1UKEA

Ump/cmp kinase from slime mold
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
193
structure length
193
Chain Sequence
b'EKSKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLFKSMGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDYLMONOPHOSPHATE/CYTIDYLMONOPHOSPHATE KINASE
publication title Crystal structure of the complex of UMP/CMP kinase from Dictyostelium discoideum and the bisubstrate inhibitor P1-(5'-adenosyl) P5-(5'-uridyl) pentaphosphate (UP5A) and Mg2+ at 2.2 A: implications for water-mediated specificity.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Nucleotide monophosphate kinase
total genus 67
structure length 193
sequence length 193
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 1998-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ukeA00
3CX6A 2YWHA 4RKFA 3KZ1E 3EIQA 1M7GA 2ZITA 521PA 3NDBB 4PC6A 1W4RA 1GVNB 2WOOA 2RH5A 4MRVA 4DT1B 3K70D 3EIEA 5JWHA 2C8VA 1XPRA 3I32A 3HYRA 2ZPTX 5EZ5A 1DAGA 4PSVA 5GJCA 3CPEA 1FPMA 3KJHA 1JXOA 1G6HA 3UPUA 1RRGA 5KSPA 1ZRHA 2ZI9A 1XB2A 5TB5A 2P6NA 2OFWA 1UPTA 1A2BA 3VR4A 2IF2A 2REXB 5JZVA 1PLKA 4XSGA 1NIJA 1Q1QA 1ZINA 3DZDA 3K8YA 3TJZA 2AWOA 1NBMD 3DM5A 2AR7A 5DN6A 3K0FB 2ECKA 3IILA 2Z6VA 2QPTA 3K9HA 4CF7A 2AFIE 3R8CA 1M74A 3FHTA 3CF0A 3U4QA 1OXVA 4ZIRB 1YZTA 1W4BA 1YR6A 4B6FA 2D4HA 4IVQA 1D5CA 3WMEA 3LQRA 1EESA 3GLHA 4JLBA 2LKDA 4IXMA 1JJVA 4JT4A 3UANA 2VIIA 4RY2A 2RKOA 2C96A 3T1OA 5CYPA 2ZRNA 2PEZA 3O47A 2C04A 2QRZA 3HU1A 2GWHA 3G5UA 5TV2A 2WOJA 3ECCA 1W49A 2ZI4A 3ZS9A 1Q12A 2BIFA 2R65A 4UKDA 3TE6A 2XTNA 4DDVA 3ADCA 1T0JB 3QUSA 2D3WA 5L3QB 1Z5ZA 4WXRA 1IXZA 3AVUA 1E0AA 3LY5A 1IHUA 4Q1BA 2ZR9A 1NN0A 3LWNA 1P2SA 3F5FA 2OESA 3S1AA 4NE2A 4BLOA 1P2VA 1TQ6A 4G5RA 3DMDA 2YOGA 1IQPA 2X19A 5A5GA 3EXAA 4LPKA 1SKQA 1Z22A 3A36A 1BIFA 4IEIA 5HZHA 2FU5C 2G0NA 3EAQA 1R0WA 1E2FA 4WW0A 1EWQA 3X1WA 4RFVA 4AD8A 1OHHD 3IIKA 4HDQB 1LB1B 4KVGA 3PUWA 2ZS8A 3FKQA 2Q6TA 5JRZA 3IIJA 1KZGB 3K0CA 4PX9A 4AYTA 1XEXB 1KSHA 2DY1A 2UZ3A 4AI6A 4IHQA 1NVVQ 5JECA 3M4YA 4NDZA 2W6JD 2IXGA 2J0SA 4TYPA 1QHSA 2BJWA 4X8LA 5EQTA 1GDDA 4JKIA 5G3ZA 2Z83A 1CXZA 2ZRGA 1GKYA 2GJKA 1VG8A 2D06A 2HLDA 4PPNA 4G3XA 4LPSA 1Q0UA 2GVZC 1IJFA 1N25A 4GMDA 4EJSA 1E9RA 4JT2A 3CRMA 1UDWA 1M8PA 4FCVA 2E1RA 1W2HA 4J0QA 3ZDQA 4II7A 4RKEA 1KY2A 2JCSA 2ZRMA 1Z0JA 2EFEB 2ODEA 1N3BA 1Z06A 1DAHA 1SZPA 1DAMA 4QGHA 2BMFA 1UKYA 4R7ZA 5L3RA 4BFVA 3PEWA 1RPZA 1MH1A 4A82A 5B58C 2VTKA 4QKQA 3Q8XB 3OE7A 4OQMA 4MRPA 1ZNWA 5EXPA 3PXGA 4C0AC 2N42A 1VG0B 2YNMA 4B32A 5HR5A 2IYUA 4D4LA 5FOXA 4PZZA 2ZS9A 1XJQA 4GZLA 1G1MA 2Z4RA 2ZJOA 4URXR 3WYAA 2ZANA 1EG7A 4JLJA 3IGFA 4W7SA 1DE0A 1GKUB 2V1XA 2DFLA 3OIVA 2BKUA 3VX3A 1OH7A 4PPGA 4LWZA 2WSSA 1XPUA 1AGRA 3G82C 4IDNA 1Z0IA 4A2WA 1HUQA 4QBHA 5C4GB 4LJAA 2BVNA 1JNYA 3C8UA 4LHVA 3W9YA 4V0LA 2J9RA 2CL0X 4YONB 4ARZA 5TMPA 1XTSA 1YZKA 3A4NA 3GMTA 2HUPA 4HB0A 1Q44A 2QP9X 2W83A 3EC1A 2ZM5A 4F4IA 2D2FA 3AQ4A 2GJ8A 5IHPA 2VP9A 4MDFA 3FMPB 1DADA 1XCGB 1E2IA 3H86A 4U00A 4Q66C 2XXAA 5HCNA 2BWJA 4DKXA 2EFCB 3ICQB 4HZUB 5CB8A 2CL7X 3PUZA 1WQ1R 1COWD 4DUGD 4TLBA 2DB3A 4M53A 4ZI3A 1FW6A 1GL9B 3TUIC 2EFDB 2JJ1D 1ZMXA 4DLZA 1SHZA 3QF7A 2NTYC 1YQTA 3K9GA 2NZ8A 1UKVY 4B2IA 3EZFA 4GDFA 8OHMA 1L2TA 1ZM7A 2ZRKA 2ZU0C 3REFA 3ADBA 1SVOA 3E70C 5LD2B 1UADA 3KTAB 5L3SA 3B6EA 5KHOC 2MSDB 4XJXA 1S8FA 2F9MA 1W0KA 1E4VA 5GJVC 1IN6A 4LJ9A 1G21E 1QZXA 4CEHB 5IRCD 2VF8A 4FWTA 1CJUC 1A7JA 2WPDA 1KZ7B 4FW9A 4N3NA 5FOVA 1G5TA 3KB2A 5EP3A 1E0JA 1Q3TA 4HAZA 3LXRA 4M9XA 2F43B 4N0DA 4JLDA 1RIFA 3LBNA 4CVNA 4Q01A 3RS7A 3A1SA 5TARA 1HQCA 2R6CA 1G17A 3CR8A 4HB2A 1D6JA 3QKUA 4B3XA 121PA 3QXSA 4IOMA 2WWFA 3KKPA 4C3ZA 4LYAA 2W58A 4RFSB 4Q47A 4C0KA 2ZR7A 1I4LD 4XSHA 2H5EA 1MKYA 4B48A 4KLZA 2ZAOA 3BIFA 2J0UA 1TPZA 2YOHA 3TSOA 4UNPA 3D8BA 1PZNA 3HP1A 4Z1MA 2QUZA 4L4UA 4FIDA 2FF7A 2L0XA 3H1TA 4HATA 4XOIA 4L5BA 2C9CA 4Q7LA 2KBEA 2IEYA 2YVUA 2ZI6A 4A8JB 3GFTA 1E2PA 4Q4AB 2ASEA 2I1QA 4IFBA 4TTQA 5B64A 3QF4B 1N2CE 3H84A 4D26A 3R7WB 2W0MA 3MWJA 3TK1A 4NCIA 3THXB 3GLGA 5CM9C 4QHSA 3AB3A 4OL0A 1G9XA 3Q5DA 4PHFA 2IYVA 4MKIA 4DSUA 3U7EB 3Q85A 1SXJC 1GL7A 4B2LA 2OAQ1 1EFUA 2UZIR 1XEWX 2ZRFA 1KIMA 3SR0A 2BOVA 4PQYA 1N6NA 1YZNA 4EFMA 4DLSA 1NRJB 2IYRA 2J1LA 4BLQA 4XWOA 4JYCA 5IK2D 1IAQA 2DFNA 4BWYA 1G16A 3KQNA 1HH4A 5JRJA 2XSZD 3AF2A 2NO7A 4DLRA 3W3ZB 2CCGA 3IHLA 2ZJ8A 3MUFA 5AR1A 3NDPA 4FMCB 4AG5A 4LJ8A 1E79A 4XIGS 3TLXA 1D9XA 3WYFA 1U90A 2CJWB 2CLDX 4HLUA 1KDOA 4C0SA 3KKNA 4Q02A 2PMDA 3LVQE 2O5VA 1U2RA 4AIIA 5DSZA 1KK2A 2FZLA 2QN6A 2IWHA 2ZTSA 4FINA 3GEEA 4NCJA 3UATA 4W5WA 1II8A 1RRFA 4EUNA 1JAIA 2KBFA 3WHKA 2G88A 2YWEA 1J70A 3QEOA 3I72A 3ONWA 2MMGA 4B71A 2V7QA 2JLSA 3QPUA 4V0ME 1F3OA 5AWFC 3ADKA 1PUIA 1S4QA 5J4LA 5K8LA 2ZS7A 4MQBA 1G20E 2BBWA 4D0NA 1KO7A 4TTPA 1UFQA 1Z08A 1Z0AA 1ODFA 2VHJA 2JIZA 1NLFA 2WJGA 4KODA 1SVIA 3W90A 4L15A 1Z6XA 2PJRA 4WA7A 4TL7A 4DVGA 1EWRA 5BXQC 5DHFA 2XAUA 3ZVRA 1J90A 5SZKB 1SXJA 3DMNA 4P33A 4BFUA 3PUXA 3C41J 2GBLC 1O87A 4UXHA 4DXAA 1YZQA 2OCPA 4I99A 3I92A 1E1RD 2V6JA 1EFRA 3VU9B 4NMMA 3KJGA 4L9WA 1TAGA 2ZRJA 3LD9A 1KI9A 1PLLA 1S1CA 3D31A 3EWSA 