1UL3A

Crystal structure of pii from synechocystis sp. pcc 6803
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
112
structure length
95
Chain Sequence
MKKVEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFEFLQKLKIEIVVDEGQVDMVVDKLVSAARTGEIGDGKIFISPVDSVVRIRTGEKDTEAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of the PII proteins from the cyanobacteria Synechococcus sp. PCC 7942 and Synechocystis sp. PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II
total genus 20
structure length 95
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ul3A00
1NH7A 3AA9A 5L9NA 2O66A 3GSDA 4CO4A 4USIA 1PILA 3NCRA 2ZOMA 4E98A 2J9CA 4WK1A 3AHPA 1HWUA 5D4LA 3O5TB 1P1LA 4D3HA 3DFEA 2GX8A 3TA1A 3TA0A 4YB5A 1VFJA 4C3KA 1V3SA 1KR4A 2DCLA 2GNKA 2XG8A 4CO1A 4YB6A 4WK3A 4NYOA 1VHFA 4Y6IA 5D4OA 1UKUA 3AA8A 4Y65A 4NYPA 3X3UA 4RWXA 5D4PA 1V3RA 4C3MA 2EG1A 2J9EA 3L7PA 3NCPA 4CNZA 1O51A 1XK8A 2XZWA 4CNYA 4USJC 2ZFHA 3CE8A 1NH8A 5DS7A 3TA2A 1GNKA 2VD3A 1NZAA 3BZQA 2CZ4A 4AFFA 2J9DA 1OSCA 3MHYA 4RX6A 3NCQA 3LF0A 4ZK7M 4OZNA 1NAQA 2V5HG 2E66A 4IYQA 2GW8A 3T9ZA 2Z0GA 1O5JA 4CO0A 2XBPA 4D3GA 3M05A 2EG2A 2XULA 5DRKA 4OZJA 4USHA 1J2VA 2JJ4D 1UL3A 1H3DA 2PIIA 4CO3A 3O8WA 2NS1B 2NUHA 4CO5A 1UFLA 4R25A 2RD5C 1V9OA 4RWWA 2NUUG 2J9DE 3AH6A 4CO2A 3N5BA 5D4NA 4RLEA 2O67A 4C3LA 1QY7A 1UMJA 1V6HA 4OZLA 3HLUA 4YB7A 3OPKA 1Q1KA
chains in the Genus database with same CATH superfamily
1HA1A 2C2EA 2CPEA 4PG7A 2XLKA 5DLGA 1J5EJ 3GV5B 4JI8F 2ZE2A 5HQLA 2CPYA 4MK9A 2GVDA 4QPTA 2E9TA 2HWTA 3BREA 3FZ2A 6FD1A 3MOJB 2R8JA 2ZDPA 3MMCB 5K14B 4DV5F 1C0UA 4ATNA 1YJRA 2GFFA 3HJFA 1ZTWA 5F0WA 2WCXA 3ULHA 2HGNA 3N6MA 4CP5A 2B9XA 2XYHB 4DV0F 3V6JA 4DF4A 1NDPA 2CUYA 1O0PA 4WIIA 4GO7X 3UNYA 5CD4A 2UXDF 4NLVA 3A13A 1SJFA 4KGKA 3P5TL 3W3SA 1HNVA 4CLFA 2WB1D 1JNZB 4DV6F 5J2MB 1HNWF 3KJVB 3VWSA 1WC3A 1F5BA 1LWCA 3R5AA 1KR4A 4N7TA 1GXUA 4QIWD 4ANDA 5I3QA 2BJ1A 2P6TA 4WP3A 1L3SA 3RW6A 3GONA 1WKKA 4OJ3A 4PWUA 5JVHQ 3QJPA 4NLTA 1N6QB 3C14B 5IV4A 3IAS9 2HPUA 3BYPA 1DJ0A 1FEEA 5JMNA 5KG7A 2YX4A 4RZRA 4JV2A 1VS3A 2XYGB 3NS5A 2HVHA 4FNHA 1YSJA 1KVJA 1MMNA 4A8WA 4F7VA 1SKUB 3OLBA 2XMJA 4ITSA 2KB2A 2QO3A 1B0PA 2ZBRA 3HX9A 3PTWA 4USMA 2C2NA 1FRHA 1QAYA 4P73A 5L38A 3HXMA 3VAFA 1T03B 4ZN3A 2MQOA 2E5LF 4WIQA 2YNGA 3BKFA 3GMGA 3PY8A 4WZQA 1RYRA 3DI6B 3RRKA 4YQWA 3W9IA 5AXNA 3TR5A 5GMKa 3TQ1A 2OSRA 2CQCA 5CYQA 2GGPA 4B9TA 1WHVA 4F4AA 4LF7J 3CCLS 2OPSB 4LFCF 4V19X 3O6QA 2D3ZA 1RT2B 2FHJD 2F63A 2LA4A 3G6VA 3UR0A 2KRRA 3LALA 5HBMB 2FVPA 1RT4B 2AEFA 4HYKA 3AD7C 4MT1A 1DLOB 3TA2A 1D9DA 1CQMA 1R8BA 2ALZA 1DTQA 1MWYA 3LH2S 1KQKA 4F2RA 5AJ3F 4DV7F 4Y34A 1MSWD 2HFZA 3CC4S 4CLWA 1RU2A 2FHMA 4KGVB 1OIAA 2HG4A 3V4MA 4B9NA 4OYIA 3I5CA 5CXTA 3LF0A 3BO2A 2NXCA 2BANA 4QWBA 1QLNA 4KHRA 3KJFB 1X5PA 2YVSA 2R7UA 3DLJA 1JLFA 1OY8A 2N7YA 2VG7B 3MPYA 4O4GB 2G0IA 1M5OC 1EHWA 2KVQE 3GIIA 1XR7A 1FXRA 5BYQA 3D68A 1FNXH 1ITPA 2ALYB 3KTQA 3NG8A 2CA9A 5A8RA 4U7CA 4NZ0A 1Q16B 1DZ5A 1BMQB 1B70B 1MU2A 2GZOA 5HQMA 5KFAA 4WXOA 1WF0A 3M6VA 3Q22A 1LK7A 3FRYA 5J1EA 4CLSA 4C2MA 5HVFA 4USWA 1RTJB 3BJYA 3PV8A 5HLFB 4JP8A 3RAXA 4O44B 3RBEA 2Y0SD 3ZTOA 1AT1B 1F3VA 1CJKB 2R7QA 4X4QA 2AHOB 2YBVA 5AE3A 2RRAA 1HNZF 1SC4B 1FI4A 3G6XA 2V8HA 4DFKA 4G3IA 2HVDA 3I4PA 2NUUG 2MZ1A 4K4ZA 1REGX 2NREA 3GIMA 3IGNA 1FNOA 4I2PA 3D0HE 4PZVA 4O23A 5D4NA 3HD2A 3HSJA 3ILOA 2EBGA 5F41A 4C8LA 4USKA 1FKAF 3ZZTA 4ELTA 1F2HA 2HHPA 4I69A 1HR0J 1CC8A 4A8OA 2BE2A 5GAGU 5EHHA 3DN9A 4LRCA 2M88A 3ILLA 2NZCA 5A76A 3AA9A 3UE2A 1WEYA 2DXDA 1M5HA 3EE3A 4WBFA 2DH8A 2H51B 3M8SA 2U1AA 5HQ8A 1N36F 1QSSA 1X4DA 3M6UA 2QFJA 2AKWB 2Y9HA 2J0XA 2UXBJ 4PR6A 3MTJA 3AOCA 3MAQA 1C1BA 2X3DA 4LF5J 3CCMS 3C6TA 1UZDA 1LWFB 3SXLA 4BCAA 3KG1A 4EYHB 4B3OB 1U2CA 3TJAA 2HHUA 2CJBA 1UWBA 1WEXA 2Q43A 4Y2AA 4DZDA 2BJ8A 1WSVA 3S6EA 4OLPA 1Q79A 3PZPA 4YMEA 3N6NA 1RTJA 2CQDA 3UI3A 1XC9A 3FRZA 3G8QA 1HBMB 4JOUA 4R8UA 3QO9B 4FS2A 1BC6A 1O6XA 3FCVA 2W7PA 3TAMA 1N56A 4JI7F 2AJQA 2DGQA 3K17A 2G2ZA 1RACB 1MN9A 1S0VA 2K3KA 4LF1A 1I94F 1LWEB 2QL5B 2QLFB 1HNVB 2ASLA 5KFVA 1R27B 4H4OA 4DDFA 3K5MA 1XMOJ 4ZPBA 4DZ6A 1D0EA 2ADBA 1RAAB 3OUYA 2VH7A 1NJXA 1WDTA 3I6PA 3QWUA 3QSYB 3H59A 1UKUA 5HMZA 4QW8A 2EK6A 2RT3A 3DMJA 4LSNB 4Y65A 2VPWB 4JI4J 3BGOP 1JKHA 2MDAA 4L6V3 2VONA 4PG6A 3CJSA 3WIUA 2C3OA 4MIWA 5C25A 5DQGA 2IYGA 2MY8A 2MXYA 2HQ3A 1KD1T 1J5OA 5JUMA 4LF8F 2VFVA 1S97A 1AZSB 3LPYA 2YNHB 4O3QA 3UCUP 1ZH5A 4ECSA 4OL8A 2YNGB 3N0VA 2BM0A 4CLPA 2IA0A 2M8DB 2D3O1 1FE0A 3PFEA 3OD2A 2RH3A 1VRTB 2DITA 4ID5A 1S12A 1QSLA 1IXKA 5GVQA 4AFFA 3B4MA 3BGLA 2DR5A 3LP2A 1HBNB 4FKXA 4RW6B 4ETZA 2CQBA 4LF6J 1NPPA 4ZS6A 4L73A 1FJ7A 2O5DA 5KT3A 1H72C 2ATCB 2MZRA 3A4TA 3NS7B 3GQCA 1D8ZA 3UDLA 4TU7A 3RB4A 1JJ4A 1HKAA 3D5MA 4B9MA 4KPYA 2FHJA 2KT3A 2PE8A 2QGFB 2IYIA 3QATA 1FF2A 4DR1F 3RRHA 1RTDA 5A8KA 2F3JA 2OPQB 4O3NA 4DR1J 2C2OB 4ZVTB 4C7QA 2XULA 3HHKA 1KLNA 4PPDA 2Z57B 2C2KB 4WE1A 1RU1A 2HNDB 2F7VA 4X66J 4FF2A 4OJ1A 5EWGA 2IRUA 4LVNP 3O3LA 2C2RA 2MQMA 2UUCJ 3EXCX 4KHPF 3G6ES 3ICLA 2KI2A 2OPPA 3NEKA 4OX6A 3W8GA 5BYSA 5BR8J 3G6YA 3JYTB 1LV5A 2ZNYA 