1UKEA

Ump/cmp kinase from slime mold
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
193
structure length
193
Chain Sequence
EKSKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLFKSMGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLMONOPHOSPHATE/CYTIDYLMONOPHOSPHATE KINASE
publication title Crystal structure of the complex of UMP/CMP kinase from Dictyostelium discoideum and the bisubstrate inhibitor P1-(5'-adenosyl) P5-(5'-uridyl) pentaphosphate (UP5A) and Mg2+ at 2.2 A: implications for water-mediated specificity.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Nucleotide monophosphate kinase
total genus 67
structure length 193
sequence length 193
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 1998-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ukeA00
3TSOA 3C5HA 4LRWA 4DEXA 4QJ5A 4ASUD 3TMKA 1MR3F 4PO8A 2GA8A 4ARZA 4GZLA 5JMTA 3NDBB 1G3MA 2C99A 4UNRA 2ZI9A 2PEYA 1EFTA 1X86B 3KJHA 5FTLA 2IWHA 1Z0KA 3BH7A 5JS8A 1SGWA 3AM1A 3GFOA 4PQYA 3RC3A 4HLQB 3CRVA 1KSFX 2DY1A 2ZRCA 121PA 4IJMA 1J99A 4D0NA 1KJWA 4MRRA 2ZXUA 2YOGA 2RKOA 3EG5A 1XTQA 3SFVA 1DO2A 1IOZA 3C4JA 1DAMA 2QP9X 4A6PA 1IY0A 3O8DA 4L8GA 3NKVA 5FL7D 1TU4A 1QG2A 5G3YA 5C46F 2VIIA 2QSZA 3H86A 4TTPA 3LVRE 3OF5A 1CKEA 4LBYA 2SHKA 2ZS8A 2QU8A 3ZQ6A 4X8HA 5EP4A 2A3RA 3GEEA 1NIJA 4RCZA 3L2OB 4X8LA 2MMCA 1FP7A 3TSZA 3VKGA 1E2NA 3A4NA 4ZKDA 1G19A 1I4TD 2X77A 4A2PA 1ZRHA 3TUJC 1E2DA 3PUYA 4QBGB 1JEEA 1G4UR 2ANBA 5FPHA 4B71A 4ARZB 2MSEB 4IOJA 3W90A 2RHMA 3EA5A 1W5TA 3SHFA 1JR3E 5K8UA 2VP6A 4PHGA 2VTKA 2WWGA 2RGXA 2V6IA 3DKVA 3T35A 4MYUA 1G8PA 3D31A 3GLGE 1ELOA 3RS7A 2WOOA 2NGRA 4TQUS 5AUNB 4ERNA 1GAJA 1NLYA 1M7HA 3BXZA 3OFND 4HAZA 3U6BA 2YC4C 4W5JA 1E0SA 1R0WA 3BC1A 3K0CA 1ZD1A 3VAAA 4KFSA 5DO9A 3MMPA 2RGDA 2PX3A 1ZM7A 4C2UA 1JEDA 2OCAA 1D2NA 2EVWX 5TVKA 4LYJA 5F3WB 1JAIA 1K5DA 4HDCA 2V3CC 3OE7D 2QENA 1OFHA 3RS4A 1D5CA 2GTPA 3L0OA 3A58B 3EASA 3TAUA 4G5OA 4TYPA 2BMDA 1KK3A 2BMJA 3QXHA 3K70C 4WZ6A 4HAYA 1DAIA 3MG9A 3T1OA 3PENA 4EPXA 4KBFA 4L9WA 2XB4A 2OCBA 3GJ5A 4XTRA 2VP4A 2DWQA 2HT1A 2J7PD 4MITA 4EQ6A 1G7TA 3KKOA 2QPTA 3VNVA 2VL7A 2WHXA 3GLHE 1L7VC 2YOFA 4F7WA 2P65A 4OK6A 4X8MA 1EWRA 1P2UA 1M74A 2QRZA 3LY5A 3X1XA 3WMFA 2R2AA 2OEPA 3B1ZA 5GVRA 3VFDA 4D4LA 3K09C 2JLYA 1KGDA 4A2WA 4BFYA 4XWOA 5FH9A 3RRZA 4C0SA 4R9UC 2F3TA 3WRYC 2GRJA 4B75A 4Q1AA 5UKDA 3UG7A 1F48A 1S1MA 1T3LA 1VG0B 4GMXA 2PCLA 4UNNA 5KU1A 1GRQA 2X1VA 1KO7A 2IW3A 1LB1B 3MSXA 3R9IA 1AK2A 1GZSA 1OIWA 2WWIA 3FHCB 4M8NE 1HURA 3U7FB 2VRWA 5KDLA 5JWRA 3EIEA 1XD9A 4IFEA 4OQMA 5G3ZA 1EK0A 3TQCA 3K53A 4MUAA 3VR2A 3EA0A 5DISB 4DXAA 3MWLA 2J3EA 4AKIA 1N5LA 2BC9A 4TT3A 5M04A 4I1VA 2IA5A 4IOKA 3ETLA 1AZTA 1WQ1R 1KO1A 2QTHA 4JLPA 4EQ6B 5FPTA 3OIWA 4S2EA 3CONA 3LH5A 4ZDIA 3LX5A 1EFUA 1E9SA 2E1RA 3V9PA 2ZAMA 1G7RA 2CLDX 2YV5A 2IYLD 4OQXA 2PBRA 3I61A 3QJYA 1DADA 1XTJA 4DDWA 2N42A 3P4YA 2OHFA 2FSIA 4G0NA 2GF9A 4XIGS 5E4FA 2AK3A 3DVLA 1LW7A 4WZAE 3SU8A 1E2QA 2I1QA 2ZSEA 2J1LA 1KMHA 1XTRA 1NF3A 4JLDA 3O47A 5SZKB 1G6HA 4YXWD 2GAAA 4Q9HA 4HZUA 1L4YA 5HCIA 5JRZA 4D80A 1E2EA 2QMEA 2XOKA 3B60A 4BLRA 4XVRA 3CR8A 4FMCF 2I1VB 2VBCA 1L4UA 1FZQA 3DZDA 4GPTA 3BD9A 5LDDC 2FGJA 2H1LA 3TK1A 5FFMA 2GCPA 3KFVA 4EJSC 3K0SA 2F43A 4B3BA 3CZQA 4Q01A 4I1SA 2W6ID 4C3ZA 4OJKA 5FOUA 4GSYA 4PPFA 2JASA 1KI4A 4Q4JA 1XZQA 4ZI2A 5L3RA 1ZD9A 821PA 1E98A 5EE5B 4D0GA 3MWYW 4DLSA 4PC1A 5FOXA 5E7MA 5JCPA 4JJZA 4DIDA 2QG6A 3GD7A 1KK0A 3WXMA 4URYR 4JVLA 1OJLA 3E1SA 3DDCA 4N0DA 4WIAA 2IS6A 4Q1BA 3FOZA 3U4QA 4DB4A 1KMHB 3RRYA 1ZBDA 2VHTA 3VX3A 5FPSA 3PITA 2HT6A 2ZSFA 2J0SA 3U7GA 4HZUB 2W00A 5J40A 1T8TA 3L8YA 5JEDA 3GLFA 5JSZA 1TUIA 1S4QA 2JJ2D 1VHLA 4ACBA 4B32A 4EPWA 1OH5A 1DAKA 2D4HA 2FWRA 3MJRA 2DPXA 1G8FA 3K9HA 1ZYUA 3RWOA 1N5IA 2F43B 2RCNA 4NBSA 1P2TA 1N6NA 1II9A 3WYAA 4O2RA 3EZ2A 3WRXC 1G18A 1JPNA 5C4MA 2GVZC 2WV9A 1OXUA 3H4MA 1TEXA 4Q4JB 3RAPR 4PC6A 3T1TA 2GBLA 2MSCB 2QTFA 3IQWA 2IUSA 2WAYA 2OFOA 2R44A 4G1UC 4ZDWA 3W3ZB 1JB1A 1N0VC 4MKHA 3U3OA 4C0HA 5F9HA 1ODFA 3U4QB 2GEVA 4N1AA 1P5ZB 2GCNA 1UF9A 2ZRMA 5EXTA 3RS3A 3H0KA 3GLFB 5JSZB 4Z8XA 4I4LA 4KU4A 4QJ3A 2GWHA 3ZVRA 5DYIA 2CHQA 4PAOA 1EFHA 4Q7JB 3I92A 1XZPA 1NVXQ 2E9SA 4B34A 2OSBA 4PFSA 1N6HA 5EP2A 4ZO4A 1G64A 1H8ED 4NCNA 1QHSA 1P6XA 3FFBA 5JS7A 3Q3JB 2VH5R 1G8HA 2A5FA 4AI6A 2JATA 2XAUA 1KSHA 2V7QD 1Q0UA 1DTSA 3CRMA 3UWKA 4M21A 4NYJR 5EQTA 1E9BA 1UM8A 4DCNA 5CITA 1IONA 3LBIA 1A1VA 1KSGA 3T12A 3GQBA 1GL9B 4N0EA 3QKSA 1W7AA 5G41A 4MA4A 4QKQA 5A4JA 1G9XA 2ZRGA 4TTQA 1YR7A 3ASZA 4EFLA 2B7CA 2JDID 4BFVA 2WZQA 1OE0A 1D9ZA 4PTLA 3CH5A 1XBTA 4JYCA 3WYGA 1KNQA 3IKJA 1P61B 4LK2A 4TQAA 2JJ8A 3OEEA 1CIPA 3M6AA 2EQBA 2W2VA 4KBGA 3FGNA 1G4AE 4B3CA 1BMFA 1WMSA 5HZHA 1CTQA 1XXHE 4DLRA 1KI3A 2IYYA 2GCOA 3B6EA 1PVOA 4PX9A 4Q4AA 3H84A 4KODA 3TJZA 3QF4A 1JXMA 1DG3A 2KJQA 4QXAA 1NMYA 1P62B 2O8EA 1Z2AA 1I2DA 1UBEA 2CCKA 3L8ZA 2FPMA 3AV0B 5EXPA 4OHWA 5K8IA 3TUIC 4DVGA 1VCMA 4YQFA 3X1YA 1XNJA 1COWD 2GJAA 1TAGA 3BERA 4WW0A 1IN4A 1SXJA 3LNCA 4A15A 5AK0A 4M2LA 3C8UA 2PL3A 3T15A 4ZI3A 4NYIQ 2F6RA 4AY2A 3KKNA 2UVQA 3QKUA 1JQLB 2HF8A 1ZJ6A 1VG9B 