1VYTA 2A30A 5BYKA 1RVDA 4MUAA 4CDGA 1GNPA 3IQXA 4DWJA 2ODNA 4G5GA 3WBJA 1VECA 2UKDA 4M1TA 1XEFA 4EDHA 1XPOA 2NMVA 1XTRA 1VCMA 2C2HA 1G7RA 4Q7MB 1YR9A 3AP2A 1TUIA 5FOSA 2C98A 4MITA 5FUWA 1NG9A 1XCMA 2ZUBA 3PIRA 4ABYA 1LF5A 5CYOA 2AKAB 1TF7A 2QM7A 1G4AE 1VKJA 1SVKA 3I1FA 4IJMA 4OK3A 4QL3A 1PVOA 1JR3E 3CWQA 4M1SA 2ZJ2A 3O8DA 4B47A 1G3UA 1U81A 2IF0A 1NY6A 4YXWA 4B74A 1FL9A 1KI3A 3L8YA 2DPXA 3LBIA 3WMGA 4KHZA 2XB2A 3TR5A 1UKEA 2G0TA 3SN6A 4GOKA 4ZKEA 3VR3A 4BFXA 3KUCA 1MRNA 1DELA 3RC8A 1YRBA 3QXXA 1GRRA 2P2LA 3GFOA 2NGRA 3QKTA 2UVQA 4A0RA 3UKDA 3TBKA 1JJ7A 4E09A 2QBYB 2XNDD 4MGZR 3N5CA 4HUQB 3AKCA 4JYBA 4PPFA 1SVWA 2FSIA 3RWOA 3THWA 2QAGC 2OSBA 3CIOA 3QG5A 4Z1MD 3A1TA 3TW4A 2WTUA 2O0JA 2WWHA 2IT1A 4Q21A 5KDLA 5JHHB 5KTYA 2V9PA 1CR1A 3VQTA 3IPXA 3B7GA 1S3GA 2WJVA 1AK2A 3DPUA 1CR4A 1CJVC 3SNHA 3ZD7A 3W6NA 2ZE7A 1DO0A 2ERXA 4BLPA 1F48A 2KWIA 2OILA 3I62A 1GRNA 2YWGA 3BH0A 3H2YA 1U9IC 3NH6A 4W5JA 3QEJA 3NC1C 3WBKA 2CBZA 1KMHB 1N5IA 2Q9BA 4P4SB 1E9SA 5C1BA 4IOLA 1NVUQ 2OXRA 1IN7A 4U02A 1HURA 4L8GA 2ORIA 4JJZA 5FI1B 1N5LA 3U3KA 1KO1A 2JAQA 2FPKA 3AVPA 1UAAA 1FZQA 1D2EA 5EUQB 2WMNB 4CT4B 2HCBA 2OZEA 4LHXA 5FBLB 4DC9A 1W36B 1OF1A 4JL6A 4WXPA 4M8NE 3TIFA 2OO7A 3UXMA 2BHRA 3RLFA 5FTMA 4PC3A 3LLMA 4A8JC 2O8FA 3BRWD 4E22A 1SULA 2E9SA 3GLIA 2BCGY 1GZSA 1P60A 2VHTA 4EJSB 4OI2A 2V1UA 1VIYA 5L3VA 1BYIA 2OFOA 4QGFA 4ASUD 1NBMA 1E1QA 4MRNA 3LX5A 5HKKA 1KY3A 4Q7JB 2ZREA 4FI3C 4GSYA 1TNDA 2OBNA 1G8FA 5KPJA 4B3CA 4B3FX 2WIBA 2V6IA 1G3IA 2FFBA 5E7IA 1VDZA 3B85A 2IXFA 4US0R 2GKSA 1Q20A 4EPXA 4AYWA 4BQSA 1Z3IX 5AJWA 1C9KA 2HDNB 3N2EA 1JEDA 1ZIOA 4JLMA 4YQFA 4HSEA 3B9PA 1QHNA 4I4LA 2JIZD 4FCWA 1ZW6A 2GCNA 1F60A 3WNBA 4IDQA 5FOUA 1OV4A 1NMXA 3T12A 5JEEA 3T1QA 4M1YA 1F2TA 1E2GA 4LHYA 1MO6A 4Q9LA 2NPIA 2VQSA 2GESA 1SXJD 2IYWA 1G7SA 3DDCA 1XEWY 4AC9A 3LXXA 2GDJA 1K5DA 3A58B 3FVQA 4P0TA 1CR0A 4NU0A 1W5SA 2DWQA 3CZPA 4ZPXA 3QVUA 4YMVA 5GVSA 1ZAKA 2IYZA 2J41A 4LV8B 2XXAB 4PXAA 4BLRA 4JLOA 4CEJB 3P32A 5HTKA 5FTLA 4DEYA 1IN5A 3TAUA 4EQ6A 3D7MA 3ZZUA 1R2QA 3T15A 4HDCA 3CPJB 2FGJA 3BB4A 2QTVB 1CLUA 2YHSA 4BUJA 5AJXA 1NMZA 5GJBA 1G3MA 1W1WA 3PJRA 3GJ0A 2CHQA 1QG2A 2BJVA 3A8TA 3O8RA 5KUTA 3L0SA 1I4TD 3D6TB 3LV8A 4KCGA 3SJCA 3R9IA 5DNYB 2W6JA 4C7OA 1UKZA 4PO8A 5AUQA 2WV9A 4DLUA 3CNLA 4GFDA 2GCPA 1G8YA 4FMDF 1Q1BA 4YXWD 4B3GA 4YDHB 3GLFA 3JZMA 3UG7A 4NYJR 2QQEA 1G7CA 3MWLA 4B33A 5FUVA 2A78A 2RMKA 1Q1EA 1KJZA 1KAGA 5JMTA 2ZQ5A 3MAAC 1OB5A 5KNDA 3EA5A 3ZGXA 5J4YA 4Q9IA 1CKEA 1GUAA 1NKSA 2WZQA 3SJAA 2ZI3A 1KJYA 4TMXA 4ZO4A 4D82A 5FOTA 5C2JB 4BFSA 2R6GA 4GP7A 1MOZA 4EPRA 4A9AA 2J7PA 4QNRA 2KJQA 5CK5A 4B34A 5DHAA 4D4JA 4L16A 3RS5A 1NF3A 1Q57A 3QI2A 3X1ZA 4AWXA 1U0LA 1WBBA 3QPVA 3SFZA 4DCTA 4OI0A 4QRHA 2QA5A 2NPFA 3P26A 4WAUA 2RGEA 3Q72A 1FFHA 2ZYTX 1B0UA 2C5LA 2OEPA 2OCYC 4QNMA 5AK0A 1OXUA 5TXGA 2FFAA 4CGZA 5K8TA 4HAVA 2RGBA 1S3SA 4XWKA 5HZKA 3FMOB 2YC4C 1BKDR 1DG3A 4Q4LA 4QOSA 5B30A 1CJTC 1M1YE 2FFQA 1E2NA 3JVUA 4HZIA 4EPYA 3CBQA 4D4MA 1V43A 3A37A 4DB4A 2WKQA 2OCBA 3CH5A 4ILEA 2AX4A 4HYYA 4P32A 3TMKA 4LBWA 1Q1ZA 4Q4HA 5JJIA 2FN4A 2VHCA 3U7HB 1NSFA 4HAWA 1OXSC 2FA9A 1R5BA 3E2IA 3R9WA 3WXMA 3TNFA 1C1YA 3LQQA 1COWA 4NKRA 4OQNA 4DUGA 1GL6A 2FMXA 4M1MA 2Z0MA 4TMVA 5KYKA 1G5PA 1MV5A 2A5JA 2WM9B 3FFAA 4RCZA 2VF7A 2O8CA 2JJ1A 1R0XA 2W2VA 4DDTA 2OHFA 4UJ5A 1NIPA 2R6DA 2RHMA 1VYUA 1E1QD 1OFTA 1ZU5A 2CHGA 4BRWA 2J0VA 5HKKD 4R2IA 1J8YF 5JCPA 3WP1B 1VG9B 1NBME 1ZUNB 1E2JA 4CIDA 2WAYA 5EXSA 2BEKA 1QVRA 3GJ7A 3RAPR 1GFIA 1US8A 3CNNA 1BH2A 4Q1EA 4C0HA 5C18A 2ZYVX 4KI0A 3Q5EA 1KOFA 5FBQB 4OHWA 1WRBA 1IN8A 1EFHA 3Q9LA 1W36C 5LDDC 3BBPA 4F38A 3P1JA 5EXTA 1DBSA 1GNRA 2P65A 1E2EA 1TADA 5LPNA 2IS6A 2A5FA 4CZ2A 3BFVA 3ZVLA 2MMCA 4CEIA 2B6HA 2BMEA 3THYB 1D2NA 2ZI7A 3MWYW 4X8HA 5HE9A 3K9NA 3KFVA 1SQ5A 4TMTA 5BQ5A 5EJEA 5K8IA 3RC3A 1N6RA 3EW9A 5JSZA 2SHKA 4DLVA 2JLXA 4PHHA 3SS8A 5EE1A 4A2PA 4AKGA 5AUPB 3HWSA 4LRWA 2GTPA 4HAXA 5AJVB 1DVRA 3TR0A 1AN0A 2JLYA 4QHTA 2I4IA 4GBMA 1E99A 4B75A 1E0KA 4JL5A 1OIWA 1X1RA 3QXCA 5G41A 1G5RA 4RZUA 3DM9B 4OK6A 1VYVA 1N5KA 2DWPA 3KKMA 1WXQA 3QIAA 1WB9A 2PBRA 4Q4JA 4NHOA 1F5NA 3RS4A 2Y8EA 1FTSA 1KI8A 4K8OA 1H8ED 2FPMA 1YHNA 5CIQA 2GF0A 4QM7A 2XZLA 2HYIC 2ZYWX 5DYIA 1ZM4A 4OHVA 2EYQA 3RHFA 1XTIA 1FNNA 3B1VA 2O52A 5IK2A 3U3MA 1QBKC 4OHZA 1F2UA 2WJIA 5FTJA 4D25A 3NXSA 4BEJA 2FH5B 2XSZA 1S1MA 4KSCA 4PANA 4KBFA 2EYUA 3FKSD 3CW2A 221PA 2GCOB 4UNNA 3VR1A 1CU1A 4HDOB 1R8QA 3OF5A 4A0GA 2PH1A 2GETA 1QHHA 3BB1A 1LFDB 3RRNA 4LJ4A 4LSGA 1E4YA 1HYQA 1AKEA 3L0OA 4Q19A 1A1VA 4PFSA 2J7PD 5BN5A 5BN3A 1EX6A 3QVVA 4TTRA 1DOAA 2JLUA 1ZM3A 2ATVA 1KKLA 2CXXA 3ZQ6A 4OQXA 4E07A 3THWB 4M9SA 3A4LA 4KYIB 5FUXA 5J40A 3D3QA 3BK7A 2ZJZA 3R9XA 3QKRA 1HT2E 2H17A 1ETUA 3NIBA 3QKSA 4PQRA 3SEAA 5HPYB 4FXPA 2X77A 1N6IA 3DEFA 5CDFE 2NQ2C 5FOWA 3MD0A 1DAIA 1GAJA 1S9DA 2C77A 1CRQA 3UWKA 1CJKC 3KL4A 4E5UA 2B8WA 4UXIA 4Y0VA 3GPLA 3KXKA 1ANKA 4LC1A 3K9LA 2F7SA 2ZIAA 4TMKA 1Z6YA 1VMAA 4PPQA 1RYFA 1E2MA 2TMKA 4LZZA 4P4UA 5C4MA 4HAUA 4A4DA 1KK3A 3T1VA 2HEIA 3UMSA 3TUJC 5F9HA 3R20A 4AYXA 1Z47A 3B9QA 2BM0A 2JJ2A 3ASZA 3CO5A 3UK6A 4LBZA 2EWWA 2ORVA 