYA 3JW8A 2QOEA 1OCEA 1QIHA 2GZSA 4L72A 3I2KA 1AZWA 1USWA 4B6GA 4H0CA 4MWSA 3N0TA 4BBZA 2ONCA 4H7EA 3VJKA 4DNQA 5K3EA 5FLKA 3WYDA 3K2IA 1L7RA 4BC1A 1WB6A 4DGQA 2VT7A 3U1TA 3EQ7A 2O7RA 4W1PA 4XWGA 1JI3A 3ZWQA 5FP0A 4U2EA 2DFPA 2XMZA 1JU4A 3AFIA 4HXEB 5FOQA 1J07A 2RGUA 1O6GA 4FHZA 1DWQA 4KEAA 3FYUB 4K5QA 4MEAA 1GGVA 1MTZA 2QKYA 4MQMA 5LKAA 4DNPA 5DYYA 3F96A 2GBFA 5CRIA 4H7JA 3H2GA 3LIIA 1SOMA 3WK5A 1EDBA 4P93A 4WCVA 1AGYA 3DYVA 4BZZA 1LNSA 5ALMA 4OUKX 1W52X 4V2IA 4DYHA 2CBGA 4PQEA 4LYDA 3HXKA 5CH5A 2RI6A 2DCMA 3C70A 1LPSA 4Y2UA 5CT6A 3DD5A 4FBLA 4QLAA 4HS9A 2J3QA 4GECA 3STXA 1QJ4A 4MQLA 1SCIA 3PFCA 4DIUA 2ACKA 2JGIA 4RNCA 3H19A 2HA6A 1XLWA 4UBOA 3DKKA 1QZ3A 1QTRA 3DEAA 5ALSA 3BF7A 5IVKA 5AK3A 2V96A 3WKBA 4G8CA 1HQDA 4OB7A 3WL7A 4KRXA 1YR2A 5CH3A 3R0VA 2GBIA 1F0PA 1YA4A 3FVRA 3TEJA 4S0XA 4X6YA 2FX5A 5ALUA 5K3FB 2WFLA 1JFRA 5IVHA 4B82A 4BVJA 5K3FA 1JT2A 1FFDA 4U2FA 4DSAA 3G9XA 4YPVA 4AZ0A 2CB9A 3WQHA 5AM5A 5FDFA 4BB0A 1O6FA 3QH4A 1ZD3A 5A62A 5BWCA 1XRMA 3D4LA 4PSDA 3V48A 2WU4A 3M81A 3ICVA 3ANSA 2OAEA 3ESAA 2OG1A 5JD4A 5AK5A 3WZMA 1UZAA 4KE7A 1VE6A 1TCAA 3HRHA 1WHSA 1EB8A 1CUFA 2WIKA 4FWBA 1TCBA 4H7HA 3QM1A 3OG9A 3H1BA 5ALLA 2VT6A 2XUKA 4DNFA 2CJPA 4NS4A 1EB9A 2X5XA 4DMFA 1EX9A 4BATA 1FFEA 4RE5A 1THTA 4OB6A 4B84A 3AIOA 4P9NA 2RONA 4CCYB 3D3NA 4HZGA 2XMGA 4QE3A 5AI6A 1AUOA 2PSJA 1E8NA 4DTCA 1DTEA 2YASA 1U8EA 3VJMA 1EI9A 3TGLA 1CIJA 3HLKA 2PX6A 1IUNA 4FFVA 2BGRA 1WPXA 4K6HA 1WCYA 3DKRA 2W22A 1DX6A 2JEZA 1H23A 3TJMA 4Y2QA 2ZVDA 3LCRA 1UK9A 3KD2A 5LIPA 5HCUA 5I7UA 5ALKA 2WFMA 1VA4A 2WFZA 3STVA 3BIWA 2BUCA 4I19A 2CEKA 4JYPA 3T4UA 3VVMA 4CFSA 2O2IA 2I3DA 1ZGBA 5HK9A 1W6RA 3ZI7A 4QDOA 1BEZA 5JATA 1QIFA 2H7YA 5I8PA 3IVMA 3F97A 2CZQA 2G5PA 3VKFA 1LPPA 1CUCA 3RLIA 3DLTA 5JAUA 2EDCA 5CMLA 5HF9A 3WWCA 1FFCA 1P0MA 4JUIA 1P0PA 2BGNA 2RHWA 1QO9A 1C4XA 1QFMA 3IA2A 5A2GA 1CUWA 2VJAA 1XRPA 2B9VA 1XLVA 3AILA 4KAFA 2OQVA 4GBGA 3I2GA 1G4HA 3FSGD 1KEZA 2EDAA 3T52A 1QE3A 2XT0A 1J06A 1FJ2A 1BRTA 4WDQA 4NVRA 4G1FA 4X3CA 5AI4A 4N5HX 4PW0A 1FSSA 1EA5A 1IVYA 3V1NA 3C8HA 4I3FA 1MU0A 5HZGA 2FJPA 1ZICA 2OCLA 1QIGA 2XUQA 3C45A 2PL5A 4CG1A 1UOQA 3OOSA 4ZV9A 5T4BA 4B83A 2BFNA 2WHPA 3I2HA 3QMWA 4B80A 2C7BA 1WHTA 1N1MA 4UHEA 1VE7A 3WIBA 3EF3A 2XMSA 4IH9A 2QXTA 3G9ZA 3M82A 1R50A 5K3BA 3FLBA 2WIGA 3SX4A 1BCSA 5IVDA 2VJDA 4K6GA 2ES4A 3GROA 5EHQA 5LZ9A 5DNVA 1LPBB 2YXPX 3PFBA 3DNMA 2BCEA 2WJ3A 4ZI5A 1YB6A 3AUKA 5AKGA 2PBLA 5JAOA 1DQYA 4ZREA 1NX9A 5ALGA 5HQ3B 5D3ZA 1ZJ5A 1Y37A 3C8DA 3BWXA 5FPQA 3IURA 1WPRA 4OCZA 1CUHA 1XQVA 3WL6A 1XQXA 3LLCA 3FYUA 1Q0ZA 3C6XA 2DR0A 5T4EA 1F8UA 5A7GA 3WWPA 3HSSA 1JMKC 5ALQA 1ZD2P 2Y6VA 4QA9A 1CUZA 1ORWA 2J4CA 4FLMA 5T4HA 3CN9A 2ROQA 3QMVA 2Q0XA 3A2MA 5AI9A 5DYTA 4DM7A 4MYSA 5EFZA 1DT5A 4UUQA 4X97A 4C4YA 1CUSA 1TK3A 3RKSA 4EY8A 2Z3ZA 3DJYA 2HA4A 3G9TA 3V9AA 1ODCA 4OU4A 1GXSA 4Y2RA 4G4JA 4ARAA 3C87A 5BOVA 3X3HA 4B9AA 1CV2A 4W1SA 1FFBA 4FFWA 5A7HA 4UHHA 2C0PA 2O2GA 2WHQA 2WFLB 4CG2A 1HPLA 4HVTA 3L1IA 2RHTA 1UWCA 3NWOA 3PUHA 5CT4A 3WK6A 2G5TA 4OB8A 2HU7A 2B4KA 3LS2A 2VTVA 1OXMA 2HA0A 3RARA 3P2MA 4KE8A 4BRSA 3JYHA 1KU6A 4FKBA 3PDCA 1GPNA 3DQZA 1VXRA 5CH8A 3PE6A 3LP5A 4Q3OA 3F67A 3QPAA 3E4DA 2V9ZA 5E2IA 2P8SA 4WFKA 4LYEA 1B6GA 5AKYA 3E1GA 4OU5A 3WK4A 4GDMA 3ZLTA 2JF0A 3I2JA 4RGYA 5FRDA 3WWDA 4AO6A 1UKCA 3SWWA 3PI6A 5C8XA 1H22A 3ANTA 3QVMA 5T4FA 3Q8WA 2WILA 4KYVA 4E11A 2ZYHA 2X76A 4UBIA 4BTLA 1XZGA 4E46A 2VEOA 3BE8A 2WQZA 1ZI6A 2E3JA 3DOIA 3W2TA 4ETWA 4XIIA 3H2HA 3OURA 1QIMA 3G9UA 4DNOA 3BDVA 5JD5A 1IZ8A 3IUNA 3VXKA 3HYSA 4YX9A 3O9VA 3S2ZA 2WHRA 2ZSIA 1BROA 5E4YA 1ZI9A 1H2YA 5CT8A 3D2AA 1A88A 2DHDA 1E8MA 1NU6A 3GBSA 4Q3KA 1GPLA 4ZXFA 3A2LA 3R40A 5FPPA 3QPCA 1BN6A 4AO8A 4EZIA 4YK7A 4UHBA 5C81A 5J3JA 2PSEA 1CQWA 3W9BA 1VOTA 1GKKA 1BE0A 4F0JA 3VJLA 3CN7A 4LIPD 1R88A 2JGEA 3WMRA 4KAAA 2LIPA 3ZV7A 5KWIA 3HABA 4J0CA 2DQYA 5ALRA 4MWTA 1CUDA 4B7ZA 1TIBA 3PICA 5AKHA 5AICA 5EIEA 3PF9A 2XUDA 1IUPA 5AOBA 4EY6A 5JAHA 1QFSA 3O4JA 2WTNA 3V1KA 4EY7A 3QMMA 1R9MA 5KWJA 1XRRA 1UK8A 3C6ZA 1HLGA 3H04A 2AXEA 1YAJA 1W75A 2C5FA 1BCRA 4CCWA 5ALJA 5H3HA 4QDZA 1QIKA 1VKHA 4Y2SA 3QBJA 1GQRA 1DWOA 1ZGCA 5AHXA 2WSLA 4AX4A 4TGLA 4HTAA 3WIOA 3K9BA 4BP8A 2HU8A 1MNAA 1CUAA 4ZGBA 4PO3X 2XLCA 2YH2A 4BE9A 4QDTA 5A6VA 5DNUA 1YAHA 2Z5GA 5DTIA 5JALA 3IIIA 3KWJA 2R11A 3O0DA 4W1RA 5LKRA 4KJXA 1F0NA 2WIJA 2J4FA 1CVLA 