1IBCB 2NS1B 2PSZA 3OFEA 3OXLA 4NA2A 2ILYA 1AZSA 3OR2B 4ZVQB 4DR5F 1NNDA 1KFSA 1EB0A 3D54A 3PX4A 2QRRA 4X65J 3KK3A 4JI8J 2VODA 4ED6A 1TL5A 2JVRA 4RWWA 3MECA 1NDLA 1TUGB 2J9DE 4AYBD 4DX8H 1X9MA 1N5YA 4JI7J 2XNQA 4YN3B 3IXQA 1X31C 4UOFA 1FVSA 4WWSA 4WJBA 4LF7F 3LP2B 2HK2A 5AE2A 3J7Z5 3H4DA 4DL2A 2CZVC 3ZNUA 3V81A 3T5KA 3IN5A 1Y3JA 3BDEA 3NGSA 2KJWA 2V2VA 2J7UA 1HYSB 5KFYA 1SKSA 2D3OR 2CQIA 1VC6A 1RZMA 1TKZA 2GC8A 2LQ9A 4LT6A 1D8YA 2BZ2A 3GWCA 3K2YA 4DG1B 1NM2A 2ZOMA 3QT8A 4QWCA 1NCLA 4TLRA 5MAOA 1IKWB 2WSFC 1NB2A 3MEKA 3P45B 1QAXA 2W4PA 4OYWA 4WK1A 4P2MA 3RG6A 1FHTA 1KQSR 3BQ2A 2C42A 1R6YA 4NEZA 2V67A 3SSQA 2VBXA 2F40A 2HQGA 3IRXA 4WFBQ 1YRXA 3I82A 2FJXA 4DR7F 4QJVA 4OJGA 3TA1A 3T9NA 4X4OA 4ED7A 3C6UA 3CDEA 1JLBA 2P5VA 4WKRA 2KT5A 3G82A 2BRLA 1SPBP 1F5AA 3CW2C 3P96A 4OQJA 5KG3A 4C3KA 2XHWA 3M9OB 3OSPA 3DLHA 2OTJS 1OQ3A 3MMAA 3GV7B 3OR1B 3FEXB 5SUHA 4IFVB 4W98A 4YR0A 4LFBF 4HEA9 1H98A 5D0GA 2CRLA 4CO1A 1ZAXA 2XNRA 2LCWA 2W9AA 2X1BA 2IRXA 5E0OA 4K4UA 1ZAVA 2RQ4A 3A3NB 4WCEQ 1N5VA 2DNHA 2OFGX 3HF5A 1TP7A 2ZKTA 2ZUAA 3NNCA 1VHFA 4O4RA 4Y6IA 2JNJA 3TAMB 2E5GA 3TAPA 4IRCA 4B17A 4NPOA 1VLOA 2D1CA 2C3YA 1FRXA 2AQ4A 1TFYA 4N5SA 1SV5A 4FKYA 2CQ3A 1VIOA 3MEGB 1IR0A 4CNYA 1XR6A 2DNZA 2EEYA 1S5ZA 5HMXA 2C22A 1W2BR 1TL1B 3DDKA 3F41A 3MM7A 2OKQA 4DR5J 1ZYQA 2OSQA 5EUHA 3DMJB 1RAGB 2KHDA 3MMBA 3EPGA 5T7LA 4K4TA 1KN6A 2F1FA 5DGBA 1RHRB 5J2PA 2VPXB 2AW0A 3TAQA 1RT5A 3JSYA 4RJVA 2WB4A 2HS3A 4RBTA 3KK2B 4AD6A 3F0NA 2CQ1A 1R8AA 2GQCA 4NA3A 2RDDA 4OI4A 5KFHA 2DNRA 1T9UA 2JLGA 3HT0A 2VBYA 3MOZA 2AP6A 3H4BA 1I5OB 2XEXA 5C42B 3NGRA 3JTNA 1YJUA 3FK4A 5E3CA 5HROB 4YS2A 1QAJA 4EBDA 3QIDA 5H1SV 2A6MA 5IC4B 1PG5B 3PCOB 2BA9A 1I6JA 3CC7S 3J7YI 1AYEA 5ETTA 4RW6A 2A6OA 2ZOFA 3CD0A 5K8MA 1UJ4A 2FJBB 1URNA 3CMAS 2RAQA 1UW4A 2EW9A 2VFRA 5L9XA 5D3GB 2K06A 1YJNS 4OX9J 3QIPA 1HARA 2HEKA 2RHSB 3GP9A 5ETKA 3UR3C 2XY7A 1DTTB 1XNRJ 2YQ1A 2EI5A 4TU9A 1K0VA 3S8SA 2OEJA 2AT1B 3L7UA 4O3OA 4N47A 4QWEA 3MXHP 1WOPA 1LWCB 1T3OA 4NLPA 5A2QU 1U02A 4ZPAA 2AX1A 2XI3A 1U0SA 3J80U 1HWLA 2FY1A 1NJYA 4WE1B 4AQYF 5H9FK 3C14A 1SL0A 3K0JA 1LW2B 4ECTA 1YIJS 3G8SA 4LF4F 3CJ4A 3JSBA 5J2PB 2WW8A 3T19A 2FPHX 3B6BA 3H2LA 1RT5B 3W5YA 4C3LA 5L1KA 1FRIA 2QL9B 3DRYA 1U49A 2V4QA 1BUXA 1S49A 3DRSB 3OPKA 1S9EA 2W2NP 4U9RA 3ZTPA 2BRKA 1ZM4A 2R8HA 1RWKB 2ZEJA 4DFJA 1H73A 4I6AA 5HROA 2AIRB 2CDRB 3BGFA 2XB2D 2BJ7A 1FFSB 1PILA 3ITHA 2WVBA 4PWDB 5I3UA 5F0UA 4DSIA 3MM9B 1QVFR 1GMWA 1OO0B 2B4VA 4Y00A 3R2CJ 2KT2A 1QAIA 3QO9A 1TMJA 4QU6A 4ED3A 1S72S 4USUA 3TZYA 5J2NB 4IOCQ 1PBUA 7FDRA 2XY5A 4F4KA 3LW5C 4LR8A 1RKJA 1DURA 1KVIA 1JLGB 3QBCA 3X1LB 3CUNA 3SV4A 4IOAQ 1S57A 4NCGB 3ZZZA 1DTTA 1SC3B 4LF2A 1ZM2A 1P6TA 1WD6A 1IR2A 1VFJA 2GIFA 1CULA 2QMUB 4OZ0A 4ZITA 1T11A 1V3SA 3FJ2A 5F8MA 3CB4A 2W9BA 1JJCB 2VFTA 1RT3B 2YX1A 1U1RA 3HVTA 4G6VB 4KGXB 5SZTA 2YX7A 4HHHA 1SXLA 3TEGA 2AV5A 2IC3B 1V3ZA 1JLFB 1FWPA 2VG7A 4J91A 1RBLA 5KFZA 1C1CB 2HFSA 3GFXA 3LAMA 3FMBA 2RDIA 3M2RB 5FLXU 2B6AB 1SH3A 2LEAA 3THTA 4JV5J 1YQHA 2FGCA 4NI2A 4B3SF 5FIIA 4UW2A 3TRGA 4QU7A 4HVZA 4ZLPA 4UY85 3TWZA 4DPUA 4EEYA 4ZP8A 1EIYB 4X4VA 3M8YA 2FLPA 3TANA 4C0BA 3IO1A 4PXDA 1Q53A 2HVZA 2BOPA 2VG5A 4K59A 2IM2A 4C4WA 1N48A 3D1QA 4LIWA 3K8WA 1NKBA 2R7SA 4RUCA 1DQ9A 2M52A 1RQ0A 1XK8A 1ZA1B 2CWXA 2GJIA 4FPRA 3C3LA 4CM0A 3BQ1A 1CJKA 1XMOF 4LR7A 1AW0A 2DNNA 3DLKA 2BE7D 1SC1B 4EI2A 1NZ8A 3FDSA 3W60A 3I0RB 2IJNA 1JLGA 2BEFA 2B8PA 2CFXA 1W7WA 2DK2A 2K3IA 5FLXY 3PO4A 3DRPA 3OBIA 2MKIA 3NMAA 3ETMA 3MEGA 4JB8B 5B0DA 2VQEF 1RHUB 1CULB 2D3UA 3VGTA 5A8KB 3CCSS 1VC5A 4JYAJ 1R8PA 2B7BB 5KG2A 3QAEA 1TL1A 2X7IA 4JI2J 3M9NB 2FGOA 2HHVA 3FMWA 2CNNB 2R2UA 3SEOA 2HNDA 3POTB 1VJWA 2COLA 5DGAA 4JI2F 3K5OA 3MMBB 3HVWA 4X2BA 2MKJA 3OFHA 5HATA 3HFZB 2OPPB 3H40A 4DX6A 3PACA 3R1LA 5KFXA 2KN4A 4DUTA 2NR0A 2IM0A 2HAFA 1BHNA 2DGXA 2BV3A 2XM3A 4LRFA 3DGVA 3AAWB 3LAKA 3SDEA 3KLVA 2UU9F 4QYRA 3GV8B 4UOCA 2XMUA 2XQCA 1F9EB 3Q2SC 2EFNA 2W2PP 4C97A 4F36A 1PGZA 1W25A 1WHYA 2GQ2A 1HNXF 2J8AA 3WQPA 5DQIA 2R7VA 2LA6A 4KR0B 2G4BA 2W24A 2Z2YB 3HJVA 4ZHRA 2YH0A 2Z2ZA 2FLLA 5HO4A 1XIQA 4FP9A 3DLGB 5I42A 2EC0A 3ZC4A 4AQYJ 1JXVA 2U2FA 1S0NA 3BGUA 3H98A 2EFPA 2EFGA 1IKXA 2MKKA 1GMWD 3CCES 1JQGA 3MEEA 4ECXA 4ZVSB 1QY7A 3OXGA 2L9WA 5L1IA 2MHEA 3I4HX 1VQNS 1S10A 1Y9OA 4HHJA 3CMQA 3TVKA 2ACMA 3KLFA 3M9MB 2W4DA 2FYXA 4DR6J 1IBLF 3OJUA 3RAQA 3OHBA 1U48A 1RWUA 4YEAA 1P1TA 3D6HB 3R1HA 3HKZD 5L1JA 1J5EF 5EWEA 3F56A 3MCNA 2W4CA 5C25B 2JEGA 1RHKB 1CJUB 4OHZA 4WPAA 1J5OB 2L08A 1A0OB 3W8PA 4DV3F 4TNOA 1KC8T 2B0GA 2DHHA 4UTGA 3QT7A 5CCMA 2Q79A 3NMRA 2CQGA 4DSFA 1KOOA 1IR1A 1YZ6A 2V4RA 2WHOA 5LMNJ 5DM7Q 2FJWA 3O5TB 5A6WA 4UOHA 4NLXA 2JC1A 4UY8T 4U7UK 1EETA 4DV6J 1WTBA 3Q0AA 1KTVA 1ZBTA 2GX8A 2Q6CA 1UP1A 2JHEA 3FKBA 1URRA 2A2DA 3IMQJ 4I1TA 3PW5A 1U1LA 2X51A 1VISA 2E7WA 4CLYA 3SCLE 1FCAA 4IUFA 1VOMA 4DCOB 1OPIA 3UN3A 3JTPA 1UVJA 1JXLA 1OWXA 2VL1A 2DNKA 2KYXA 3DLGA 3R6GB 5I42B 3U02A 2KFYA 2LECA 4BWJA 4JBCA 2E1MC 3OVSA 1U1MA 1QD1A 3KUGA 1DHMA 2EKNA 4FXWA 4P72A 3D1OA 4ZCKA 1VI7A 3S01A 3TUIC 2DR6A 2V8VA 3TZXA 4LF9F 3SFGA 3PR4A 2HIYA 3AY0A 