3CF0A 2IHBA 4DSTA 3QKSB 1KKMA 1Z6YA 2C9CA 4JLAA 4LHYA 4Q21A 2OCYC 3SJZA 1DELA 2GVDC 1AA9A 1R8QA 1DO0A 2D06A 3IIKA 2ZS9A 5DH9A 5FUYA 1GTVA 1W1WA 2P6RA 1E9CA 3ONWA 3P32A 3AF4A 3QUSA 1U99A 2C9OA 3LBNA 1HA3A 1CR0A 1E32A 1ETUA 3HU2A 5E95A 4B73A 1HYQA 2YJTD 1SHZA 3I3SR 2C98A 5JRJA 2HLDA 1XPRA 1NVWQ 1GRNA 2A9KA 1E2FA 5KNBA 3X1ZA 2WWXA 2GCOB 2G0TA 3L43A 3TAHA 4W9MC 4Q4AB 2WOJA 1S3GA 2ZETA 4KO8A 2KBFA 3QF4B 2OBNA 4GOJA 2G1JA 2O8EB 1N6PA 3DL0A 2IX3A 2BBWA 3BRWD 4L15A 2QL6A 1LNZA 3LD9A 4IVPA 4US0R 1G7CA 1K5GA 1SXJB 5BYJA 1KHTA 2LWIA 4M9ZA 2W0MA 4KCGA 4TYQA 1E2GA 2O5VA 4PZZA 3SBEA 1M7BA 5KPJA 1SKQA 1ZC3A 5EJEA 2OLKA 1Z63A 2QTVB 4M1SA 2IYTA 3TVTA 1W0KA 2C78A 5FL3A 4AKHA 2REOA 3W6OA 1YZNA 2HCJB 1LTQA 4OI4A 2ZRBA 3KUCA 2J9RA 1Z6GA 2NTYC 5KPDA 4B6FA 5FBVB 1A82A 1XJQA 2WWWA 3FYHA 4Q19A 2PJRA 2IUTA 2XTMA 3QY0A 2C96A 3LQQA 5AJWA 2GHIA 1RRCA 3CX6A 4A0HA 3ADDA 3TE6A 2JLXA 1NIPA 3EC2A 1WRBA 3CRW1 5FOTA 4AYWA 1RZ3A 3QKTA 1ZD8A 2J0UA 1F60A 4ESVA 1XCMA 3WNBA 1NJFA 4EKDA 1KI7A 1Z29A 3B5JA 3FWYA 3TGPA 2ZJ2A 3KQHA 2D74A 1BO6A 4DRZA 4PPQA 1XFAA 4QFMA 2YHSA 5LBIA 2RGEA 2B92A 4BRWA 1G8GA 3EZ9A 1J8MF 3CWZA 4BEBA 1W4AA 1R8SA 3TR5A 1E79A 2J0VA 2XITA 4P4SA 4JLJA 3GJ4A 2VEDA 3GLFE 3FFAA 1J70A 3HP1A 4DWJA 3TR0A 1JXOA 1Q57A 3L0IB 3PG5A 2DYKA 1VG1A 3THXA 1VCIA 5AJXA 1W2HA 1AQUA 3LFUA 2C9YA 4M1YA 4ASUA 4C0KA 3FMIA 2HDNB 4TMXA 3RANA 3A1UA 5FBLB 5F9FA 3IBYA 1IXRC 1XB2A 3AVPA 3WHLA 3BGWA 4TLDA 3E70C 2BKEA 2ZU0C 1OH7A 1OH6A 2OZEA 4UJ3A 5DYGA 4PO9A 4D81A 1W5SA 3QXCA 1KI6A 4A4DA 5C18A 1Z08A 2ZJBA 2WSSD 2O8CA 2WWHA 2RMKA 1IN8A 2IS4A 3U60B 4XOIA 4BLQA 3BB4A 3SFZA 1R0YA 4M4SA 3FTQA 2NPIA 3HR7A 3SBDA 3NC1C 4B33A 2J0UB 1UBCA 4TL9A 3IQXA 4US1R 1Q1ZA 4A92A 1G1MA 4YMWA 2WKPA 3LX8A 5FL7A 2Z5FA 1A5TA 1T91A 4I1OA 4MKIA 1PZNA 5J4LA 4L16A 3L0SA 2AN9A 4NU0A 2QMOA 5BWMA 1E3MA 4LX0A 2DFTA 3KUDA 3WBKA 1QHYA 1V43A 4QGAA 3WNCA 4P4SB 4M0LA 1T3SA 2GETA 2WJVA 3SYKA 1E0JA 4GBMA 1UPTA 1W2GA 4DSOA 4LV8B 2HCBA 4RD2A 2K5UA 2ZRAA 5EP3A 3THXB 1EFCA 4KVAA 2ASEA 4JVSB 2QP3A 4M22A 1GWNA 2D62A 2FGKA 1DEKA 4U7DA 1NN5A 1WA5A 2WAXA 3PXGA 1G41A 2G3YA 2QAJA 1KI9A 4XSGA 3CR7A 2NO7A 1KI6B 2AD5A 2XX3A 3TNFA 4O3MA 2O8CB 4NYMR 1VG8A 2RHDA 5E3HA 3K70D 4DLZA 1KY2A 4NHOA 5L8VA 1DVRA 3OFNA 4A2QA 2XTNA 2Z4SA 4P31A 1FQKA 1BYIA 3IO3A 3NDPA 4IDNA 4YDSA 4LV6A 3JVVA 1XTIA 4RD0A 4LC0A 4IOLA 1KI1A 3PJRA 3GMTA 1M34E 4LJAA 4MYTA 4P4TA 4JSTA 4TYNA 4JLKA 1AKYA 1J2JA 3W3AA 4Q48A 5JJKA 621PA 3OE7A 1CJUC 3GJ7A 3ND8A 2Q0HA 1ZNZA 3B2EA 3H2YA 3MJHA 1QRAA 4NL4H 4OHZA 4LBWA 4NMMA 2QORA 3C14C 2XZLA 1JJ7A 4BGDA 5IT5A 3AUYA 2TMKA 2V9PA 3F3YA 5TB5A 4C0AC 1Z6XA 3S1AA 1G8YA 3MUFA 4FCVA 2G77B 5LB4A 1DS6A 2P6UA 1M8PA 4DDVA 4DLUA 4B3GA 2QROA 2VO1A 2W2TA 4OQLA 4P33A 1KY3A 1X1SA 1CJTC 1IN6A 1XRJA 4NP6A 1IBRA 4UNSA 3PUWA 1X6VA 1UEJA 3KXLA 3JZMA 3QVUA 4MRSA 4V0ME 2O8BA 4RD6A 3FMPB 2P6NA 1U2RA 1RVDA 4NCJA 3BH0A 4QHYA 3ZVMA 4FIDA 3D8BA 5CLLA 5DI3A 1PLLA 2GBLC 5H1YA 2NMVA 4W5WA 1DARA 1ESMA 2IF0A 1W48A 4MRVA 1SULA 1B23P 1W4BA 4O0MA 1G291 1G17A 4LJ6A 3ZYCA 2A7QA 5DSZA 4EPRA 3BJIC 3BB3A 1QZXA 4B3DA 2JLSA 2QAGA 1DOAA 1XCGB 3S1AB 2UZ3A 3LVQE 5IHPA 3SQXA 1KDRA 5JI3E 4KYIB 2BEJA 3CM0A 3DKPA 2XXAA 1T0JB 4K46A 5KDOA 3CRQA 3ZVLA 5D3MA 3GPLA 2W83A 1I4DD 1RRFA 3X1WA 2ZRHA 2ZUCA 1AS2A 3JVUA 5AUQA 2UZIR 1H65A 5HTKA 3NIBA 1QVAA 5FBWB 2O8BB 1F3OA 3T1QA 1C1YA 1M6NA 1DAGA 1KAOA 4OKSA 1MO3A 4L4UA 1HTWA 3LXXA 4Y0VA 1RFLA 4TL8A 1TTTA 1U9IC 2CLCX 4Q66C 4B2LA 5DI3B 2IYWA 3MFYA 2IXGA 5CIWA 4CEIA 4RD3A 2OE2A 3R8CA 1V5WA 721PA 1BH2A 4D6PA 2EYQA 2FE4A 2ORVA 2R6FA 3RRMA 2OO7A 4BE7B 5FI1B 5EZ5A 3AGPA 1HH4A 5KSOA 4BLSA 2QMUA 2CDNA 3K9GA 4URZR 2W6IA 5DHAA 3PUZA 2BKUA 2QAGB 1CJKC 1XX6A 1Y63A 1YR9A 3A1WA 4JLOA 2R62A 4HDOB 3B1XA 3CKLA 5LD2B 1N5KA 2YINC 2BM0A 2RGAA 3ZDQA 3QENA 4HLUA 1I4LD 2P0EA 2AXPA 3LW8A 4I81A 5FUVA 3WP1B 1LFDB 4CRWB 3HU1A 5D3MB 1E9DA 2FEOA 1KIMA 3SQWA 4A0GA 4DB2A 1OXVA 4FINA 4BFXA 4LJ8A 1AS3A 3QXJA 3FHTA 1E1QD 3TW4A 2ZSDA 1OF1A 1E1RD 3EPLA 3ADCA 5JBQA 2P5TB 3IUYA 4KI0A 1F6BA 1XEXA 4B2IA 3QOFA 1U8AA 3NXSA 1SVOA 3B1YA 3IEVA 1U98A 1SXJC 4X8OA 4JBXA 2JJ2A 2ZYWX 5J5CA 3GJ6A 3EC1A 1U90A 4A8JA 1Z0FA 2JJ1D 4IFBA 4MGKR 4CEIB 3QBTA 2AL7A 1N3BA 2ODNA 1Z5ZA 4IKEA 3GJ0A 3FVQA 1KYIA 4EAQA 1GG2A 4B6EA 3QG5A 2Y8EA 2G9NA 1GM5A 4ITRC 2WPDA 1MH1A 1MO6A 2GNOA 1LV7A 2CL7X 3B78A 3CNOA 4OYHA 3QBVA 2R6AA 2ZQ5A 1OIVA 1KO4A 5J4HA 4A36A 1XXHA 4OHVA 4YONB 5HR5A 1NBMD 1ZM2A 1OT3A 5E7IA 1XMIA 1F2TA 1P73A 1UBFA 4YMSA 4OBEA 1ANKA 1IJFA 3AF1A 4HUTA 3WHKA 1F5NA 2OLJA 1O87A 1UKZA 2BBSA 4ILEA 4AKEA 2ZRKA 2A2ZA 1Z6TA 2HJVA 2BOVA 4B76A 2R8RA 4EFNA 5IK2D 3SEAA 1E99A 1T9HA 3LLUA 3R9XA 1Z0JA 3IIJA 1FTSA 2ZJ8A 4PPNA 1TQ6A 1H8HA 4XD7D 3BOSA 1T6NA 1Q20A 2XSZD 2Z43A 4IDQA 4L9SA 1YU9A 1H8EA 3AVXA 2GJ8A 2QQEA 4G01B 3ZIAD 2YYZA 1OFUX 4QRHA 1BKDR 2OAQ1 2Q6TA 4CT4B 221PA 3CPEA 4V02A 4AYXA 2DWPA 2V7QA 3Q8XB 4L5BA 3REGA 3UIEA 5JEEA 1UKVY 2FMXA 1XXHB 2JIZD 1II0A 2V6JA 2XJ9A 4I1UA 1J90A 2AR7A 3E5HA 4DDTA 5IF9A 5HKKD 1U0JA 3IPYA 1F2TB 3FKQA 1E2IA 1XD8A 3I62A 3EPHA 2PX0A 2NZ8A 1JBKA 3MRSA 3RSLA 3QEOA 4GMDA 2BBTA 2GILA 5BYKA 2JDIA 4GZMA 4UQOA 1QHHA 2A5JA 2OAP1 