5SYNA 4IQ4A 1L7AA 1AURA 4Z49A 4GWLA 4KE9A 1D07A 5C8ZA 2C4HA 3BL8A 2HA7A 2O2HA 2WUFA 4BE4A 5HF5A 3BIXA 2OPHA 5C7YA 3RM3A 2Y1KA 4FNGA 5HF8A 2QS9A 1SC9A 1DWPA 3GUUA 2JGFA 4LKOA 5AM4A 5K3DA 4LXHA 2XUPA 1RWQA 1E5TA 3NGMA 3ZLUA 3QITA 1QLWA 4P08A 5FUMA 1OILA 1H2XA 3ED1A 1MX9A 2ZJFA 2Y6UA 2QUAA 3R3XA 1LZKA 5JANA 3LIPA 5AI8A 1Q83A 5YASA 3U0VA 2YYSA 1A8UA 1XRLA 2HRRA 5ALVA 3FYTA 3WKCA 3C6YA 2JGJA 4A16A 5IVIA 4AN1A 4C4ZA 1Y7HA 4CIAA 1LBTA 2JEYA 4L9AA 2BUBA 1XZIA 2G4LA 1VZ3A 1J1IA 1ETHA 3AJAA 3H18A 3TRDA 3H0CA 2XB6A 1XQYA 5LZ8A 4AO7A 3D7RA 3FVTA 5K5EA 4DMHA 4UBKA 5JADA 3I2FA 2V98A 1PFQA 4G4GA 1XZHA 2PUJA 5ALXA 1AC5A 4UBMA 4C4XA 1JU3A 1E66A 1YSCA 5CXUA 2WUEA 4QDUA 2PM8A 3I6YA 4EHBA 3KDAA 4JNCA 1W1IA 1ISPA 3FLEA 5FV4A 1XZMA 5DJ5A 4OYLA 2XMRA 1XZLA 3OC0A 3O4GA 1XQWA 3WKEA 2HL6A 2CKMA 2IIVA 2AJLI 4N8EA 4BCDA 2QT9A 2DQZA 5K3AA 3YASA 2OLEA 2XUAA 3EQ8A 3V1MA 4QDXA 2HDWA 2QUBA 1TRHA 5AI0A
chains in the Genus database with same CATH superfamily
3F5SA 3GAFA 4BLOA 1T2CA 3IXLA 1D8TA 1UP4A 1Z8HA 5ALFA 3U31A 4ZCIA 1HBJA 1LF5A 3TLEA 4Q16A 3IV7A 1GARA 1F6WA 4L5CA 3KTFA 1O9HA 5CB4B 2R44A 1LJUA 2Y68A 5AM2A 1BZYA 4I1IA 4MKHA 3EZ6A 1QS0B 4BU1A 4IHAA 2HQBA 2DG2A 3OIWA 4CMIA 3P9SA 4DUGD 2Y77A 1ZESA 2VDRB 2VZ9A 3DFUA 3LUJA 3RWMB 3K6SB 3G23A 3RJ5A 4DA8A 4IGAA 1MO6A 4IAOA 4DW8A 3H5IA 1G291 2V6MA 2HTFA 4W1QA 2WWVD 3VISA 4JK3A 1H2EA 5JZSA 1LDNA 1Q77A 3EAGA 5IAAA 1YZYA 2HF9A 1V47A 4TWRA 5IUKC 4GOOD 2B4AA 3EDMA 3QGMA 4V02A 5JYCA 3J81A 3GLFB 1KJ9A 3G0OA 3AI7A 5A0FA 4FK8A 4PHFA 4EY5A 1UBJS 2H1IA 4BRZA 4BUJA 2C00A 1M72A 2ZP1A 3BMQA 1G5TA 2GN0A 3D8HA 3IT1A 5DNWA 4EW6A 3GLGB 1ODTC 1FYFA 1LRJA 5EIFA 1X1RA 1C3OA 1XZPA 2A6PA 1HOTA 2JCBA 2WU1A 3ZV6A 4P7KA 5EYPB 2DH5A 3ZE1B 2C98A 1Z4KA 1LW6E 2R00A 3IPYA 2IU4A 1B73A 2BLLA 2ZBPA 3MBOA 3HA7A 1KDYA 2JHGA 5F33A 3REQB 1QCYA 3VM6A 3VR4H 1ZRHA 2BF4A 2CHVA 5FTNA 4A10A 4B2IA 4DEVA 4KXWA 2O8EA 1NHGA 3B1JA 1ZN7A 3EVZA 3QPDA 1FSFA 4L75A 4Y2JA 5L6MB 1NUAA 1E5QA 1ZJZA 2D0DA 2QMHA 4GPD1 4KIJA 2ZUWA 1X94A 4QYIA 3D1VA 4EYEA 1IPFA 3OPXA 1QQBA 2WM8A 4LXIA 4AQ7A 1MVOA 1W0KA 2G40A 4HAYA 1SHKA 3ZBQA 3KAQA 3MZ0A 2MSDB 1I8TA 1RXEA 4JODA 3KJEA 4DLKA 3E7PA 3RK4A 1XMQB 4P1ZA 3STHA 3HXOA 3WGLA 5CVTA 3PV0A 2GRUA 2IE0A 3G5UA 3AF1A 1DU4A 1T5HX 3FCCA 5BRAA 4NPCA 1IM5A 2IUSA 1A7KA 4JEMA 2LVBA 5H5JA 1Z0ZA 4M6WA 3ZD6A 2H1SA 3KOUA 2OR3A 3D2BA 2EYQA 1G3QA 2NTJA 2O7QA 4XVCA 4HQLA 2XUIA 3ESCA 1IAQA 3T4EA 3C15C 2QGNA 2FWMX 4JENA 4G1UC 4YLEA 4X3OA 1MB4A 4NV3A 5BQOA 1KDVA 5KX5B 5LP6F 1BC5A 3GRVA 3FRJA 2WYOA 3IODA 4Y2YA 1RYFA 1XZCA 3DFFA 3G0DA 4KWHA 5EP4A 4CT4B 1XN1A 4DCVA 1SVUA 2PX8A 4PPFA 1M33A 3DZ8A 4UAGA 4WKOA 1RQNA 5SICE 3PJEA 1QKIA 1JSCA 2AC7A 1U0EA 2PZAA 4A91A 4JI7B 2H0QA 2VQEB 1M7HA 1UM8A 5DIZA 1E59A 2HU5A 5L3ZA 3NHYA 3EGIA 1JAIA 4DMUB 1KYVA 4ARZB 4RACA 2FPGB 3L7JA 1GA6A 3CQ9A 3O8NA 1EJ2A 3BSYA 1CXZA 3CBQA 5K45A 2HOQA 3HUFA 2ZYGA 3RRYA 1V43A 3X0DA 2AZXA 1DO0A 4U7TB 1GTJ1 4ZOBA 3TFOA 1VCMA 2OHFA 4ZO6A 1G16A 1XTVA 3P0IA 2JJ1D 4RNDB 3RASA 3EWIA 1G42A 4DA7A 3ZS9A 1ZK1A 3QYJA 1K98A 2PS3A 1L5NA 4A9AA 1ONPA 4BTEA 2WWYA 3JVIA 1IB0A 2XY4A 1F38A 5BVHB 1WF6A 4ZI7B 1E1CA 1D0VA 1IH8A 3R3YA 3E7XA 3QZUA 4AL4A 1N57A 2ECKA 4FW8A 2BDEA 3ZXXA 1D04A 4QM6A 2ESRA 2ISSD 4XFJA 4UU1A 4QQRA 1XV5A 4AP9A 5IBRA 5DYWA 1ZHOA 4RELA 2X8JA 1CBUA 3ADDA 3OLXA 1K6EA 4ER5A 2R60A 1ZWKA 1I1QB 3ESBA 2OEPA 4UU7A 4WJLA 4HN2A 5IABA 4W9RA 5JVDF 2F1KA 4EEZA 1TAGA 1RYDA 4YLYA 1FUUA 3AG5A 3CZRA 2ZRAA 4Q6BA 4RWEA 1D7AA 1BFKA 4GBMA 1NJ2A 5AI5A 4S0ZA 5T57A 1PG0A 1J7KA 4YYZA 3D64A 3OM1A 3D4BA 3LF2A 5FBLB 4B81A 2O50A 3C3YA 1R6XA 5BPFA 4FDLA 1QGAA 4XLLA 3F78A 4IINA 1GZ4A 2EATA 1ODFA 3BERA 3IJEB 2CMFA 3M6IA 4H15A 1JAYA 3LJKA 4M55A 5EL0A 1G8KA 2PBFA 3IQXA 2VEDA 5TMBA 5F9FA 4EVRA 2QRJA 4NEQA 5AO9A 3R9IA 1C4OA 1RZVA 2R1ZA 3JQRA 4J0GA 4TWAA 4V2UA 3BS4A 3BD8A 2PQ0A 4ZKEA 1N3YA 2WKQA 4UAVA 3U3ZA 1N2CB 4RKQA 4O1IA 2QJTA 3RUFA 3ICPA 1H5UA 3E23A 4K2HA 2MSLA 1A9OA 4YGYA 3TW8B 1E7QA 1LDGA 2GK6A 4L4SA 3QLUC 3RJZA 3GA7A 5F3WB 3L8EA 1T1SA 4L85A 2WD7B 4BYMA 1ML4A 3W04A 3EC7A 3OIGA 2C04A 1O03A 3BCHA 4O2AF 2X3UA 3IKLA 1KETA 4INJA 3IAEA 3ROGA 5ADVA 2Y9PB 1OREA 4DDUA 1G20B 1ICIA 4JR1A 4DQLA 4DFDA 4PPNA 1V11B 2GBCA 3QFRA 3NGLA 1Q0SA 3MWDB 5ALWA 1ONBA 4C9BA 4DQVA 1ND6A 2HO4A 3PJRA 4E2FA 1ZR2A 3EAQA 5ER9A 3G5MA 4NE9A 1TPZA 5DBHX 5KAMA 3PHGA 5IAKA 1P1CA 4HPXB 4BE7B 2XRZA 