3AD8C 5A8WA 5MLCV 3KLFB 3T6BA 2F5GA 4QIFA 4QZVB 2I2YA 4NLGA 2RF2B 3J7AN 1Q7YT 3BDPA 1RTZA 4I7FB 5M2PA 2GVZA 4LFCJ 4EBCA 3UDCA 3IAM9 3MTKA 1L3KA 5LSOA 2AD9A 3L7PA 3TX0A 2E9RX 3LQVA 3PEJA 2DHXA 4EZ9A 2QMXA 3KKFA 2NZ4A 2C3MA 3BPSP 1NPRA 4G65A 4DS5A 2LQ8A 2LU1A 4KH0B 2DH7A 3H20A 2VKRA 2C2MB 5F8LA 3NRBA 5G0RB 4B3TF 2ROPA 4C8NA 2B5JB 2N7CA 1R8HA 2V2KA 3VZIA 4IH5A 1IN0A 2QL7B 1GQEA 1X5TA 4A46A 4NL5A 4TY9A 3AJDA 1VBYA 1R8CA 4KC5A 2JX2A 1IKVA 3MHYA 3KHRA 1T9WA 3DDNA 4ZVPB 4ZK7M 1WKLA 3V6DA 3GJRB 3H0PA 3AODA 4PUOB 2LFVA 3C15B 3AJ2A 4NLDA 1TKZB 1CS4B 3MFHA 3Q23A 1X5OA 4OI0A 3M8PB 1S0OA 3V4IA 1TL3A 2V68A 2MY7A 1VQPS 5B0EA 1HHTP 1T9YA 4CO0A 1IKWA 4LFAJ 1RBAA 2E1PA 2V9WA 4OHVA 1QVGR 4NXMJ 2VFUA 2UUAF 4LFAF 2Y1RI 4LRAA 3QJLA 3EGNA 3EZ5A 4KSEB 4ZP7A 3KUHA 3D6MB 3RBZA 2ZDOA 5ETLA 4ZCIA 3GB0A 2VB6A 4KO0B 2DBBA 4BDPA 4KKOA 1UL3A 5FJ4A 2M5YA 2LKZA 2R7OA 2A0FB 4FPIA 2HQCA 2FZGB 4RW4A 5CZXA 1YGYA 2HLTA 1TMMA 4NYZA 1KQFB 1B3TA 4MKAA 3WHIA 4C6AA 4EWTA 4CWBA 1WDDA 1E6VA 2OD6A 3QYYA 2YPYA 3EX7B 3JSMA 4Y2IA 4J9RA 4KRWA 1GTHA 1YDLA 4HH1A 1X8DA 1TAQA 2DKOB 4I68A 4NMLA 1PKUA 2JFDA 2VICA 3U1MA 1T05B 3U1LA 5A6PA 3PW2A 1XNRF 2Y3YA 3GYGA 2DO4A 4DPTA 1CJTB 1T02A 4OZLA 4I56A 3T6JA 4YR3A 2FJDB 3GIKA 4IQXA 4YOEA 5B0BA 2JEFA 1JXEA 1FT8A 1NH7A 1RABB 4DPOA 4PG8A 1W26A 5IFMA 2NPFA 5DG9A 4CO4A 5D6GA 2PA8D 3FZBA 3H5YA 4USVA 3M6XA 4C8YA 4URSA 1WC0A 1PJ6A 2DGWA 2OMOA 3PYFA 4NCGA 3M6WA 1TKXB 1UFWA 2RNEA 4TYBA 1FDDA 5DG7A 2C2ZB 3AD9C 3MEEB 1X7VA 2DNOA 4OV6A 1NB7A 1HQ2A 1XR5A 4DPWA 4C8ZA 4K50A 1LKZA 4DU8A 3HVTB 2Q1LA 1EKSA 3T5JA 3TX8A 3CDBA 4U8VA 1R7IA 5CAAA 1K0TA 1RDRA 1IJEB 2BVZA 2QC3A 3MPDA 1S7IA 2WZ1A 4URGA 3CXCR 2WBRA 1FRLA 1HIYA 4ZVFA 3UN5A 3TNVA 8AT1B 2F4VJ 1OPZA 3R97A 2VPZB 4ZVUB 3EGZA 1RJJA 1NPKA 5HI7A 2Z4PA 2QYCA 2VBWA 2BOAA 4KGMA 2HQIA 3TEHB 2XMWA 4HTIA 3VQSA 4KE5A 4I6YA 3CCUS 2HGLA 2Q3PA 4DV0J 2VFSA 5IQ6A 1S77D 3O1LA 2PMWA 1S6QA 1JJ2R 1VDHA 2ROGA 4PQUB 2V4JA 4IOBA 4LREA 7FD1A 1Y10A 4B3RJ 1CJVA 2F9DA 3CJ5A 2E1AA 4M5DA 3H2UB 4IR9A 3DOMB 4PG4A 3OL9A 2WVEA 1S1WA 4FF3A 2LDYA 4DR2J 2P9EA 2OELA 2OI2A 2AGQA 1NKCA 2EKYA 4Q45A 2ZH3A 3NAIA 2LXUA 3A8KA 2XMMA 1RT1B 2PGCA 3Q8YA 4M5KA 1VC0A 3Q2TC 2UXCJ 1SH0A 2F65A 1TV6A 1VQ7S 4DR6F 4NRTA 2DYAA 2LQ5A 4GO5X 4AL6A 5CCLA 3RGIA 5IQQA 1F0XA 1FKPB 1NH8A 4DX7A 2VD3A 3EICA 1YJ9S 4I7FA 2OP5A 1TKDA 4ILMA 1T95A 1WOOA 4RL1A 5KG4A 5KFBA 1LW2A 2W2OP 5H9EK 1O8BA 2RRNA 3VGSA 1HHSA 1U1OA 3M8RA 3HSGA 4R0EA 1YLXA 3CJ2A 3KJVA 3JQMA 4F50A 4NXNF 1X4CA 5LSLA 2NYHA 2DIUA 2I0XA 3VAHA 4UQTA 1VR6A 1RA7A 2HAIA 3SDEB 2G13A 3GFZA 3R3TA 3D6FB 4DSEA 2JEIA 3N5FA 3ISNC 2D74B 1N6QA 3RRGA 3HK2A 2V2QA 3R27A 3DOKA 2KFZA 3GJSB 2XC9A 2NCKL 3K8VA 3IA0A 3M8QA 2G1DA 1O5JA 2XBPA 2IDEA 2E7XA 1WSRA 3KK1A 2GAGC 3OVAA 3AB2B 1JLCB 1UVIA 3M32A 4F4YA 2ZBIA 4DR2F 2P9CA 5LJ3Y 3QFHA 4ICLB 5A0YB 1VK3A 1XMQJ 4ZHRB 3MWBA 3OTCA 1F60B 2I1RA 2RMLA 3C15A 3VHQA 3OT9A 4IG0A 3VCDA 3UVJB 2E44A 1K73T 4WFNQ 1RT1A 4J9LA 4DV2F 5GAHU 4B3SJ 2H5IB 1JLQA 1KVKA 4RPFA 5IM0B 4FNIA 1H3DA 1PJ5A 1WC5A 2VG6A 4ZKAA 2BXJA 3W1YC 1S1UA 2VJVA 3CIMA 4XDCA 5B09A 2IBKA 4EGLA 4Z7CA 4N56A 2ZZMA 3QFWA 4ZPVR 3BBBA 4ZLNA 2J6UA 3TARA 1VBKA 3KLEA 5B08A 3Q8SB 2JOQA 3AXMA 4RW8A 4KO0A 4JV0A 5BJRA 3QZ8A 1WHXA 3D67A 4KKOB 4KV8A 5ETOA 4Q8EA 2AJ1A 4DPYA 1ZZFA 5DM6Q 4FZVA 3AOAA 1EZZB 3GFYA 2FVQA 3PFOA 2Z56B 3GFHA 1HMVB 2UUCF 1CVJA 2KZMA 1WKJA 3HLUA 3KXDA 1G2EA 3ZZ0A 3HSZA 3BF4A 1BXNA 3D1HA 2ZH6A 3FBBA 2ZZTA 4PRFA 2KL8A 1U1PA 2W25A 4DSKA 2O66A 3HCXA 4P2XA 3UCGA 2E1CA 2YKAA 4HI1A 2QN6B 5I4MA 1ZETA 1KONA 3L4BC 1IQTA 2ZHAA 1T05A 3HHLB 6FDRA 1L3VA 3EVMA 1QUVA 1OSDA 1WI6A 3FBEA 3Q83A 2XMAA 1MWQA 3CT9A 2DCUB 1ZPVA 4WU2A 1XWLA 5D78A 2N4DA 5FD1A 3OQ2A 2WTFA 2WVFA 4O0NA 3DFEA 4JI5J 2KXNB 3HHNB 2W01A 1YJWS 3ZZPA 1Y5LB 1VQ9S 1JLQB 1LOUA 3ISZA 1X4EA 3UD4P 5K14A 1KOHA 1F9FA 2CPDA 2MMYA 3FVYA 2UUWA 3W63A 2Y8YA 2XLJA 3EDQB 5A2QY 4DL3A 2ADCA 2HNYB 2YWWA 3PHEA 4TVAB 3W2VB 3PW7A 3PNIA 4TLQA 4FBTA 4IH7A 3POTA 3H5XA 3G8TA 3OVBA 1SIZA 2W9CB 5D15A 1KDNA 4F26A 4E2FB 2H9ZA 2D41A 2LU2A 1HHQA 3MM5A 4RUAA 1S4FA 1RWMB 2HFNA 1REVB 3QMQA 4LRDA 4YP3A 2MSTA 1P9YA 4OYPA 4MFBA 2V50A 5FDLA 4Y0FA 1M1KT 2MHNA 2V2ZA 3M7VA 1YKWA 3VR1A 4DI6A 1B4SA 4OX8A 4OIXA 1EX8A 4CRJA 4OMFG 4UZBA 4ZPWR 1ACMB 1GMVA 5D4PA 4CH1A 3MPUB 2NXUA 1NHKL 2J9EA 1W2IA 2P8IA 2ZHOA 5H9FJ 4ETXA 5CA5A 5KFRA 1CJVB 1RT7A 1NSAA 1O51A 2EPIA 2GMHA 3AOBA 2H54B 4DL0C 4B3MF 2CPXA 3BYRA 3FCHA 2R2SA 1FDNA 2F8MA 2J0WA 2ZFHA 1NDKA 3VGVA 4DX5A 5F8HA 4HR2A 3CULA 4DR7J 1GNKA 3DI6A 1CPZA 1CQNA 2WVDA 4WTYA 2QFIA 1NZAA 4NLQA 3BZQA 1YWXA 3FUYA 3PG9A 2DNGA 1NDCA 4DU7A 3VAJA 2OPSA 2FY8A 3KLIA 2E7VA 4C48A 4CLUA 1AB8A 1EJ7L 3MM8B 2UUAJ 3CWJA 1WEZA 2W7OA 2R8KA 4MKYA 5D77A 3BBCA 1S1TB 2BABA 2HRTA 3OW2R 4B9LA 5B0CA 2E5JA 4IO1A 2QYGA 1NAQA 4X64F 2DHAA 2FJVA 2MQLA 4X4NA 2EXUA 1J27A 2L48A 2VF3A 4M63A 1X0FA 2EC2A 3KOAA 1K44A 5LOQA 3MPVA 1UVMA 3LTOA 1IVZA 3W64A 1JX4A 4EUVA 4RW4B 1ROFA 2G9OA 1KEKA 1E6YB 1WELA 1FNMA 2HZAA 5E3PA 2Z2MA 5D0HA 4B9SA 2ASDA 2OPRA 3W2WB 2RQCA 2MSSA 1IBMF 3W9HA 2K7KA 2H3EB 2UV8G 4LSNA 2KU7A 4USHA 6AT1B 3CJ8A 3E01B 