The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
9
|
sequence length |
81
|
structure length |
81
|
Chain Sequence |
LRLCQVDRCTADMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHDLQEFDEAKRSCRRRLAGHNERRRKSSGE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
A novel zinc-binding motif revealed by solution structures of DNA-binding domains of Arabidopsis SBP-family transcription factors.
pubmed doi rcsb |
| molecule tags |
Dna binding protein
|
| source organism |
Arabidopsis thaliana
|
| molecule keywords |
squamosa promoter binding protein-like 4
|
| total genus |
9
|
| structure length |
81
|
| sequence length |
81
|
| ec nomenclature | |
| pdb deposition date | 2003-09-09 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF03110 | SBP | SBP domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | DNA-binding domain of squamosa promoter binding protein-like 12 (lacking the second zinc- binding site) | Transcription factor, SBP-box domain |
#chains in the Genus database with same CATH superfamily 1UL4 A; 1UL5 A; 1WJ0 A; #chains in the Genus database with same CATH topology 1UL4 A; 1UL5 A; 1WJ0 A; #chains in the Genus database with same CATH homology 1UL4 A; 1UL5 A; 1WJ0 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