2IL1A 4Q1DA 4JVSB 5KOYA 1U98A 1KI7A 1E1RA 1SVLA 3DHWC 4JSYA 5B2ZA 2FNAA 4KFTA 2Q9CA 3WHLA 4HAYA 2G9NA 4A1FA 2AHOA 4O0MA 1N5JA 5C46F 2D7CA 1P4SA 4BFTA 2DFKB 3NBXX 5CLLA 1ZBDA 4C0QC 4IDHA 3X2SA 4C0BA 4WVFA 4R9UC 3VTKA 4C9BA 3LO5A 1KTVA 2NO0A 3B2EA 1DARA 2VPPA 3K0AA 4OK5A 2G6BA 2IEZA 3VFDA 1G8GA 1CIPA 4OQLA 1XD2A 1RJ9B 2QGZA 4MKFA 4QG7A 3BGWA 2QM8A 1W48A 2GK6A 4MH0R 4QC2A 5BN4A 1T3HA 4JLNA 2XTMA 4MYTA 1OLOA 3FDIA 4GP6A 3SBDA 4P4TA 2IS1A 3ZQJA 1IM2A 5D3MA 3IO3A 2IA5A 1ZNYA 1YR8A 4LUCA 1WF3A 5JCZA 4FCTA 3N70A 1N6LA 4TLEA 4QHYA 3IO5A 1HE1C 1L7VC 1KAOA 2FEOA 2BDTA 1OSNA 5E4FA 3GLHE 1T8UA 1W0JD 1CBUA 3AKDA 1IONA 2O8DA 2P3SA 4Q48A 1KNQA 2QL6A 3BFKA 2JLVA 1LY1A 2FG5A 4IKEA 3KB1A 4LV6A 4NYJQ 5JJLA 1OFHA 2VSOA 2XNDA 3B78A 4X8OA 4A0HA 5KPDA 2FSFA 4BZPA 1VG1A 3AKEA 5J4VA 3B8HA 4OHYA 3NBYC 2JDIA 1JXMA 2C9OA 2GRJA 1DEKA 4B44A 1NNEA 1X8JA 1MO3A 1XXHA 2ANCA 3A4MA 3PCRB 4IFEA 2GEUA 5KNBA 1N6OA 2C95A 2F1IA 1X1SA 3A1UA 1N6HA 2ZSAA 4QBIA 2GJSA 3CF2A 4RD1A 2QZ4A 3BOSA 4BZXA 1EGAA 1ZJ6A 2ZRIA 5EP2A 4DCVA 5F98A 4IXNA 2RB4A 2OE2A 3B1YA 2IUUA 2ODBA 2VP2A 3EA0A 1XMSA 2G83A 4ZCLA 5F9FA 3WRYC 2PEYA 2IC5A 1G8HA 1YR7A 2X8AA 3T34A 3VHLB 2FDCA 4A92A 1E6CA 2OAP1 4F4CA 1A2KC 2O8BA 1LNZA 2R6FA 3BH6A 5CITA 4GMXA 4Q03A 1T9HA 5KNCA 2I1VB 1T3SA 3TH5A 5J5CA 2HT1A 2IYYA 2WBLC 4D0LB 1WCV1 3FTQA 3KFXA 1AS2A 1Q22A 1CR2A 2MSCB 1Z8FA 3TQCA 3KX2A 3N2IA 4Q9JA 1JALA 2ZI5A 1AGPA 1W36D 3CR7A 3OIYA 3EARA 4DT1A 5FL7D 2VP4A 3DZ8A 4ASUA 4WZBE 3I8XA 3B1WA 1JR6A 4TYQA 5FFMA 2XGJA 4JZKA 3HR8A 3CX8A 3RYTC 2NO1A 2ZRCA 2VP6A 4HUTA 5F3WB 3DKVA 1XF9A 2CCJA 1OE0A 2P67A 1LW7A 5FPTA 3QQ5A 2PJZA 3ND8A 4JBXA 4Q00A 4TL6A 2ZAMA 2CLCX 1MO5A 1S2MA 1X6VA 1FX0B 1OPXA 2PCJA 4LBVA 4K81B 1XJCA 821PA 3TAHA 1W7AA 3LH5A 4G5QA 5EP1A 3K0FA 4BEBA 1JAHA 2DBYA 1OFIA 3PEUA 1J8MF 4A2QA 2V54A 4A6XA 1OJLA 4B35A 3GP8A 4MKGA 5P21A 4QXAA 3AVWA 5TVKA 1AS3A 2CK3D 1X8KA 5FPKA 4I1SA 2PT5A 4O2RA 1ZC3A 2CNWD 2HXSA 3TRFA 1Z63A 1NSTA 4MGIR 3C4JA 1RYHA 4URVR 2QTHA 2JJ2D 4GT1A 3VNVA 4QJ4A 4HI0E 4JLKA 3QBVA 1LVGA 2MSEB 2FX3A 2D62A 4YDSA 1X86B 1XTQA 4XWAA 4EIWA 1GP2A 5CJPA 2GZAA 2V8OA 2C03A 2EFGA 3EZ2A 3T35A 4PO9A 2HF8A 3ZD6A 2IYQA 1KDTA 2AD1A 2B7CA 1XU4A 3NH9A 2WVJA 4ON9A 2GAOA 5E7MA 2YWFA 1JECA 2GJAA 2HF9A 2GZHA 2YYZA 3KUDA 2Q3MA 4DHEA 2KI5A 621PA 2F3RA 1M7HA 3LW8A 1E98A 2ZSEA 3FPAA 4MYCA 4YMWA 2ZRAA 4TZ6A 4LCBA 5J4HA 2W0SA 2JGNA 2QROA 4V02A 2C99A 2ONJA 3RVBA 4IVRA 4ACAA 5FBRB 2QRNA 1X3SA 3U4QB 3U2QA 1XEXA 4TYNA 4K46A 3ZVMA 2OXCA 1D2MA 2GAAA 2QMHA 3GLHB 2JASA 2Z4SA 3HPQA 3QENA 4PAMA 1OH8A 4OI1A 1QHGA 4XVRA 2J46A 4GOXA 1IY1A 3X1DA 1T5LA 2QSYA 1TX4B 4JSTA 3T61A 3KQHA 2CE2X 4ITRC 1W4CA 3W5JA 1N0WA 1SGWA 4KJZA 1WDTA 2F1JA 4B3BA 3A6PC 1E9CA 3SFVA 4BECA 5BWMA 1Y63A 4G5OA 4XVUA 5JS8A 2VA8A 1B23P 2JDID 2QTFA 4C30A 2VP0A 5CM8B 3AF3A 2BBTA 3C5HA 5KU1A 5LD2C 2B21A 2CL6X 3IHWA 5JSZB 1K8RA 2GBLA 4Y0AA 2LKCA 1AIPA 2LCFA 4DIEA 3S1AB 3TSZA 3B5JA 3SOPA 1M7BA 4BE7B 4MYHA 2CEAA 2G77B 1KSJA 5E95A 2AWNA 1M2OB 3GLGE 1VHLA 2OCAA 2WHXA 4YC7A 5HCIA 1SHKA 3BXZA 5HE8A 3A1WA 3I61A 2QPOA 2QP3A 2GVDC 2VO1A 5GVRA 1GWNA 1QDEA 2RGXA 4JVNA 4TZ0A 3B13B 3GJ8A 2HV8A 5DI3A 3OAAD 5M04A 3E5HA 1ESNA 3RRYA 4B6EA 4TSFD 3RS0A 1J2JA 1WBDA 1G64A 4KFSA 3W6OA 1AJEA 4DLWA 1XP8A 3SHWA 4TLCA 3U3RA 2HXYA 5DH9A 5EZ6B 2PZGA 4NL4H 5JWRA 1NKTA 1QHIA 1YZGA 2QEQA 2J59A 3EZ9A 2ZSDA 1HEIA 2CDNA 2XOKD 3OHMA 4P31A 1AQYA 4DJTA 2ERYA 3NEJA 3KQKA 1L8QA 5ELXA 4OBEA 1NVXQ 3VMFA 2IUSA 2WWXA 2VH5R 3NHBA 1AA9A 2DYKA 3AF1A 2BV3A 2CVHA 5FPHA 2NIPA 4HZUA 4PZYA 1EK0A 5FUYA 3MSXA 2OM2A 1QG4A 1YJ5A 1P75A 4UNQA 4BRUA 4ERNA 4URYR 3ZH9B 2BMJA 2CMKA 3JVVA 3U5ZB 2B8TA 3C5CA 2AD5A 3RS2A 1Q3HA 3X1XA 1YU9A 1JEEA 2QAGA 2OG2A 1BMFA 2R8RA 1GOTA 4JLVA 2R62A 2YKGA 3AP3A 3OEED 4HB4A 2C9YA 5FPYA 2J7KA 4Q1CA 2RGDA 1KI4A 2FV8A 2DCUA 3KTAA 5G53C 1DAKA 1RZ3A 3F8TA 3PUYA 2CLSA 3QKRB 4X8MA 4F7WA 3T06B 3WNCA 1WP9A 1ZVQA 2RGNC 2VLIA 2F3TA 1OIXA 1XJ0A 3AP1A 1OKKD 2RGCA 1U9IA 5JJKA 4TQAA 4ZDWA 1S0UA 3DKPA 4D0GA 4DDWA 3GJXC 4V0KA 2F6RA 2W2XA 2YOFA 3ND9A 3P27A 2BC9A 1IY2A 3W8RA 2F43A 4AK9A 1NY5A 1QRAA 4ARZB 2PX0A 2ZRDA 4TMWA 1SXJE 4TMZA 421PA 4DB2A 1CP2A 4PHTA 3EZ7A 4HLQB 2D74A 3KDSE 5EE9A 4AKHA 2W6IA 4O3MA 2XNSA 4A0FA 3TGPA 1TF5A 2A2ZA 2GJ9A 4US1R 2J3EA 5FL3A 2QE7D 2QU8A 4RFSA 1J99A 1AS0A 3W6PA 2EWVA 3GFPA 5GJWC 4KU4A 5D3QA 4W9MC 1XBTA 4LC0A 3CUEF 1KGDA 1ZIPA 3NBZC 4A6PA 3K09C 2X1VA 3CRQA 4G5SA 2VL7A 3IKJA 4A8JA 4Q4AA 1TF2A 1Y3AA 2PX3A 2ZYUX 1HA3A 2GEVA 3QF4A 4IRUB 2G3YA 2GXQA 3R7WA 5JBQA 2WICA 5AUNB 4JVMA 1H8EA 2C78A 5KSYA 3V4RA 3THXA 3EC2A 1PUJA 2AL7A 2REBA 3QXHA 4LYJA 3WMFA 1NJGA 4G1UC 1MABA 2WSMA 2QQ0A 3A1VA 4S35A 5L3SB 4IW3B 1KK1A 3L0IB 1P6XA 1YVDA 1SVSA 2YINC 4FMCF 3UMFA 3LA6A 3VR6A 2PT7A 3AGPA 1RFLA 4KAXA 2QT0A 2VHUA 2NOAA 4IVPA 5FI0B 3ZLJA 3FKSA 4EAQA 3TW8B 1WE2A 3OFNA 2Z5FA 3GQBA 2QY9A 3TVTA 2XZOA 3B1ZA 1XCPA 4KFUA 2IS4A 3IUYA 1M34E 1E9FA 1YZLA 3IEUA 5FBVB 3Q7QA 1UBGA 3ZIAD 3P20A 2R9VA 1TMKA 2ONKA 3FGNA 3UIEA 3SDZA 2GF9A 2J0UB 1GRQA 3Q3JB 4Z51A 5A0FA 2CJWA 2ZVPX 3SBEA 3MFYA 4KFRA 2CHVA 3RNLA 2NZJA 1IOZA 2B7BA 3ZVNA 3HJNA 4LJ5A 3TUZC 1CS4C 2WWIA 4JMPA 