4IG3A 4MKBA 3SQGB 2R7TA 1N34F 2HRUA 3ENVA 4B08A 1AFJA 2DNMA 4B3MJ 4A47A 3CJ0A 3FSXA 1LXJA 1PIEA 1S1XA 2XSJA 4FYYB 3ZNJ1 1CJTA 2J8SA 5A8RB 1H6KX 2XO6A 1VQ6S 1OQ6A 3H2VE 4NXMF 1LFWA 2RS8A 3SSRA 3H5UA 2IJFA 3PW0A 1VRTA 4DMZA 1H2UX 2CJXB 4DSLA 2QV6A 2QA4G 1VBXA 1TKXA 4RO0A 1YJVA 2K8GA 3MAAB 1EARA 3EZUA 1MWZA 3SV3A 1HBNA 2PA3A 1C0UB 1R0AB 4TYAA 4C9DA 4RNHA 4TY8B 4NA1A 3SIPB 2RF2A 2E5HA 1R31A 1RHJB 5GADI 3KHGA 2BKNA 1RT6A 2C2DA 2B4PA 1WWHA 1EQMA 5CZVA 4ES1A 3DXBA 2DHSA 2J9CA 3M8ZA 4J9VA 4M8LA 5THWA 3ZZUA 2H5JB 3CTRA 3ADAC 1RBOB 2D9OA 2OPRB 2YQ0A 5ETVA 3W2WA 3VVUA 2ZM6F 3PX6A 2VOPA 1I51B 5E2QA 2IVFB 4IG3B 3SQGA 4DL7A 5LXYA 1S6QB 3IP0A 1KS2A 1FK9A 2DGTA 1C1BB 2WRMA 1U4BA 3FQKA 2E5LJ 4M5DB 3PR5B 3EZOA 2O1PA 1LXNA 3DOMA 5E41A 2EBEA 4DCJB 2VA3A 4JI0J 4ZP9A 4OYZA 1KRPA 1JMTA 2XG8A 3IBCB 2DPIA 3DYAA 2L41A 1PAEX 3AQPA 3GE9A 3IBFB 1EP4A 4UOGA 2F8HA 3IR6B 1QTMA 2DRDA 2BMBA 3AJ1A 3FNNA 4Y28C 1K1SA 3MPWA 4NYOA 3QRPA 4YUDA 4XTTA 2A18A 4TY8A 4PKDB 1U1NA 2V8GA 1YITS 1FKPA 5IV3A 3MR2A 1N5SA 4WXWA 2YNIB 1PYTA 2ZVSA 3C16B 4ZVOB 4YR2A 4DLGA 2L9DA 4Q7AA 2CQ4A 3KJQB 2R2RA 4A8KA 5KFWA 2R7XA 4H4KC 2HS0A 2E29A 4L76A 5KFKA 2BE9B 3FFIB 4Q2LA 1GK8A 3OV7A 1WJ9A 5B0GA 4MTPA 4Q43A 4J9SA 3CE8A 2OLWA 4DV7J 1T0TV 2P6SA 1R6VA 1HBOA 4GRSA 4DFMA 5HAOA 4RU2A 1KP6A 1BQMB 3NBPA 3MUVP 4DL5A 2LXFA 1HD1A 4X62F 4DUZF 4A8QA 1FK9B 2V69A 4OYBA 2VDIA 1TUVA 2ZJRQ 3VAIA 4LF5F 3ENAA 4RX6A 3ONQA 3NAHA 1Y3KA 3C66A 1VQSA 4Y2CA 4ED0A 1G4CA 3DYAB 2MJNA 3QRRA 1EP4B 3RBDA 4PABA 2HHXA 1WF1A 4H4MA 3LGNA 3MM8A 2CYYA 2LP4A 2RVJA 3NS6A 4ES3A 4D3GA 5ITHA 5LMUF 1YHQS 4QR1A 2MKCA 2YKPA 2ZC3A 2BUNA 2XO7A 4F02A 1SIWB 3TVYA 2FHOB 3C19A 5LL6d 3KLEB 4F04B 2V94A 2Y1IA 1Y5NB 3PHTA 2JZ5A 4P10A 2YWKA 2OFHX 1SV5B 1RAHB 1M5PC 1ELOA 1C4AA 3CO0P 2GJ2A 4TQSA 3HVRA 4J7CA 4FVMA 2R7RA 4B9VA 1VQ4S 3R5JB 4ED4A 2KH9A 1HQEA 3IC1A 3K89A 5CH7B 4DHVA 3D4JA 1Z2ZA 3JSRA 3QAUA 2UXBF 2FC8A 2HIQA 4ER8A 1OJ4A 2PEHA 3NNHA 3UCZP 4ZJQA 2DD8S 2ZH9A 1VRUB 4R5PB 1QUPA 1SUQA 1LWFA 5U47A 4DV2J 2XMTA 1V6HA 4JV5F 1T03A 4LF8J 4BBYA 2C1EB 2MQPA 1S1WB 3A8JA 4G1PA 2YKNB 3QSIA 1CSJA 4ZPTR 5KFGA 2FZCB 2HK3A 4WP9A 4KJIA 2R2TA 1H74A 1NJWA 2UVRA 2CQPA 3G71S 3TO8A 4DV1J 3PIOQ 4NX9A 3EMTA 1PYSB 4HKQA 2JFKA 4QCLA 3KUEA 4I6WA 1ULRA 5B0AA 5KOXA 2N82B 4DV3J 4GVBB 3OTDA 3RB6A 3NOGA 1DLOA 2CADA 3WZ0A 1QE1A 1FJGF 2OUGA 1NK0A 4I67A 2X3GA 1RCXB 1WF2A 2JH3A 3DRRA 4MAKA 4DFPA 4O3SA 5HSPA 5D8HB 5GAGI 2RSQA 3MR6A 4H4OB 1VK8A 1VCTA 2IDLA 4ECQA 2J7KA 2GNKA 1NSPA 3VALA 2FQQB 4IKAA 1N5QA 2PFDA 4DQPA 1WC1A 5GMEA 2VUGA 4YB6A 2KXFA 1XMQF 3HHDA 3MI7X 3Q86A 4YDDB 2OMLA 3N28A 2YTCA 4FVCA 2AYGA 1U7LA 2ZJPQ 1WC6A 1U6BA 4CLKA 4ANCA 2CXEA 1X9WA 2GAHC 2ACYA 1UEUA 2R42A 2YNHA 2MJUA 2ILZA 5GMDA 4TXSA 4ZCLA 5GAEI 2R9LA 3GZ7A 5F8NA 2QSFA 3HI9A 3OL6A 3DNCA 1T9XA 3L3CA 3D2WA 3JQKA 3HHEA 4DV1F 1XEZA 3ITHB 4KB7A 4NLOA 3K5PA 4C3MA 4FF1A 4J9QA 4C11B 2AZ3A 3THVA 3RR7A 4FYDA 2ROEA 4URQU 4DQSA 2MZQA 4USJC 1UEVA 3MURP 4GVBA 4OZ5A 3N4WA 3OTOJ 3L09A 5DZ6A 1R0CB 5KT5A 3B54A 4P2SA 5DJBA 4K7QA 3R5GA 2Y1JA 3ILIA 3NGDA 1G7CB 1HWIA 2GIRA 3CD7A 4AT1B 1S0MA 4WZMA 2CJ9A 2ZC4A 1Q5VA 5E3QA 1E6YA 2HHHJ 3G4SS 4UUXA 3T1HJ 1VQYA 3OXFA 3R5CA 1H2TZ 3RYLA 4N8OA 1SJ4P 2B9WA 4OZNA 1U45A 4ZVRB 2HQDA 1U47A 2FVSA 2E66A 2R7WA 4FBUA 3PM9A 4X4RA 4ED5A 3M8WA 2AX0A 3Q24A 3CCQS 1IBLJ 2ZH7A 1C1CA 1UCNA 1HLWA 4IFYA 4XAKA 3M2RA 5L8RC 2C3PA 4JI0F 3VTIA 2LMIA 5CD4H 4J9KA 3P6YC 5C24A 2AGPA 3B4DA 3MGJA 1DFDA 2JEJA 3S7RA 1KLMB 3UPFA 1I94J 5GADU 1UETA 3DU6A 3U1NA 2B3TB 4PYDA 3BEGB 1Y5IB 3MUMP 4GKJJ 3GR0A 3WDOA 1SL2A 1DY3A 5IOLA 4KFBB 2UXDJ 1RWXB 4K5RA 5C7PA 3OJSA 3CDAA 4U96A 4W90B 3G96A 2BBEA 1NSKL 1R0AA 1HNXJ 2MQ8A 2AZ1A 3BO3A 2F4VF 1UFLA 2DHGA 4M1KA 1N0VC 2DXEA 1SI9A 5KFIA 5DDPC 4IO9Q 3WC0A 2GHVC 2MLZA 2XGQA 3ENWA 4QOTA 1D9AA 2ZOGA 3A8EA 4WFAQ 1K9MT 1XJWB 2J6SA 1K1QA 2BJ3A 3N5BA 1NLKL 3MM5B 1N33J 2HZVA 3MCOA 2IVYA 3BR8A 3WIVA 1OY6A 4XPCA 3PJ9A 2BACA 3AB4B 4ECVA 3CJQA 3ZO7A 2WSEC 1X60A 5AE1A 1PAUB 1AROP 5CYMA 3R9LA 3QPIA 1N8RT 2I5JB 3DU5A 3J7YU 3KG4A 1IJFB 1VRUA 1WI8A 3PYDA 4R5PA 4ED1A 1NK7A 5C24B 5HVHA 3G87A 3U7JA 2P9GA 4AL7A 3DRSA 3FQLA 1TQLA 4F2SA 4TKTA 4MIAA 3GSIA 2ZD1A 3OTEA 1U6FA 3EJMA 1RAIB 3HULA 3DLEA 3P4UB 4J5OA 3CJKA 3TW0A 4U6PA 4MYTA 4KFBA 1U2RA 2V34A 2DY1A 5AJ3J 2N4CA 2ZH8A 5ETPA 5F8IA 3VQTA 2UV8A 5ETRA 1GEHA 3BH6B 3J7A1 2DCLA 3KHLA 2HGMA 4YHHJ 3R2DJ 2P2CB 4GKKJ 2YKMB 1D09B 1FDBA 2G0JA 2EWHA 3DKDA 2ZKUA 4HLBA 4IDKA 1GXLA 1RKIA 3FEZA 3VV2B 1FX2A 4QR0A 3W9JA 4X4PA 3KNAA 2RQMA 2K2PA 2AMCB 4P7VA 2G2OA 3DRRB 2YKOA 5J2MA 3BPDA 4YHHF 2XI2A 3MDFA 3SCKE 1HQUA 3N6LA 4GVLA 5KFSA 2ZH2A 2BE2B 4DV4F 2AGOA 1RK8A 1NRKA 2QA1A 3OHAA 2UXCF 1KHWA 2HVEA 1I1GA 2MKYA 4RBUA 5DETA 4J9MA 2WSCC 3NGTA 4GKJF 1UVKA 4X4TA 5HL7Q 1FESA 4DR3J 2ERRA 4XK8C 2MGZA 3OSNA 1MNEA 2CJYB 2ZITA 3C6TB 1S1XB 1CC7A 4OLOA 1KSPA 4NLSA 3KMQA 2XTJP 1NMEB 1UWBB 2FB0A 2HMIB 3MCMA 4W92B 5DS7A 2WW4A 2R3VA 2SXLA 3IR7B 3TJ8A 3KLHB 3CVKA 3GR1A 3MECB 3MM6A 3U27A 5C42A 1TK8A 1S7HA 2M3DA 2FJEB 2MLXA 4RUBA 2DNYA 3V2UC 3LWMA 4B3TJ 1IQZA 2KRBA 3I5AA 4OZ3A 3LUYA 2G2YA 4N41A 2AYEA 3KHHA 4PAAA 