2I78A 3FMVA 3IOBA 4KNWA 3IX7A 4IV5A 1GGMA 4OH7A 3EXHC 4L07A 3TKYA 4P7BA 2NUTA 4ND8B 5K9ZA 4XD2A 1LQ2A 3VPBA 1AMNA 3GDOA 3KCQA 3WICA 3NS7A 1ZLXA 5HQJA 5J63A 5AP9A 5DE3A 2Y1CA 3HKCA 4NCHA 4PGGA 4OREX 3ISTA 1IXKA 4LDPA 1WXGA 3NNDA 4IO0A 5D3QA 4B6SA 4BV9A 1WY7A 3STTA 2GHQA 3BVPA 1P44A 1NMSA 2DFKB 3IUEA 3JQGA 2HCRA 1EX1A 4PYKA 1DJLA 1UKVY 3DMPA 4H4DA 1TQHA 3Q5GA 4LSWA 1N7IA 2G82A 3LQ1A 1UKYA 4YP1A 3SQDA 3FCXA 5EHIA 2F00A 4GXRA 1KI3A 1RJEA 4HDKB 2FY8A 3PFIA 3O2JA 4JI6B 2PKYX 4E09A 1E89A 1LSJA 4Q05A 1HEIA 1Q7BA 1TLFA 2ZQ5A 2K5UA 3R9WA 4H31A 3FTFA 4V1CA 1RNLA 3MFYA 2P41A 4GMDA 4LDJA 5FR1A 4W9NC 5F7XA 1FLDA 3TR6A 2OECA 3VHQA 4D98A 4PSUA 3JRWA 3CPSA 5KOHA 2FCRA 4PYLA 4FMCB 4KZPA 2PVSA 4ZALA 3GAAA 1S3GA 3T7DA 4B6FA 4CE6A 3TW6A 4X00A 4E33A 2WZQA 1W4AA 3DV0A 4BMVA 2J7PD 2C58A 1IOZA 3IPRA 5K03A 2EVWX 3DQQA 4FMPA 4YY3B 3F9CA 1HC7A 5A6SA 3QEMA 4PZPA 3VNQA 1R8YA 3JASB 2CUKA 2HA3A 1PQ4A 4IX1A 3EDQA 1T0HB 1UK7A 2FJUA 2R8OA 4YWJA 1VKOA 1GGHA 2X5KO 3OY7A 3MWLA 1ZJWA 3BB4A 2HRBA 2I76A 3MGCA 4OQZA 3NBFA 2A3RA 2SCUB 1BEUB 4ZU3A 5ICMA 2IOHA 1J33A 4XDHA 3KUKA 5JSHA 1LJLA 5FPYA 4F3TA 2JJ1A 3AX6A 1CEQA 4EHAA 4P7FA 3AZPA 3TAHA 1QH8A 3ENWA 4QNMA 4AMZA 4DIOA 1GPJA 5DX1A 2VFAA 4I9UA 1GT91 4UPDA 1MJNA 1MKYA 1UMDB 5ALDA 5J5AA 1NFFA 2LP4Y 2VUHB 5LZ7A 2M1ZA 3BIFA 2IPMA 2NGRA 4HNQA 3ZWAA 3ZCSA 4ZHQB 3J81k 1GGKA 1O6ZA 2V3VA 4OVKA 4ZIRA 5JR3A 4W5OA 4DV2B 4AICA 4B2YA 2FKNA 5GV8A 3V4OA 2LZ0A 3RYCB 4JLWA 1PZEA 1WO8A 2N47A 4OF4A 3LP6A 5TVKA 4BVBA 3A1WA 1XG5A 1V16A 1XCJA 1Z5PA 5A9SA 2FZ5A 1T4BA 1N0UA 3EPJA 1EFLA 1OKKD 1UL1X 1Z38A 2GNAA 2QA5A 1NASA 2HFKA 2QRKA 1RWMA 2V6BA 3B9BA 3JALB 4H7FA 4JX8A 4NZZA 1TD1A 2AJ8A 2VJQA 4WBNB 2G1PA 2XSZA 3OKFA 2PKRA 1H9AA 5HKAA 2R1VA 3IALA 3Q7PA 3UAYA 4B35A 1WDMA 3RJMA 1NT2A 2M32A 3DL4A 2QMOA 3F3MA 1X8XA 3NV7A 4FEYA 3R41A 5EC8A 2NO7A 3RUAA 5C8VA 3N2ZB 4MEBA 4QOEA 3FPAA 1Z13A 2VKQA 3VA7A 2HA2A 5E1BA 3EVGA 4JB8A 4LC9A 2AHRA 1NQAO 1SURA 3AY7A 3N8IA 2YJ3A 3WMXA 4PO9A 2WUGA 1NXPA 4HD8A 4URXR 4L0MA 1MNQA 3TI7A 1X8LA 5BMVA 2HEIA 3ESDA 2YS6A 1QG6A 4C43A 2YWJA 3TCXB 3LW8A 1IN5A 1NUTA 4X8OA 1RAGA 3RAPR 1T3TA 1MAVA 1ZR4A 3CRRA 3JQEA 1R1DA 3KSUA 3W8RA 3FHLA 4ZV7A 2FR8C 3LY9A 1AV7A 3A14A 3HKEB 3LZCA 3TI9A 2CL7X 4DXDA 1KMQA 2BI4A 2Q4EA 3F8TA 3VX4A 3LX5A 3C6QA 1U1DA 3N75A 4NOMA 2F9LA 3ZWYA 3K0KA 1NR1A 1KC3A 1B8OA 1QYRA 1U1FA 1WUYA 3HBMA 5CD9A 2VJBA 3I53A 3UO8B 4C3ZA 3S2YA 3MIIA 2AOUA 4WCDA 4E0BA 1S2IA 3BRSA 1DL5A 1XX6A 2A0WA 1EK2A 5E1MA 3H3JA 5EG5A 4JT4A 1T25A 3QFTA 1EP2B 4HP8A 4Q7KA 1TZJA 3BXZA 4JBYA 2F17A 1KYYA 3DUFB 4OK6A 2VOJA 3CR3C 1ZS9A 4UC0A 4XYEA 4YMIA 7REQB 1N5MA 2GCGA 1QGUB 1UMBB 3IP1A 3LZ6A 3SVLA 2O7SA 5K0NA 2VUTA 5T8KC 4Z7NB 1TW2A 5JCZA 3TQOA 2HN9A 3TR0A 4EF5A 4UEJA 3FAKA 1L8OA 1RXYA 5FORA 4AJNA 3EEIA 5EJ2A 4EUSA 4NG5A 5FL7D 5LNK1 2ZCUA 1BHQ1 5CX1B 2I33A 3TDMA 2BBSA 2EW8A 2W8ZA 2YRFA 4KMOA 1E2EA 4CN8A 4QLOA 4PBRA 3S6JA 3LHDA 4Q7MB 3SZ3A 1QGED 3DAFA 3UENA 1N6PA 3KT3A 1EK1A 4PX2A 1DTWA 1Z06A 3E9EA 3JU3A 3LUBA 1VFNA 2ZSUA 2OHVA 1N6RA 1DTWB 1E58A 1YS7A 2RK3A 3AETB 3OMXA 3QFHA 5EZ6B 4YXWA 4A3SA 4ZCTA 5CFMA 1H6DA 1HX7A 3T8YA 1NOJA 4EJSA 1HDEA 1T3GA 2AC4A 2WG1A 1WS6A 3SX2A 1KQOA 1VG1A 1ACLA 2BI7A 2WW8A 5FNVB 3URKA 2K6GA 2XBMA 1YR8A 5KYNA 4DDVA 2H1LA 5D3MA 2ZR9A 5EGNA 2Q99A 2QTVB 1N5OX 4EUFA 1GTVA 2XE4A 3NKVA 1J99A 5AJYA 1CDDA 5C2JB 2X58A 4DV5B 1F06A 1HLDA 4Q3CA 1CQJB 2YIDA 3M1IA 2GRJA 1S2MA 2ZBFA 4L5IA 4LPKA 3U13A 4ROTA 3MT0A 1FQJA 4EGCB 4GQAA 3TW0A 4CCYA 1C7QA 5K0SA 1XO1A 2DC1A 5JIBA 1F6DA 2QTLA 1CLEA 4KQIA 1M7BA 2Q5CA 5CD1A 2H0RA 5F51A 1CSEE 3AVUA 3DXYA 3UMRA 4BDSA 2K7ZA 1ZISA 1FDWA 3RSLA 1XEXB 4A0GA 3Q0TA 1RXSA 2PZFA 2TECE 3CVJA 3BB3A 4NZPA 2C4KA 2EG5A 1NTOA 3DZGA 3G8DA 3O38A 3DOUA 2WDPA 3NRBA 4I4IA 1RJ9A 4KBYA 1FYVA 2BBWA 4NFHA 4ARSA 2QN7A 2XOKA 3BXHA 2JD0A 1LLQA 3STWA 3IXQA 3HKEA 1EBBA 3AI3A 1FU8A 3QQPA 3QUCA 3ROPA 4CV1A 1OBCA 3PDWA 4CLOB 5C18A 4S12A 3PXEA 4O2LA 1WY5A 1Y3DE 3ONNA 2YBDA 4XCXA 4BLVA 2IXEA 4W5TA 1WLSA 1TM7E 1SU4A 3PIIA 4FHCA 4G9GA 4N01A 4OHOA 1XCPA 2W4IA 3R2JA 3FNGA 4TN5A 3R1IA 2NAPA 2QIPA 2FE4A 3QEKA 5KWSA 1JHZA 1Q1ZA 4O63O 5IANA 4BMDA 4PICA 4EUKA 1JA0A 2CXRA 3LG2A 4MDHA 3TTVA 1TUEA 2BGGA 1O08A 4A8JA 5EE5B 2LIVA 2ZRQA 1U8AA 3FETA 3QXSA 4KH0A 4R3NA 5J43A 5D1NA 4CHGA 4Q12A 3WB2A 3ICWA 3TMYA 1AX9A 2XV1A 4URWR 5J2UB 3CCBA 3G13A 1TDJA 3PQ8A 4N3CA 5KWVA 1WU7A 