1XTJA 3GEHA 3KJEA 1FTNA 3V4FA 3U61B 1TU4A 4FWIB 3GLGB 5DISB 3THOA 1NLYA 1KJWA 1XRJA 4TN1A 3TQFA 2OUKA 2GXUA 1LV7A 3HYTA 1LS1A 2OBMA 4BFWA 4DSNA 3JZAA 4DCUA 1OH6A 3REGA 2RAPA 1ZNXA 4YLGA 1E9AA 1T3LA 3CB4A 4ZCIA 4C2TA 3BE4A 4LI0A 3KXLA 2W00A 3H0KA 2F1HA 3CWZA 3NEYA 3PEVA 3CRRA 3SU8A 1GM5A 3KJIA 2XZPA 4HEJA 1KO4A 1WA5A 1II9A 2O0KA 2IK8A 1G4UR 5H70A 1T5IA 4JS0A 5FR2A 4LY6A 1AKYA 1W46A 1JPNA 1GILA 4B2PA 4Q7KA 4DLYA 1GSIA 4TL8A 1AZSC 4LOAA 3NKVA 2G1JA 3BB3A 3PENA 1GKIA 2OV2A 4JBWA 4MUBA 3GLIE 2ZEJA 1OFUX 3VU9A 3SE0A 3L8ZA 1E96A 1Z0KA 2ZUDA 4WIAA 3C14C 5G3YA 1KSGA 1OW3B 1DTSA 1II0A 1ZC4A 2ORWA 2QG6A 5FTNA 1UF9A 1TU3A 4GPTA 4RZ2A 2GZDA 5TY0A 4TYYA 1ZCAA 1II8B 2IXEA 4G0NA 3HU3A 3GJ5A 4LHZA 4S2EA 1BMFD 5EP4A 3K0CC 4QGGA 3U6KA 4URUR 4QGAA 4GZMA 4OI4A 4XH9B 3BFXA 3V00A 721PA 2J87A 4UXJA 4RZ3A 4DCNA 1W2GA 2D7DA 4KITB 4R98A 1W0JA 1FUKA 2KB0A 3AEZA 3NTUA 5IT5A 4BASA 2WWGA 4LJ6A 2NO6A 3RS3A 1E2QA 1GNQA 1NP6A 3RRMA 1P7CA 4GRAA 3IDQA 2EQBA 3OIUA 3QNUA 5CIWA 4EJSC 4PTLA 4O25A 1JQLB 5LB2A 1K5GA 2N46A 2ZRLA 4TT3A 1DPFA 1KO8A 2ZXUA 1V5WA 4ZDJA 1SXJB 4MGYR 2W6ID 4EFNA 2EFHB 3RABA 1U8YA 3LBHA 1CEEA 5AJYA 3LDAA 5H1YA 3FHCB 2QBYA 2B92A 3KQUA 4LV5B 4HUQA 2BBSA 3K53A 4C0LA 2ZRHA 1K6MA 1J7KA 3F3YA 3EIHA 4GNKA 4M1KA 1PV4A 5L8VA 1N0VC 4MYUA 2AXNA 4PZLA 3ETLA 3GCGA 3C15C 2QAJA 1Z2CA 5FBWB 1DS6A 1TL7C 1CULC 2P6UA 4RSGA 3VR2A 1HQYE 1U0JA 4AG6A 1RRCA 4XD7D 1SVMA 3B60A 1ZM2A 1KMHA 4P4SA 2NO9A 2VEDA 1LF0A 1TTTA 3FMFA 1NJFA 4PQFA 4PAOA 2ZSBA 4Q1FA 3L43A 1H8HD 3GLFE 3MWKA 4NYIQ 4M9ZA 3ICEA 3M6AA 4M4SA 3OIWA 4MDEA 4URZR 4OJQA 2AK3A 3OFND 1W47A 1D9ZA 1UBCA 4BZQA 3IPYA 3BH7A 5FL7A 4BFYA 4AKIA 4NYMR 3G0HA 3X1YA 1DAFA 3PR1A 2ZROA 2J5XA 2IS2A 2FSGA 3K0SA 2QMEA 4OYHA 3CM0A 4V03A 4MRRA 1T4GA 4JLPA 4DDUA 4LGMA 4D81A 5JEDA 4C2UA 3V9PA 4US2R 1ZYUA 3HR7A 1EXMA 2QMUA 3LNCA 2VHQA 1ZNZA 4EFLA 4YMTA 1OYYA 1TEXA 4R2HA 4PR0A 1OT3A 1ZM9A 2ZU6A 3AVTA 2JLZA 1E2HA 1HE8B 1W44A 5FH9A 3I8SA 1FUUA 3AF0A 4Q9HA 2CK3A 4LDJA 4JLAA 4IDOA 4QM6A 2Q21A 2ZJ5A 4M9QA 3KXIA 4V0MA 1YE8A 1AM4D 1N6PA 2CNWA 2ZSFA 1NN1A 2HT6A 2F55A 1XNJA 1RW4A 1FQKA 4CYMA 5LBIA 4A15A 3CZQA 2AK2A 1MRSA 2QT1A 2Z43A 5DI3B 4HLDA 4NBSA 4LYFA 1Z0DA 2BCJQ 4WOPA 1A82A 5FPSA 4CW7A 2GNOA 1A5TA 5SZIA 3K70B 2R2AA 4H9GA 4P3YA 4QBGB 3QPWA 4KYUA 3LW7A 4KBGA 1ZP6A 1X8LA 3UG6A 2ZETA 1JB1A 4BFZA 4ZV4A 4KSBA 5CJ2A 1KSFX 2O8FB 2I3BA 2GEDA 4FN5A 3TVDA 2X2FA 4U7DA 3GLIB 3RSLA 3BAFA 4EPVA 3EZ6A 3EG5A 1Z0FA 3GD7A 5BW8A 1KYIA 1TEVA 2ZE8A 1S96A 2HYDA 1H65A 4URWR 4CEJA 4AKEA 4NPHA 2ZE5A 4QFMA 2IBMA 5IDVA 1OH5A 3SQXA 3GJ3A 3LX8A 2LWIA 1T0HB 2N1BA 3CONA 3EWAA 4IOKA 5F2EA 1CTQA 3FB4A 2QORA 3HU2A 1P3JA 3CRW1 3I3SR 1KI6A 2O8EA 4YMSA 1U8AA 2FGKA 3CRVA 2V3CC 1XFAA 3PUVA 2QAGB 1G18A 3RSOA 4NZYA 4FMBB 1RKBA 1PLJA 2CVFA 4IOJA 4KV9A 5SZHB 2QI9C 5GADl 4RD6A 4D2IA 1ELOA 5DN6D 3DOFA 3U44A 1W5TA 3QE0A 2JLWA 1UBFA 1VCNA 2WKRA 1LS6A 3SQWA 2IYLD 1JR3A 4JBYA 3L82B 3EX7C 3EPHA 1CRPA 1FQJA 1YRAA 4D6PA 2ZRPA 5DGXA 4Z8YA 5DI9A 3SJZA 3W5IA 1F2TB 4TT3D 2Q9AA 2JA1A 3T5GA 4HLUC 4WBSA 4XVQA 2ZJBA 1OXXK 3BS4A 4UJ3A 4BLSA 1P73A 2QPAA 1E9DA 2PLFA 3GJ4A 4F91B 4C0JA 3B1XA 2PZEA 4EPTA 2H1LA 5EUMA 5EE3A 4TYWA 2J45A 4JKYA 5AJZA 3C7KA 3GJ6A 3SI7A 2PL3A 4DIDA 4RD2A 4DZZA 3TKLA 3AF4A 5UKDA 1AZTA 3MG9A 1OYWA 2OLJA 3NVAA 4EQ6B 5JS7A 5LB4A 5KDOA 1FMLA 2P0EA 3PEYA 4DRZA 2EU8A 2FE4A 1R4AA 2JATA 4JJKA 2FEMA 2XX3A 3OAAA 1KI1A 4GI7A 3O8CA 4TQ9A 1GTVA 4B76A 1NN3A 1NMYA 2IYTA 4TSFA 4EKDA 4Q5IA 3Q7PA 1Z29A 3SYKA 4C7OB 5KSZA 3IQWA 3EASA 3VNUA 1MABB 4JIMA 3W8NA 2QENA 4AY2A 3HDTA 1Z28A 2WJHA 5J4KA 1FMJA 4LYHA 4M2LA 3GLFB 3I5YA 4M1WA 2QSZA 2XOKA 2H92A 1XMIA 1A4RA 4UQOA 1NI3A 4ACBA 2QGNA 4NCHA 5E7JA 1YKSA 2XJ9A 2F9LA 2WWYA 3BC1A 4EPWA 2IYSA 3OESA 1E2KA 2XTZA 3DL0A 3P4YA 1U0HC 2BM1A 2YV5A 1BS1A 1XX6A 3L2OB 4I1UA 4LK2A 5FR1A 1RC8A 3R8FA 3ZYCA 2HLDD 2AFHE 3BWDD 3BERA 2WMOB 4NCNA 4O2LA 3QOFA 3U6BA 4V0NA 3KQLA 1Z83A 4ZCMA 1GG2A 2REOA 3FFBA 3MJHA 2R6AA 4FMDB 2Q3HA 2AXPA 4Q18A 4U5XA 4RD0A 1KI2A 3VKGA 3RRZA 2WKPA 3OEEA 4Q1AA 1HY3A 4PC7A 1R5OA 1XZQA 1R7RA 1T8TA 2H7VA 2E87A 3OE7D 4DLXA 1FOEB 1SKYE 1L4UA 3AVQA 2KE5A 3PG5A 4POAA 1P2UA 4ZIRA 2A5YB 1S9HA 2XJ4A 1OKKA 5H68A 3WY9A 4KO8A 4PC1A 3B82A 5CK4A 3NG1A 1E0SA 1MR3F 3L0PA 2HCJB 3NC0C 2GILA 1P9RA 5JFGA 3RWMB 2ZJYA 2FPLA 2V55B 2Q0HA 4BGDA 1IXSB 1XDBA 4MGKR 1NG1A 1R0ZA 1ZD8A 5DO9A 1GIAA 2X2EA 3PV0A 4TLDA 1FNMA 3VAAA 1IY0A 3ZZ0A 2IX3A 2XEXA 1ZUHA 2DWOA 1E94E 2VBCA 2WSSD 2D2EA 1O3YA 2QE7A 6Q21A 1LTQA 3THYA 2BKEA 3QG1A 5L3QA 4Q4HB 4AURA 3AM1A 1TQ4A 1BO6A 3EPLA 5E3HA 1QVAA 4L9SA 4ESHA 4Z54A 4DEXA 2YZ2A 3OEHA 1E2DA 3CH4B 4CT5A 1DO2A 4R71A 1HT1E 3BORA 4OJKA 4PSAA 2HJGA 4RJLA 1MT0A 4M1OA 3OZXA 1EFTA 2A3RA 2NG1A 5EXXA 5JHGB 1WMSA 2H57A 4MKHA 2O8CB 2QNRA 1UEJA 3LVRE 4F93B 5DE3A 4NH0A 1P9NA 3BD9A 3BJIC 2GK7A 1T6NA 3H4MA 4B43A 2BEJA 1N6KA 1CF4A 3AVVA 2P5TB 1VTKA 1W4AA 1I4DD 1TUEA 2FZ4A 4C4PA 3SYNA 1G6OA 1R0YA 4QBFA 3UMRA 5ANRB 1UJ2A 1KK0A 1US8B 3DOEA 2CE7A 1GITA 1E9BA 1XTKA 3CF6R 5CB6A 2VRWA 4LBYA 1Z07A 1QHXA 1TQDA 1JR3D 4F4JA 1JI0A 3K70C 1QF9A 1EFCA 1W0KD 3MMPA 1ESMA 1U8ZA 3K1JA 3W3AA 2WPDD 5EE0A 3U7FB 2HJVA 3ZIAA 