4CH0S 1I3OB 3DOLB 2BR0A 4Q8FA 1FX4A 1RT4A 2GO8A 2RU9A 2YKMA 5ETMA 3QWPA 5KFEA 1FWLA 4CLZA 4J37A 3FSIA 3I0RA 5ETNA 1RT6B 2GW8A 2R4FA 3O2IA 1KKHA 2KXHA 3TP2A 1HBUB 4EYIB 4M5JA 2OHDA 3D66A 3SCJE 5E33A 1FJCA 2FD2A 1HQEB 1ZA2B 2H5EA 3PYGA 4K5SA 3W7BA 1LNQA 2HNZB 3BGRB 5BXIA 2DTJA 4ZDNA 2BQUA 2FVRA 1B7FA 4QPXA 3IM9A 2YWFA 1D3WA 1YJTA 1RWWB 1TTHB 3BKTA 3KDOA 4OV1A 1SJQA 1MMLA 1SKWA 2VC0A 2HFOA 3UWTA 5B7WA 2VA2A 3IBWA 1SUQB 2CPIA 2E9ZA 4K4VA 1WUUA 4Z7YA 1GX6A 1XBWA 3BN4A 4OHWA 3H42A 3MMAB 4ILRA 1MU2B 2D7SA 3THPA 4CQ1A 1G3OA 5KT6A 4E0DA 1YJ7A 2B5JA 1DBDA 4I2QB 3UN2A 4QR2A 2PC6A 2QTWA 4CO2A 4FYXB 3PRBA 5J1EB 3CC2S 5K9FA 1Y4ZB 1H0HB 1HWKA 4LFBJ 2EK1A 5IT0A 3R8YA 2PDAA 1NU4A 3D6TB 4RW9B 4O44A 2H1YA 1BWVA 2BW2A 2CQ2A 3KDNA 4AXIA 1RI7A 4Q44A 4MK7A 1VBZA 2GQQA 4CH7A 5J2NA 3V6DB 5F8GA 2XGPA 3KMSA 2LLZA 2HZCA 3M1VB 3QLHA 1Q86T 2XCPA 1XERA 3M8PA 4IR1A 4I2PB 3ZTRA 1UJ6A 1HBUA 3WX4A 3DLBA 5K8PA 4EK2A 3P8BB 1N36J 1RTDB 2DR8A 2IAJB 2BJEA 2BM1A 5K5MA 2OPQA 4OYXA 3FFIA 3R7SB 1A9NB 3CCWA 1WORA 1RT3A 1UPPA 5B0FA 3JAMY 4X66F 2VOOA 5L46A 1RWNB 1U1QA 2CNLB 1BQMA 2KJVA 3QJJA 2CZ9A 4YY3F 3PRDA 4DQQA 1SQEA 2JLFA 2OGUA 2A2CA 4HT5A 2OEKA 4NI2B 2DVIA 1N52B 3OR2A 1FEHA 1RCOB 1X5SA 3IRWP 1TK5A 1GAOA 2CPJA 2A3JA 2UUBJ 3W62A 4Y3CA 4A8XA 3ISND 2RB7A 4E8UA 4ZIWA 2CQHA 1U8SA 1FFGB 3PYEA 3UO0A 2YPZA 1NBEB 3NWGA 1RADB 4H4MB 4KH1B 5E3RA 4NOHA 2MB0B 4C11A 2K7JA 4DR4F 1LQ9A 1F3FA 2XS2A 1HD0A 3LOUA 4G1QB 2EFVA 5K20B 1NHUA 3M2UA 4K2XA 3DLKB 5JXSA 3TQEA 4DJBA 4V19J 3NNAA 2Z30B 5D4OA 4NYPA 4M95A 4ELVA 3M1VA 1Q8LA 1DTQB 3X3UA 1ZOTA 1S6PB 2CQ0A 4LR9A 3KLGB 4DG1A 1JK9B 4ZMMA 2KG1A 5HMWA 1U24A 1EQ0A 1M1HA 2GHWA 3SMZA 1R0BG 3MF5A 1M5KC 1Z1ZA 3BBFA 4QIVA 5DG8A 4NEYA 2GS8A 2HBYB 1MMDA 2O3DA 2FJAB 4UT4A 1QJHA 3IG1A 2R8GA 2QX0A 3D0IE 4OHYA 2V8PA 1DQ8A 1UJ5A 4H54A 2CVIA 1KTQA 5AT1B 1KBRA 4O4GA 2CZ4A 3HHLD 2H48B 1SH2A 4BC9A 4WTOB 1XQIA 2AEJA 1LK5A 1JLBB 2LQJA 3A3PB 3A3OB 4P75A 3JXOA 2F4FA 4MH8A 3R7BB 3CD5A 4F8RA 2HBRB 3E3XA 1WG1A 1OSCA 1KLMA 3PKYA 4JV1A 4RNFA 1TL7B 3I9V9 4IFVA 2VQFJ 5KG5A 4DUYF 2V5HG 2ABYA 3I5BA 5G0RA 3KLHA 2C28A 4OYMA 4RNNA 2ZE2B 4KY3A 4EO6A 1IBKJ 2XHCA 3D28A 2YH1A 2CG4A 1YX2A 2BJDA 2XS7A 1SB6A 4ELUA 2J0SD 5I3UB 2X1AA 4F25A 2DIVA 3HFKA 4NRUA 4DCPB 2ZHBA 2NLWA 4GC6A 3LWLA 3MR7A 1GH8A 1MLAA 1NEEA 2IM1A 3UFCX 1FXLA 1UTAA 2QEXS 1KQGB 2PEBA 3RR8A 3R5DA 3EGVA 1J2VA 3Q89A 3P5BP 1S6PA 2IY5B 3KLGA 3EWGA 1SJ3P 5D3GA 3GU0A 3Q8PB 5LJ5Y 4F3OA 2MPUA 1RHMB 4JI5F 2J7WA 1S79A 3VZHA 4CDIA 4WFZA 1DARA 4NLRA 5BR8F 2AWZA 4H4KA 1HW8A 4ES2A 2HFUA 1VRQC 1MW7A 5F9NA 4JI1J 2VDHA 3G86A 2IC3A 4HT7A 5CYMB 4L3NA 1HWJA 3W65A 4ENOA 5HVGA 2VASA 3IGVA 1FDAA 3QZ7A 2JVOA 1APSA 1CJUA 2B6AA 2O67A 3K59A 3S1TA 2RRBA 1NO8A 3JB9k 4N76A 2V0NA 2IIHA 4QIGA 2ZH4A 2VQFF 4B3OA 4DR4J 2JWNA 3HPOA 4I4BA 3N9UC 3KK3B 3TJ9A 1Y0HA 4A4JA 1XN9A 2CNKB 2ZD1B 2AJFE 1T3NA 1VQ8S 4I2QA 4FYWB 2ZWPA 2RHQB 1PCAA 1SL1A 3I31A 2VBZA 2HYIB 4LBIA 4F67A 1BLUA 4LF6F 4DL4A 2RUGA 2VU5A 4PEOA 4RW9A 3GJQB 3Q8UA 1NK9A 2HHSA 3SZ2A 2J5AA 2L9NA 1RAFB 1HWUA 3IWXA 3V81B 5M2RA 1GXTA 5DZ7A 4O0IA 1N33F 4RU9A 2E1RA 3HKWA 4D3HA 3D3CJ 1IM6A 2HLUA 5E3AA 1RUSA 4LVOP 2IMOA 5KFNA 4QBUA 1NK8A 1TAUA 4C8KA 1LWEA 1G1XA 1B64A 3D7SB 4OI1A 5KG0A 2ASYA 1R89A 2NXEA 3J81Y 2KM8C 1G6BA 3FBCA 1T7PA 4A8FA 4DL6A 3AXKA 1U2FA 4P7TA 2GMLA 3A12A 5E5NA 4YFUA 5IWAJ 3OUYB 2VQEJ 4CCHA 4A48A 1RTIB 3CPWR 3ELHA 4TN2A 5IWAF 4JI6F 3VAGA 2DRAA 3DCAA 5EX3A 1JKHB 2Z58B 1VGYA 1FA0A 3T3FA 3KYLA 1TFWA 2H4YB 4OI3A 4RNMA 2IFXA 1HNZJ 2RJZA 3IFEA 1S9EB 4J90A 4LRBA 3QGHA 3GYNA 1M1GA 5IXUA 1OMSA 2DT9A 2YWHA 9RUBA 3I32A 1X0PA 1PSDA 3MM6B 3IWNC 2WONB 2J6TA 5DDOC 2RUSA 1FD2A 4ID5B 1YG0A 4OFZA 2G0CA 5HLFA 1F1BB 2POKA 2OAUA 4BS2A 5KG1A 2BQ3A 2UVWA 2PO4A 3RJMB 2QSWA 4MK8A 4B3RF 1N32F 1JWWA 3BSCA 1MG7A 2MQNA 2WOMA 4HACB 4F4XA 3GYXB 3CCJS 4ECZA 3BKUA 2CPHA 2AEMA 3IM8A 5IT9Y 2IHR1 3SCIE 1TV6B 1IWAA 2MZTA 2IPOB 2CJAA 4CT8A 3V5RA 3G2XA 2J9DA 4U67Q 1RTHB 2DJWA 2QZ8A 4QWAA 1HFEL 3L9ZA 1NUEA 2HVIA 2HNYA 3W2VA 5HJXA 1V5VA 2ZH1A 1OYEA 3QGIA 1GT8A 3UDEA 3BN7A 1ZM9A 2EFOA 5JJBA 1AXQA 3OL7A 2W9CA 4EZ6A 3MFIA 2EFQA 2UU9J 4IRKA 2KFNA 2HRYA 3HVAA 2NXJA 5FDLB 1NJIT 2V9KA 1BY9A 2EG2A 1PJ7A 1TL7A 4OZJA 3VGUA 4CT9A 4S0MA 3DLEB 3CJKB 3RAMA 3CDWA 1WG4A 4NLWA 2APOA 3NLCA 1B7YB 3V6HA 3DM2A 3ZFVA 2PIIA 4ANEA 2ZUGA 3EVWA 5J1NA 3R7NB 3M32B 3OTOF 3BS9A 5KFJA 3MD3A 4R8UB 4ZN1A 5CABA 4R25A 4HACA 1V9OA 4B02A 1H2VZ 3QLHB 2HQFA 3W66A 3UVJA 1QDUB 1XMBA 2VPYB 3QIPB 1F6TA 1PC5A 1UEKA 2BKOA 2QLXA 5K8OA 5IS2A 3R5BA 4N8NA 2KM8B 1RWVB 2CWKA 2PT0A 2HHHF 1YRUA 2WBMA 3TOQA 4KHPJ 5A8WB 3DHWC 4DR3F 1HW9A 2I9SA 2J76E 2K1RB 2FDNA 2W1BA 3CSKA 4J9UE 3F73A 4K4YA 1T9TA 1IWGA 3IRXB 2YKQA 2XLIA 3L7OA 1TR0A 2GVZB 1WNEA 2KTQA 1LW0B 4KV8B 3IWLA 5J2QA 3PX0A 3NCRA 2BQRA 2MGZB 3LGMA 4RW7A 1RE1B 3BQ0A 3GIJA 2UZAA 1UWAA 3OLAA 1X9SA 2CG8A 2LXIA 3HHLC 4XDDA 4PQAA 3RZAA 5KFTA 2HMIA 5D4LA 2A10A 3GILA 1Q95G 4AE5A 5EWFA 4RUHA 1RAJA 2Y8WA 2D69A 2GA7A 3AFGA 1HNWJ 2D9PA 1NKEA 2RQKA 4PQUA 4PWDA 3HHLA 2FLOA 2AYMA 4BWMA 4DBQA 3DOLA 3VVTA 5L39A 1CBKA 1X4FA 4G1QA 1C0TA 4IRDA 1S99A 2FC9A 1M5SA 