4X6UA 4GKKB 3HB4X 1XMOB 3UT6A 4CV3A 2H1WA 3IELA 2VO1A 2ZUCA 4X0EA 1ZM3A 4L9RA 4OJKA 3FRIA 3HNOA 2BJHA 3C5WP 1HT2E 3V4FA 5E7JA 4NV1A 1ZJ4A 3VU8A 3HWSA 3FPGA 4LJLA 4WZAB 5JSUA 2IDZA 3T4XA 3UMJA 3RVQA 4KQFA 4FFMA 4XB6B 3OM8A 1G21A 5JNUA 3PVSA 3T4PA 3DMNA 4QNNA 4F4IA 3CVVA 2YBEA 4DIMA 4A15A 2J9YB 4XM1A 1HFEL 5LMNB 4CRWB 1GA4A 1MJ5A 3WHLA 4GKBA 2JVJA 5BN4A 3VTFA 4ENVA 1D4ZA 2OZPA 2V6JA 1U65A 3A70A 3K6RA 2Q1YA 2JA1A 4AKTA 4U2DA 3WY9A 1QE5A 2D6FA 3NVMB 2A1TR 2BR5A 4RQUA 2H9AA 2IZ7A 3FWZA 5AOAA 2IYVA 5FBHA 1C7IA 2A5LA 4ISCA 4R40A 1Y6RA 3W9SA 1XDZA 5T41A 1Z12A 3DOHA 1SG6A 3T3IA 1UKBA 4QD3A 4KXVA 1K63A 4EH1A 1TA0A 3PVZA 4LDNA 3LBNA 4RTQA 5KYKA 2P90A 2PZ8A 1RWKA 3RWOA 1KJ8A 4XWAA 1R4ZA 3GDWA 4JJIA 1W4LA 4OMUA 4NXNB 3WK9A 4B73A 2OD9A 4D4IA 4UTVA 3WYNA 2B21A 1Y98A 2R1UA 1YL5A 4PHCA 2GFQA 4B32A 4R05A 4BNGA 5KNDD 3K8OE 1QHNA 2VT2A 1J2EA 4EG3A 1EDDA 1G6OA 5KTYA 3L0DA 1YS1X 1DXYA 2FPPB 3GRAA 1QFXA 1HT1E 4YJ2A 2BAGA 2W48A 2WDZA 5AH0A 1I51A 2XYGA 3CNOA 2PKQO 3K94A 3WIDA 4B8YA 1LKZA 1ZOIA 4I6GA 1XU7A 3V1LA 1Q3TA 1HT0A 1K66A 3TB4A 2PANA 1PFKA 3ZV3A 4Z3KA 4G5YA 4G0PA 1TGVA 4L4UA 1Z28A 4GM0A 1LVGA 3OX1A 4GIBA 2EKQA 4BN5A 2ZXUA 4AJLA 1GN8A 5AK4A 3JZMA 5H9WA 3UFXA 4C3UA 2O2SA 1GZ5A 3LBHA 4GYKA 1KSHA 5CXSA 4TS3A 1ENPA 1K5PA 1L5LA 1SC6A 1QTIA 2O19A 1NL3A 3RYFB 1XWWA 2NYAA 4OHBA 3ZWVA 3HXMA 1LSUA 1T29A 4FDMA 4MMXB 4UUPA 3U7JA 4I4TA 2OZEA 2REBA 3PNQA 5CYGA 3ZJ5A 2NT4A 1ONOA 4PHHA 4E4YA 3DEHA 1YUMA 3UUFA 3VRHA 4J0IA 1HKUA 4TS4A 5D5PA 4OFBA 1P7PA 1IPHA 1MN6A 1VGVA 2VNHA 5CFNA 4I14A 2VATA 3NHUA 2AG0A 2X22A 5I7EA 5SY6A 1E1DA 4B7CA 1E2LA 1AF4A 4ENTA 1A3CA 1K27A 2GHTA 2XUFA 2HR1A 5KDDA 4CM1A 3M34A 3ONDA 4RGBA 1N3IA 1YJQA 2QLJA 3FROA 3KPYA 1F4PA 3GMDA 2CFOA 1B6SA 3ABRB 3IDZA 4PLVA 4ZVSA 5GONB 4TYWA 4JLBA 2P40A 1VLVA 3PBKA 2XUJA 3SBXA 4P92A 4AKEA 1FNMA 3G2NA 4REQB 3ILXA 5AQ1A 5IDXA 1ZINA 2P62A 2BP7B 3WS7A 1VE3A 2C84A 4RK4A 5ECGC 3UFBA 2GQ0A 2O6HA 1K8QA 3KVOA 4KR9A 4DG5A 2WD7A 3KE9A 1IB6A 5I01A 3UWMA 3CZMA 3LCMA 4RCZA 1WM1A 2BGJA 5LQJA 2FF7A 5JCJD 3JCZA 2ECFA 5GY7A 3HJTA 2FPMA 4NBVA 3TEFA 4C6TB 3Q3EA 1MEEA 4BEWA 3CB4A 1SFRA 4BO0A 1UODA 2RHGB 4E7OA 4FWTA 3KQVA 2LV8A 1PJCA 2IUEA 4WVFA 1LGYA 4CM4B 4LBYA 3CKLA 1RM3A 3KU4A 5AW1A 1KQFA 1DC6A 2JZOA 3AERA 4J0DA 5K6TA 1GKUB 4Z1MA 4LY0A 2V1XA 2QVYX 1TLLA 1EVEA 4JI4B 3IERA 1Y0BA 1P5ZB 1KIMA 1Q50A 5FKJA 1VPTA 3U4DA 1R0SA 3DKIA 1TFUA 2JFFA 2P5UA 2R6R1 4TV9B 4FUQA 4GLJA 2VWGA 2CNNA 5CDSA 1CULC 2B30A 4EB6B 3C16C 3O8OA 3RLFA 1RI4A 1IM8A 4MKXA 1IN1A 4RK0A 4QFMA 2EQ5A 3EULA 2EEPA 3K05A 4REOA 4HUQA 3RYHA 1PZMA 3QG5A 5AXBA 4B4OA 2REXB 1LS1A 4PTLA 3UJDA 3WA6A 3G6KA 3LCJA 4M8LA 2G63A 3OZSA 3TQHA 4K46A 1AB6A 1NHWA 2QNBA 5DGCA 1ZEJA 2O52A 2X0IA 3F71A 1ADGA 3FPBA 3NUZA 4PCVA 3U3OA 4F1KA 4ZCRA 1G2IA 3TVYA 4FQ7A 1TC2A 1U04A 1D1QA 2IZ6A 4MUEA 5IXSA 1YULA 5ALTA 4ZI7A 2C2OA 5AXAA 1WB4A 2B3DA 4UXJA 3OTWA 5HFAA 3UWKA 4JYCA 1SGWA 5KOIA 4BAUA 2PQ6A 4E5UA 1PK8A 5G0TA 4LS3A 3T99A 4EJFA 4QEKA 1AE1A 3I1FA 2I1VB 4WZ6A 5BN5A 4PZDA 1MTOA 4OHCA 1ODJA 4EJSC 3L1VA 3VYTB 1BU5A 2DHCA 5AKXA 3G85A 5GINE 1RHRA 3CW2A 2WMYA 4RPIA 2IP1A 1ZMOA 2XZLA 2FUG6 4CJXA 3FFXA 1LCIA 5ALHA 1MQ8B 1JFVA 1LS6A 4AZ3B 4O2BB 2ZRKA 2XB2A 1KDPA 1ZD5A 3LAWA 3MELA 4NCKA 5KJCA 2Q3HA 2NO1A 4FLFA 1H0SA 4HDMA 4IUCS 4O4HA 4O4LB 4PZYA 3A4LA 1TCUA 5AR1A 3WNVA 1IZ7A 1RAEA 1RKVA 2EXXA 4O2AA 1H2FA 4O4HF 2CLCX 4GEGA 3WLLA 3PQFA 4WY5A 1SIWA 3QU9A 4GR5A 3BMCA 4RJTA 3A9WA 5EZSA 2Z98A 1BA3A 2ODBA 2PSHA 5H9VA 4OI4A 5LQDA 1S8OA 4M2LA 2IS1A 4B6RA 2J85A 3QUSA 1GR0A 3V1UA 1DRVA 1R00A 1SKYE 1JYEA 2QUZA 4ENRA 5HCIA 5H4GA 4MHSA 4GWKA 1CRPA 1LVHA 2Q8QA 5P21A 3BOSA 3MAAC 3P0RA 4KSYA 2ZRPA 2IX9A 2DKNA 2ZJ7A 5GOZA 3SN6A 1R4MB 5TGZA 5CA1F 3RNLA 2B37A 2ORVA 1HI9A 3H4MA 3MB5A 3WYGA 4CLOA 2YV4A 3WA7A 4NCBA 3GLRA 3RHZA 3I9V1 1OXXK 3AY6A 3A9VA 3TZ6A 3JD2A 2DHEA 3A9TA 1VL8A 4JH0A 2FMTA 3UM9A 3RUCA 2BUAA 2A9VA 3A1DA 3H83A 2I9KA 3A1UA 4YDRA 4AXBA 3EUEA 1P2FA 5K4AA 2RHDA 4BZXA 4EX6A 5JJ5A 1V9LA 4OQDA 3PD7A 4KOEC 4UCQA 4JBXA 1ICEA 3LE8A 1C0PA 3NTXA 5AKEA 5L45A 3H2JA 2WJHA 2O8EB 4X90A 2UU9B 3Q3GE 1AQLA 3KHUA 3I8OA 1QOZA 1FA9A 5JQGB 3LQFA 3ROEA 4JXZA 2FFAA 3R7WB 3W3ZB 2O8VA 5HQ3A 1P17A 2I9PA 5I9BA 2XGOA 3FPKA 3INNA 4TTSA 4DSTA 6REQA 4B48A 3DYIA 3FJOA 3ANNA 6YASA 2MYPA 4BU0A 4KDFA 5AM1A 3GLGA 4KIFA 2I67A 1XFDA 5G4LA 5JS8A 1R0CA 4WXHA 3VU0A 1GZ7A 4FHGA 5C1BA 