5TDHA 4CEIB 4I1OA 2A5GA 2GCOA 3PFIA 3T5DA 3U3JA 2AKYA 5K8UA 1UEIA 4PHGA 1UDXA 2G1KA 3O8BA 3CPHA 4JVLA 1IBRA 4NYMQ 3SJBA 5IF9A 1XXHE 4TQUS 4QJ3A 2DR3A 1Z6AA 2KSQA 1NLZA 3W34A 2PMKA 3WYGA 5BYJA 3FE2A 3CNOA 4KVAA 4LJYA 3AV0B 1CJMA 1HTWA 4LJ7A 4HB3A 1IJEA 4WZAE 3UWOA 3AVOA 1XMVA 5JI2E 3AGQA 3FHOA 1KDRA 3MLEA 2RCNA 3QBTA 2VSXA 3AKYA 1PJRA 2P5SA 1ZU4A 3KKOA 4PC2A 4ESVA 4DSOA 1KNXA 4H1UA 5H8WA 2H18A 4Q4JB 3SZRA 1ZD9A 3AVYA 4MA4A 1VIAA 3AUYA 4NYIR 5DLQC 1R10A 4UNSA 3LAWA 1XD8A 1NVVR 3IEVA 2JLQA 4N1AA 2O0HA 4PSKA 3TSWA 1P62B 5A4JA 4BLTA 4F92B 3ASYA 1Q21A 1F2UB 5J47A 3QJYA 1JPJA 2RGAA 1KO5A 4N0EA 2YC2C 2RHDA 1T91A 4TLAA 4JL8A 1VCIA 2WAXA 1VHTA 2XB4A 5EE5B 3AUXA 4DBLC 4RD4A 2IWRA 4I81A 3WNDA 1MO4A 3CLVA 1BOFA 1KHTA 4PAQA 1U99A 3QSYA 2K5UA 1E32A 2J0QA 1QHHB 4QJ5A 2OFXA 1G291 2WIAA 1QHYA 3CKLA 1OB2A 1ZCBA 4GL2A 3PVSA 1G3QA 5G40A 2JEOA 4FD2A 2Q3FA 3M1IA 4IEEA 1DAEA 3FYHA 1JQJC 3PITA 4NCKA 3GEIA 1N0UA 1E79D 3ZZTA 3FOZA 3C16C 2ZUCA 4D80A 3MJRA 3SHFA 1ZUIA 3NWJA 5AUOB 2GXSA 1RJ9A 2PCLA 5SZJA 2PZFA 1FP7A 2WJJA 4LX0A 3VR5A 2XITA 3SYLA 2EW1A 4UNRA 4M0LA 2FFHA 5B57C 5KSOA 1RE0A 3QKSB 4B73A 1RRPA 5KDDA 3EPJA 2WWWA 4RZXA 4CEHA 1SKYB 1FP6A 4NONA 2FSHA 5DIFA 3MCAA 1UBEA 4Q9KA 2GHIA 2VSFA 4RD3A 1DG1G 2V7QD 3NBFA 5JWOA 5KO2A 1G8PA 1U94A 4DCSA 1NN5A 2A7QA 3KKQA 2JJ8A 2PLRA 1G3RA 2ANBA 2JLRA 2QMOA 2IHBA 3DO6A 3M0EA 1R5NA 3VX4A 3WP0A 4NP6A 3T1TA 4KLNA 2IHYA 3I73A 3QXJA 4D4KA 2ZRBA 1BYUA 3OEHD 3NHAA 4ZI2A 2FJUA 5JI3E 4NTZA 1E9EA 1P61B 4XTCS 2OBLA 2ZJAA 1EX7A 1G41A 1UM8A 3F0TA 1C4OA 1P5ZB 3LRPA 2A5DA 3J81k 3K0AB 1EFRD 3VHXA 2IW3A 1Z6TA 4WZ6A 2H16A 4DSTA 1XD2B 3P4XA 3DVLA 1G19A 3E1SA 4XD7A 1YZUA 4KXFB 4OQFA 1XZPA 2OT3B 2RGGA 3VKWA 2WJYA 2VYFA 3IBGA 3FMIA 3RDPA 2A9KA 2IUTA 1XMJA 3LLUA 3I5XA 4MRSA 3EPKA 1OHHA 5DYGA 1I2DA 5D3MB 2H8KA 1H8HA 1KI6B 1JBKA 4M22A 4M21A 2O8EB 2F1RA 1OIVA 1NVWQ 3IBYA 1I2MA 2QP4A 4TL9A 4LHWA 2FWRA 1P9WA 3U44B 3RANA 1R8SA 1E3MA 3MGCA 2O8DB 5JLJA 2CCKA 1AQUA 2RGNA 1F6BA 2ZVQX 4IDPA 4ZDIA 1VCOA 4RCYA 1XWIA 2FOLA 1KDPA 1R6BX 4ZDKA 1Z6GA 3QY0A 1KKMA 2V4ZA 2GA8A 1D8TA 4TWZA 2ZE6A 1XD9A 3PQCA 3ADDA 1XXHB 1ZD1A 4I1VA 2GXAA 1TQ2A 4V0OA 2AN9A 4ZKDA 3I4LA 1M6NA 2ATXA 4Z8XA 2EVWX 2IYXA 4PO1A 4CRWB 1NL3A 2W2TA 4RVCA 4XTRA 1P2TA 3SC3A 4E03A 1Z2AA 1P72A 4G01B 4W5HA 3ZJYA 3HPRA 3FWYA 4OKSA 2BMDA 1IN4A 1FX0A 1OXTA 2BBOA 1L4YA 3K09A 2VP5A 2P6RA 2DFTA 3VKHA 5FTKA 2YJTD 2ZR0A 3CX7A 4GOJA 3U3OA 3WRXC 3LFUA 4B3DA 3AVXA 1KMQA 5CDFA 1IXRC 1VPLA 3ZS8A 2R44A 3U60B 4DLTA 1HV8A 3IIMA 5CLQA 4YMUA 4BPBA 2O8BB 4OHXA 1E2LA 4A36A 2ODWA 3MRSA 2DHRA 3U7GA 3AH8A 4H1VA 4HLCA 3K0EA 2OLKA 1G7TA 1ONBA 1E69A
chains in the Genus database with same CATH superfamily
3CX6A 2YWHA 4RKFA 4S1NA 1DIRA 2Y1KA 3QFHA 1WW2A 1R50A 3QE2A 3I9MA 2G8NA 521PA 1KQFA 3NDBB 3IX7A 1XU9A 2BN4A 2RH5A 3VYVA 1T9DA 4HXYA 2I7CA 4RPKA 1WDMA 2ZPTX 2PYDA 5CG2A 1DAGA 1UIMA 4ED9A 3M1LA 5BUSA 1ULUA 5IFLA 5GJCA 3CPEA 1FPMA 2BR3A 4FQ7A 3UPUA 3LJKA 2QOEA 2H0AA 2ZI9A 5GQSA 3ICCA 3K16A 3Q8KA 1K6XA 1HDZA 1UPTA 5JZVA 1M9NA 2IF2A 5KAMA 4EY7A 2IPMA 2JGDA 2Y93A 1GQFA 1ZINA 3PYLA 4AVYA 4E3ZA 2J6HA 1NBMD 4PRLA 3DM5A 3RTGA 1NJ1A 2AR7A 3GD5A 1LDBA 4AXXA 3ZHSA 2B5OA 3GRRA 4KRFA 4L5YA 3PWSA 2GM3A 2COEA 1R16A 2AFIE 3VGPA 4KIUA 3K6SB 3R8CA 2P9TA 4ICIA 2VPXA 5BORA 4RTSA 2CD9A 5CEEA 5CVJA 4UM9D 4QOGA 3STTA 4ZIRB 4P81A 1W4BA 2WMDA 1ADCA 1YR6A 2J3KA 4KVZA 2O1SA 4X71A 1C1DA 3ZWNA 1TVEA 3H8WA 5ALIA 1VB5A 3EVAA 4JT4A 5B3LA 2AHRA 1ISGA 2VDQB 2GA9A 5LQDA 2GB4A 2MYUA 4NSNA 5LZ9A 1KC1A 3M4JA 1LPOA 3GP5A 3HXPA 3JQAD 3O0DA 3EXHC 4RY2A 4BTVA 1FNSA 1HLDA 2ZB2A 3KKEA 4GG1A 3T1OA 3UKJA 4IHJA 1J9EA 3OICA 4OMFG 2QZ9A 2J32A 1CY7A 1P2FA 2Q5JA 3HU1A 3INGA 3G5UA 5TV2A 5HX7A 3WWDA 1AMNA 3WDMA 3EXIA 4XB2A 3TE6A 2XTNA 2Y1XA 2FDXA 5CW2A 4DJAA 3A3OA 2VRNA 1DCMA 1Z5ZA 1F8GA 3EDCA 1IXZA 2HJHA 3ZC3A 3AVUA 1X2EA 3KZCA 1B4DA 4PXSA 1G42A 2G36A 3ZUPA 2D3TA 1P2SA 2YW2A 3LMKA 4WESB 1BG6A 1NBWB 4ZCPA 2QUBA 1UXOA 1N36B 1OYOA 2CC2A 2BL4A 1TQ6A 4G5RA 4ZOEA 4RW0A 1R0SA 5A5GA 2GOYA 3EXAA 3A36A 4RACA 1X80A 3E1GA 4MV6A 5TS2A 4D8VA 7REQB 5L7WA 4Z0HO 2IOHA 1IK6A 1H94A 3PSAA 4UC0A 1X70A 4JUDX 3QNWA 3DMPA 5TS3A 1P7VA 1OHHD 4AKTA 3OJEA 4UTVA 4CTMA 1PGOA 1IMJA 3CUVA 4POOA 1UMBA 4RWZA 1DINA 3BF8A 3AHGA 4KVGA 3PC8A 5EMJA 2Q6TA 1MNAA 3LCVB 1DP4A 1SD5A 3HKBB 3VPGA 3S3TA 1ZWLA 4WBNB 1CV2A 1F14A 1V71A 2HD4A 2O2XA 4TZTA 3AU8A 3AJ8A 3U7RA 1PFGA 4EHJA 4AI6A 5JTUA 2QX6A 3AU9A 2LE0A 4ADSG 3JAMA 2YRFA 3EQ9A 2W6JD 4NDZA 4BNHA 3F71A 2B82A 3F9CA 2IE0A 3FUUA 3MS7A 2OXFA 1JU3A 2Z3WA 5DSTA 1CXZA 4HH0A 4Z4IA 1KRXA 1I6KA 5CMLA 2D06A 2FTKE 5ECWA 1RXEA 4G3XA 1F06A 4LPSA 1Q0UA 4ROTA 4FZ5A 2GVZC 4IS3A 4NV1A 3E9YA 4EJSA 5KJ1A 4O0LA 1Y8AA 4CODB 3IOYA 3CLKA 2C8LA 3UYKA 3ZDQA 1T3GA 3B51X 3CEAA 2JCSA 1U2ZA 1Z0JA 2ODEA 2C7PA 1Z06A 3D6FA 2YQZA 5HRAA 1HYGA 3BWBA 2BMFA 3I6YA 1LBTA 3D8TA 3EBPA 5BY2A 5MDHA 1MH1A 4R1MA 3GT3A 1FDTA 4QKQA 2PWYA 4OQMA 3OE7A 1RMYA 5EXPA 4OIFA 3PXGA 5HP4A 3U4AA 3GT7A 2N42A 1IHYA 5HUQA 1J0AA 2YW9A 3P96A 5DHTA 3BMQA 3DE7X 2XLBA 4JB0A 5ALLA 3FDFA 2OGUA 2IYUA 3ENVA 4RELA 2IZ5A 2ZS9A 1FFWA 1M33A 1Q0PA 2A0YA 2ORYA 4JOCA 5K3FB 