3QNWB 3OTBA 1SJRA 1Q0NA 2Z8QA 1RXOB 3GPAA 3W5XA 3FGVA 4Q0BB 4OI2A 2LVWA 2RIJA 3MR3A 2CKWA 3E51A 5I3PA 1TL3B 3RTVA 4JI6J 3K57A 3P49B 4ECUA 4MJKA 3ILJA 3QT5A 1X4AA 4YY3J 4C98A 2HSEB 3CCVS 1U0HA 1VQ5S 1PC4A 2OH2A 3CEDA 5IT4A 3CCRS 5LMUJ 4LF9J 5LSRA 2HNZA 3BGRA 1Z2LA 2FHKA 2K1RA 4ZOSA 3IG1B 1FJEB 2HHQA 1SBRA 4QWDA 5EDWA 3LGHA 2VJUA 2Y0BB 4DOZA 4L72B 2RU3A 3HD1A 1LW0A 2ZWOA 3UDVA 3N01A 3W5ZA 1V3RA 4JI3J 2EG1A 3C2PA 2XY6A 5KOWA 2GCFA 1FKOA 3KK2A 3ZXWA 2MLYA 4IH6A 2BJ9A 3GLJA 4DEZA 2OIHA 1U1KA 3DLLQ 1FXDA 2QIFA 5KFUA 1LEOA 3SFUA 2B4UA 1SKRA 4JUZA 1OYDA 2CDQA 2RKIB 3W61A 2DPJA 2WONA 2YXLA 1SVDA 2B7CB 4DPXA 3HO1A 2JSXA 3RW7A 2UUTA 1RP5A 3EGWB 2NQPA 3Q8VA 4UZCA 1RT7B 2DGVA 3KK1B 1BGXT 3D3BJ 3EM1A 3P3DA 3H8YA 2AU0A 1FTCA 1CEZA 2JLEA 2JL9A 2B9YA 3NCQA 1RHQB 5A0YA 2ASJA 1HNIB 3H5SA 3TYTA 1Q82T 1N34J 1DRZA 1UPMB 2FUG9 4KGZB 2MYFA 1UZHA 4NE9C 2XZDB 4BC7A 4CI0B 3US5A 1IM4A 4NMXA 4M94A 4L74A 1S1UB 2NSCA 4L3KA 4UQGA 1S1TA 2UUBF 5ADZA 5EN1A 3B8HA 2M70A 3KFWX 3M2VB 3R6LB 4RKUC 2W8LA 1S9FA 4NCBA 3UNGC 2PN6A 2YNIA 2OTLS 2B9EA 3T1YJ 2XMKA 4ZLLA 2JJ4D 1UVNA 2V63A 4NLYA 4O3PA 1N0UA 2QLJB 4F4ZA 3C6UB 2YNFB 2MZJA 2AJ0A 3CO9A 4ALZA 2CNOB 3G82B 4QW9A 1R3NA 3M30B 4KQZA 1FTRA 1TVRB 4A8MP 4YDXA 4QYZJ 3G9CA 3FEYB 1PBAA 2VHGA 3UW1A 3AH6A 3HT3A 3NBPB 4WU3A 1S76D 1DQAA 2Q66A 1YTYA 2XSFA 2CVEA 3VAMA 2ZNZA 4DQIA 2ZBCA 4P74A 4OX9F 4CM2A 2ZJQQ 1FD8A 5DQHA 1IKVB 2YQ3A 1JLAA 1R43A 4C0OC 2HWHA 4X4UA 4ZVGA 1X4GA 2DNLA 1HNIA 2QLBB 3GG0A 2EVZA 2RE1A 2HWIA 4PXEA 1JJHA 2QA4S 1K8AT 4KTQA 3MZIA 4RR5A 1F9HA 1KFDA 1TZ0A 3Q8QB 2BYCA 3RB0A 1OS5A 2ATLA 1UAWA 4X62J 3DGPB 4UUWA 4DUZJ 5H9EJ 3AHPA 1FRMA 2KHCA 3A1YG 1QM9A 1UFKA 1RTIA 4DS4A 4HL9A 3PVXA 1IKYB 4A8SA 1KNZA 8RUCA 3EUNA 5LMNF 2BW7A 4HH0A 2UVVA 2DGOA 2X1GA 4DLEA 5J2QB 5JVGQ 5HJYA 3PO5A 2FVCA 5DDQC 1RA6A 3FSYA 2CJKA 1REVA 1FO1A 4U7UD 4MFBB 4NLUA 1YVFA 3MD1A 1TVRA 3CJ3A 3MR5A 2H65B 4M5GA 5KFDA 2HBZB 1CLFA 2IM3A 5AXMA 4ECRA 2LEPA 1OY9A 1RSCA 1A7GE 1TL4A 2YWGA 4P6QA 1P27B 4ZA1A 2NPIA 1JB0C 4EBEA 1ZM3A 1JLCA 3CGIA 1S6OA 3NY0A 4ZP6A 2A1BA 4MYUA 4NWBA 3ZZRA 1V5IB 1Q8KA 1H7XA 2L3MA 3AA8A 3ZZOA 4DXLA 3TUZC 2HW3A 1QTNB 1U8WA 1WACA 2FLNA 3O44A 1K47A 1VMBA 2GVDB 5F8JA 3T1AA 4JI4F 2IBOA 3QGGA 2KZZA 4XIUA 3ETOA 5IM0A 4WFXA 4MMOA 3M4XA 4CNZA 2ZH5A 3GIRA 2XZWA 4ID8A 4P52A 1U0HB 1RTHA 4OX7A 4FXDA 3I56S 3K5LA 3B82A 1JIHA 4WF9Q 3Q8RB 1U26A 2R8IA 1FRJA 4CLLA 8ATCB 3JAMU 4M5IA 3PDNA 4KHMA 1HI8A 1CG2A 4PXCA 5T41A 4NXNJ 5CYJA 2HHWA 2XZTB 1FKOB 2O01C 4J9OA 1HMVA 4Q5VA 2ZZNA 1SCJB 5C2GA 4FN5A 5J1PA 3NWRA 5AXLA 1IBMJ 4DWIA 4JI3F 2GIQA 1VQOS 4K0KJ 2YWEA 2W2MP 2KG0A 1VJQA 5GAHI 3GTYX 3TI0A 3T9ZA 2DRBA 2PFFB 3ZZYA 2E5IA 3ET6A 3MMJA 3CDUA 1F2GA 1T9VA 3DM2B 4G1IA 4ZLJA 1WG5A 2XWYA 3KNGA 4OZ1A 3H25A 3MM9A 3TVZA 1BQNA 1KHVA 4F3QA 4FXVA 2HBQB 1MN7A 2DNPA 1Y00A 3EYZA 2CJQA 3BM7A 2G1HA 4C8OA 1UA0A 1NK6A 3MCSA 5IZHA 3D9BA 1NK4A 2QE5A 2AF6A 3I0SA 4F0HA 3PJWA 5HP1B 3BSNA 2V8DA 1SQFA 3V4IB 1L3UA 1IKXB 1RT2A 3FBFA 4K4XA 2XS5A 4LMZA 1B0VA 2KKHA 4B9UA 3JTOA 2NUHA 4CO5A 2XMVA 2B43A 3DC2A 3NGKA 4Y2MA 2W9BB 2NXNA 3M2VA 4ZPCA 2RD5C 3VAKA 1VIXA 4RNOA 3FCWA 4X84A 1TK0A 3LP1A 2WK4A 3J7ZT 2DR9A 3HSDA 5KT4A 1MROB 4CYUB 4ZIVA 1PYOB 3I96A 4RW7B 2DXFA 1RWOB 3M30A 1UMJA 2GJFA 2MEWA 2IJRA 3K58A 1Y7PA 3IS9A 1FWKA 5IC6B 5KT7A 1Q1KA 4QIEA 2OD4A 1C4CA 4WYWA 1IBKF 2BANB 2IRYA 1EETB 1YBUA 1BD6A 1Q8BA 2GMJA 2BDPA 2VG5B 4EO8A 3K7RA 5KFQA 5GAEU 1EKRA 4P9SA 3RU0A 4F3MA 2XCAA 5EX0A 1S6UA 4F0KA 3BH7B 4C8MA 2N3LA 2F9JA 5CHCB 1C0TB 3ENQA 3PIPQ 1AUSL 3I87A 2F8EX 2WOMB 2DH9A 3DHXA 4ICLA 2KYZA 5ETQA 4KYZA 1Q81T 2WVCA 4FF4A 1VQKS 1P1LA 4Q0BA 2FZKB 2YKNA 4IG0B 3H7HB 4P71A 1H7WA 3NGUA 1N5TA 2J0QD 3KLIB 1WHWA 1Y11A 2AJ4A 2I38A 1HL6A 3DRPB 1M0SA 4PCQA 3J81j 4EMDA 3DGPA 4MKVA 5F9LA 4K2JA 4L75A 4KAIA 4CZCA 5EGYA 2IMWP 2UP1A 4LIRA 2RILA 1IKYA 4OYOA 4HTJA 2IVMA 5KFMA 3CF5Q 2B4OA 1ZZNA 3CNQP 1AUDA 1XNQF 4ED8A 4HHUA 3LP1B 2BX6A 4WK3A 2KO1A 1UW9A 3RBXA 4QQBA 1A6LA 2N3OA 1NXIA 1MROA 4CYUA 3D0GE 4YB1P 5ETSA 3H90A 4LQ9A 2VC1A 4ZVEA 3TUJC 4ZCMA 1GTEA 1S9GA 1UVLA 3LANA 1U25A 1TELA 4ECWA 1TUWA 4DV4J 1HBOB 2KVIA 3GJTB 4UF4A 3T5LA 2AJ2A 3DRXA 3TZZA 3C8YA 3CCTA 5D0EA 5LM7E 4Y2KA 1RISA 1HI1A 1ZAWA 2V4JB 7AT1B 4BHQA 3BR9A 5F3TA 3KJNB 2ZM6J 2IA6A 4TQRA 4U8YA 1Q4RA 1Z4UA 2MZSA 1TU0B 2I8EA 2NSBA 4OHXA 1HI0P 3SYZA 3C46A 4WKYA 5F3ZA 4FS1A 1F5CA 2B56A 2DO0A 1D1UA 2GGPB 5C2CA 4P2FA 3CD6S 4OZ2A 4DV5J 1GX5A 4FYVB 3EDRB 3MAAA 2HS4A 1SC6A 3LPEA 1Q78A 4PPZA 3CJRA 1QSYA 4XO0A 4X4SA 4XPEA 2HURA 2RDJA 1N54B 1N88A 3T1YF 4GMKA 3AT1B 4NASA 4F0MA 5KAKA 3PKMA 1HPZB 1RWPB 2M2BA 1P8GA 4AL5A 4X64J 3OFGA 2Z0GA 1S48A 4HI2A 2M0GB 3L95X 3OL8A 3MUTP 5E7OB 1D9FA 4Z2XA 3LP0A 4ZPDA 2M4MA 1NHVA 1GMUA 3M05A 4LSLA 1HQUB 3MAHA 1S9GB 1YRTA 4M5LA 4OJHA 3JSMB 1IUJA 5KG6A 4K0KF 2GO9A 5HMYA 3E8OA 1BE4A 3EXYA 2ZVIA 2XYPB 3HDSA 1U6ZA 1S4EA 3ET6B 1YBAA 4IFYB 1SJ1A 2HKEA 1X4BA 3BB5A 4MIBA 4ED2A 1FFWB 1NK5A 3QRQA 5RUBA 4CO3A 2CIMA 3O8WA 2W7AA 1BQNB 4GC7A 2OEMA 4RBVA 4TU8A 4F4WA 4JI1F 3QQCD 3CIZA 3QT6A 3SI8A 3CJTA 2XWXA 1JLEB 1KWMA 2PD1A 1YI2S 3WC2A 1JNRB 3EPIA 3I0SB 4M5NA 