4RY2A 1QG4A 3NBYC 3ZS8A 2VHJA 3T34A 1SZPA 1P9RA 2O52A 2QMHA 4H1UA 1KMQA 4R2IA 4KV9A 2CK3A 4PAMA 5HE8A 1IY2A 1XMSA 1CLUA 4TZ6A 4G5SA 1VMAA 4A0FA 1Q3TA 5C4GB 2RGNC 5H8WA 5L3SA 3X1DA 1HQCA 2L0XA 2RH5A 2ZVPX 4ZKEA 3HJNA 4V0NA 2CJWA 3VR6A 4IDOA 1YHNA 3LDAA 4DHEA 1GIAA 3U2QA 2KE5A 2VSXA 3DOEA 2PZFA 1J8YF 2P2LA 3THWA 2IEZA 3U6KA 1COWA 4HZIA 2IHYA 2BM1A 3B13B 3C15C 4HLDA 1SVLA 1JJVA 4HUQA 1E2PA 1XMJA 4WA7A 3A8TA 4LHVA 5D3QA 2BJWA 1MO5A 2ZE7A 1MV5A 1ZINA 2D2FA 2DFKB 2HXYA 2QPAA 4OL0A 5DE3A 3T5DA 2A30A 4ACAA 1AKEA 2CBZA 2YZ2A 1QHHB 2QNRA 2W0SA 3KKQA 2P5SA 3MWKA 4FW9A 4Q1CA 5AWFC 4TYWA 1FMJA 3AVWA 1XPUA 4A1FA 4BASA 2BBOA 4HATA 1YRAA 2CLSA 4NH0A 1HV8A 1YQTA 4WZBE 2J59A 1YVDA 1G7SA 4Q4LA 3IO5A 4IEEA 1XTSA 1ZNYA 3Q85A 1P2VA 2ZYUX 3BIFA 4CIDA 5L3SB 5DNYB 1VCNA 3O8RA 1N25A 4FD2A 1US8A 3AF0A 2CJWB 1KZGB 1ZVQA 2Q3MA 2ORWA 2X2EA 1UFQA 2DHRA 3DOFA 3MGCA 4TMZA 4BZQA 4LCBA 3THWB 4QHTA 1BS1A 3OAAD 3VX4A 4HUQB 1BOFA 4RCYA 1C9KA 5BN4A 1G20E 1CF4A 4KVGA 4OK5A 5HE9A 2EWWA 2BVNA 1Q12A 2VQSA 2ZRNA 3DMNA 1GL6A 2QE7D 4N3NA 2Z6VA 4G3XA 3CLVA 4GI7A 1YZLA 2IEYA 2XNSA 3CPHA 3LW7A 4M9SA 4Z54A 1LVGA 2IC5A 2WBLC 3UMRA 1KI8A 2ZROA 4MYHA 3HYRA 4US2R 1OH8A 2GJKA 5KUTA 2EYUA 1E96A 2D2EA 2RB4A 1G3RA 2ZJOA 1HT1E 4PXAA 2H92A 4E07A 3BORA 1KDTA 1OHHD 4TMTA 1EWQA 4MGZR 2BMEA 3MD0A 1UDWA 3PCRB 3EARA 3LRPA 1A2BA 4JLBA 3QF7A 4LWZA 1ZNWA 3ZS9A 3TUZC 2WMOB 4M53A 1R2QA 4G5RA 1US8B 4DEYA 2O8FA 3PIRA 5AJZA 3RS2A 3A1TA 3OIUA 2CE2X 4PHTA 4QGHA 2H57A 1UDXA 1RPZA 1Q3HA 4AK9A 3W8NA 4TQ9A 3ZZ0A 2N46A 2FZ4A 1RRGA 4UJ5A 3CNLA 4ESHA 3UATA 1SVKA 1YR8A 3QXXA 3CH4B 3NBXX 1AN0A 5FUXA 5GJVC 3W5IA 3GLIE 1Z22A 3SS8A 1XJ0A 4Q1FA 3LQRA 1KJYA 4IHQA 3THOA 2ZUBA 1OFTA 5BW8A 5EXXA 4KJZA 4B44A 2O0HA 2YWEA 1XEFA 1UKEA 4DSNA 1P2SA 4Q9IA 1R0ZA 2X19A 1NI3A 5LPNA 3KB1A 4DLYA 4GT1A 4JIMA 5EXSA 4HB4A 4KSCA 2CL6X 5EUMA 2HXSA 3KKMA 3NH6A 1ZM9A 2QEQA 4C0JA 1A7JA 3W9YA 3CWQA 5KDDA 3QEJA 3QNUA 5J4YA 4QBIA 3RC8A 2VP2A 1EGAA 1NKTA 1QF9A 2V4ZA 5TMPA 2O8FB 4PHHA 4C0QC 2D7CA 4PPGA 1DBSA 4JMPA 3KQLA 3SJBA 3KZ1E 1FOEB 1NSFA 3VKWA 4AYTA 2FV8A 2QAGC 4DKXA 1NG9A 5F98A 2HJGA 4JS0A 5JLJA 2ZS7A 4BEJA 4V03A 2ZJAA 4LBVA 3DMDA 5LD2C 2XOKD 1N6RA 4BZXA 3W5JA 2OM2A 2W58A 3K9NA 4QBFA 3AEZA 4V0MA 1P9WA 4OI2A 3AVVA 3Q5EA 3EAQA 3EW9A 3CF2A 2I4IA 2EWVA 4Q9LA 5CIQA 5F2EA 2MMGA 1QHXA 1ZCBA 1FMLA 1U94A 3AP3A 2CVHA 4DUGD 4QGFA 1FUUA 5FR1A 5DHFA 4FCWA 2DB3A 4DLWA 2VYFA 1G5TA 1OW3B 3EZFA 3UMFA 1GDDA 5AR1A 1OSNA 2D7DA 4ON9A 5K8LA 1JI0A 1N2CE 3TVDA 5HPYB 3EPKA 5LB2A 4A9AA 2H17A 3ZZTA 2DFLA 4KFUA 2A5YB 4OK3A 1XEWY 4U5XA 3N5CA 1OIXA 3N2IA 3PV0A 1FNNA 1VTKA 4URXR 1ZU5A 4RZ2A 1LY1A 3C41J 2ZREA 3BWDD 1Q21A 4UKDA 3AQ4A 1W0JD 4DZZA 3KL4A 3NG1A 3P4XA 4YMUA 3NHBA 2EFHB 2FH5B 3HU3A 4RSGA 2IUUA 2ZI4A 4MGIR 4R98A 3K09A 4KFRA 5CK5A 3RDPA 3KXIA 3FMFA 3AF2A 4FN5A 1T5IA 2QT1A 2ZE5A 5DN6A 3AGQA 4Q9KA 2REXB 2VHQA 2X2FA 3GEHA 4RD4A 2GEUA 2EW1A 3K0CC 1NN0A 4KYUA 1W36B 2EU8A 4NYIR 2B6HA 3B8HA 4J0QA 1IM2A 2WJJA 5CYPA 2XGJA 3RS0A 4LJ4A 1ONBA 1T8UA 2ATXA 3BAFA 3LA6A 2ODBA 4MYCA 2OFXA 1Z07A 3ZZUA 5CYOA 1OV4A 4F4JA 2CCJA 3H1TA 3K70B 5CB8A 3AB3A 1YZKA 4E03A 1GNQA 1NRJB 2FJUA 2ZRDA 3R9WA 3QPWA 1WE2A 1N5JA 2RGGA 3C5CA 3CNNA 1R6BX 1IQPA 1FP6A 3A37A 1OKKA 4D26A 4C0BA 4TL6A 1N6IA 4MKFA 1G3IA 2AWNA 1PLKA 4BLOA 1ZAKA 4M1TA 4XTCS 1WB9A 3GJXC 4PO1A 4D0LB 4GOKA 2AFIE 3ASYA 3QPVA 4BECA 1F2UA 2GXUA 3DO6A 4ZPXA 1XCPA 1G3UA 3FKSA 4JT4A 4KLZA 5HZKA 3QPUA 4JZKA 3I8XA 3SZRA 3TQFA 3THYA 2E87A 5CM8B 2BMFA 1QHGA 3NH9A 5KTYA 2R6DA 2GKSA 1Z0IA 4GNKA 4CYMA 2FDCA 1Z8FA 2C03A 4MDEA 1J7KA 3VR4A 4Z1MD 1JPJA 2ZR7A 1RRPA 1Z06A 3OESA 5GJCA 2VF8A 1LS6A 3AF3A 3SDZA 3CUEF 3F8TA 3T5GA 3ZGXA 1TF5A 3D7MA 1LF5A 4OI0A 1QVRA 4F92B 4Q1DA 2ANCA 1E9EA 1ZM4A 1U0HC 5BN3A 2YC2C 1YR6A 2GXQA 3LBHA 4JKIA 4TLBA 4EJSA 3QQ5A 1AGPA 3M1IA 1S9DA 6Q21A 3RNLA 4RFVA 1QHNA 1Y3AA 3R8FA 5EZ6B 4AG6A 3VHXA 4II7A 4GL2A 4QNRA 2WSMA 1HEIA 2O0KA 1TU3A 2AKAB 4LPKA 5L3VA 2H5EA 2OBMA 4BUJA 3Q7QA 4AIIA 4LHXA 3GJ8A 4B3XA 1I2MA 1SVWA 1T3HA 1AS0A 3NWJA 3QXSA 2JEOA 2Q9CA 4EFMA 4JVMA 3KQNA 3A1SA 3V4RA 4O2LA 2YNMA 1F2UB 2B8TA 2GZHA 1P7CA 3UMSA 4HYYA 1NVVQ 2WJYA 5EE9A 5KOYA 3CRRA 2A5DA 4LSGA 1KDOA 4F91B 1RE0A 1DG1G 2W6JD 4K8OA 1CU1A 2NPFA 3THYB 2G6BA 2IBMA 3NC0C 3SI7A 1ZCAA 3G82C 4CW7A 4R71A 4C7OA 3CB4A 4C4PA 1JR6A 3BFKA 3CBQA 5FBRB 4B43A 2P67A 5CK4A 5TY0A 2DR3A 3Q9LA 3KX2A 5KHOC 1SXJD 2ZIAA 5J47A 5FTKA 3QSYA 2BWJA 4FMBB 1A4RA 4HI0E 1SKYE 2R65A 4BZPA 3P26A 3M0EA 4BPBA 3CX8A 1YJ5A 3B9PA 2FFBA 4HAXA 3ZVNA 3AVQA 4EJSB 3V4FA 4YDHB 3FE2A 2ERYA 1KNXA 1GVNB 1SVSA 4Q02A 2ZRJA 1E1QA 1P60A 1D8TA 2NOAA 4TSFD 3KQKA 1CR2A 1E1RA 4DIEA 3WY9A 3MAAC 2LKDA 3BS4A 1ZUHA 1GITA 2J87A 4Q4HA 5FTMA 5C2JB 2ERXA 2IYZA 3LV8A 4RZ3A 1DAHA 4EPVA 4NKRA 1YKSA 1P9NA 2AKYA 2B8WA 4IEIA 4Q47A 2ZI5A 4DJTA 2CE7A 3ZH9B 4M1MA 1X3SA 2UKDA 2AFHE 4EPYA 4EUNA 4C7OB 2J7PA 2ZI6A 1R5BA 2BIFA 2WKRA 1KZ7B 3RSOA 2NO9A 4WBSA 4CEJA 3VNUA 1VKJA 1NBMA 1TF2A 3VKHA 2G88A 5DI9A 4ZIRA 1FPMA 3C16C 1JAHA 4URWR 3MWJA 1ZUIA 2IYVA 3NBZC 3V00A 4HAVA 2MSDB 4K81B 3WNDA 5AJYA 4DCSA 5JZVA 1FW6A 1KJZA 2KBEA 5KNCA 4IXNA 3FPAA 1E9FA 2AHOA 3FHOA 1XJCA 