1UL5A

Solution structure of the dna-binding domain of squamosa promoter binding protein-like 7
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
86
structure length
86
Chain Sequence
VARCQVPDCEADISELKGYHKRHRVCLRCATASFVVLDGENKRYCQQCGKFHLLPDFDEGKRSCRRKLERHNNRRKRKPVDKGGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel zinc-binding motif revealed by solution structures of DNA-binding domains of Arabidopsis SBP-family transcription factors.
pubmed doi rcsb
molecule tags Dna binding protein
source organism Arabidopsis thaliana
molecule keywords squamosa promoter binding protein-like 7
total genus 7
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2003-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03110 SBP SBP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.1100.10 Few Secondary Structures Irregular DNA-binding domain of squamosa promoter binding protein-like 12 (lacking the second zinc- binding site) Transcription factor, SBP-box domain 1ul5A01
1WJ0A 1UL5A 1UL4A
chains in the Genus database with same CATH superfamily
1WJ0A 1UL5A 1UL4A
chains in the Genus database with same CATH topology
1WJ0A 1UL5A 1UL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJ0 A;  1UL5 A;  1UL4 A; 
#chains in the Genus database with same CATH topology
 1WJ0 A;  1UL5 A;  1UL4 A; 
#chains in the Genus database with same CATH homology
 1WJ0 A;  1UL5 A;  1UL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...