1NI4A 3H3FA 1C4WA 1DDOA 2DWUA 2GTHA 3WYAA 5L9AA 1IB0A 2ECOA 2JGJA 3F3SA 1XCLA 2ZIWB 4IICA 4F8EA 1XDSA 5KU7A 1UZMA 2BKUA 3GARA 3VX3A 1M2KA 4LWZA 1XPUA 1QE5A 5JRDS 1CQXA 5I7SA 3K1ZA 4MA5A 4ENWA 5C4GB 3OOWA 3OKFA 3ZGNA 1DJLA 3ETJA 5C34B 2BVNA 4LHVA 4PZCA 2DLDA 3AFMA 2YV2A 3N87A 1PGJA 4YONB 4ZVQA 3WGIA 2WP8J 5IZCC 3DMTC 1M3SA 2I2DA 3ED5A 1M1XB 2AMFA 4PS1A 4S3MA 3ZQUA 3FGPA 2CLFB 2FW7A 3K8ZA 3B70A 3MB5A 1DBIA 1ZD5A 2Q5EA 1VE5A 3QVKA 4D0RA 5JJ5A 2VP9A 3FMPB 1HKHA 1SIOA 4J7XA 3A2LA 3T7DA 4ND8A 5ITZA 3BKWA 4ODIA 3TQTA 2O14A 3B6MA 5C7OO 4O4JA 4EMBA 4F84A 1OWLA 3ICQB 3H1GA 1EE2A 4I5GA 5CB8A 1O4VA 4D5EA 2CL7X 2FPWA 2ZSUA 3FSRA 2GO1A 2ZUVA 3IKMB 3KPVA 3N5KA 1KPIA 4FR0A 4TLBA 4DUGD 3WFJA 4M53A 1PQ4A 4O4LA 2HIHA 1P9LA 1GL9B 1Q0SA 2DPHA 1UBMS 1SCNE 1SIWA 1ZGCA 3SHTA 1TA0A 1FSPA 1YQTA 3EUAA 1BA3A 2JRCA 4FONA 2NZ8A 3IKLA 1UKVY 1ACLA 2AT1A 3EZFA 1DQYA 2BEUB 3NYWA 3R5TA 4KXUA 1H1LA 1L2TA 3F49S 2QN7A 4X1YB 4KO1S 4X44A 4BATA 5LD2B 1T9CA 3LPAA 3VZQA 5KHOC 2A59A 3SF8B 5LLDA 1AHNA 1S8FA 2F9MA 2JCBA 1W0KA 5JZSA 1RP1A 2Z3VA 5GJVC 2O7QA 3PQ8A 1GNTA 4LJ9A 5B3AA 1YGPA 3RCBA 5IRCD 3DLBA 1QH1A 4WCFC 2N3ZA 3B2NA 1LTHR 3KSBC 3M6MD 1H4TA 1P7YA 1XLTC 5BR7A 4DA4A 1KQNA 5FWXA 5K4HA 3ROXA 1DJPA 5ES3A 2CN1A 5C7YA 4Q3OA 2OL4A 1XHLA 1E4EB 1U11A 3RAJA 1EDBA 3TEMA 3WICA 2EX0A 1L4KA 2I7XA 3KIPA 3P5BA 3M9WA 1FBTA 1A50B 4JJ8A 5EHXA 3AEKA 4NBUA 1HQCA 3DE2X 4MQFB 4X54A 3P9RA 3V8QA 5HQTA 4XFKA 3ZGZA 4MVJP 4IDGA 4C3ZA 2RHRA 2QLNA 1EXDA 3ODGA 2FSVA 2QR3A 3BE6A 3HXLA 2QSUA 3BMOA 4UHDA 1M6EX 2ZR7A 3WIBA 4B48A 1MKYA 2EIXA 4C6RA 2JZCA 1PN3A 5BV0A 3AB8A 3CUYA 1RYZA 1B16A 2NTEA 3FZNA 3D8BA 3HP1A 2P4HX 1N78A 4RQUA 1ZGZA 1JDTA 1N34B 3ZEIA 3KSAC 2FF7A 5JTTA 4OSPA 4F9TA 1JYEA 1USVA 1JKXA 2A9VA 4HATA 2C9CA 4KGVA 4L5BA 5EA2A 3JD2A 5AVJA 2ZI6A 1K8YB 1JKFA 3B38A 5IZCA 3IOEA 1U3VA 2ASEA 2I1QA 4TTQA 3W5HA 4P7KA 2COUA 1E1CA 4URFA 4AU1A 4E5KA 2ODTX 2JHPA 2PD3A 2B37A 3THXB 2VQEB 3GLGA 5CM9C 2GFIA 4TKZA 1UPCA 4DZRA 3Q5DA 4BNXA 3N2LA 4GR4A 2DM6A 1OLUB 4ZCRA 2I91A 2UZ4A 3Q85A 4UDNA 4TV8B 1YFJA 1EVIA 4DMCA 3SC4A 1TO1E 2CMFA 2UZIR 4WLFA 1I3KA 5EZSA 3CUUA 4JXZA 4CMGA 1BE1A 1LDYA 1C7QA 4PQYA 1PYDA 4FU0A 4B6QA 2HF2A 4EFMA 3NALA 1EKXA 1NRJB 1O7JA 2J1LA 5KOIA 1GZVA 1XKLA 5DYWA 2AYZA 4BLQA 1Z4IA 1IHPA 4JYCA 4XWOA 1T24A 5IK2D 5JIBA 1IAQA 2X41A 1G16A 1VJDA 3MF4A 1KYWA 4JI8B 4DUYB 4PLPA 2V74B 5JPCA 3FCXA 3R7AA 4GGOA 1CZOA 1Q91A 3U40A 4JX8A 2CUZA 1JT2A 4WCFA 2PQMA 3W3ZB 2ZJ8A 4CIVA 2G9ZA 4ZOQI 3GUHA 3WGUA 3PWZA 4FMCB 4YRGA 1KH3A 1CUXA 3KZMA 3AIKA 5HKOA 3TLXA 1D9XA 3WYFA 1XQXA 2GFQA 4XQEA 2RAVA 1KDOA 1I7PA 1QG0A 4GHWA 2EGHA 1DC3A 4Q02A 4Z3OA 4NC9A 3PLNA 1Q7GA 2Z9CA 2BZ1A 1U2RA 3C70A 5EERA 3IS3A 1KK2A 5EMLA 4EQZA 2QN6A 1QTQA 2Q5OA 2BCEA 1CETA 3A0UA 4NCJA 4FIZA 5I4BA 3F3MA 3KL2A 4Y7DA 1ZIDA 1H5UA 4EUNA 5FFNA 3ZHXA 4EA8A 2KBFA 1MHTA 3CE6A 2ZP1A 3FVVA 2O9JA 2YNMD 4K9KA 4G0UA 5LQMA 4CMJA 5PGMA 3SS7X 1H4SA 5JARA 4FHDA 4FXOA 4IG9A 3QPUA 1L5HB 1G5FA 3GHHA 3N7AA 1E5TA 4BBZA 3VOAA 2PAFA 3JATA 2JCVA 2HPVA 4ETWA 4EOGA 5J4LA 2J3HA 1BRTA 1NUQA 1G20E 3UTCA 1FU8A 4G41A 3K6KA 1L3BA 4TKVA 1UFQA 3H2BA 4R2LA 1JHQA 3E8MA 5J3JA 4NFHA 2JIZA 3PPYA 4ZGBA 1A9SA 1GUYA 1JA0A 3N0WA 4L15A 1Z6XA 4ZTUB 1XFDA 3LZ6A 4TL7A 1ISSA 4GVLA 4CKCA 4DVGA 3D4NA 4GXRA 2QRGA 4B8YA 1RPNA 4FEAA 3EVTA 2CFRA 4MV5A 3C41J 4GWKA 2GBLC 3WYCA 3JYOA 1HDGO 4QPCA 2HZBA 2NVWA 4IG4A 4U7JA 2LR0A 3NWEA 4DXAA 2QRQA 3FNRA 3I1IA 3I92A 4ZYYA 1EFRA 4P3OA 4C06A 3T5MA 3KJGA 1U2SA 3GN1A 2JAXA 1DXYA 1X2BA 3NX4A 4NPCA 1ZI9A 5AM5A 3IMCA 1KI9A 1PLLA 1S1CA 3E9ZA 1OX4B 4I1IA 1PZGA 1P1HA 4U3JA 3RS9A 3LHIA 2LXNA 3A26A 2QNIA 2I34A 4DWJA 3CVXA 2ODNA 5FEUA 1F4VA 2HSZA 4PX5A 3V48A 3ELYA 2YTZA 1DUIA 2CUKA 4O4HA 2F8SA 4N3GA 1E3LA 2XMBA 1DV1A 5JBNA 1N7JA 2ZUBA 3PIRA 2WQZA 4ABYA 3E3OA 1THZA 2AKAB 1O95C 2QM7A 1VKJA 3JQ9C 1IPHA 1SC1A 2E7ZA 1OX5A 4QL3A 4UHFA 1COZA 3K0HA 1JR3E 1X15A 3H2KA 3JQGA 4H3HB 3N2GA 3ZWOA 1G21B 5LXTA 2OV8A 3CUSA 1U81A 2IF0A 1B41A 1AA6A 4REMA 5DLDA 1L7AA 1KI3A 4YXWA 3W9UA 2EEPA 3NT4A 3NUGA 1JL3A 1URPA 3WZ2A 3VAYA 1SOUA 4KHZA 3GRFA 3ZWXA 4BDTA 1B8UA 2Q1YA 5B7QA 5H4GA 3RNOA 1QK3A 3D4IA 3VR3A 3DW1X 3LM8A 4H7FA 4BFXA 3SHVA 2HBZA 3L46A 1IQUA 4IIVA 1T29A 1PG0A 2WVGA 3DONA 4RDHA 2IUYA 4FYIA 2EQAA 5HDBB 4JELA 2UVQA 1H3NA 1JJ7A 4WLEA 2XNDD 2NVUB 5HUHA 3N5CA 2NU6A 1B6TA 1SVWA 3QFCA 4S1OA 2QAGC 3PX3A 2OSBA 4Z1MD 3A1TA 3IVCA 3B53X 4RNDB 2QZZA 1U0TA 3TW4A 1EVZA 5JHHB 3VQTA 1IEWA 2YJ3A 4TMFA 3FUXA 4KRGA 2WJVA 1AK2A 2EG9A 2ZAIA 5BSGA 5IN4A 2H3EA 4CLRA 1ODSA 4Z0TA 2JGEA 1N2CB 2ZE7A 3ZE2B 1VKHA 4RSRA 1RWQA 3E2PA 3T3MB 3UCXA 3PIIA 4AKSA 3EMBA 5AVQA 3BH0A 2VJOA 5LP6B 4B7UA 1U9IC 1POWA 3KOXA 4N76A 3D6NB 1MUUA 1SBYA 1LD3A 1UMDA 1KMHB 3QWIA 3ZK7A 4P4SB 4AB1A 4BOYA 1NVUQ 2R1VB 4RMHA 5JQGB 1IN7A 1PVVA 2IOQA 4CKBB 3MSCA 3HQ4O 3ZUGA 4F3CA 5KWJA 1MJNA 4L8GA 5IULC 1DC6A 2RHWA 3ILYA 1OA1A 4U2BA 4DZTA 2FW1A 3OFKA 2X6QA 2Y1GA 5CFPA 4UQLA 2V4MA 2FPKA 1GSOA 4E51A 2K7ZA 4E2YA 1FZQA 1PJCA 4LMRA 4QUEA 3ZNOA 1QAQA 4UCFA 2OZEA 3BWEA 2WFZA 4C2BA 4DC9A 5IJ9A 3C3BA 4EYSA 3CEJA 5IVKA 3PZRA 3FRJA 2OA0A 1ZOOA 1EZ1A 4YRJA 1JJBA 5JAPA 2X0RA 4X91A 3RLFA 