1ZC4A 2H7VA 2BHRA 3AKEA 5IK2A 3AUXA 2V1XA 1FUKA 3F0TA 1UEIA 2QPOA 4H9GA 4ZCMA 4NE2A 4Q4HB 5GVSA 3IHWA 1E4YA 2J46A 2ZYVX 4XD7A 2F1HA 3IHLA 2XSZA 8OHMA 2GDJA 4WVFA 2VF7A 2WMNB 2VSOA 3IILA 3TKLA 2PZGA 4KFTA 1E2HA 1JR3D 5JHGB 4XVQA 4IDHA 4TZ0A 1S2MA 1N6OA 5KYKA 2JLUA 2JIZA 3ADBA 4D2IA 4CEJB 3U7HB 2DCUA 4GRAA 4ZIRB 3AVTA 2VHUA 2NZJA 2XNDD 1Q22A 4XSHA 5FOWA 2GESA 2ZYTX 3R20A 1IAQA 5JECA 3I8SA 1JNYA 4C9BA 4FWIB 2YWFA 1AIPA 2ZJYA 1OXSC 3SHWA 1TADA 3OEHD 5A0FA 3EZ7A 1MKYA 2NIPA 2C5LA 4QGGA 4Z51A 5CDFA 4YXWA 1UBGA 2VP9A 5JWHA 5A5GA 5FOVA 4JJKA 1OXTA 5K8TA 4PSAA 2IYUA 3K0AA 4OQFA 3IBGA 1VYVA 3HPQA 2FPKA 4I99A 5IDVA 4S35A 1R5NA 3RLFA 4ZDJA 5CJPA 1KKLA 2WICA 3O8CA 3P27A 5FR2A 3ZJYA 2BCGY 2OILA 4FI3C 4M1WA 2V1UA 2IYQA 1BYUA 2JCSA 1EXMA 4DCTA 2PT7A 1RYFA 1CR4A 3UWOA 3K0EA 1TEVA 1TNDA 4LYAA 3W34A 1Q44A 4AWXA 2FU5C 5J4VA 1ZU4A 1PV4A 4LZZA 4BFTA 2J41A 2XXAB 2ODEA 4ABYA 1GKIA 2JLVA 2ZANA 3A1VA 4TLAA 4E5UA 5AUOB 3PQCA 3QG1A 2FZLA 4UNPA 2YWGA 1YZTA 4DDUA 2YOHA 2EFCB 3E2IA 2OFWA 1K6MA 3B7GA 4RZUA 2PCJA 2ODWA 3N70A 3AVOA 3GLIA 3U3KA 3SN6A 3WYFA 1XMVA 1ZIOA 3ZQJA 3K0AB 3PUXA 1CJVC 5CJ2A 2ZRLA 3BFVA 2OESA 2C77A 2HUPA 3SJAA 1NG1A 1GFIA 1GRRA 2VLIA 3K9LA 1CS4C 1CRPA 2F55A 1EG7A 1HE1C 1S1CA 2YWHA 1K8RA 2I3BA 3L0PA 1NKSA 1S3SA 5E7JA 4QJ4A 4F4IA 1RYHA 3PEVA 3FB4A 4FMDF 1DAEA 4JLMA 1W36C 5KSZA 2O8DA 3BK7A 3TIFA 3OAAA 3CIOA 4WOPA 2BEKA 4QM7A 2R6CA 2ZM5A 3OIVA 2OBLA 2OXCA 3GEIA 4RKEA 5KNDA 2QE7A 2ORIA 1N6KA 4AC9A 1TQ4A 2Z83A 5EE0A 1IY1A 3B85A 5GADl 2ATVA 4PAQA 1MRNA 1RC8A 2ZJZA 1S8FA 1T5LA 2WJGA 2JA1A 2Q9AA 5G40A 3GLIB 1FX0A 2WIAA 1EFRD 1XEXB 2ZE8A 3KJEA 3K1JA 4MKGA 521PA 2QSYA 1OHHA 1CP2A 2X8AA 1OYWA 1CULC 4PC7A 2CNWD 4A8JB 1AGRA 1NY6A 1XU4A 3T61A 3UG6A 2FG5A 4MQBA 1IXSB 3DHWC 2Q21A 1UJ2A 4GP6A 4NTZA 4WAUA 2REBA 4QHSA 3X2SA 4ZV4A 3CO5A 2JLZA 4BLTA 1IN7A 2OG2A 1LS1A 1OPXA 3NVAA 1FNMA 2F9MA 2ZRIA 3J81k 5H68A 4Q9JA 3KJIA 3SYLA 4GDFA 3MLEA 2O8DB 1P4SA 2YVUA 1RIFA 5FUWA 1MABA 1UKYA 2BDTA 4A82A 2PLFA 1MRSA 1VIYA 4PC3A 1R4AA 4LHZA 1NMXA 1TX4B 3DM5A 2BCJQ 4HDQB 3FDIA 1GKYA 2PH1A 1VHTA 3EPJA 2HV8A 1KDPA 2OXRA 2FFQA 3UKDA 2WWYA 2FSFA 2CMKA 3K0FA 1Z0DA 1R0XA 5CB6A 4W5HA 3N2EA 2CL0X 3BE4A 1FX0B 1XTKA 3I73A 1XDBA 2CHGA 4OI1A 2G0NA 4P0TA 5IRCD 4LHWA 4Q7MB 1KTVA 1QDEA 2FF7A 1WDTA 5AJVB 4HB3A 3C7KA 1E0AA 2WJIA 2ZTSA 1NBME 2ZSAA 1NL3A 2GZAA 3FMOB 1D9XA 4HB2A 1A2KC 1E2KA 1CBUA 3JZAA 4AG5A 3M4YA 4LDJA 2G83A 3CW2A 1Z0AA 3ADKA 2GEDA 4AKGA 3A4LA 3HYTA 3OIYA 4D4KA 1BIFA 3P1JA 4QC2A 3TW8B 2C2HA 1VCOA 5JJIA 1C4OA 2CEAA 3GP8A 1JQJC 3CX7A 2IF2A 4YMVA 3TSWA 4EPTA 1VYTA 4HAUA 1TQ2A 2WKQA 1GOTA 1MABB 4XJXA 4HSEA 4PC2A 5HCNA 4UNQA 2QRNA 5B64A 1E4VA 3AKDA 2F3RA 2AXNA 1CRQA 3VR5A 3U5ZB 2NG1A 2V55B 4M9XA 1ZUNB 3K0FB 2ONJA 1W49A 1S96A 1P72A 4DUGA 2FEMA 4PANA 4Q5IA 4RJLA 3ND9A 1IN5A 4Q18A 1Z28A 1YRBA 1ESNA 2HYIC 2AD1A 2QM8A 5BXQC 4BWYA 3KB2A 4B47A 1OB5A 4V0OA 2ZI3A 3T1VA 2QI9C 2ZE6A 4RD1A 5JHHB 5KSYA 2ZI7A 4OHYA 4WXPA 2F1JA 1AJEA 3LWNA 4YMTA 5JCZA 5JFGA 1IXZA 4DLVA 1W0JA 3AKYA 2GXSA 3EX7C 2WVJA 3EIQA 3QE0A 4PQRA 3KKPA 5CDFE 3QI2A 5SZIA 4HB0A 4P32A 3T06B 4R2HA 1WF3A 3RS5A 1G5PA 421PA 2PLRA 4NYJQ 2FA9A 5FI0B 3NBFA 4H1VA 2AX4A 3OZXA 1TL7C 1W44A 1KAGA 3PVSA 4DBLC 2DWOA 5GJWC 3DEFA 4PSKA 3U3MA 4O25A 2J5XA 4EDHA 3W6PA 1D6JA 4PZLA 2KI5A 4LBZA 4CEHA 2WIBA 3ZD6A 2WPDD 2R6GA 3SE0A 2ZU6A 3WMGA 3Q72A 2XEXA 3BB1A 1X8JA 3VR1A 4HAWA 3U3RA 4CF7A 4E09A 2FFAA 1CEEA 4U02A 3SJCA 5TARA 5B57C 1W4CA 5C1BA 4Q1EA 3KDSE 4DCVA 3EWAA 2GK6A 4NPHA 1D2EA 1E69A 2QQ0A 2FX3A 2QUZA 2IT1A 1U8YA 4TN1A 1EX6A 1Z6AA 1DPFA 1NVUQ 2CHVA 3LLMA 1O3YA 4TYYA 2GJSA 3SOPA 1KSJA 4C2TA 2ZR9A 1SVMA 2ZPTX 4BFUA 2PJZA 2XZPA 1UADA 2QGZA 5AUPB 4AD8A 5P21A 3WP0A 4FCTA 3KFXA 3O8BA 5ANRB 4TLEA 1NN1A 1H8HD 1VYUA 3RABA 1M7GA 2CVFA 2IXEA 1FQJA 3EXAA 1WBBA 3AVUA 4NZYA 1YZGA 4GOXA 4QL3A 4UXJA 1KO5A 2XB2A 2ZITA 4R7ZA 4UXHA 4JLNA 1ZMXA 1KK2A 2PMDA 4Z8YA 1U8ZA 1B0UA 4TT3D 3U7EB 4B3FX 4CEHB 1KK1A 5BQ5A 4KITB 2EFEB 3HWSA 1Z83A 4Z1MA 1N6LA 3L82B 2IXFA 1PUIA 2NQ2C 4TWZA 1NMZA 4KSBA 1II8A 4PSVA 4MUBA 1U9IA 4GP7A 3NEYA 1ZW6A 4LC1A 5H70A 2H18A 2ZRFA 3AKCA 1G5RA 2XTZA 2W2XA 2WSSA 3U61B 4TMVA 5JWOA 2FN4A 5G53C 5B30A 1SQ5A 1T0HB 3CPJB 3LXRA 1NNEA 4LV5B 4TL7A 1HT2E 4Q7KA 3D3QA 2JGNA 3UXMA 4MRNA 3AP1A 4E22A 1SKYB 2VHCA 4M9QA 4B2PA 3SC3A 1SHKA 4IW3B 2BJVA 4CGZA 2QN6A 4Q03A 4QOSA 3Q5DA 3UPUA 4CT5A 2R9VA 3AVYA 2CK3D 4BRUA 4F4CA 1PUJA 1X1RA 2H8KA 4PHFA 5BN5A 4JSYA 4POAA 1E2MA 4TMWA 5EE1A 4D4MA 4QBHA 4DLTA 5FTJA 3WBJA 3PEWA 4CDGA 3VHLB 4W7SA 1ZIPA 1QHIA 3I32A 2W6JA 2CXXA 4BFSA 3CZPA 4ZCLA 4QM6A 1E2JA 2AK2A 2GZDA 1WBDA 1AM4D 1NP6A 2GK7A 4LPSA 1VDZA 3VTKA 4P4UA 2DFNA 1MOZA 4B35A 3GFPA 1HQYE 1II8B 3RRNA 2OV2A 4V0LA 4DC9A 3PEYA 4V0KA 4BFZA 1DE0A 2ZRPA 2PZEA 1G6OA 3CF6R 2RGBA 1R5OA 2WWFA 4IXMA 4RFSA 2GJ9A 2V54A 4D82A 4LY6A 3PEUA 4CZ2A 1PJRA 2ZEJA 4NONA 3IEUA 2GAOA 4OHXA 1GKUB 4TSFA 2Z0MA 5ELXA 1FL9A 4JL8A 4MDFA 1Q1EA 1XWIA 3AH8A 2OT3B 4G5GA 2A78A 2ZVQX 4B48A 3ZD7A 1RKBA 2PEZA 2V8OA 2ZR0A 3G0HA 1GNRA 4ZDKA 1VECA 1KO8A 1WXQA 4HLUC 4IOMA 1UAAA 2PT5A 2FNAA 1VPLA 4XH9B 5EP1A 1JECA 2KB0A 3R7WA 2Q3FA 5SZJA 3WMEA 5FPKA 