4PG5A 2VIHA 5HP1A 2FTRA 3AQOA 1Q8IA 3I9ZA 4KIAA 1H38A 5K8NA 1L3TA 2W8KA 1LFPA 3MMCA 4ILLA 3J81U 2NYIA 3OFFA 4HDGA 5HN0A 2B8QA 4R0JA 5KFLA 4CIOA 4DQRA 3E2EA 3PXGa 1X4HA 1DAXA 5T14A 2V6AA 4I0WA 1FE4A 2RS2A 4Z37A 1WC4A 5L9NA 2UVUA 4CLTA 3GSDA 1QE1B 1HPZA 4RW8B 1EAYC 4NZ6A 2DGUA 4USIA 4ECYA 2MKHA 3N79A 1LWXA 3I55S 1FVQA 1TKTA 4E98A 5AXKA 3FC9A 2BKPA 2M7SA 3HZGA 4ZJOA 4A8YA 2DGSA 1Q5YA 4KPCA 5HANA 3ZTSA 2C3UA 1UA1A 2WAQD 2RKIA 3TUPA 3PJXA 2QMWA 4PWWA 4LUBA 2Z2LA 4OI6A 3SBMA 4ERDA 3TA0A 1C2PA 2DB1A 2YY3A 3GCWP 3SSSA 3PEHA 3V6KA 2HHTA 4DSJA 2W2QP 4YB5A 1AA1B 4WFYA 2PI5A 4J9PA 2QJ3A 5LT5A 3LO3A 4LJMA 2MTLA 4FDFA 1PO6A 2MQQA 4LQ3A 3LA0A 2FIUA 4NCAA 3UD3P 1JLEA 4LF4J 1XTZA 1N5YB 4BLGA 2M8HA 1NJZA 4PUOA 1CS4A 5KTQA 4DUYJ 1S59A 2B51A 5CYQB 3BSOA 2X1FA 1XNQJ 2VKZG 1RAOA 1RLDA 4EU0A 2ZBQA 3GCXP 4M5MA 3IR5B 2OJ3A 1S1VB 3KG0A 1P9QC 3EVOA 2OO4A 1HBMA 2DY9A 5HBMA 4O3RA 2LEBA 2JDJA 2KDOA 5D0RA 3J80Y 2LDIA 3MEDA 4IDKB 4NZ7A 3SQOP 1VQMS 3TZWA 1HYSA 4AXJA 4X65F 4M5HA 3NKYA 2Y1LB 4USTA 9ATCB 4RWXA 1WOSA 1T94A 4W4MA 5KT2A 1YBTA 3NP5A 1WTFA 3NCPA 4WYLA 2YNFA 1FRKA 3T41A 3DXSX 1TKTB 2LQBA 3T1HF 3HFVA 2IAJA 3RUBL 1T8EA 5CQGA 3BV8A 5DLFA 3HP6A 1E6VB 1ZS6A 4C0HA 2JRSA 4ZVHA 2CPZA 4LBHA 4ZJLA 5BYRA 2I6WA 3UQSA 3VF0B 1ZTTA 3PRVA 1ZPWX 4V1Ak 5LXRA 3HM9A 3DOKB 5G4DA 4J9NA 2H4WB 3M8QB 1SQGA 3NOCA 2M9KA 5KFCA 4JYAF 3K5NA 4CTAB 2AYBA 2ZBPA 3PW4A 3RB3A 1JLAB 1RYSA 4LSZB 4N77A 4DF8A 2PMZD 3OR1A 2CAJA 1L5UA 4KT0C 3KWMA 4QYZK 3BO4A 4KBIA 3DDIA 4IYQA 5DDRC 2Q6BA 3HZEA 1RAEB 4WP8A 1BWEA 1M5VC 3T5HA 2GV1A 1ICEB 2MKSA 2VG6B 2DEJA 4PXBA 1S1VA 4IQMA 5HK4A 4DN0A 5KFFA 1VQLS 2PI4A 4GKKF 2DISA 5IT9U 3A8IA 3M2UB 3CCZA 1BQXA 2DR7A 5DRKA 3ZTQA 4AUKA 3MEDB 3CMES 1NSQA 3GG1A 3QGPA 4EFAC 3HMJG 3C16A 3JQJA 4OYAA 4Q2MA 1RLCL 1RB0A 3NXZA 2DNQA 2VV5A 5KFOA 2PMHA 4HDHA 3WBZA 1HR0F 1N32J 3JS9A 3LP0B 1M90T 1YK9A 2CPFA 4LSLB 4LBPA 2JC0A 3B78A 3WX8A 3IS9B 4K4SA 4DN9A 1N4LA 2QLWA 2VZ9A 3MM7B 4I64A 1YZ7A 2QA2A 5C5JA 1RGVA 3BSAA 2GHPA 1FERA 5DO2A 1VYAA 2QT7A 3E01A 2HFVA 1B0TA 3F44A 5T7LB 2I5JA 1B99A 3UD5A 5KFPA 1AFIA 1VLYA 1Q7LB 1U09A 4K8RA 4K4WA 4CTAA 4RLEA 2LYVA 3JYTA 1GFWB 2XSJB 4YB7A 5M2UA 2DEIA 3NL0A 1VHIA 4U95A 4PYAA 2QG9B 1FJGJ 5L1LA
chains in the Genus database with same CATH topology
1HA1A 2C2EA 2CPEA 4PG7A 2XLKA 5DLGA 3GV5B 4JI8F 2ZE2A 2CPYA 4MK9A 4QPTA 2E9TA 2HWTA 3BREA 3FZ2A 6FD1A 3MOJB 2R8JA 2ZDPA 3MMCB 5K14B 4DV5F 1C0UA 4ATNA 1YJRA 2GFFA 3HJFA 1ZTWA 5F0WA 2WCXA 3ULHA 2HGNA 3N6MA 2B9XA 4DV0F 4DF4A 3V6JA 1O0PA 4WIIA 4GO7X 2UXDF 4NLVA 1SJFA 4KGKA 3P5TL 3W3SA 1HNVA 2WB1D 1JNZB 4DV6F 5J2MB 1HNWF 3KJVB 3VWSA 1F5BA 1LWCA 3R5AA 1KR4A 4QIWD 1GXUA 5I3QA 1L3SA 2P6TA 3RW6A 4OJ3A 4PWUA 3QJPA 5JVHQ 4NLTA 1N6QB 3IAS9 2HPUA 1DJ0A 1FEEA 5KG7A 4RZRA 2YX4A 4JV2A 1VS3A 3NS5A 1KVJA 2HVHA 4FNHA 1YSJA 1MMNA 4A8WA 3OLBA 2XMJA 4ITSA 2KB2A 2QO3A 1B0PA 3HX9A 3CCQS 4ED0A 1FRHA 1QAYA 5L38A 3HXMA 3VAFA 1T03B 2MQOA 2E5LF 2YNGA 3GMGA 3PY8A 4WZQA 1RYRA 3DI6B 3RRKA 4YQWA 5AXNA 3TR5A 5GMKa 3TQ1A 2OSRA 2CQCA 5CYQA 2GGPA 4B9TA 1WHVA 3CCLS 2OPSB 4LFCF 4V19X 3O6QA 2D3ZA 1RT2B 2FHJD 2LA4A 3G6VA 3UR0A 2KRRA 3LALA 5HBMB 2FVPA 1RT4B 4HYKA 3TA2A 1DLOB 1CQMA 1R8BA 2ALZA 1DTQA 1MWYA 3LH2S 1KQKA 4F2RA 5AJ3F 4DV7F 4Y34A 1MSWD 2HFZA 3CC4S 2FHMA 1OIAA 2HG4A 3V4MA 4B9NA 3I5CA 5CXTA 3LF0A 3BO2A 2BANA 4QWBA 1QLNA 4KHRA 2R7UA 1X5PA 2YVSA 3DLJA 1JLFA 2N7YA 2VG7B 3MPYA 4O4GB 1M5OC 3GIIA 1XR7A 1FXRA 5BYQA 1FNXH 3KTQA 3NG8A 5A8RA 1DZ5A 4NZ0A 1Q16B 1MU2A 5KFAA 4WXOA 1WF0A 3M6VA 3Q22A 1LK7A 3FRYA 5J1EA 4C2MA 1RTJB 3BJYA 3PV8A 5HLFB 3RAXA 4O44B 3RBEA 2Y0SD 2R7QA 4X4QA 1HNZF 2RRAA 3NNAA 5AE3A 4G3IA 3G6XA 2V8HA 4DFKA 3I4PA 2NUUG 2MZ1A 4K4ZA 2NREA 3GIMA 3IGNA 1FNOA 4I2PA 3D0HE 5D4NA 4O23A 5F41A 4C8LA 2EBGA 4ELTA 1FKAF 3ZZTA 2HHPA 4I69A 1CC8A 4A8OA 2BE2A 5GAGU 5EHHA 3DN9A 2M88A 3AA9A 3UE2A 1WEYA 3M8SA 1M5HA 2DH8A 2U1AA 5HQ8A 1N36F 1QSSA 1X4DA 3M6UA 2QFJA 2J0XA 4PR6A 3MTJA 3MAQA 1C1BA 3CCMS 3C6TA 3SXLA 1LWFB 4BCAA 3KG1A 4EYHB 4B3OB 2HHUA 2CJBA 1UWBA 1WEXA 2Q43A 4Y2AA 3S6EA 4OLPA 1Q79A 3PZPA 4YMEA 3N6NA 1RTJA 2CQDA 3UI3A 1XC9A 3FRZA 3G8QA 1HBMB 4JOUA 4R8UA 3QO9B 4FS2A 1BC6A 2W7PA 4JI7F 2AJQA 3TAMA 1N56A 2DGQA 1S0VA 2K3KA 1LWEB 1HNVB 5KFVA 1R27B 4H4OA 4DDFA 3K5MA 4ZPBA 1D0EA 2ADBA 3OUYA 2VH7A 1NJXA 3I6PA 3QWUA 3H59A 1UKUA 5HMZA 4QW8A 2EK6A 2RT3A 3DMJA 4LSNB 4Y65A 2VPWB 1JKHA 2MDAA 4L6V3 2VONA 4PG6A 2C3OA 4MIWA 5C25A 5DQGA 2IYGA 2MY8A 2MXYA 2HQ3A 1KD1T 1J5OA 5JUMA 4LF8F 2VFVA 1S97A 3LPYA 4O3QA 2YNHB 3UCUP 1ZH5A 4OL8A 4ECSA 2YNGB 3N0VA 2BM0A 2IA0A 2M8DB 1FE0A 3PFEA 2RH3A 1VRTB 2DITA 4ID5A 1QSLA 1IXKA 5GVQA 4AFFA 3B4MA 3BGLA 2DR5A 3LP2A 1HBNB 4RW6B 4ETZA 2CQBA 4ZS6A 1FJ7A 2O5DA 5KT3A 2MZRA 3GQCA 1D8ZA 3UDLA 4TU7A 3RB4A 1JJ4A 4B9MA 3D5MA 4KPYA 2FHJA 2KT3A 2PE8A 2IYIA 1FF2A 4DR1F 3RRHA 1RTDA 5A8KA 2F3JA 2OPQB 4O3NA 4C7QA 2XULA 3HHKA 1KLNA 4PPDA 4WE1A 2HNDB 2F7VA 4FF2A 4OJ1A 5EWGA 2IRUA 4LVNP 3O3LA 2C2RA 2MQMA 3EXCX 4KHPF 3G6ES 3ICLA 2KI2A 2OPPA 4OX6A 5BYSA 3G6YA 3JYTB 1LV5A 2ZNYA 2NS1B 2PSZA 3OFEA 3OXLA 4NA2A 2ILYA 3OR2B 4DR5F 1KFSA 1NNDA 3D54A 3PX4A 2QRRA 2VODA 