4JV5B 3LH5A 2HRQA 5BR7A 2PT9A 4U5XA 1JKMA 4GSYA 5FF9A 5JMOA 5EQDA 4EB0A 1UFRA 1XMJA 2QN8A 4MPDA 3NWPA 2HH9A 1GVHA 2HLDA 2VYCA 4LHEA 2Q7OE 4Q15A 4FJ2A 2R68A 4EW2A 5JPCA 4GPZA 3EZ7A 3X1DA 3HB5X 1MFPA 1TQ8A 1UKEA 1XKLA 1KDTA 2R5FA 4QU9A 4I2NA 2MMGA 1YONA 1L5SA 4WK4B 3BE6A 4F9FA 4NBSA 4WH0A 3CLSC 5LQKA 3HC7A 1GPAA 2H1FA 3ZCTA 3CIFA 5GJCA 4D9BA 3K09C 1O8BA 1FNDA 4D8XA 5ALPA 4WXEA 4D96A 2C29D 2NXEA 1P5JA 2ZATA 3I83A 1C1XB 1X7WB 4DIEA 2OPBA 3NDIA 1MV8A 4CLEA 5DXAA 5D3MB 3PU6A 2OVFA 5JHHB 2XKAA 3ES9A 2VZEA 4YJ3F 5HWSA 4DSOA 3JPYA 4LGCA 1SR8A 4QT4A 1U2ZA 3A32A 4TMTA 4MDYA 3M4JA 5DHRA 1XBTA 3F49S 3V2GA 3RUPA 3NBZC 4EVQA 3MWJA 1ST3A 2I6GA 4WNAA 1RQPA 3LL4A 4MR9A 3GG2A 2VI5A 4I7EA 3ZK7A 3ZWWA 4GGMX 1XTJA 1NMXA 2E82A 5B1IA 3CGWA 1JR3D 1PWEA 3GGGA 4FOLA 4PNHA 5HMMA 2WQ7A 3QKSA 5A3JA 2DPXA 3LUDA 2W71A 4J7UA 5C0OE 2WR8A 5DLYA 1ZITA 2DP4E 3QIVA 4UZEA 1HUQA 2R7MA 3TM4A 2IY9A 3SXPA 3EXEB 3GLGE 2DFLA 2YOFA 4RTOA 3PFHA 1SKQA 1SVIA 5LWQA 4LJ8A 2OBYA 3E9NA 4UFOA 1KK0A 1EWKA 3CISA 4TVKA 5DSTA 3U6KA 4Q1EA 4YALA 1IOWA 2AF3C 4AURA 2FGKA 2OP0A 4G4IA 3D3WA 4JR2A 2XDAA 1DDGA 2HSWA 2A1TS 3BMXA 3JQPA 1RVV1 2X40A 4R2LA 2VRNA 1K6JA 2FWJA 2OXEA 2VP6A 3E7DA 3SR3A 4CKYA 1IWOA 4D3SA 4X1OA 3O3OB 2O8FB 2PH3A 2QM8A 3NIWA 1N2XA 2QRQA 2DPMA 2ZB4A 4I9FA 4BCBA 4KCGA 1W0CA 2R66A 4MINA 2R4UA 3VDXA 4I4CA 3EA0A 3EG5A 3E35A 4IMJB 5KC8A 1OPXA 3AKYA 1ENOA 3GL9A 4O1HA 3W7BA 2BMFA 2LTAA 2ZYUX 3MT8A 1XN4A 3MSCA 5L51A 1NOKA 2YCBA 3H5RA 4OQLA 4E30A 3EEBA 4KG7A 2E48A 4X91A 4L8YA 2VR1A 3IEMA 2PE5A 1YQUA 1QYCA 1RP1A 2ODQA 3O84A 4LX0A 2B8WA 4WOBA 1OUMA 2JIDA 3PZBA 3O8LA 3B13B 5GMOA 3HB1A 2QJRA 3Q7RA 2F64A 5KNCH 1LBIA 1THZA 1SCUB 1RRVA 1ZIDA 3EUWA 4KGZA 1U4NA 3Q87B 2VH2A 3N53A 4KBGA 1YQDA 4OXXA 3GRPA 4E31A 1II9A 3OC6A 4I99A 2EFHB 5HKLA 2HYDA 4AD8A 1NXOA 2OAGA 4ND1A 3OZIA 1SD2A 1KZ9A 2EGGA 3CX3A 3DCNA 4RM2A 2TRSB 3ASVA 4YT4A 4MS4A 4QXAA 1NU8A 1OI7A 2VHQA 3T3EA 1MUUA 3JW8A 2YWGA 3OPNA 2BKXA 2CLIB 3IEIA 5FTKA 3ZE2B 4F04A 2PFKA 2PBRA 2X2PA 2RJNA 3KDSE 4Y2GA 1JDTA 2GS9A 2NPOA 5EIBC 1G8FA 5F1PA 3ZVLA 4DQDA 3A1NA 3FDXA 5DRTA 4UXHA 5HG0A 3VU1A 5BSTA 2RGNA 4K6MA 1FX0B 4U1RA 1BQEA 2M9MA 1TZCA 4E70A 1N4DA 4I50B 1HYBA 4NHOA 4MWSA 2XR1A 4C7OB 1Q20A 2R8XA 1XYGA 4RVCA 3F6BX 4NPAA 2AMLA 2EZ8A 1OH6A 4RK1A 3V4RA 3PENA 2ZUUA 3HBLA 4RVHA 4BBZA 4H7EA 4I55A 1N5JA 1R9GA 2JLAA 1YQWA 2ZANA 1JTVA 3KOYA 2VQFB 3HK2A 4TTRA 2ID4A 4FHFA 4JL6A 4D0NA 3KM0A 2FFRA 3BTSA 2IOFK 3Q2OA 4MULA 4RFSB 4Z7QB 5BUQA 1ZNYA 4IJ5A 4B5LA 4G1EB 1KBOA 4M8NE 2BM8A 3MCZA 1IHOA 3BMNB 3IEUA 2HKIA 1V26A 4P3PA 2TMKA 1L7RA 4BC1A 3ETCA 1D2CA 1UMCA 2FVYA 1L7EA 1Q0UA 1Z2NX 4PIVA 4E4RA 3BZBA 1FSPA 3EQ7A 3ZS8A 1KBZA 3WLHA 1JI3A 1C0KA 3NC0C 4XIYA 5IKPA 2JAUA 1JIQA 3DE0X 2XMZA 3F46A 4M1KA 1J20A 2QD2A 3D8UA 4YRBA 5JSZA 3ESYA 5IJ0A 2RGRA 2ZDHA 3GVIA 1ZSYA 1Y63A 3FOFC 2OHXA 4DS3A 5LD2C 2NO5A 3E5HA 3UEOA 4EG6A 2UAGA 1GAWA 3AHDA 2IU3A 2COUA 3GJ6A 4OQPA 5FOQA 1TCVA 5CDFE 3Q5EA 5EZYA 2HPZA 1Q1AA 4N49A 3E2MA 2ZK7A 3VR5D 5JNRA 3BGVA 1XD2B 4RDCA 2QTFA 3LDHA 3TLKA 1KEPA 3TD9A 2Y0EA 4FNOA 1KP3A 2Y66A 4MQMA 4HWKA 3V6LA 3K0CC 4I36A 4L08A 2BMAA 1IJBA 5SY9A 1ESZA 2D74A 3ZV4A 1U2DA 4DZZA 1ESCA 2JCYA 3F96A 1N2HA 4RX1A 5J5CA 4E6EA 5BVGB 4DV7B 3CZAA 5HCNA 1SBIA 3FNFA 1ZRNA 1SOMA 3FUXA 2RKBA 3H16A 3R6TA 4W82A 2WY2D 4BFYA 2P9YA 1IBKB 1IQRA 1PD1A 2H2DA 3EH1A 3FPSA 4I50A 5JJIA 1AGYA 4O0LA 4KW7A 3S2EA 3VPXA 1M1YB 3RRFA 3UMSA 3L6BA 4MS1B 1LNSA 3VNUA 1OI4A 1N0WA 5A0VA 1N9KA 2C54A 3QSGA 1KVSA 2VHXA 4YYEA 1I0LA 2IKQA 4GICA 4DAEA 4XXHA 2WK1A 4YRRA 2XDQA 3LX4A 3PT5A 3D0QA 3T1YB 1B0UA 2N1BA 3C3WA 1G60A 4PQEA 4QXOA 3LCUA 1N75A 3FD8A 3UKOA 4LJYA 3CA8A 2D7DA 1R15A 2XMPA 3HXPA 2FSUA 5EMHA 5BQ3A 2A59A 1O0CA 3K0EA 5EIBD 2JIPA 3FUTA 4QOIA 1J0DA 3UCEA 3CKKA 1N5IA 4IGEA 4IVPA 3AUTA 1P45A 3MWDA 1H3EA 3V46A 5J2TF 2CLEB 3BPSA 1PFUA 4EEKA 3PPWA 4UHJA 4HS9A 2J3QA 3MCUA 1MIOB 3AESA 1AK2A 1PFGA 3MB8A 5IZCC 3SOZA 3OD1A 2AI3A 3RFTA 3WDMA 5CFRA 3QJYA 4LISA 2G9VA 4BVEA 2QYHA 2EYUA 1SCIA 4HDSA 4JLKA 2F6RA 2L82A 3HZRA 3EPRA 1MABB 3I6QA 3MJDA 3NV9A 3QXHA 4JC8A 3WXMA 1C8VB 3DNPA 4KV9A 4GMFA 4V0ME 1J8QA 1SUDA 5GGXA 3H19A 2HA6A 1XLWA 3ZWPA 3EF1A 1PW7A 1EGHA 1R0BA 1Z17A 1JILA 4OQMA 3Q11A 1KE2A 4EAAA 2XITA 4HRVA 5DB4A 2EJBA 1F2DA 3DBRA 2W6IA 3KELA 3L40A 4YI3A 2JI4A 1Z0FA 4PLHA 1XTIA 1O94A 5EKDA 1NQOA 5ALSA 3EFHA 3RSCA 4JIGA 5IVKA 1P9LA 4ZCMA 