3GJ3A 3Q7PA 1JALA 2QA5A 1E6CA 1NY5A 3RYTC 2J45A 4M1OA 5CM9C 1NLFA 2KSQA 3IIMA 2C8VA 3TLXA 4A6XA 4XVUA 3U44A 3BFXA 1LF0A 4DSUA 2DBYA 1RW4A 4MH0R 1N0UA 3VU9A 2LKCA 2HEIA 1X8LA 3EWSA 2RGCA 3B82A 5TXGA 1U81A 2Q9BA 5DIFA 4A8JC 4F93B 4KAXA 2HYDA 3NHAA 1G3QA 4RFSB 1FFHA 1TPZA 2QT0A 5EE3A 4DT1A 4QG7A 3TH5A 4KXFB 4JL6A 1NSTA 5SZHB 1YE8A 1NN3A 4AURA 2F1IA 4Y0AA 4M1KA 1M1YE 1Z3IX 1TUEA 2XJ4A 1GNPA 2JAQA 1W4RA 3REFA 3W8RA 4GFDA 4OJQA 4D25A 1AZSC 4LYHA 3P20A 3UK6A 1XP8A 1EESA 4TTRA 1G21E 1E0KA 2B21A 3I5YA 4D4JA 1OFIA 1IHUA 1TMKA 1ZP6A 3QVVA 4URVR 4NCIA 3VQTA 2N1BA 4PQFA 2QM7A 3K8YA 3VMFA 1JR3A 3R7WB 3LAWA 4CVNA 5J4KA 2JLWA 4MRPA 1S0UA 3GLGA 3U44B 3U3JA 2IYRA 4EIWA 1GP2A 4JKYA 1Z47A 2Q3HA 1HE8B 4RZXA 3HPRA 3SNHA 4LYFA 2LCFA 3TBKA 1CJMA 1RJ9A 2C04A 3VU9B 4JL5A 2ZSBA 5FOSA 2XNDA 4LGMA 1R10A 5FTNA 2RGNA 3B9QA 2NO0A 2OUKA 4PR0A 3W6NA 4JBWA 2J0QA 5DLQC 4Q00A 5TV2A 5B2ZA 4IRUB 3OEHA 4BQSA 1DAFA 1P75A 3KTAA 4KHZA 4P3YA 4IDPA 4NYMQ 4DT1B 1MO4A 2F9LA 3IPXA 2FFHA 3QKRA 3A6PC 3ICEA 1E9AA 4YC7A 4IVRA 1XF9A 1CR1A 4FMDB 3NEJA 3RWMB 2IYSA 1GUAA 4KLNA 1GSIA 3OEED 5B58C 1SVIA 1G16A 4JLVA 3RHFA 2CCGA 1W46A 1XD2A 4JVNA 1BMFD 1QBKC 3I5XA 1N0WA 5EUQB 2WM9B 1CXZA 5JJLA 3I1FA 4URUR 3HDTA 5TDHA 3KQUA 3QIAA 2A5GA 2QGNA 4LJ9A 2QP4A 3GLHA 2EFDB 3ZLJA 2FSHA 5GJBA 1U0LA 4FWTA 1KOFA 2FPLA 1P3JA 3OHMA 1OLOA 4XWKA 1E9RA 3GLGB 2BV3A 1XEWX 4A0RA 2F7SA 1RJ9B 3HR8A 5FBQB 1D2MA 2P3SA 4OQNA 2QBYA 3KXKA 3B1WA 2XZOA 2ECKA 5L3QA 1ZNXA 2KWIA 4YLGA 3VR3A 1TF7A 3KTAB 3PR1A 1GILA 4WXRA 3A36A 4TMKA 1W36D 2D3WA 4RKFA 4JBYA 3QKRB 4NCHA 3DM9B 1YZUA 1MT0A 3GFTA 4BFWA 2WTUA 1WCV1 2HLDD 3F5FA 1S9HA 2RAPA 2G1KA 3I72A 1GL7A 2ZUDA 4TLCA 1T4GA 2ZAOA 1XD2B 3BBPA 4LUCA 5DGXA 4FXPA 4Q7LA 4NDZA 2JJ1A 3IGFA 2IYXA 4XWAA 3UANA 2VP5A 1L2TA 4HEJA 5FPYA 1R7RA 4C0LA 2GXAA 4QNMA 4LOAA 3AP2A 3GLHB 4ZCIA 2VPPA 2IL1A 4NCKA 3D6TB 2HF9A 1YZQA 2J7KA 1PLJA 4B74A 2WJHA 4F38A 1OYYA 1VIAA 1AQYA 3NTUA 1OB2A 1E94E 4LJYA 2GF0A 2ONKA 3G5UA 1NVVR 2JLRA 2ZJ5A 5KSPA 2VA8A 4LJ7A 3KJGA 2VP0A 1TQDA 4JYBA 3PFIA 2JLQA 3PUVA 2IWRA 2QBYB 2B7BA 5DN6D 1W0KD 5L3QB 3ECCA 4DCUA 4LJ5A 3ICQB 2IS2A 4BLPA 1NLZA 2F1RA 5CLQA 1M2OB 1W47A 2NO6A 2QZ4A 3GCGA 4G5QA 2H16A 4IVQA 3SYNA 2OCPA 4PZYA 2C95A 2QY9A 3DZ8A 1EFRA 2FSGA 4LI0A 1Z2CA 2IK8A 1EX7A 3IDQA 1OXXK 2CNWA 3LO5A 5KO2A 1X8KA 2NO1A 2PMKA 3SR0A 1FTNA 1SXJE 3MCAA 1KI2A 2IS1A 4FMCB 1Q1BA 3ZIAA 4UXIA 3DPUA 1IJEA 3I4LA 4C30A 2EFGA 4JT2A 4DLXA 5JI2E 1HUQA 1E2LA 1WP9A 2VSFA 1OKKD 1HY3A 4MGYR 4RVCA 1XPOA 3RVBA 2O0JA 4U00A 5HKKA 3B1VA 1L8QA 3A4MA 3EZ6A 4HLCA 3EIHA 2YKGA 1E79D 1Q1QA 2Z4RA 1ZM3A 3FKSD 1NJGA 3BH6A 3TRFA 2AWOA 2FOLA
chains in the Genus database with same CATH superfamily
1P44A 3C6YA 3TSOA 4B45A 4DEXA 3O2NA 4H0NA 4QJ5A 4WKOA 1MR3F 1FJGB 3PNMA 2E4ZA 2WDPA 4ARZA 3WLKX 1KXZA 2JAPA 1IU9A 2O2ZA 3OX1A 3ZDBA 3NDBB 4LW8A 1KYVA 1Z3CA 2QSUA 2OZKA 4HYTA 3SP1A 2Y71A 3DO8A 1QQBA 1MEJA 4PSDA 2J9ZB 2ZJFA 5TGTA 1JL3A 5MFZA 1SUWA 2VP3A 3E7WA 4PQYA 2IPAB 5IH7A 4R1PA 5EWJB 4E15A 1FNCA 5MGNA 1G4HA 4IJMA 4D0NA 4P80A 4MRRA 2CFRA 2ZIUB 2V8BA 1J0EA 2RKOA 3VSAA 3DCJA 1EFAA 1XTQA 4QYTA 3S44A 3SFVA 3PF9A 3ZXSA 1IOZA 2HA3A 3LKBA 4X94A 2QUKA 2JPDA 2QP9X 1GGEA 1IY0A 3DD5A 3DEKA 4L8GA 4U7TB 5IM4F 3K20A 3CR3C 3NKVA 2FPXA 5C46F 3JQAA 1L5MA 3CVYA 3PR3A 1NONA 2DBZA 3FF4A 4TTPA 3LVRE 4MLPA 2A0KA 4O4LA 1GCUA 3UW1A 4XYEA 1JSLA 4KQIA 2CLLB 4YT2A 4IXWA 4KE9A 3ZQ6A 3AEUB 2H06A 1LPSA 4OXQA 1FUIA 2A3RA 4X8HA 2EIXA 1X7XA 5K05A 1NIJA 3L2OB 1XVAA 8LDHA 1NM5A 3GMDA 1PS9A 1HDRA 2MMCA 3O1HB 3VKGA 2XIQA 1E2NA 2FXIA 3A4NA 3KU1A 1VL8A 2EGUA 3K9QO 3PUYA 5FFNA 1JEEA 5FPHA 1CRZA 1ACJA 2ANBA 1Q7BA 5DMXA 2Q3EA 2XUIA 4NMXB 4B71A 1QZZA 2H08A 1QF6A 5AD1A 4IOJA 4LXUA 5CW1A 3E9DA 2OVFA 2VTKA 3O74A 2RGXA 3MNFA 4RPLA 3AR6A 4UEKA 5DRYA 3GMIA 3UJCA 3NOXA 1IIBA 3D31A 5HGJA 2Y77A 5GONB 4PYIA 3GLGE 5BNIA 1U5BA 3I1IA 5F2NA 2DPLA 4ERNA 1YULA 3DDZX 4XWYA 5BSVA 5IT0A 2GRAA 4QAJA 2ZIVB 2YC4C 4FFBB 4V2IA 5J5AA 3GCDA 1E0SA 1R0WA 2DHCA 3BC1A 3TRJA 1V26A 4JJ4A 3NDRA 4UU8A 3VAAA 3CXUA 5DO9A 3FGZA 4WTOA 4G86A 3LS2A 1R9GA 2RGDA 2PX3A 4HFRA 4C2UA 1W5BA 3AEQB 2JIOA 2OXFA 3ANLA 2EVWX 1COZA 2PSEA 3IMEA 3QZUA 4J1SA 4LYJA 4ZVMA 5F3WB 5JAUA 4HDCA 4BVKA 3ZHUA 2DPYA 5DYWA 1IRIA 3PC8C 4NBRA 1ECPA 1T43A 4AJJA 4R8KA 2GTPA 3PNQA 3JRWA 1SWWA 3ROXA 3TAUA 4Y6GB 5L7WA 5EERA 1R0BA 2BMJA 3QXHA 2GSWA 5AVYA 3K70C 1SC6A 3MG9A 3T1OA 2P91A 3PKZA 2OVBA 2PA0A 2XB4A 2OCBA 6PFKA 5E2AA 3A3NA 4UZEA 5EN4A 3JZDA 3NPAA 1PZMA 3FLBA 1EE9A 4MITA 4G0WA 1U65A 3A6HA 4GKBA 2D3TA 2FW9A 3QTLA 4XDHA 4YJDA 4LE1A 4CMJA 1G42A 4L4ZA 3NHSA 4WV3A 3VNVA 1PYOA 1GRCA 3RVLA 5HFNA 1P2UA 3LY5A 2BZGA 3GJTA 3H7IA 4JGGA 4XWTA 3KZKA 4FLFA 3BDAA 2P2NA 1JIUA 3AHFA 5ALDA 4LFCB 3K09C 2JLYA 3UT0A 1QONA 1V8OA 1Y1PA 2GI4A 2JAOA 1GCOA 2PFGA 3GLVA 3LX6A 3LPCA 1HFJA 4N8DA 4U7PB 3WRYC 2GRJA 4Q1AA 3IXMA 5UKDA 3O82A 4XJSA 4K26A 3HFRA 3VAZA 4IV5A 2ZCUA 1TM3E 4HNVA 3DEAA 2IXBA 5TE9A 1AK2A 2QD3A 2QRUA 3HVIA 3R9IA 3HKCA 1ZXLA 1HURA 3R6LA 3WIEA 5IDWA 4N76A 5JWRA 1C8KA 2ZBFA 3FNEA 4PS0A 4PXYA 4XOUA 5G3ZA 4AFNA 1YR2A 2VYCA 1KEUA 3DT6A 3LOUA 5ADWA 3K6KA 4MUAA 2VRNA 3Q7EA 2WEKA 