3KK3A 4ED6A 1TL5A 2JVRA 4RWWA 3MECA 1N5YA 2J9DE 4AYBD 4DX8H 1X9MA 2XNQA 3IXQA 1FVSA 4WJBA 4LF7F 3LP2B 5AE2A 3J7Z5 3H4DA 4DL2A 2CZVC 3V81A 3T5KA 3IN5A 1Y3JA 3BDEA 2KJWA 2J7UA 1HYSB 5KFYA 1SKSA 2D3OR 2CQIA 1VC6A 1TKZA 2GC8A 2LQ9A 4LT6A 1D8YA 2BZ2A 3GWCA 3K2YA 4DG1B 2ZOMA 4QWCA 1FJEB 4TLRA 5MAOA 1IKWB 2WSFC 3MEKA 5F3TA 1FHTA 1QAXA 2W4PA 4WK1A 1KQSR 3BQ2A 2C42A 1R6YA 3SSQA 2VBXA 2F40A 3IRXA 4WFBQ 1YRXA 3I82A 4DR7F 4QJVA 4OJGA 3TA1A 3T9NA 4X4OA 4ED7A 3C6UA 3CDEA 1JLBA 2P5VA 4WKRA 2KT5A 2BRLA 4OQJA 1F5AA 3P96A 4C3KA 5KG3A 3OSPA 3DLHA 2XHWA 3M9OB 5D8HB 2OTJS 1OQ3A 3MMAA 3GV7B 3OR1B 3FEXB 5SUHA 4IFVB 4YR0A 4LFBF 4HEA9 1H98A 2CRLA 4CO1A 1ZAXA 2XNRA 2LCWA 2W9AA 2X1BA 2IRXA 5E0OA 4K4UA 1ZAVA 2RQ4A 4WCEQ 1N5VA 2DNHA 2OFGX 3HF5A 1TP7A 2ZKTA 3NNCA 1VHFA 4O4RA 4Y6IA 3TAMB 2E5GA 3TAPA 4IRCA 4B17A 4NPOA 2D1CA 2C3YA 1FRXA 2AQ4A 1TFYA 4N5SA 1SV5A 2CQ3A 1VIOA 3MEGB 1IR0A 4CNYA 1XR6A 2DNZA 2C22A 1W2BR 3DDKA 1TL1B 3F41A 3MM7A 2OKQA 1ZYQA 2OSQA 5EUHA 3DMJB 2KHDA 3MMBA 3EPGA 5T7LA 4K4TA 2F1FA 5DGBA 5J2PA 2VPXB 2AW0A 3TAQA 1RT5A 3JSYA 2WB4A 2HS3A 4RBTA 3KK2B 2CQ1A 1R8AA 2GQCA 4NA3A 4OI4A 5KFHA 2DNRA 2JLGA 2VBYA 3MOZA 2AP6A 3H4BA 2XEXA 5C42B 3JTNA 1YJUA 5HROB 5E3CA 1QAJA 4EBDA 3QIDA 5H1SV 2BA9A 1I6JA 3CC7S 3J7YI 4RW6A 2ZOFA 3CD0A 5K8MA 1UJ4A 2FJBB 1URNA 3CMAS 1YJNS 1UW4A 2EW9A 2VFRA 5L9XA 5D3GB 3QIPA 1HARA 3UR3C 2XY7A 1DTTB 1K0VA 2EI5A 4TU9A 3S8SA 4O3OA 4QWEA 4N47A 3MXHP 1LWCB 1T3OA 4NLPA 4ZPAA 2AX1A 2XI3A 1HWLA 2FY1A 1NJYA 4WE1B 4AQYF 1SL0A 3K0JA 1LW2B 4ECTA 1YIJS 3G8SA 4LF4F 3CJ4A 3JSBA 5J2PB 2WW8A 3T19A 2FPHX 2AYGA 3H2LA 1RT5B 4C3LA 5L1KA 1FRIA 3DRYA 1U49A 2V4QA 1S49A 3DRSB 3OPKA 1S9EA 4U9RA 2BRKA 1ZM4A 2R8HA 4DFJA 4I6AA 5HROA 2XB2D 3BGFA 1PILA 3ITHA 4PWDB 5I3UA 5F0UA 4DSIA 3MM9B 1QVFR 1OO0B 2B4VA 4Y00A 2KT2A 1QAIA 3QO9A 4QU6A 4ED3A 1S72S 5J2NB 4IOCQ 7FDRA 2XY5A 4F4KA 3LW5C 1KVIA 1DURA 1JLGB 3X1LB 3CUNA 3SV4A 4IOAQ 4NCGB 3ZZZA 1DTTA 1ZM2A 1P6TA 1WD6A 1RKJA 1VFJA 4OZ0A 5F8MA 2FJXA 1V3SA 3FJ2A 3CB4A 2W9BA 2VFTA 1RT3B 2YX1A 1U1RA 3HVTA 4G6VB 5SZTA 2YX7A 1SXLA 2AV5A 2IC3B 1V3ZA 1JLFB 2VG7A 5KFZA 1C1CB 3GFXA 3LAMA 3FMBA 2RDIA 3M2RB 2B6AB 1SH3A 2LEAA 3THTA 1YQHA 2FGCA 4B3SF 5FIIA 4UW2A 3TRGA 4QU7A 4HVZA 4ZLPA 4UY85 4EEYA 4ZP8A 2FLPA 3TANA 4C0BA 3IO1A 4PXDA 1Q53A 2HVZA 2BOPA 2VG5A 4K59A 2IM2A 4C4WA 1N48A 3D1QA 4LIWA 3K8WA 1NKBA 2R7SA 4RUCA 2M52A 1DQ9A 1RQ0A 1XK8A 2GJIA 4FPRA 3C3LA 3BQ1A 1XMOF 2DNNA 3DLKA 3FDSA 3I0RB 2IJNA 1JLGA 2DK2A 2CFXA 5FLXY 2K3IA 3PO4A 3DRPA 3OBIA 2MKIA 3NMAA 3MEGA 5B0DA 2VQEF 2D3UA 5A8KB 3CCSS 1VC5A 1R8PA 2B7BB 5KG2A 3QAEA 1TL1A 3M9NB 2FGOA 2HHVA 3FMWA 2R2UA 3SEOA 2HNDA 3POTB 1VJWA 2COLA 5DGAA 4JI2F 3K5OA 3MMBB 3HVWA 4X2BA 2MKJA 3OFHA 3H40A 2OPPB 3R1LA 2NR0A 3PACA 5KFXA 2KN4A 2IM0A 2DGXA 2BV3A 3KLVA 2UU9F 3AAWB 3LAKA 3SDEA 4QYRA 3GV8B 4UOCA 2XMUA 3Q2SC 2EFNA 4C97A 1PGZA 1W25A 1WHYA 2GQ2A 1HNXF 2J8AA 5DQIA 2R7VA 2LA6A 4KR0B 2G4BA 2W24A 4ZHRA 2YH0A 2FLLA 5HO4A 4FP9A 3DLGB 5I42A 2EC0A 3ZC4A 2U2FA 1S0NA 3BGUA 3H98A 2EFPA 1IKXA 2EFGA 2MKKA 3CCES 3MEEA 4ECXA 1QY7A 3OXGA 2L9WA 5L1IA 2MHEA 3I4HX 1VQNS 1S10A 1Y9OA 4HHJA 3TVKA 3KLFA 3M9MB 2W4DA 1IBLF 3OJUA 3RAQA 3OHBA 1U48A 1RWUA 4YEAA 1P1TA 3R1HA 3HKZD 5L1JA 1J5EF 5EWEA 3F56A 2W4CA 5C25B 2JEGA 4OHZA 1J5OB 2L08A 4DV3F 4TNOA 1KC8T 2B0GA 5CCMA 3NMRA 2Q79A 2CQGA 4DSFA 1KOOA 5DM7Q 2V4RA 2WHOA 2FJWA 3O5TB 5A6WA 4NLXA 2JC1A 4UY8T 4U7UK 1EETA 1WTBA 3Q0AA 1KTVA 1ZBTA 2GX8A 2Q6CA 1UP1A 2JHEA 4I1TA 1URRA 2A2DA 3PW5A 1U1LA 2X51A 2E7WA 3SCLE 1FCAA 4IUFA 1VOMA 1OPIA 3JTPA 1UVJA 1JXLA 1OWXA 2VL1A 2DNKA 2KYXA 3DLGA 5I42B 2KFYA 3U02A 2LECA 4BWJA 4JBCA 2E1MC 3OVSA 1U1MA 4FXWA 1DHMA 3TVZA 4U7CA 3D1OA 4ZCKA 1VI7A 3S01A 3TUIC 2V8VA 4LF9F 3SFGA 3PR4A 3AY0A 5A8WA 5MLCV 3KLFB 3T6BA 4QIFA 4QZVB 2I2YA 4NLGA 2RF2B 1Q7YT 3BDPA 4I7FB 5M2PA 4EBCA 3UDCA 3IAM9 3MTKA 1L3KA 5LSOA 2AD9A 3L7PA 2E9RX 3LQVA 3PEJA 2DHXA 4EZ9A 2QMXA 3KKFA 2NZ4A 2C3MA 4DS5A 2LU1A 2DH7A 3H20A 2VKRA 5F8LA 3NRBA 5G0RB 4B3TF 2ROPA 4C8NA 2B5JB 2N7CA 1R8HA 2V2KA 3VZIA 4IH5A 1IN0A 1GQEA 1X5TA 4A46A 4NL5A 4TY9A 1VBYA 1R8CA 4KC5A 2JX2A 1IKVA 3MHYA 3KHRA 3DDNA 4ZK7M 3V6DA 4PUOB 3AJ2A 4NLDA 1TKZB 3MFHA 3Q23A 4OI0A 1X5OA 3M8PB 1S0OA 3V4IA 1TL3A 2MY7A 1VQPS 5B0EA 1HHTP 4CO0A 1IKWA 2V9WA 4OHVA 1QVGR 2VFUA 2UUAF 4LFAF 2Y1RI 3QJLA 3EGNA 3EZ5A 4KSEB 4ZP7A 2ZDOA 4ZCIA 3GB0A 2VB6A 4KO0B 2DBBA 4BDPA 4KKOA 1UL3A 5FJ4A 2M5YA 2LKZA 2R7OA 5CZXA 4RW4A 1KQFB 1YGYA 2HLTA 4NYZA 4MKAA 4EWTA 1E6VA 2OD6A 3QYYA 3EX7B 3JSMA 4Y2IA 4J9RA 4KRWA 1GTHA 4HH1A 1X8DA 1TAQA 4I68A 4NMLA 2JFDA 3U1MA 1T05B 3U1LA 5A6PA 3PW2A 1XNRF 2DO4A 4OZLA 1T02A 3T6JA 4I56A 4YR3A 4IQXA 2FJDB 3GIKA 4YOEA 5B0BA 2JEFA 1JXEA 1FT8A 1NH7A 4DPOA 5IFMA 2NPFA 5DG9A 4CO4A 5D6GA 2PA8D 3FZBA 3H5YA 4C8YA 3M6XA 4URSA 2DGWA 2OMOA 4NCGA 3M6WA 1TKXB 1UFWA 2RNEA 4TYBA 1FDDA 5DG7A 1NB7A 3MEEB 1X7VA 2DNOA 1XR5A 4K50A 4C8ZA 1LKZA 3HVTB 2Q1LA 3T5JA 3TX8A 3CDBA 1R7IA 1K0TA 1RDRA 1IJEB 2BVZA 3CXCR 4URGA 2WBRA 1FRLA 4ZVFA 3TNVA 1OPZA 3EGZA 2VPZB 1RJJA 5HI7A 2Z4PA 2QYCA 2VBWA 4KGMA 2HQIA 2XMWA 4HTIA 3VQSA 4KE5A 4I6YA 3CCUS 2HGLA 2Q3PA 2VFSA 5IQ6A