3UMYA 3N1UA 2H1CA 1V3QE 1WXHA 2QJTA 3OTWA 4P36A 4YR7A 1PBTA 5TGZA 1R4NB 4EW1A 3DE1X 1F38A 3SQNA 2E9SA 3BTOA 2BCGY 2FMUA 1RQRA 3IYLW 2V1UA 4KC0A 3MYYA 1ABBA 4DRXB 1FIUA 1Y89A 1PI3A 3PX2A 3UXYA 4ASUD 1E1QA 1L5OA 1SUIA 2IE8A 4BNGA 1KY3A 1ZJ5A 1JH8A 5JS6A 2IEAA 2ZBGA 4NFSA 4UBMA 3EEYA 4GSYA 2OBNA 3BXPA 3AK4A 5J1SB 2WKSA 4B3FX 2WIBA 2FXVA 2V6IA 4I36A 4EG3A 3EHDA 2FFBA 1H5QA 1S2IA 4IIEA 5LBUA 4XQ0A 2ZTMA 3DVAB 3NBQA 3MAJA 2GKSA 4US0R 4BZWA 4EPXA 3B3JA 4YV7A 2ZT7A 1VLLA 5AQ1A 3WMXA 3N2EA 1JEDA 1ZIOA 2R7LA 4ALLA 5M2QA 4ZALA 2NSLA 1QHNA 5LYJF 3OO0A 4UMVA 4FCWA 1B26A 1ZW6A 3E9CA 2WB4A 1F60A 1Z7GA 5SY6A 1ETHA 3I45A 4UVIA 1DHTA 2PA0A 3KWMA 2EDAA 4BNFA 3T1QA 5JD5A 1Y9DA 2VHYA 3P9PA 4LHYA 2BEVA 4RXTA 5TMEA 1MO6A 3X2FA 4Q9LA 4DJFC 2PKQP 4ZMRA 2VQSA 2BFAA 5IVIA 4X1KA 1ZL0A 2II6A 2IYWA 2YFQA 1RADA 3N75A 3ZE7A 3F9RA 2EL7A 3DDCA 1KQOA 1N1EA 1BE8A 4U6NA 3O83A 3G0BA 2ZKLA 3ORYA 4GMGA 4NQZA 4UEQA 1BJRE 1L5YA 4WGFA 3WA6A 4P0TA 4HGRA 3N39C 2E2WA 1WCXA 4GE0A 1W5SA 5EJAA 2DWQA 2QQ5A 2HO5A 2N47A 3QVUA 2PNJA 1X0VA 1ZAKA 2IYZA 5DTIA 5GVSA 5C51B 3ADOA 2XXAB 4HRYA 3NYQA 4HRXA 3UCFA 3P32A 4BLRA 4UOZA 3MTGA 5FTLA 4CEJB 1LV8A 4RM3A 4N6NA 4EQ6A 4HS9A 1OTXA 1SJ9A 1GGKA 2Q41A 3JASA 3NRCA 4R8VA 3T15A 2J30A 3ANNA 1KMNA 5AJXA 5ENZA 1NMZA 4HEHA 4KN5A 1W1WA 5F2KA 3PJRA 1U3UA 1N9ZA 1QG2A 3E7FA 4W5QA 1YV9A 3A6GA 4EMTA 1K68A 2PMBA 2E4XA 4QOEA 3JZDA 3D6TB 3MBIA 3LV8A 4KCGA 3JAWA 3STXA 4M6WB 5IJAA 5LL6P 3M3PA 4ECEA 4H08A 3AEUB 3IE0A 7ADHA 2WV9A 5A71A 3CNLA 3FD8A 4GFDA 2GCPA 4FMDF 1Q1BA 3VSEA 4YDHB 3GLFA 5CPFA 5C80A 1H0HA 3UWSA 2MDTA 4DV2B 2VJMA 1FP4A 2XE8A 4R0NA 4XCVA 2B4YA 3MWLA 4D44A 3N76A 1HL3A 1EZZA 3AY6A 2RMKA 3GFGA 1YR3A 1ISPA 1U0FA 3DXYA 2HCTA 2AOTA 4KXNA 1I32A 3EAGA 2Q1SA 5BVGA 5HGJA 3VJRA 3ZGXA 2WSLA 1ZGJA 4RVNA 4Q9IA 2WZQA 2BEWB 3KVRA 2Z8XA 2ZI3A 4OP1A 4QJBA 4MEJA 5BSVA 4JR0A 2CHEA 2BKAA 1MENA 2R6GA 4OJTA 4LY9A 4EK9A 4A9AA 2J7PA 1E18A 2KJQA 4NV3A 3GLVA 3LVFO 5ARDA 1Y4ZA 1V45E 1GZ3A 1NF3A 1X14A 2A4MA 3QI2A 4P58A 1CY0A 3A31A 2WUEA 4E08A 4H0CA 2HPZA 2K2WA 1U0LA 5ALSA 5HRCA 3LYUA 3QPVA 1MB9A 4QRHA 2A8YA 4WFKA 1WD7A 4J8PA 3Q72A 4P22A 4HTFB 4TXJA 4PIMA 4ZEWA 3AR5A 2C5LA 1UBRS 2GM4A 2OCYC 4P0PB 5AK0A 5FUBA 2NNLD 2FPSA 3CU5A 5B2EA 4DCMA 2CHUA 4V1CB 3DDOA 1OVGA 4N39A 3M6WA 3RHSA 2ZYRA 4XWKA 1EXVA 4U2DA 1C8KA 4ER3A 3WQRA 2RHCA 4BNUA 3P9KA 1FQOA 5ECYA 4YT8A 2LIVA 3I2KA 3T5PA 1E2NA 3JVUA 2HWXA 3L0BA 3OCYA 4WLNA 4D4MA 1V43A 4DB4A 3S5JA 1C3JA 4QOFA 2V5VA 4HWRA 4A1OA 4GW3A 4ILEA 3IUNA 4IZIA 4WXHA 3AXTA 3TMKA 1QANA 2WTBA 3LY7A 1Y1LA 2LPMA 1EJ6A 4N0MA 4Q4HA 2ZJ3A 3A32A 4PXYA 2FN4A 4ZOBA 2V03A 4IIJF 4Z7NB 3DOUA 5CFLA 2P4EA 5ICSA 1S7GA 1PT7A 1I9CA 1R5BA 3E2IA 4D45A 1C1YA 4NKRA 5SYMA 2BFWA 1DTEA 3J80A 4DV3B 2ECPA 1U80A 3DEKA 4J1NA 3FBWA 2QIOA 2A5JA 3PGKA 3OWHA 2JJ1A 3C3MA 1TE2A 3PHGA 2OHFA 1NIPA 2A1IA 2R6DA 2ZR8A 1ZU5A 4FE4A 4ME6A 1BW9B 3OPVA 5EEGA 3MXOA 5HKKD 1KVTA 1TFUA 3QPDA 1F8UA 2H52A 1L6RA 3WP1B 5JCPA 4L2IB 1B8OA 2D2VA 2RH8A 2AR9A 4CIDA 4EF4A 5ALXA 4Y2YA 5EXSA 1T8WA 4DMHA 1QVRA 3GJ7A 4MW2A 4PAWA 3RAPR 3FB1A 3AY7A 4WASA 2PX4A 1R8XA 3H16A 2I62A 3CNNA 5B1IA 3U1TA 3NRBA 1I5OA 2G9RA 3R7BA 2ZJ0A 1JJIA 4R0MA 3SICE 5BSFA 3FYTA 3LTNC 1PTJC 2ICAA 3T7RA 5B12A 1WQ4A 1WRBA 1W73A 5LDDC 4NBNA 3JY6A 3EFOA 2ZDGA 3PU6A 3UCEA 1NQVA 3DMYA 3GDHA 3P1JA 4MS1A 4ZWNA 3L7BA 3D1JA 3LF2A 1A9ZA 2I4LA 3E0XA 5ALMA 1TC2A 2GDZA 1UP6A 2A5FA 2JBAA 2ZAGA 4CZ2A 2IS6A 1T35A 3A6ZA 3K4PA 4LOLA 3TW6A 1PT6A 2BMEA 2Z98A 2X42A 5GZ6A 4PHCA 2HMVA 4LF4B 3MW8A 4TMTA 5BQ5A 1TJ3A 3ZWQA 1CYDA 3KEFA 1QE3A 13PKA 1TCBA 4J29A 3HKDB 4F56A 1I2ZA 1EZ4A 5JSZA 1WXIA 3FMGA 1P39A 2AJTA 3OD5A 4OAPA 4PHHA 1CK4A 4CM3A 2XNHA 5K0GA 1O6BA 1GXSB 2HAEA 2I66A 4LDZA 4WK0B 3Q88A 2HRDA 2GTPA 1LK0A 1UK6A 3PXBA 5SYNA 3OM0A 1E0KA 3OLXA 4B6GA 3B3FA 2WQ7A 1B0PA 2OD7A 4BKPA 2JVJA 4XOUA 3QXCA 4YQEA 4GRIA 1G59A 1RM5A 1R0RE 1SWVA 3NTOA 4FDTA 1ZZGA 3DEHA 4UTZA 3ZWDA 5IYZB 2HR1A 3NEAA 3QIAA 4Q34A 2PBRA 2XVZA 1JF8A 2BFDB 2PRSA 4NHOA 4NF2A 4MCJA 1WB9A 2YN2A 4LZNA 2Q2QA 1FTSA 3Q7SA 4LXIA 1H8ED 1YHNA 3U0VA 5AVSA 5CIQA 2BHNA 3NDJA 2P4UA 3CKKA 5CXSA 4QPNA 2GK4A 5DYIA 3Q6IA 3SVLA 4YWHA 3FLAA 2EYQA 5BNFA 2YVQA 4WOJA 3B1VA 3TM5A 3HL0A 4N4AA 3U3MA 4OHZA 1F2UA 1LUAA 5BW5A 9LDTA 4D25A 1JFFA 3GGCA 2FH5B 5EIFA 1AUOA 3F78A 4KBFA 4GLJA 5JZOA 1A69A 3CW2A 1SBTA 221PA 4HWSA 2RI0A 2WILA 3EGVA 4RM2A 1C4XA 1JDJA 2NACA 5CDUA 1EM8B 2IXTA 1UZLA 1PTJA 4A0GA 3TLYA 1SPBS 5L6LB 2FCAA 1TEHA 1QHHA 3C6BA 3HUUA 5G4LA 3GIWA 4XIJA 4LJ4A 3TRIA 2PS0A 2H0QA 4A23A 1SC9A 3WKCA 4F6LA 4B87A 3K35A 4PN3A 1L3CA 1CNEA 4YB8A 5BN3A 5EYPA 4EO7A 2Y71A 4NS1A 2JLUA 1ZM3A 3GLTA 3DBRB 5AK5A 3E58A 4DMMA 2Q99A 1JT9A 5IDXA 4TUYF 4X20B 5DTRA 2IYNA 3KJQA 5F51A 3U9SA 2F3SA 4R2MA 5DCYA 3BK7A 1QG6A 5J2TF 1DQSA 1N8SA 4EUSA 2EGGA 1XZHA 3EMVA 2H17A 3HYNA 3NIBA 3QKSA 4PQRA 1V2HE 3MIZA 3SEAA 5HPYB 2EV9A 1WV1A 2GCGA 3HY4A 3DEFA 4JUBA 5CDFE 3KYIB 3WRVA 3GR6A 1DAIA 5EZYA 3WBFA 3UWKA 1CRQA 3OU7A 3WLRA 1FS6A 3OJWA 4E5UA 2Z1DA 2B8WA 4UXIA 5AVZA 4OX9B 3V6LA 5I9LA 1F9AA 2MT9A 3K9LA 2ZIAA 1I14A 4UTXA 4WLOA 1VMAA 3CH7A 4BVFA 5IJZA 5LA6F 5FX2A 3PPXA 5JXGA 3DL4A 1BN6A 