3EA0A 4FFPA 5DISB 2DJIA 4DXAA 4B4OA 2AXEA 1JB9A 2AZ4A 4AJNA 4AKIA 3MUNA 1GRVA 2IA5A 4IOKA 1FFEA 1QB7A 5IN5A 1IHDA 2AEFA 3ND7A 3STXA 4AQ7A 4L3VA 1YASA 3AJRA 3RVKA 3OIWA 2D4AA 2XUGA 2PYIA 3LWBA 5K0NA 3LH5A 3UTCA 1ZW1A 3S2GA 1U7WA 3I9MA 1YVUA 2IYFA 4OFWA 3G79A 1Y3FE 2B37A 3FCXA 4CV1A 2VAMA 3MMSA 5TVGA 1RYBA 3V9PA 3OJXA 3CF4G 1EBBA 1HDIA 4M46A 2ACVA 3PGMA 2AR0A 3PUHA 3RYCB 4G0NA 3K9WA 2FSIA 4IIJF 2GF9A 3DZGA 5E4FA 2AK3A 3RASA 3DVLA 5BV8A 5BNZA 1FA9A 3SU8A 3KK0A 3NBKA 1AGXA 2O8EA 5LL6P 1M6YA 5H80A 3GCXA 1UPUA 5SZKB 1NF3A 4EB8A 2CB9A 2NU8B 4F3CA 1X7WB 3CMCO 1JE1A 3RSCA 3RUAA 4IILA 3E9ZA 1RQRA 1RACA 3U26A 1MX9A 5HM6A 2NYVA 3A9TA 5AI4A 3P7MA 1SBIA 2J3MA 4HGZA 1WZ2A 1E2EA 2XOKA 2FUKA 3NUQA 5E6SA 4BNLA 1HQKA 1EKXA 2YJ3A 3DOJA 2PXAA 3K2BA 4TMYA 4ALMA 3CR8A 1DG9A 1EHYA 2VBCA 1FZQA 3DZDA 1ULTA 4GPTA 5E9AA 1YIDA 2H1LA 1PW5A 3KCNA 4R1MA 3C8HA 1KOLA 1Y7LA 1VSUA 4Q01A 4B3BA 3C45A 3A6FA 2XGOA 4Z9YA 3JQ9A 3ZE1B 3O92A 5LNK6 4MV8A 4OJKA 2Q2QA 5FOUA 5C35A 4G2NA 1EH5A 2P1ZA 2ZWPA 4UM9D 1XAHA 2GWRA 2QTCA 3ASUA 4NOKA 4YASA 4D02A 4ZI2A 1E98A 4GQIA 3F3MA 1N7JA 4FQ8A 2FF5A 2LIVA 3O4JA 1TVEA 1VHQA 4R6WA 4G6ZA 4D0GA 3LTEA 5IMBA 2V6GA 2Y05A 4JJGA 5CFQA 4U39A 1Z4PX 2XGSA 2JGIA 3EYWA 3GD7A 5BNTA 4J1TA 1QIFA 4URYR 3WXMA 1C29B 2X6QA 2IY7A 3T9DA 1BVYF 3ZTWA 3HDGA 2EDAA 5GQSA 3L1JA 3M81A 4ZHQB 1VGVA 2IS6A 3PT5A 4JU8A 3ZXXA 3ZKWB 1IL0A 1SA0A 4UBJA 4N54A 2UXCB 4OSPA 1L4KA 3RTCA 3TZ6A 4Z9XA 3ROKA 5ALRA 1W34A 1WS6A 4MYSA 1YWGO 4QDOA 3WGGA 4ZV9A 4ALNA 4E5KA 3NM6B 4GNRA 1LBSA 5JEDA 4G1FA 2XE8A 3UFBA 1ZH2A 1Y4ZA 2XBUA 3C3XA 3RF7A 3VGJA 4HNGA 4ACBA 3B3GA 3BRCA 3HBMA 4FUTA 4B32A 4EPWA 1OH5A 1MFZA 3H1PA 2HC9A 2FWRA 3FVRA 3FPLA 4JJFA 3JRNA 3LK6A 2DETA 4RQAA 2QB5A 1Z88A 1LPPA 2HRQA 4J7UA 1YQ9A 1T26A 4X9XA 1GD1O 2F43B 2KM1A 3SBOA 3FYUC 5FUQA 3UKOA 1ZGAA 2I67A 2HADA 3EZ2A 5CT5A 1DKMA 1G18A 4RLFA 1Y1LA 5EINA 3WRXC 4J16A 4KW7A 4EQZA 4PC6A 4UFPA 3HFJA 3BXFA 4GZ6A 4KQHA 2JKVA 1L8XA 4MUGA 4FGLA 5EHZA 4U5QA 4O2AB 2VKQA 4LXIA 4MA0A 2WAYA 4LRUA 3PC2A 2HPVA 2GARA 2A9PA 3M3HA 4ZDWA 2I4MA 3F9RA 1TIBA 4DR1B 4EI2A 3GEMA 3WGIA 1GA1A 3DVQX 3HDYA 2LR0A 1JFTA 4YI5A 4H27A 1XRSB 4F3TA 2V98A 3I04A 4N1AA 1I4EB 2AOVA 4MV3A 4QO7A 3P9QA 3C7CB 2RKBA 3L6BA 2ETXA 1ESDA 5EXTA 2I4NA 2PGJA 1H6BA 4ONEA 2JLBA 2Y0BA 3H0KA 5JJBA 4E5DA 1PUXA 1SQFA 1U3DA 4Z8XA 1WDLA 4QJ3A 5JSZB 2GWHA 3FPEA 2PL9A 2K2QB 5DYIA 4EMBA 4BO0A 1XZPA 1JHAA 1RHJA 2XMZA 3WL3A 4B34A 3D4PA 2OSBA 2JGLA 3AIKA 3Q9SA 5EP2A 4NCNA 1H8ED 3G7NA 3NGXA 4IIEA 3QV1A 3I01A 4UHHA 3UVEA 4IR7A 5JS7A 4PZUA 4B81A 2HU8A 4UAGA 5BSGA 4QPCA 1UBSB 2FJ0A 1A97A 2C1ZA 1IEQA 3L92A 2V7QD 3PPYA 4J0IA 4RKQA 3CRMA 3UWKA 1GG8A 5C7LO 4JLSA 1E9BA 2I2DA 5LZ4A 1WKVA 3HNRA 3VHRA 4EVQA 1UBNA 2R85A 2ZKIA 4OXKA 4R8LA 4RHYA 1ZGGA 4XFJA 4W8OA 4AJPA 2VBIA 2PVCA 1D2GA 2QM0A 2I6FA 3T12A 1KJIA 3GQBA 5I7UA 2IPXA 3KKKA 3GA7A 4QKQA 1Z38A 2O2DA 4ZT4A 1VXRA 3B6ZA 3M6VA 2GBCA 4EFLA 2G25A 3LGXA 5IYZA 2NXWA 4YCMA 4MO9A 1USIA 4CMHA 4A8TA 3V33A 4PCVA 1W94A 1XBTA 8MHTA 3E9RA 4JYCA 4XASA 1T35A 1QPGA 1H5QA 4ZT6A 1FVFA 4TQAA 4OV6B 1GZ5A 4U2BA 1MAHA 3MXTA 4KBGA 2XQVA 4B3CA 1FEZA 1YJXA 2D00A 3JD2A 3UEOA 5KWIA 1CTQA 4DLRA 1Q11A 2IYYA 4B09A 4U2KA 1YI1A 5CLFA 4KODA 4J9VA 2O1WA 5H5JA 2FVYA 3DP7A 1C0EA 2YTZA 1V1MA 3VR6D 1Z25A 2F4VB 2KJQA 4QXAA 4NCXA 1RWXA 3KDPA 1UBEA 2CCKA 1N9GA 5FWDA 2GZMA 3AV0B 3R3ZA 4HK4A 5EXPA 4CTJA 4DVGA 1VCMA 4OQQA 4PYKA 1D07A 1NXOA 3WDSA 3ZCVA 4RULA 1XNJA 3IVAA 3M6FA 4FDAA 3IOYA 2KS6A 3TBFA 1OOEA 1LC3A 2C4TA 1ZK4A 5LJIA 1PFWA 3SGLA 5BO5A 3QKUA 1JQLB 2QRQA 1ZJ6A 1P2GA 3WL4A 4Q21A 1KKMA 1Z6YA 2C9CA 2C42A 2FPRA 3EBOA 4GW3A 2GPTA 1PJLA 1E20A 2RHOA 1ZOPA 1K8YB 2Y0DA 2YZGA 1JZSA 1XYVA 3IIKA 1L1FA 5ITZB 5DH9A 5FUYA 1GTVA 1W1WA 3WWEA 3SXPA 4YCSA 3ONWA 4F6RB 1NE2A 1AKUA 1MTOA 2C9OA 3LBNA 3QUSA 4U4AA 3REQA 4PZAA 4G0OA 4EVSA 2F3UA 1DTWB 1ETUA 2Q4EA 4MQUA 5E95A 2IU6A 5LIPA 1SHZA 1W85B 3TZKA 4JUAA 2X4DA 4EKEA 1ONPA 5JRJA 2HLDA 4XDYA 2O3SA 4DGSA 3HCNA 3H1GA 2A33A 4M88A 2XCIA 5J63A 2CDAA 1JS1X 1UPXA 1W9MA 2WWXA 2N3ZA 3DZHA 1JKJB 2GCOB 2AW5A 2G0TA 3F78A 1PR1A 4PIMA 1VM6A 1FRNA 4D8YA 2VBFA 2B8EA 1JDSA 1O2DA 1NM5C 3G49A 3OQBA 1OLSB 4YRMA 2O8EB 3ZZ1A 3LOPA 3PDWA 5DULA 2IX3A 1W88B 2DKNA 4ITUA 5BQOA 3ASVA 3U4GA 3OWHA 1T2FA 1EA7A 1G7CA 2QN3A 4Y2RA 1SXJB 3OE1A 5LMNB 4N65A 4UHEA 2OAGA 2A4MA 3AKZA 4TYQA 3C6XA 4BLWA 5I6DA 1H6CA 2ZSHA 1M7BA 5KPJA 3G6WA 1WXDA 2OLKA 3QWBA 2EHDA 3NGLA 3WTBA 3ABIA 3NWBA 1A5ZA 1CVIA 2Y66A 3BZUA 4FGZA 1ZWKA 5IJXA 2CLKB 3T7RA 2HA6A 4WWHA 1Y34E 3JS5A 3KUCA 4U7JA 1MCZA 2J9RA 3QX8A 3VPAA 2C5BA 3DZBA 5BVGB 4Y9SA 1IBCA 5FBVB 2G80A 5EJFA 3KSAC 2C2GA 2IE8A 2C5HA 4ZOBA 1YMQA 4UOZA 3ULKA 4PN3A 1XKTA 1RP1A 4QTXA 4MP6A 3SYRA 4MIKA 1A7UA 3DPIA 1G9TA 1RKQA 2IUTA 2XTMA 3QY0A 1JAZA 2K7ZA 3LQQA 2CSUA 4G8BA 4N5NA 5AJWA 1RRCA 3CX6A 3PDJA 2DT5A 2EEZA 3CRW1 3GRYA 4DM4A 5ICEA 4W7IA 1TEZA 5EVJA 3QKTA 2J0UA 1JHUA 1Z5PA 1KI7A 2PRJA 1Z29A 3FWYA 2ZIXB 3OJOA 1YMUA 3S2IA 2XWJI 5FBHA 2GM4A 3WICA 3HY4A 4G23A 1UMBB 4YREA 2XZDA 2SCUB 1A71A 3HE3A 4FYWA 1W4AA 1R8SA 2HLNA 4D96A 3BWYA 4EARA 4P4SA 1RQXA 2B0CA 2I5PO 3C6MA 2B61A 2WDZA 4CLOB 5ALFA 3TR0A 