2Q50A 1LC3A 5HQTA 3ENZA 2FMFA 3B51X 1DC3A 4K9KA 4FPXA 5IK2A 1BFDA 3KL2A 3WIVA 2RHBA 3BHNA 4V0OA 2I29A 3WKBA 5IF3A 1HQDA 1KDOA 3J80A 1QBKC 5FYDA 4NQZA 3ZVMA 1ZU5A 4Q3AA 1U9ZA 1JDNA 1XDUA 2VTBA 1YR2A 4RTKA 3J7AC 5AVVA 4I5DA 4GX0A 4RPJA 4YAUA 3VPHA 1QPZA 2O59A 3I12A 4BLQA 1XAGA 2Z95A 1XC7A 2JZCA 5JDCC 4G1CA 4ML3A 3QKSB 4CEIA 3L1KA 3C24A 4IXMA 2GK7A 1Z0DA 2GD0A 1Q1NA 3T5GA 3P9XA 3H6KA 3RFUA 3T5MA 4X7MA 1N9GB 3BCRA 3MTJA 3L0IB 3ILVA 3C14C 4GVPA 4JT8A 4NF2A 1LBEA 4Y6LA 5AW4A 1JR3E 1JJAA 1DV2A 4MAAA 3GJRA 1KRWA 3MTQA 4N39A 1VRCA 3VNBA 1O5OA 1M0TA 4R5MA 4R3UC 4BVJA 3PHIA 2JLYA 1JT2A 4U2FA 5CYFA 4DSAA 2HBQA 3G9XA 1BYUA 3J7TA 1P9WA 5AVXA 1WRBA 2BKUA 4OHXA 3FYCA 5CM9C 2ENUA 2A58A 4WZBB 1JIVA 5EN4A 2GXSA 4FYXA 4P6VF 4OHRA 1VBKA 2AFHE 1PLKA 3QH4A 2Z5VA 4NCAA 3U9TA 4HUTA 1II8A 3BWCA 5A62A 4FDAA 2IH4A 3MT7A 4KO1S 1U28C 1SA0A 2YRXA 3FFTA 4HC4A 4WEOA 3UIEA 4EVSA 1NYTA 2GAOA 1TKCA 1VTKA 1XRMA 2OT3B 4QDKA 1AOXA 4W9MC 1CS4C 2O1XA 3LUKA 4PSDA 4EG8A 2VNAA 1P3DA 1D4AA 3GCWA 3K2BA 3E58A 2ECOA 2BM9A 1U90A 2N0SA 3OOHA 4LZWA 4V0MA 1PJRA 3O3CA 4GGOA 2OG1A 4HQ6A 4L1KA 1YDGA 2BEVA 5IHXA 4KE7A 4WVLA 4E4TA 1OH8A 3ITKA 1ODLA 1OXKB 5ICCA 4ZTBA 1JDUA 1PU2A 3PYXA 3U7RA 4B17A 5CB6A 3OH8A 3TPCA 4EHNA 1Q1QA 2Q0QA 1UBHS 2X5NA 3CZQA 2OKGA 3H1PA 4XGQA 2GD1O 821PA 3QEBZ 4MI6A 3G1UA 4EMUA 4PAGA 2GERA 1IONA 1WZCA 4ENPA 4EO7A 4EY3A 4CI0B 4NENB 2XUKA 1O95C 2CJPA 2CE2X 1E6KA 1B26A 1RE0A 3FPFA 3QKWA 5EKSA 3SX0A 3VHRA 5DCLA 2I2XB 4KQ9A 2BZ0A 4J1TC 1EEHA 3LC2O 4FQ5A 4AAYA 3MUEA 4O4IB 2P3LA 2X8AA 5C4MA 2D1TA 4C7KA 2YN2A 2UV8A 1RRPA 2H54A 2OZVA 4OB6A 4B84A 3WMGA 4JYAB 3AIOA 4CXMA 5J4HA 3JYPA 2RONA 2ZS7A 4CCYB 3HI6A 1G5RA 4RJIA 2JGRA 4Z9FA 5EHGA 5GIOE 3C0KA 3MF4A 1TTQB 1F51E 3A4YA 3AEUB 1L6IA 3LXMA 1TIPA 3MCTA 2NU8B 1UJNA 4Q9DA 4WAUA 2FPKA 1NVAA 2EWVA 2IYWA 2PSJA 5FLXA 1WE2A 3L8GA 1W1UA 1OLUB 3QX8A 2YASA 2I8AA 1XVUA 3MINB 2IPLA 3VH2A 1D9ZA 3VJMA 1CY7A 3QUQA 4FFNA 4RIHA 3X1KA 4AM8A 5DGIA 3FOEC 2WTEA 1R10A 3OZBA 2Q27A 2GXQA 2PX6A 3D54D 1J2RA 3TSCA 5LU9A 3K0AA 3WDLA 4PFKA 2RHCA 3B6MA 3EGOA 1NF3A 1WPXA 3UHAA 4A0QA 5DX8A 2JIMA 3IMEA 4FE7A 3SR0A 3ZCVA 3DKRA 4IFIA 1UJCA 1Z74A 2W22A 1DX6A 4L57A 2QSJA 1NI4B 1WABA 4UVIA 1WMDA 2IDJA 2RSLA 2GO7A 4P4LA 4LV8B 5AVKA 3UF0A 4OYHA 2PKQP 3E22B 5LA6F 5ALKA 2WM9B 3NCTA 1C7FA 1XL0A 2HDNB 3HY6A 3ICCA 4ZO7A 3JR3A 4DDWA 2GZHA 4A0HA 3L7LA 1E5XA 2R6CA 1QDEA 4E88A 4NQRA 5H70A 4A2PA 4DLBA 2ZWAA 2ZIZA 4NRDA 3KAPA 5F2OA 8LDHA 1VJRA 3BIWA 5IM5A 1WWKA 5HGXA 3U39A 4EFMA 2HMTA 3A4VA 3VOSA 3D7NA 3B85A 1LD3A 1OAOC 1URPA 1PJLA 1PVDA 4CFSA 2O2IA 3IV6A 5DGTA 2W8BB 3S1AB 1W0JA 2OO5C 2YY5A 3R6WA 3IDSA 4U7HA 3KALA 3VUFA 3IMGA 3N2IA 5FA6A 3H8JA 3OQOA 4M53A 3GFOA 2JHFA 3COSA 3N70A 5K6AC 1HDCA 2ZJOA 2AEFA 4GMKA 5AWFC 3ZDDA 2EW1A 5FB3A 3V2IA 4GZ6A 1ZH4A 2J9FA 3BXGA 3IVMA 2ET6A 4EDHA 1C2YA 1Q3HA 2AFRA 2VSNA 4HI0E 2OBBA 4AU1A 3N86A 2ZR7A 2K7FA 2VP5A 1L5HB 3VKFA 3PEWA 1E61A 4XGKA 2Q1WA 4F4CA 2D54A 3NMUF 2ZT6A 1C9NA 5JAUA 1QRUA 2EDCA 3VBEA 3VR5A 1YJ5A 4ESOA 1ZSNA 3AKZA 1P0MA 1PNTA 2RHWA 1PEYA 4ZO9A 1EFPB 5TS3A 1ZNZA 3D5TA 4M88A 3ZW7A 1DIRA 4DBVO 2Q9UA 5A2GA 5KTOA 1XRPA 4OLJA 2WJIA 3GEBA 1XLVA 2OG2A 4HAXA 4KAFA 4X8MA 5I9SA 3KTAB 3MW8A 1ODIA 3RR2A 3T7SA 3DCIA 4TKZA 4M49A 3LKDA 1VMDA 1E2QA 3X1JA 4J8PA 2NXWA 1RWBA 1TRKA 2RGYA 4NDZA 3FE2A 1XB2A 2WVJA 4IILA 4KWIA 1NWHA 2C4WA 1UWKA 2QZ4A 4JDUA 4WDQA 4ESEA 3BM5A 4Q03A 2PWPA 2E7ZA 3KTDA 2NVUA 4IX9A 4Q9NA 1E6CA 4UOQA 1EA5A 3GGOA 4KUHA 1ADYA 4LDZA 5G41A 1IVYA 2ZIGA 2ZVJA 4G0YA 3V1NA 2W43A 3E1KA 1AG9A 3GRKA 4KDRA 1MU0A 3GT3A 5A4AA 1L1QA 4EW1A 4JB2A 1Q44A 3SZGA 3BH0A 3OI7A 4QELA 3TS1A 4KXMA 2OCLA 4WOCA 2PG3A 5E6SB 3F7OA 3QG1A 4PZLA 4RMIA 3LU1A 3C45A 4P81A 2QL9A 4S2UA 2X0EA 2TMYA 3EK2A 1HZZC 2O20A 4QATA 2XRYA 3PEUA 1LXCA 1JEOA 4WK6A 1P9OA 1GZVA 4D6PA 3OOSA 5JXHA 1JDZA 3R0IA 5ADWA 3LGSA 3CE9A 5CXQA 2WT8A 3PCXA 2X3YA 1XKQA 2YVKA 1EHCA 4L5JA 3I2HA 4TTAA 1GG5A 5FOXA 4BJ3A 4ENSA 2PIDA 5FBWB 2DBVO 1WHTA 2RDMA 3AUJB 3D0RA 1ZSVA 1BG6A 2GD2A 3F1LA 4OXIA 4UHEA 4YPFA 3VAZA 1Y6ZA 1QC5B 1CERA 1VE7A 2Q41A 2V55B 3WB9A 1TVEA 4HX9A 4MP3A 4NMXB 2F1RA 2P27A 2R5WA 3U4QB 3L7KA 4QGGA 1ZK4A 3DWIA 1R50A 1QG0A 3OQPA 4C08A 1YVPA 1Q14A 2J3HA 4GLOA 1BCSA 5IVDA 1YUNA 4A7PA 4AKHA 4OK5A 4PLZA 1ZGAA 1P1HA 3HJGA 2MINA 3ND9A 3KUDA 4DVJA 3R5TA 4TUYB 1EGMB 2CFTA 2ES4A 5GONA 2QNRA 1RHMA 2GK4A 3OA0A 2ZPUA 