1D2GA 1ZO8A 3QW2A 1T9KA 2I03A 2HEIA 1TW3A 3OKPA 3T1VA 3WNVA 1YB5A 4NECA 4AYXA 3O82A 3B9QA 1YZVA 2QHXA 3KOMA 4R05A 1FVXA 1OOEA 1YMQA 2QN3A 5CCXA 3BSYA 2FFJA 1E1RA 1UUFA 3I1JA 4JA2A 5D85A 3ND5A 4FZ3A 4HLNA 2CV0A 3ACDA 4LFCB 1ZIYA 5FHQA 1P4SA 2INGX 3H2SA 1J39A 1WLYA 3AB7A 3NBXX 2WHEA 5CLLA 2ZBUA 3C3PA 3EZGA 4IDHA 5DRYA 4C0BA 5KQLA 1XP5A 2ONYA 3A04A 2APJA 4N3BA 1T9BA 4XJSA 2XKAA 3DR5A 3PI7A 4ZODA 3VTKA 4EKGA 2AVNA 2Z8ZA 3LO5A 4F1JA 3B2EA 5K0SA 2LUOA 1NDUA 1U8FO 1GV1A 5C7LO 5CJJA 1E3IA 2XUHA 4RCVA 2NXWA 1RJ9B 1UDAA 1WMBA 1YU6A 3NP7A 4M49A 2F9FA 4RAQA 1Z0UA 4MICA 1W48A 3NJ4A 4GDMA 1K88A 4MDYA 1WDWB 1T3HA 3BSFA 5JMWA 4BNDB 3NHRA 4YEDA 1OLOA 5B37A 1YACA 4B3MB 1LWOA 2LVBA 2IS1A 2OPBA 5TC4A 3CTPA 1Y6ZA 1IM2A 3A6FA 2YX1A 3IO3A 4LUCA 4DILA 2ZWPA 5JANA 1W8DA 5JAUA 2YV3A 1MIOA 2QTTA 3IO5A 4F5YA 1JWAB 4MR9A 2OO3A 1U0OC 2FN3A 1DLIA 2BDTA 3QQPA 5E4FA 2I6XA 4KG7A 4PYQA 3L6UA 1W0JD 5D5PA 3WV5A 1CBUA 2FF5A 2VG8A 4YFYA 2QRVB 2G4CA 2GBGA 3GJYA 5BMVF 3FNHA 3ROMA 4NVRA 4Q48A 1WCYA 1GGMA 3QNMA 4Y1RB 2OKCA 5I01A 3V1UA 1FS4A 1RRKA 1U5AA 1C7IA 3GUUA 4BNKA 1I36A 1X7XA 4IKEA 5A5DA 4IYRA 3ZDAA 4HNRA 1PW5A 1OFHA 3KKKA 4WKOA 5KPDA 4YAUA 3N3BC 4GYJA 4ZVSA 1YD7A 1XLUA 2YS7A 4GX2A 1OLXA 3KEMA 3AKEA 2NU9A 5G0TA 4MRAA 1KZ4A 2MJLA 1SAYA 2JDIA 2C9OA 4AF7A 1EBBA 2A0KA 5A2QA 1XXHA 2ZT5A 4F71A 4AM8A 1W85A 3PCRB 1GD1O 2A5LA 3QIVA 3P97A 2GEUA 1R4MB 1N6OA 5KNBA 4ONEA 4C0WA 3DHYA 4WEOA 2FMTA 1X1SA 4LS3A 2PRIA 4QBIA 1MT3A 3HJBA 1QKJA 4GM4A 3OWXA 5M3BA 1MVLA 3WIEA 2QZ4A 4ENVA 3BGSA 3G23A 4BZXA 1BEZA 3FI0A 1EGAA 2FDRA 4DNOA 1YR2A 5CNJA 4DCVA 1I01A 1SXPA 2IUUA 2NXNA 4B4WA 3EA0A 3ANSA 1RCFA 1UL1X 1YBFA 3VR2D 1P19A 3FDJA 4MR8A 2PEYA 1X7DA 5LFAA 1MAUA 4Y1FA 4U39A 1Z6QA 3NWOA 1K5PA 5CEFA 5IAOA 4RFLA 4XR9A 1RPTA 3Q1KA 2Y3IA 1TB4A 1JHMA 1Y4UA 1TO2E 3LUFA 1S4MA 3TPFA 3WLPA 4EL5A 4Q03A 5BW6B 1T9HA 1N0IA 3BMNB 5GONA 4P7GA 1M2VA 1N1MA 1UOOA 3TH5A 3ENQA 1E64A 1FFDA 2ZDQA 4MCIA 3JQRA 4HXEB 4N5NA 1TCUA 3SSOA 1M6HA 3PCTA 3FTQA 2Q1WA 5CA1F 4PG4A 4CDRA 4IRMA 1DDIA 4REQA 1P5JA 2MSCB 3PKZA 3TQCA 3EVDA 3PGJA 5LNK1 3VSCA 2R3SA 4Q9JA 2ZI5A 3NUZA 3VNQA 2DE0X 3OIYA 4RTOA 3DMFA 4XM1A 5FL7D 4LDQA 5H16A 1XYGA 4IRXA 3BK2A 4MVJG 4OQQA 3I8XA 3OQIA 4H4CA 5HK9A 1Y9JA 2ZUTA 3HWWA 4P2GA 3PC3A 3FKJA 4DQDA 3RYTC 3CX8A 2VJBA 2ZRCA 2WINI 5KJCA 2XCIA 3DKVA 4H7KA 5F3WB 1LW7A 2PJZA 4WXEA 5IM5A 2D1FA 3ND8A 4PINA 4AX4A 3SAJA 2ZAMA 1NR1A 1V5IA 2CLCX 5DGHA 2AI1A 1FX0B 3HRKA 3HP4A 3JX9A 1QQTA 2ZTLA 4G86A 4NZMA 3C43A 3H4IA 3LH5A 5EP1A 4BEBA 3RKUA 1ID8A 5BSEA 2HGZA 2C4HA 4QYWA 3TKYA 3UB4A 3HDHA 4C0KA 2B69A 4QYXA 1XC7A 2HSWA 1OJLA 4A6XA 2VHEA 1IVYA 4B35A 4MB2A 2JKZA 4BNWA 5GOTA 2NUTB 4MI6A 2QJWA 4EFKA 1XVAA 1QUEA 5FPKA 4I1SA 4GF5A 3DLTA 2EXXA 1U9ZA 2GAIA 4EHKA 2CNWD 2DAPA 1HDCA 4MGIR 1FSFA 2P62A 5JVDB 3C4JA 1RYHA 2DKNA 4URVR 1UPBA 2QN8A 1RIIA 3IDFA 3JALB 4GX0A 1BN7A 2QTHA 4V0SA 3A3NA 2BTEA 2JJ2D 3IH5A 1IHOA 2J48A 5DLEA 3HB9A 4L4YA 4AZ3A 4YDSA 1DX9A 1X86B 2JGRA 3C3WA 3EH2A 5E9QA 3RODA 3V4PB 4EB3A 1AB6A 2IPOA 5CJPA 4O29A 5ALFA 2GZAA 4EIWA 5JNTA 1ZN9A 4EG6A 2FJPA 1M6VA 1H2AS 2C03A 3CN9A 3DBOB 3EZ2A 3KR2A 4Q3AA 3T35A 4AO6A 5KTNA 4XLTA 2DUMA 2IYQA 4YJHA 3FNBA 2XDAA 4PG7A 4WSOA 4C29A 1DC7A 2B7CA 2OZVA 2CLEB 4QDKA 1XCJA 3NRJA 2WVJA 1HKUA 2KPOA 4ON9A 4XM2A 5KNDH 3RUEA 1TYEB 2HHHB 2YWFA 3S70A 1JECA 1MDBA 5D5QA 2LDXA 2PQ0A 3KVYA 3OH8A 4Y6RA 4HPJB 2Q3MA 4HMOA 4W7HA 4G63A 5DKFA 1QU3A 3HFRA 4DHEA 3F6YA 3OZCA 5B1HA 1KJJA 2JGDB 4MWOA 3T7IA 4C21A 2VJCA 5C5CA 2QRPA 5DV9A 1NBIA 1L1RA 3WZLA 2FN8A 2ZRAA 4YT4A 1Z8HA 3A7DA 2I78A 4QEKA 1TYBE 1K0FA 3A4TA 1DB3A 4P38A 3WGGA 4IVRA 4QYIB 1WHTB 2EZTA 2QRNA 3MJFA 3V7NA 1EHIA 1JLMA 1T4BA 2PBLA 1VHJA 4OQPA 3ZV4A 4I9NA 5AP9A 1RNLA 3VUEA 2QUHA 4BO3A 1YQWA 1C1DB 3HXTA 1D2MA 2XB8A 4F5ZA 2IU0A 3U4IA 5E0KB 1GNVA 3BK1A 1VLQA 2A35A 1C8BA 2H2IA 3N53A 4XLZA 5FI5A 1Z5GA 4OI1A 2IOYA 5CEJA 1OH8A 4XVRA 5EUBA 1C3EA 3BZWA 1IY1A 3WYEA 4WEQA 2Q3LA 2GASA 1VI5A 2QSYA 4CV0A 1I7QB 1RFGE 1IPEA 1Y1KE 3KQHA 1W4CA 2PFGA 2YBEA 3LX6A 4M86A 3A6PC 3G8DA 1NBEA 4C3OB 2EEZA 2CJFA 2B1QA 2RGUA 3O3CA 1O6CA 1LLDA 4RTLA 2I5PO 2HQRA 2QTFA 3O38A 4L8WB 5C37A 1B23P 2W2KA 2XYQA 3BTSA 2HREA 4RK6A 2QX7A 2G1UA 3GB9A 2XDQA 3IKVA 5EKXA 5A62A 3JZFA 5KU1A 1KPGA 2CL6X 3IHWA 4DQXA 1K8RA 1CUAA 2LKCA 3MS4A 2OCDA 3A9VA 1AIPA 1QV6A 3L05A 2VUIB 3LQ1A 4IXWA 2AC4A 2BFPA 1YDFA 2Q0SA 4ITVA 3RVDA 2G77B 1X80B 1X92A 2FEAA 1UFKA 2OCAA 4FHCA 3GRYA 1WUIS 4EZEA 5HCIA 3ZWBA 4UMDA 4IIXA 5THKA 2OXIA 5E6SA 2D54A 4ZREA 3A1WA 3KSMA 3I61A 2VO1A 2HA4A 3A2KA 1JX6A 3BHMA 3GLUA 3O6VA 3ORSA 4JVNA 3B13B 1UMBB 4B1FA 3T4XA 1RHQA 4F2DA 3GJ8A 1XNGA 2O8NA 5HF6A 5A6SB 3RVSA 5DI3A 5M04A 4OMUA 2WYOA 3H42B 4D3ZA 5IAAA 2XA2A 4ZAXA 1C81A 3DQZA 1FFSA 4ZAGA 3RS0A 2FW6A 4E31A 2G71A 2Q5IA 1D0SA 2JJYA 4DQVA 3I58A 1W4ZA 3PXDA 1SELA 1LFAA 4KFSA 4RORA 3X2EA 1DIOB 1O94D 1TYCA 1OBOA 1YBMA 3DFIA 2WSYB 3BJMA 4X85A 4EGQA 2PZGA 3GFBA 5JWRA 1GAWA 3TINA 2UUAB 2GM9A 3L04A 1NXWA 3EZ9A 2FB9A 2M1ZA 3BGDA 3OPXA 4MARA 3D7LA 3LU1A 3QE4A 4RDIA 3FDZB 3FHJA 3V8VA 4FGKA 2CJPA 2FMIA 4RPHA 1L4MA 1PGPA 1EG2A 2PV7A 1QONA 5AW3A 1E1KA 2IUSA 3TLEA 5IAKA 1NBAA 2DYKA