4HVLA 3GG9A 1Q57A 1QV7A 3ZV4A 5JPCA 1D7AA 2HQSA 1B2RA 2NZVG 3IV9A 1AO0A 4CIBA 5JZSA 5JNLA 1VCIA 2D5AA 2DOKA 3LFUA 3JX9A 5B12A 1NLMA 1YDHA 2PD6A 2Y0PA 2YMQA 3FMIA 5EJ4A 2C2BA 5FBLB 3G5AA 1IXRC 1E89A 2QZPA 2WK1A 2P4EA 3AUKA 3BGWA 4RJKA 3E70C 4LF9B 1BEEA 2OZEA 3PDUA 5L6LB 4F1JA 4YJFA 2LCQA 4A4DA 1V39A 2HO5A 1WSDA 2ZJBA 4JUFA 3ROTA 1Z5VA 1UBHS 1IN8A 3OICA 3H5LA 4M60A 1A77A 1LLCA 4GOMD 4JOQA 4XOIA 1B93A 3BB4A 5DBGA 3VU9B 1R0YA 3DPSA 4JENA 4M4SA 1CD5A 3FTQA 4QDZA 4D9KA 1SQSA 3NC1C 4MVYA 2IV7A 1JYSA 3BBLA 3PQ4A 1FFBA 2ONCA 3FB1A 1QC5A 3CLRC 1Q1ZA 2X2OA 3FWPA 4CTMA 3MHTA 1DIHA 3TIVA 5BSHA 3S7ZA 2NU9B 5FL7A 1YB2A 2O57A 1BW9A 3D6VA 4C2AA 1R64A 2XI4A 3ZKAA 3BKXA 2D54A 2ATCA 2P2CA 4L16A 5BWMA 5K0BA 1C9EA 1PVVA 4LX0A 4AKSA 3KUDA 1V43A 3ETCA 3L7KA 2DPMA 4QGAA 4KNVA 2E7ZA 4EZEA 2GETA 2YMMA 5CHYA 3SYKA 1EFVB 1E0JA 2GHTA 2GK3A 4DIFA 1E5TA 4RD2A 2WSYB 1XRQA 1TVMA 2ZRAA 5JC8A 1EFCA 4CM9A 4RF2A 2B4QA 4OP1A 3FPCA 2QP3A 4C1BA 1P3Y1 1ORHA 2D62A 3C8DA 2WAXA 4O4IB 4FILA 1T25A 2I6XA 1QZTA 4PE5B 1BH6A 4OKIA 1XQYA 3F5DA 3SF0A 1W581 1UC9A 1WLSA 1VG8A 2K4MA 1F8FA 4R2JA 3PT9A 5ESDA 3VV3A 1IIRA 1DVRA 3THSA 1JA9A 1WVIA 2QV0A 2ZIWB 3LL4A 1USWA 4PYOA 4XUEA 3IO3A 5DGDA 3NDPA 4YDSA 1N8TA 5BY2A 1HX7A 1VLVA 3HKEB 3L7LA 3BGDA 4LV6A 5BNFA 1TTPB 3EXHA 1QK5A 3OZAA 4RD0A 4KQFA 4FFMA 5ULLA 3JQ9C 4RESA 4BXOA 2XXJA 3EHEA 3GMTA 3OWXA 1D03A 3QYPA 2R66A 4MPDA 5TGZA 2X76A 3VOSA 4TYNA 3AHIA 2JGJA 2E3JA 4JLKA 4JSTA 3MPOA 3PFWO 1I9GA 3OE7A 3AX6A 2C2YA 1CJUC 5IARA 5B3LA 3GJ7A 2II6A 4S1NA 4X93A 4UM8B 3TJRA 2V97A 1V47A 2GZSA 1YXMA 5AHOA 4J4HA 1QAOA 4E3ZA 2VTBA 4FM9A 4NL4H 4OHZA 5DDIP 5J2UA 1FNDA 4L51A 4OU4A 3DFUA 2OKCA 4NMMA 1I3NA 4RANA 1U28A 3QWFA 3WLHA 5EQDA 4BGDA 1WU8A 4WRRA 1E7RA 3L1IA 4P4GA 3CB2A 4H0CA 5B6PA 4CV3A 2VDWA 4NU8X 4YGXB 3PD1A 1N2XA 1K6XA 2VHWA 4UAVA 2A0WA 3B36A 1DQSA 3FFXA 4U2GA 1FLAA 1GEEA 4G25A 4XGQA 4BU0A 1YF3A 2R6JA 1UKAA 4J0JA 4B3GA 4PZPA 2W2TA 3C70A 1S2OA 2ZLBA 1H2BA 3DAHA 2HJSA 4X84A 3BXEA 1ZK2A 3B8EA 4O0LA 5IDYA 3W0LB 3IE1A 2XE7A 4RZIA 5IYZF 4PG6A 5ESXA 1IBRA 1E5QA 3CFYA 4OTZA 5CFRA 2ZSJA 1UFOA 3W7BA 3JSXA 1I80A 3RAGA 4MTCA 4EY8A 3K1ZA 2PZJA 2XWPA 3AR8A 3AR9A 1QUEA 4JEHA 1QIGA 2NZYA 2Y0EA 5A2QA 1E18A 3EVZA 5B1YA 4R9VA 1PJ3A 3MT8A 3F8SA 1GPYA 1Q7GA 4Z0PA 1PLLA 3LKZA 3MWEB 3KT0A 3BWEA 4K6KA 1QDUA 1H1LA 3KAJA 2C5AA 1KVTA 2IF0A 4W5WA 2JFHA 4R0VA 2JANA 2FWJA 1U63A 1K7XB 2W4MA 3WIOA 3QE3A 3EFEA 4MV5A 5E2BA 2CB0A 1L5HA 4EPRA 4N3BA 4BEWA 1U0BB 1XN1A 2YVAA 5IAOA 2PKQO 3G5TA 3A7EA 3S1AB 2E85A 2NQ8A 5K2MA 4AO7A 3LVQE 4WFJA 3UJ3X 2NUTA 5JI3E 4KYIB 3QFFA 2BEJA 2QUAA 3LCRA 5D7BA 2XXAA 2XRFA 5CH3A 4YRSA 2PY6A 1Z6QA 2HDOA 4LE2A 1B8UA 3TAXA 2W83A 2DULA 1I1QB 1OBFO 1RRFA 1FY2A 2ZJ7A 5ESWA 3PNVA 2HQBA 1AS2A 2JEZA 3C3WA 3QLUC 1EPUA 2BE7A 4HYEA 4OH1A 1CDEA 2AFVA 3EMBA 2UZIR 4F9EA 5IJ0B 3IAXA 1GY8A 2CC2A 5FBWB 2NX2A 1J22A 3KU4A 4KP7A 4IGAA 5DZSA 1XHFA 1KVUA 1PFQA 3IKLA 4FHCA 1DAGA 4OKSA 1MO3A 4J3FA 4L4UA 2XUZA 1HTWA 2C5EA 3LXXA 2CLCX 3KQOA 5DI3B 2IYWA 4ZFNA 1QYRA 2ZPAA 3DDOA 2ET6A 4AY6A 1BDIA 5B1DA 2RH4A 3C0KA 5CXXA 1IMJA 3HGTA 4C5CA 4EI9A 3JD1A 4Z2AA 1CB7A 4A5OA 1BH2A 2CNDA 2W98A 5ALPA 3RRMA 1MVOA 2PLAA 4UM7A 2GB4A 4BE7B 4O4JB 1CUFA 4QQFA 3M5WA 1OYVA 3KD3A 1UOQA 4M89A 2B2NA 2QMUA 2ERCA 3ZY3A 2CDNA 3HVKA 3K9GA 4M3NA 5K51A 2BKUA 3EEQA 1M8KA 1SVNA 1CJKC 3IMKA 4KDRA 2SKCA 4RVSA 1P7WA 4TS9A 2E21A 2R62A 3B1XA 5IXSA 5LD2B 4D6XA 4CM5A 4EA9A 4INPA 4I66A 2P0EA 3OIDA 3CLTC 3SMVA 1LFDB 2UZ1A 3HU1A 5A7GA 1OI7A 2JW5A 2WM8A 2GNAA 4I8IA 2JGAA 2RHGB 1OD6A 3FY4A 3MRTA 4CM1A 3FTEA 2AEEA 3IPAA 3BSFA 4A0GA 4DB2A 1I6KA 3P9IA 4FINA 4FLEA 4D45A 2QRMA 4BNVA 1LDEA 1AS3A 1D1QA 1E5XA 1KPGA 1F4LA 1RR6A 3EF1A 3FZGA 1E1LA 2A1UA 2HU5A 1E1RD 1JWAB 1A69A 2EHJA 3EPRA 4YCBA 3TQQA 4CKYA 1DB3A 2PUAA 3IUYA 1EAYA 4KI0A 3QKWA 1SZDA 5T3YA 1RQ7A 2UUCB 3QOFA 1FQWA 3NXSA 3VVBA 4D97A 4LF8B 1U98A 4OHBA 4FSXA 4F2DA 1RZRA 1HORA 1OZAA 2DMRA 4A8JA 1A9TA 5TQJA 2NV6A 2ODNA 4DV3B 4R7TA 4KTTE 4RZQA 2YZ7A 2OOSA 1KYIA 1W93A 5C51B 4HGOA 2I29A 3NFYA 5HF8A 2D1TA 3ON5A 3CO0S 5DU2A 4MK4A 6REQB 1CC1S 1GM5A 4ITRC 2NXCA 3ENVA 1M0WA 3B78A 2WTBA 4DPMA 2CL7X 3CNOA 4E21A 1UBTS 3QBVA 4IIBA 3VZDA 4BTEA 2UZAA 1XXHA 3UYLA 4YONB 3DKIA 4EG8A 1XU7A 2XA1A 1F38A 1OT3A 1EG2A 2I2XB 3OEYA 3E2PA 1F2TA 1Z26A 1OZGA 2QVLA 4K0RA 1H93A 1LU9A 2B78A 4MWZA 3U7QA 3LQ4A 2LUOA 1IJFA 3AMVA 3X43A 1MZPA 4C05A 2EG9A 1ISPA 1Y8CA 1GAWA 1O87A 1NBEA 3INNA 4QFCA 2BBSA 4MWGA 4TWRA 4AY4A 2OENG 4AKEA 1CP3A 1KVSA 1OCEA 1Z6TA 5F33A 4J3JA 2HL6A 4NG4A 1O6FA 1R6DA 3TQTA 4B76A 4BU1A 3OOSA 3RYHA 3S28A 4JJ6A 1E99A 2IYNA 4PZCA 3LLUA 4F0JA 4PLFA 5ALJA 3UNXA 1NZFA 1YBFA 5G0UA 1BJRE 1FTSA 2ZJ8A 4N0PA 4PPNA 3MTAA 1BVRA 4BPRA 5KYUA 1H8HA 4P08A 3E5MA 3BXPA 2JH8A 3DA8A 4M38A 3GVHA 4R1TA 4ZO7A 1Q20A 4W9RA 4IDQA 3JYNA 2M2IA 4KV7A 3AVXA 3W2GA 2GJ8A 3DTVD 1UK8A 4N6OA 4UARA 4CCYB 2DR2A 1A3CA 4QRHA 4BNMA 1E62A 1DQRA 1NJ8A 4HFMA 5CG1A 3ZWWA 3G89A 3A4IA 2H1CA 1O03A 2QL5A 3NM5A 5IXYA 2R1VA 4AYXA 3Q8XB 1WZNA 1T1SA 1ZZGA 2JAHA 3D0QA 3GOHA 2FMXA 3KKZA 3C85A 4MX8A 1II0A 1WV1A 3S6JA 1NRIA 3OJ0A 1XCOA 4X97A 3DFMA 1DIAA 1SEPA 3OJEA 3CH6A 3KQPA 4HWGA 