4N40A 3A27A 3DOJA 3VOTA 4Q37A 3DE7X 1VHQA 1OBHA 2OM2A 3OZTA 4JGGA 5DNVA 1LPBB 3LKBA 4J91A 1XTTA 5AW2A 3BQNB 1XP5A 5CPBA 3RTCA 3U4CA 5BRJA 3OTOB 4JI8B 3DNMA 1ABBA 2I99A 2J1LA 1JQEA 2CEAA 2I7CA 4HYYA 4NYIR 4XEHA 2D2XA 1U99A 4FFSA 3TXAA 2ZKLA 4KLZA 2Y0BA 4ISBA 1O9GA 5AHOA 3ED5A 4EKYA 1CQIB 2MT9A 4B3GA 1KSJA 4PBSA 5AKGA 5JAOA 1FQOA 2A30A 1P29A 3L0BA 2EV9A 2H08A 5EWMB 4CMCA 1I3CA 1MP0A 4FYHA 4QAQA 5D3ZA 3K2QA 4W99A 4JVMA 4P4TA 2HMWA 1R64A 1GKYA 5DULA 4DLXA 2GSWA 1E4EA 3JSAA 3NHMA 5HJ2A 4N0MA 2HD4A 4TT3D 1ZGHA 3L8HA 3PHLA 5KTRA 3BWXA 3LPDA 3NNNA 3R7FA 5FPQA 2V0CA 4MI3A 1NPTO 2XYHA 1ZA2A 3IURA 2QD1A 3M4ZA 3ZXYA 4ZOCA 2ANCA 4A8JC 1UPXA 4OCZA 1IOVA 2Q2QA 4U7PB 2UZIR 5KQGA 3LXUX 4HB0A 3AFGA 3WL6A 3SGLA 3ZQ6A 2X41A 3TQQA 3DO8A 3DVQX 3RVKA 2ZGVA 5DBIA 5T4EA 1F8UA 5FTWA 1UFKA 2VYND 1M3SA 1GDDA 2WF7A 5KSZA 3O4RA 3LW7A 5ALQA 1QK3A 2BEUA 2Y6VA 4M8IA 4KYUA 5FFMA 5E3HA 2C2KA 4MGIR 4WD3A 3HCOA 1G7SA 2J4CA 1J8MF 3V6MA 4BNWA 5JZOA 5MHTA 3F6YA 1P4HA 3GCDA 1OBOA 3NRCA 3OWXA 3S2FA 4IV0A 3OLVA 4FLMA 5T4HA 5TC4A 1FRVA 3CSUA 3HZHA 4BNNA 3GP8A 2ZI3A 1QR2A 3GJYA 3TZEA 5CAEA 2AR9A 5TGTA 2FRVA 1Z0JA 2QD5A 1G5IA 2CYBA 3LOUA 5J40A 1N8KA 3RVPA 2JVKA 4H4CA 4CHTA 4IMIB 1SCUA 1DT5A 2KLBA 1IDN1 3KKEA 2Z5LA 3HPQA 2GO1A 4O8CA 4UUQA 1HH4A 3ODPA 4X97A 4EY8A 3E6AA 4GFDA 4C20A 1X39A 2NV6A 2YR0A 4G0UA 2Q5QA 1AZTA 2X9QA 1FMTA 2RB4A 4FEEA 3D4IA 3VMFA 4LE0A 1LX7A 3EWAA 1YQ9A 3F1KA 1GQYA 2IV2X 3T95A 2N1MA 4TMKA 1Z39A 2JK1A 4W8GA 4Y2RA 5CLQA 1S4QA 3FIUA 5TF0A 2BMEA 2E2WA 1GFIA 2G3YA 2XTMA 3NYWA 4QARA 2ZWIA 4ARAA 4DA9A 1KORA 5E3JA 1CS0A 4ER0A 5BOVA 4QXRA 2P9EA 4YNBA 1CV2A 3NGXA 3WOVA 3L6UA 4B9AA 1FFBA 1P9NA 2VP2A 3AJRA 3VNSA 1TUGA 1KI2A 2C0PA 3L8MA 4LOLA 2WP8J 4QFDA 4QRDA 2WHQA 1A95A 1VSQA 5H4HA 2MIIA 1H2AS 4MAFA 4O4JA 2WFLB 3WV4A 3P2JA 1OGYA 4E32A 1HPLA 4DQ0A 1J25A 3FUCA 4PFQA 4YR7A 4RV5A 5L4NA 1GDHA 4NECA 3TN7A 5A1TA 5JW6A 2VSYA 2NAFA 1UWCA 2YCLA 3EVAA 3QSYA 4ZVNA 3CTPA 5CT4A 3I1JA 2W4QA 4I4NA 1QLJA 1W5FA 2FFBA 4EB3A 4HFRA 5G0SA 3H1EA 5A0TA 5CJ2A 4NG4A 1Y5NA 1ML3A 2VTVA 1AKUA 1EUDB 4H4EA 1Q1GA 4YAKA 4BNKA 5KVCA 5GGYA 1W94A 1FP2A 1Y1LA 3JZFA 2FGJA 4KE8A 4BRSA 3JYHA 1YRYE 3MLBA 2VYNA 5FIUA 2JLVA 3C4JA 4FKBA 2CNKA 2FK7A 3GRUA 3MG9A 4FC6A 5FUQA 1GPNA 1A8PA 1IY8A 1PNVA 3C3JA 3PA8A 3DQZA 3PVCA 4TL8A 1TLTA 2IL1A 2GBLA 3SR4A 2F3UA 4DJEC 4BNXA 2FXVA 3D3EA 4X64B 5G1NA 3KQLA 4WCFC 3PD0A 1XNHA 2C5SA 1U28A 2AVNA 3HR7A 1FW8A 3E8XA 3OEHA 4RBNA 2CLKB 4R1MA 5LYJA 1JX6A 1VL0A 4ZVLA 2EZ4A 2O8DB 4BEVA 1HT3A 2J6HA 4IDGA 5EUCA 3LBIA 4Z1MD 3DTYA 2RAVA 1F7VA 4Q4HB 5IM4F 1K4KA 1PR0A 2P8SA 2JLCA 3O31A 4H0NA 4XPIA 3OFSA 1MHPA 4NIMA 3KETA 4P0PB 5AKYA 5FADA 3DV2A 4KQGA 4CCSA 3OCCA 2TYSB 3EE6A 2GZ3A 3BREA 2P6PA 4LECA 2GJ4A 3R76A 1VPWA 2NYRA 3TLMA 3GLQA 4AJ2A 2NU8A 3I2JA 3A9RA 2QP4A 1Y9AA 4OMCA 5FNVA 1JH8A 2AZMA 2C3YA 5D6NA 4X45A 1S3FA 3T1QA 2FI1A 4IOKA 3SS9X 1KY5A 2AH5A 3TIFA 1W36B 1UCFA 2ONZA 3ANTA 3IKMB 2YY7A 4NCJA 5EY5B 4B3XA 5M34A 1JXQA 2PQMA 4QUHA 3DUFA 1H65A 1NNI1 1H85A 1RQ7A 2R79A 4E11A 2AKEA 5F77A 1FOEB 2X76A 2DYKA 3ODGA 1XZGA 5HIAA 1WF3A 4P8RA 2X2FA 3RUHA 2QBYB 3Q3IA 4ZANA 3WLEA 1JECA 3BE8A 5JAQA 1ZI6A 3KR0A 4OQFA 1IE3A 4FYVA 3DLHA 1AH2A 4QUEA 3H5VA 1QGZA 3MMSA 4LDRA 1DHRA 1S3IA 2FEPA 1XCMA 1DZ3A 1G8HA 2J9RA 1PX2A 1EFUA 1YL7A 2OILA 4Q3NA 1Z7WA 2D7CA 2P35A 4ETWA 4F96A 4BUCA 3T1OA 4QVGA 4EYGA 2FPSA 2NO4A 3AHGA 4I8XA 3D6JA 2WP0A 1FTSA 1OLSA 1QIMA 2GBPA 2QP9X 4WA7A 1J2YA 4NNJA 1Q11A 1X0VA 4ASUD 3GLFA 1P5RA 4YVFA 3R7WA 1SZPA 1T9GR 4Z99A 3UT5B 2HMSA 4LRSB 3PWZA 4RIGA 3HUDA 3KLMX 2H4FA 4OGFA 2IUFA 1KNXA 2X4IA 5KNCA 5G02A 2CLLB 3O9VA 1EUYA 4LFAB 4ND5A 2ZSIA 1T8YA 1HDIA 4IOLA 3E9QA 1OX4B 1ADCA 4KK3A 1H2YA 2OL4A 2DHQA 1YHYA 5CT8A 3SS7X 4IGKA 2DWUA 4GNKA 5B5SA 1D09A 3BULA 3MWKA 5G4KB 4MR8A 5FCDA 3RRZA 4ZO8A 1OYOA 2WLTA 3A04A 3OJOA 5IM4A 2Y1WA 4MTCA 1YNOA 3UAXA 1BKSB 1GD1O 2QY6A 1KDZA 1Z82A 1I6LA 3M7IA 4HGOA 1E8MA 1NU6A 3NP9A 5ED4A 3QVVA 1TEZA 3PHCA 1PFYA 3OTGA 1CR2A 4QPJC 2XQVA 5C37A 2VJYA 1S0UA 3I37X 5AT1A 3T9CA 1G8YA 2OV6A 2QLNA 3ANLA 5FPPA 1T36A 4AW9A 4MYUA 4EZIA 4O3MA 1VLLA 2AV6A 3ADPA 1DOHA 1Z3CA 2MU1A 2PD6A 1YS9A 4MLZA 1CQWA 2AFHA 4HOYA 1GKKA 2PV0A 4I46A 3UB3A 2WJAA 5F1YA 2WIBA 3VZPA 4LDAA 4F0JA 3OPYB 3VJLA 3BHIA 3D8TA 1NVKA 2QDKA 3U2QA 2GJSA 1OLOA 4DIFA 2HW8A 7MHTA 3CVYA 3TM5A 3HKBA 1L4YA 3AC0A 1GPYA 2RGNC 2W0SA 4HGNA 1TF2A 3K70B 