5HKKD 2C20A 3CRZA 3IPYA 3FKQA 2WF8A 3DUWA 2QI9F 3WDMA 5EKTA 5JVDA 4IQFA 2HJHA 1USKA 3I62A 2BE9A 4PNZA 3JWPA 2NZ8A 1SHTX 2HIGA 3F7NA 3OLXA 2IUEA 3H4TA 4XB1A 2DZDA 1O94D 2GILA 4M98A 1TC2A 5BYKA 1EK2A 2GSDA 4PCLA 2P4UA 1GXSA 5HK8A 2YUTA 3C5WP 1WMBA 1G63A 2QPLA 2VHJA 2W2NA 1JQAA 1SZPA 1P9RA 3EY9A 3JQ8A 4JN6B 4Q34A 4WY5A 1JPVA 3TN7A 2PSHA 4CT0A 2W2KB 2VZ8A 1NXWA 5H3CA 5I9TA 3CEPB 2YZNA 3PSAA 1PS0A 2CK3A 3V32A 1IY2A 2O7QA 4TZ6A 4G5SA 3S8EA 1K3UB 4Z0TA 3EGXB 1SXGA 4MCJA 5GP1A 4EB6A 1UMKA 1X7DA 1YZVA 5A4AA 2RGNC 3EVAA 5LLDA 2VJYA 4HKTA 3HO1A 3WLSA 2OHOA 1HQCA 5AVTA 4Q6WA 4ZKEA 4H17A 3UV6A 2CJWA 4WGGA 4IDOA 5LP6A 1XZBA 1YHNA 1V16B 2P7IA 5HKOA 3G5MA 5TMEA 4EZBA 5HGXA 1LBQA 4KR2A 2QLBA 2VSXA 3ET4A 1CYDA 3GCWA 3TEJA 3TLKA 2P2LA 4H16A 1BXKA 1COWA 2EIHA 2IHYA 3K6SA 4HLDA 1SHUX 1SVLA 1JLLB 4PYQA 1E2PA 1GTZA 1MJ5A 2MOKA 4OD0A 2HHHB 3SHTA 2WT8A 5LOVA 3IOBA 3QH4A 1MV5A 3SLGA 5J2UF 1ZINA 3CG0A 2HXYA 2QPAA 1UWCA 3IMCA 2X14A 4OL0A 3DR3A 5BV2P 1GSAA 2A30A 3UFXB 4ACAA 4EHNA 1QHHB 2QNRA 3JR3A 1Z82A 4CKCA 5M2QA 4Q1CA 1Z7EA 1XO1A 2HA7A 4OX9Y 2I6SA 2PBFA 4B9EA 4TT8A 1XPUA 2OZPA 3GAFA 4HATA 4YIHA 2XYQA 1TE2A 4NH0A 4BATA 3KQYA 4DG9A 4YS6A 3O9ZA 3SD7A 1U8EA 2B99A 1XVLA 3BE6A 1Q95A 1ENZA 2FN8A 3QIVA 5LBTA 3WNVA 1IOWA 5TSDA 2EXXA 3L4BA 3I52A 2QMZA 3Q85A 4FT4A 1JQEA 1P2VA 3FYCA 4CF6A 4Q3CA 5LZ9A 2VK4A 1Y6GA 2OD9A 1N25A 5GZ1A 3RR2A 1AE1A 2TMGA 2Q3MA 4JXKA 1Y7IA 4BE9A 2ORWA 2X2EA 4TMZA 5ICMA 1DRUA 4J07A 3BF8A 4MR8B 3E05A 3THWB 1BS1A 4V0SA 3P0EA 4FOPA 5EJ2A 3VX4A 1Q17A 1N9KA 2O7SA 5B3JA 5BT9A 4UCWA 4KVGA 4IG4A 4DBVO 2EWWA 2BVNA 1XRNA 5BT8A 4FR5A 3D7SA 1LTKA 1NJ6A 2P2YA 2R5WA 2Z6VA 5KCZA 4G3XA 1YZLA 1RTTA 2XNSA 3LW7A 4LMPA 4M9SA 1X7YB 3E3LA 1GKKA 3LHFA 5JZBA 3H2BA 2ZROA 3VH4A 1N57A 2ID7A 2W2LD 3FXAA 1N2ZA 1N9ZA 4NFHA 5CTAA 3C6BA 2O59A 3EQ8A 3WMXA 4DADA 4F06A 1ZBQA 1GPAA 5HNKA 2RB4A 2CD9A 4FFDA 4RVUA 4WQMA 2TECE 2VDPB 3AEKA 1VFPA 3BORA 1GZ3A 3HABA 2AEMA 1Y9ZA 2RIPA 4K9QA 2C59A 4DF3A 3PCRB 4IUYA 4P53A 4UHFA 1PE0A 2YHIB 3IH5A 5DGIA 2BUBA 3TUZC 1ZNWA 2GFIA 5CA0B 1TA0A 3G5LA 3ZDCA 4R8RA 4DWOA 2A94A 1I7QB 4N7MA 1EA5A 3KS9A 5IT9A 1GCGA 1AB5A 2H57A 3G9QA 4WESA 3FM9A 4J90A 3I9OA 5JD5A 4D9HA 5E0OA 3KETA 1RXEA 5HG0A 3IT1A 3UATA 4I9NA 3WBBA 3ZE0B 5EMLA 4J03A 5KTMA 3KQTA 1D4ZA 2VYND 2NU6B 3LQKA 1XJ0A 3DAOA 3I6QA 3MTGA 2NV0A 5ALNA 3SS8A 2R97A 4TV9A 1UBLS 1O5IA 1ZLXA 1U0SY 4MZXA 1OFTA 4ZTZB 2O0HA 1ZX1A 1XEFA 1UKEA 1RVV1 3Q15C 1P2SA 4Q9IA 1P4HA 1R0ZA 2WHYA 3DEJA 3PKJA 1QQ5A 5TLSA 2IH2A 4Z5XA 4M86A 2CXOA 4UHCA 3WQRA 5LPNA 1P0FA 2I2AA 3MVEA 1H2XA 1V37A 5CFZA 1G38A 5JIBA 4MS3A 5KB3A 4YUYA 4HB4A 3QHAA 3VSCA 1Z2OX 4FFLA 4MUKA 4O6VA 1YUNA 4TRMA 4R2KA 1JTFA 1HEUA 1DC8A 1RAAA 1T9CA 2VNIA 2XHEA 1KIFA 1ZM9A 3KKMA 3MBOA 2QEQA 1FU8A 1WXWA 4NXNB 4MEBA 1LRKA 3VDRA 3ZV3A 4JH0A 2Q3BA 3QEJA 2WY2D 1O5OA 3V8PA 1JH8A 1K7YA 1HDYA 1NKTA 1QORA 5AI0A 4OQZA 4PHHA 2AZXA 4BQNA 1CVRA 4JMPA 3ZGLA 1VI6A 2OGWA 5JNTA 5KYWA 1JILA 4OMUA 1HGXA 1XLTC 3LHDA 1QANA 2JK1A 1MQSA 3I6IA 2P9YA 3DZJA 5DOZA 4BVLA 1TM4E 2ZS7A 1DSSG 3O38A 3BULA 4BEJA 2CFCA 1QP4A 3RC8A 2QT9A 4JX8A 4WNAB 4TTSA 2OM2A 1GU0A 4UUQA 1A9XA 3GGDA 2A3NA 3T1NA 4V0MA 3FR8A 4DZRA 1P9WA 4OI2A 1G5FA 2EX4A 4ZU6X 3S2YA 4BNUA 5CBKA 2ZBUA 3CF2A 2I4IA 2CHEA 1Z8DA 3D0OA 1QHXA 3EVNA 3QPBA 5F12A 4YRAA 1AKVA 4KLRA 1PTKA 4OGFA 4QGFA 4Y1EA 5HMLA 2DB3A 4A8PA 1IEXA 1W19A 4WFIA 1LNSA 5K3BA 3ZHSA 4BNHA 2HLPA 2JARA 3H9GA 5IJ9A 2YR0A 4ON9A 4D3ZA 1JI0A 4NV3A 5DASA 4HCJA 4MR7A 3EXFB 2FSSA 3M7IA 3X1KA 4BZZA 4KFUA 2ZK7A 4N5MA 1XEWY 1ZL0A 2YVLA 4OK3A 3PHJA 4Y2VA 3S7TA 3ZG6A 1FNNA 2PO7A 3MMNA 5LMZA 2X8JB 1Y8QA 5GAJA 4CI0B 1PIWA 2QYOA 3NUGA 4XVCA 2W8BA 3KRTA 3BWDD 4E1VA 1E4EA 3E53A 4JQOA 1W0JD 5DX1A 3H5VA 2WWVD 3OZIA 3GK3A 4YMUA 4ZOLA 3SCZA 5KYXB 3K4PA 4NZPA 1K7FB 1SCUB 2GBIA 1ESEA 5KQPA 1YNOA 2ZI4A 2HR1A 4D9CA 4HADA 1TM2A 1Y42X 2ZJ1A 3GAAA 3QK7A 4GAEA 5F64A 4DBZA 2V9ZA 1W4LA 2ZE5A 3AGQA 4WKNA 3WQQA 3G9ZA 4D9IA 2REXB 1YB6A 5B7QA 4TKVB 1D1PA 4RD4A 4I2NA 5E1DA 4KYUA 1FS6A 4LY0A 3BXOA 3KAPA 1NU8A 2IIVA 4ARAA 3SEQA 4S1VA 1N2GA 1IM2A 1YS7A 2QWXA 3JQFC 2J9FB 3RS0A 4LJ4A 3E9NA 1TJYA 2ZQZA 1T8UA 3G8CA 1AURA 2ATXA 3HJCA 3MB8A 2ZSUA 3DVSX 4ZO9A 5EKUA 4EHHA 5JVDF 4B17A 5FUMA 4P1ZA 2E18A 2FR0A 2PS9A 4MPJA 1ADCA 3K70B 4N7RA 1O4WA 3AB3A 5CB8A 3J80A 2Z3ZA 4E03A 4WOKA 3ZCTA 2B94A 2FJUA 4NENA 1Y4SA 4AZ3B 1X80B 2NWQA 3QPWA 3ZD8A 5KWEA 3ES9A 4IZ6A 2RGGA 2WAAA 3CNNA 3GLGB 2PN1A 1OJ7A 2XMPA 1VLZA 1ZGJA 2BR5A 3UWPA 4DL9A 4K88A 4YAFA 3IFSA 3LDGA 2Z98A 1N6IA 2CLIB 1HE5A 4MKFA 4TL6A 4DIOA 1M5RA 4QSMA 4FNMA 4WY8A 3GJXC 3C1TA 2ZJ3A 2AFIE 2PMFA 1IOLA 3S8MA 3UMGA 2MYTA 3I58A 1V8ZA 4MPTA 4XPZA 1XCPA 3IA7A 3FKSA 5CA1B 4HDMA 4H7EA 2OPHA 5ITVA 5LP6F 4BB0A 4F56A 2Y2VA 3TTXA 4CM7A 3PWZA 1TYDE 3EW7A 5CM8B 5JO0A 2V65A 5KTYA 1G8AA 1REQA 2GKSA 1Z0IA 5DGHA 1Y81A 1HEYA 1UQRA 2TSYB 3L7JA 1MDBA 3NHPA 4PX5A 3OIGA 1P7ZA 3B70A 3O8OB 4IQ0A 1AGNA 2ZGVA 3MSCA 4ZMSA 1LS6A 3ED5A 3F96A 4OHRA 4FDTA 4IRXA 4MYRA 5EUBA 3ELYA 4B3RB 1CJSA 5CEEA 2L69A 3INTA 4ZT7A 4OI0A 1VSVA 3O4HA 4W5NA 1F17A 3OPXA 4Y6SA 4H15A 3UB4A 3EGDB 4I1PA 3L05A 2CF5A 2C3YA 2ZVDA 3E3OA 4EJSA 1J49A