1W36D 4Q7LA 1DAMA 2P2NA 3S2UA 2E4YA 2IZ0A 4M1TA 4BLRA 3TUZC 2PYZA 2AX4A 1RRMA 1PVVA 2Q3CA 3DC7A 4XR4A 4RETA 4F4UA 4ZVTA 4HAVA 1KH3A 2FB9A 1TIBA 2FPOA 4J2TA 2PMKA 3KYCA 4FYPA 1VLMA 1K3TA 2WVGA 5AKHA 1Z7EA 4QTTB 4CV2A 4F3RA 4TKUA 2FWNA 1COWA 3PF9A 4BWVA 1YBVA 4EI7A 4FMDB 4D97A 5ILOA 4EY6A 4NMHA 4U63A 1QFSA 2QVCA 1KZHA 5LDHA 2J5KA 3B9RA 2Q3JA 4D02A 2A8YA 3P2OA 3N5KA 4JL5A 3DP9A 5GWXA 1PR5A 2YXEA 3V1KA 1A4IA 1Z4QA 2QEQA 1AQ6A 1XVLA 3QMMA 3ECAA 5SYAA 1UM9A 3OSZA 3MN1A 3OT4A 4HDSB 4P3KA 4I3HA 4CKWB 1XRRA 3CF2A 4OY3A 4IO1A 3TJZA 4Q24A 1G7RA 4ZQBA 4BMZA 2GJKA 1DQNA 3GMTA 4D9KA 1J0XO 1HZJA 1UK8A 3IT2A 3QMPA 4KIUA 4QU8A 4U7DA 1XWFA 1HLGA 1KEWA 2AXEA 3LDUA 1YAJA 3WLJA 6AT1A 4MVJF 4M0UA 1RADA 5JJBA 3DLBA 4QUBA 1EVZA 3JAKA 3MCWA 1AXEA 4FJ1A 4QDZA 5FWYA 3B9QA 1OTYA 1EVKA 2B69A 2CVOA 1G0OA 3B8EA 4TKUB 3QBJA 4Y2SA 1Q2UA 4AC9A 2IYEA 1KPIA 1GQRA 1X7ZA 1ZGCA 2J67A 3DB1A 3OF2A 4ZA2A 1AHIA 4KU4A 3F6SA 2GPNA 3PWSA 5AHXA 1CF2O 5A06A 5JWOA 1DQSA 2H2WA 4ND8A 1QH1A 4NATA 4L8WB 4BWFB 3AM1A 4X44A 4LGYA 4JQOA 4P53A 2P9HA 3SKYA 1A69A 4BP8A 1U3UA 4RKFA 4ZGBA 1Z3IX 4FE3A 3VZCA 4DADA 3AQ4A 3D4NA 2BFPA 2QAIA 1OVGA 4G25A 1M5TA 1NLZA 2YH2A 2BM1A 2IX3A 4WOPA 2WPDA 3EB9A 3DAYA 4QDTA 5A6VA 3LXRA 1JYSA 1NG1A 2JIZD 2MINB 4RKRA 4TMFA 5DTIA 2QQ0A 4TWZA 5E6UA 1UANA 5DOVA 4K26A 2E5FA 3ISVA 3KZMA 4KDCA 5AVOA 2HRZA 4YAGA 1WTCA 4TSFA 1TQ2A 3H4IA 2BP7A 3ABOB 4RTPA 2AN3A 1C4KA 4LF8B 3IP6A 3UPDA 2WIJA 1ZVKA 4HEA1 4NPHA 2J4FA 1CVLA 1DE0A 3ZBUA 4ZMRA 3GU3A 3SD7A 2FZWA 1AHHA 2C59A 1U3VA 4ILEA 4OO3A 4RVFA 5JDIC 1BMTA 1T36B 1K86A 1HORA 1UMKA 4BIIA 4P22A 4RY2A 4B87A 4KR6A 2P77A 4NOKA 4WIAA 2OO3A 1XPRA 1E6WA 3D2LA 3FGZA 4OL9A 4GWLA 2P5YA 1PWXA 1HFKA 4K1XA 2FCAA 3AU8A 5C1PA 1Z8NA 2QXYA 4WNIA 5EEHA 4A92A 1KTIA 1XDDA 3KKQA 1N0HA 2FMKA 4NEGA 4YP5A 1GSHA 3IMFA 5E38A 4HLNA 1JHVA 3BL8A 2JAXA 4B3MB 3HCRA 4HGRA 4RH0A 4ZGWA 5CDFA 1B4DA 2HA7A 5CX4A 1JI0A 4KQXA 1XE3A 2WUFA 1YT5A 4XR9A 3WYEA 2X2OA 3BIXA 4LFBB 2YIMA 2X19A 4MJLA 4BIMA 2RC5A 2ZZKA 3HVJA 3I9OA 2Y1KA 1XNQB 5HF8A 3D7MA 1K7EB 3EIHA 4D81A 1JIUA 2AQ8A 4L6AA 1OJLA 1XA0A 1DBQA 2QS9A 1VJ1A 1DWPA 1XA4A 3OLQA 3GUUA 3W7AA 1J8YF 3KUUA 4G0NA 5D51S 4LKOA 5DW0A 4TL6A 1A9ZA 4HLUC 2EC5A 3AFNA 4ARIA 1HYHA 2GZAA 2KI5A 5EJGA 4BECA 4A6DA 1ISMA 4L9SA 1GNPA 1XYVA 2FPUA 3HV0A 3PITA 3PE4A 3TG2A 2QN6A 3ASUA 1KJQA 1OILA 3NORA 2J0UA 4WL0A 3ZKWB 1GA1A 2YXDA 2WYWA 2CV1A 1QNLA 2FXIA 4IF6A 1I01A 2G77B 4LOJA 1T2AA 1FX0A 1TZBA 2COKA 2FN7A 4C5CA 3ERCA 3DC2A 3WGKA 3W2GA 3DF9A 4J0EA 1DKNA 1LZKA 5ICSA 2UXCB 3M6VA 5DM1A 3IAUA 4I4LA 4YH1A 2FEMA 2K87A 5AI8A 4F86A 3AEKA 1R0RE 1JSZA 3AM3A 4NI5A 4MKRA 1EZ4A 3WLRA 2IHZA 2FPLA 4JUAA 3MPOA 1DBIA 3ZHZA 4F4FA 2HRRA 3LM8A 2QTHA 3RE1A 1E32A 1IHXA 3KJZA 1BD3A 2D0OB 3L5OA 4BNYA 4RPKA 3GNLA 2Z6UA 1JNYA 4OX9B 3GT0A 2WYIA 1QHHA 1QRTA 3ZHYA 5J2UF 4YQZA 5AD1A 3ZD8A 4AN1A 2QW8A 1TKAA 1UDXA 1FRZA 2O0LA 4MIYA 1D6NA 3CZ5A 3FHOA 3U3JA 1QQ5A 3DMYA 1Y7HA 4ZODA 4CIAA 4F06A 1K68A 2C8KA 2JEYA 3AONB 1M9NA 3P20A 4TLMB 5BWMA 5HEKA 1BXKA 2G4LA 2NV0A 1EM6A 2WWRA 2YS7A 3CC8A 4NU0A 1NKTA 3KT6A 5JH7B 4LZJA 3GYGA 5KAPA 2Q5HA 4KPEC 1VZ3A 1ETHA 1J2TA 2H4YA 4MUHA 3TRDA 2E89A 3H0CA 1QB7A 2XB6A 3TGWA 2ZRNA 5LOVA 2PH5A 4EENA 2H0AA 5LZ8A 4DJDC 4QPCA 5FTMA 5E1DA 3L8YA 2FYTA 2VDLB 4G0XA 2NU9B 3ZHOA 1RYMA 2YW9A 4G9BA 2FN9A 1KKLA 4C4OA 4DMHA 4H3VA 5JADA 2AI1A 3GQBA 2VTEA 1K7YA 1KQPA 2FWPA 4YQYA 4A8JB 3W3AH 3S44A 3PL1A 1LC0A 1TO1E 3GJ5A 3HFGA 3K0AB 3EZNA 3PL5A 1ID1A 1Y9EA 2BFFB 4G4GA 1C30B 1BGWA 3A9UA 4L5AA 1QHGA 3WXBA 2I7DA 3CKMA 2IPAB 3FHJA 3O03A 3PRJA 4OQQA 2Q29A 4R1PA 2JJ8A 2CBXA 2R7AA 3KBBA 3RROA 3TLZA 2OCDA 1V1JA 1E66A 3EVNA 1V8BA 4QO7A 2AOXA 4AFNA 2IYAA 4ODIA 1OLUA 1YC2A 3HVKA 5AOVA 3S1LA 1U0FA 1XCLA 3G49A 4MUBA 4QDUA 2PM8A 2FZKA 4II2A 4IXWA 4FT4A 3CLRD 1B0AA 4US0R 1NBAA 4RHXA 4XE5A 4ZT5A 4EHBA 5FTLA 3RVBA 2K2WA 3T0FA 3FB1A 5KTSA 5K0TA 3IUPA 5CFLA 2BHSA 1NIPA 4NDNE 4IJVA 2OV8A 5I4IA 5EP3A 3OQIB 5IX8A 1L7DA 4J6EA 3K71B 3NAGA 3TMAA 3L4BC 1BRMA 2QY9A 3HJCA 1S1MA 1SVNA 4D9GA 2HL6A 2XPCA 2IIVA 2YJ6A 3HADA 5BSGA 3B5IA 1BVYF 3REQA 2J0UB 3WYCA 3ZKWA 3EQ6A 4BCDA 5CCEA 5EIXA 4P7GA 5ETJA 1HG0A 1RAIA 1NUHA 1W2GA 1Z4MA 5CDGA 1CQJA 3IBCA 5AJVB 4Q4AB 3DLIA 3P96A 1V2HE 2QX7A 1EGVB 2BMWA 3P19A 5LOVF 2QUKA 2R47A 4L4ZA 2CHUA 2QUBA 2AKYA 1B2LA 3QELA 1KOGA 4E2WA 4QYXA 2TMDA 2FZLA 1U3FA 2HREA 3ZQKA 3DQPA 4WSOA 4YP7A