1ULIB

Biphenyl dioxygenase (bpha1a2) derived from rhodococcus sp. strain rha1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
177
structure length
177
Chain Sequence
FRTKPAPVDPSLQHEIEQFYYWEAKLLNDRRFQEWFDLLAEDIHYFMPIRTTRIMRETAQEYSGAREYAHFDDNAQMMRGRLRKITSDVSWSENPASRTRHVISNVMIVDGEKPGEYHVSSVFIVYRNRLERQLDIFAGERKDILRRTGSEAGFELAKRTILIDQSTILSNNLSFFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Terminal Oxygenase Component of Biphenyl Dioxygenase Derived from Rhodococcus sp. Strain RHA1
pubmed doi rcsb
source organism Rhodococcus sp.
molecule tags Oxidoreductase
molecule keywords biphenyl dioxygenase large subunit
total genus 52
structure length 177
sequence length 177
chains with identical sequence D, F
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uliB00
3RGRA 3FLJA 2BMQB 1TP6A 2GEXA 4XDVA 2BMRB 4HZBB 1Z1SA 3EBTA 4R1KA 3ECFA 4J8TA 2Z77A 1JKGB 3G16A 3IPTA 2QIYA 4R9KA 3E99A 5CK6A 1K41A 1C7HA 1U5OA 1EG9B 4OVMA 5BXQA 2YFLB 3EHCA 2F98A 3T8UA 5IG5A 3BB9A 2PZVA 3LYGA 3CNMA 1O7HB 3DXOA 3GZYB 3F8HA 2CHCA 2HMLB 3DZLA 3JUMA 3NHXA 3NV0A 4HM7B 4WWUC 4WYKA 1O7NB 3SOAA 8CHOA 5D82A 3SEDA 1E3VA 3T8NA 1OUNA 2HMMB 3MSOA 3OWYA 4MJDA 3S5CA 1HKXA 1NDOB 4ORLA 3EN8A 5D83A 1AR0A 1W00A 2K54A 5AIFA 5DRVA 5G2GA 3D9RA 1BUQA 2R4IA 1OHPA 3OV4A 5AEWB 3UNLA 1DMMA 1OHOA 1O7WB 3CPOA 1Q40A 3EX9A 1O7MB 3B4PA 1DMQA 4HKVB 4FCMA 4N3VA 4U13A 2HMJB 1OF5A 4X2HA 2YFIB 5STDA 5CF2A 1ULIB 3MG2A 1GS3A 5TGNA 4XBTA 4LMIA 4Q53A 4XBXA 4XBYA 4HZ9B 3F40A 3H51A 3HK4A 1OGXA 3NM2A 5IG0A 3LZAA 3FZWA 1OPYA 1QMAA 3KZTA 5IG4A 3EQQB 1CQSA 4OUQA 2XSHB 1TUHA 2HMNB 4K1VA 2BNGA 1JB5A 1ZX2A 4HM8B 4LGQA 1Q40B 3JUQA 3MYTA 2OWPA 3OX9A 4I4KA 3MKIA 4WP5A 5EVHA 2GBXB 2B1XB 4HVNA 1JKGA 3KKGA 4CDLA 1QJGA 1W01A 3A76A 2CKFB 2A15A 3ER7A 3F7SA 3OWSA 1O7GB 3OWUA 3F7XA 1JB4A 4HM3B 4HM6B 3G0KA 5AIIA 3B4OA 4PEJA 4HJLB 4WYKB 2GEYA 3EBYA 4HM2B 3DMCA 6STDA 5IF6A 1JN5B 4HM0B 2RGQA 4STDA 3F9SA 4KVHA 3RGAA 1W02A 3CU3A 4L7KA 5AEUB 2HMOB 3M8CA 1EA2A 3HZPA 5DREA 5CXOA 1NWWA 1GYBA 3B7CA 3F14A 3EF8A 3JUPA 4RZMA 1DMNA 3MHEA 1O7PB 5IEOA 2GXFA 3DM8A 5CF1A 5IENA 5JPUA 5KP1A 5KP4A 2XRXB 3FSDA 3HX8A 5FW5A 1GY7A 3BLZA 4X2OA 2RFRA 4HM4B 5AI1A 3NXJA 3EJVA 4HM1B 5BVBA 2XR8B 3VSYA 3G8ZA 2HMKB 3CNXA 4J9AA 5AIHA 3VGNA 2Z7AA 4XDWA 1GY5A 2BMOB 1VZZA 1IDPA 3UJMA 2F99A 3GZRA 4H3UA 3I0YA 2UX0A 4GB5A 5IERA 4L8PA 1OF5B 3FF2A 4FCJA 3MG1A 3SOYA 1JN5A 3GWRA 3Q90A 2F86B 1JB2A 1ZO2A 5D81A 1UUVB 2INXA 4L8OA 3WMDA 5KP3A 3K0ZA 3FGYA 1UUWB 1OGZA 1OHSA 3B8LA 2GBWB 1OH0A 3GRDA 4LEHA 5CLKA 4XM4A 4HM5B 7STDA 4IIAA 1W6YA 2RCDA 3ROBA 3KE7A 1S5AA 1OCVA 3FH1A 3FKAA 2JQ5A 5IEPA 2STDA 5AIGA 1E97A 2I9WA 1STDA 2Z76A 3EC9A 3GZBA 1SJWA 3NBRA 3NUVA 3NV0B 4R9LA 1GY6A 1ASKA 1NU3A 2YFJB 3JUOA 1E3RA 3EN1B 4K1UA 3OXAA 1WQLB 3K7CA 2XSOB 1Q42A 3JUNA 1A2KA 2B24B 5IG3A 1ISKA 2QGUA 3FF0A 3KSPA 5JPPA 3H3HA 2IMJA 3STDA 4XB5A 2W2CA 5HGRA 3DUKA 1ULJB 3F8XA 3GZXB 3MG3A
chains in the Genus database with same CATH superfamily
3LMLA 1FUTA 3CPW2 3HOHA 1VQ63 3VF1A 2JDIH 3QRDA 3K9MC 5CK6A 3E99A 3IMAB 3LXUX 5GSPA 3LTCA 2CX0A 2K3DA 1KQS2 1UCJA 1GOYA 2F98A 4WFOA 2PZVA 1Q9EA 3DXOA 3CCM3 3NHXA 5DRVA 3DZLA 3WA2X 3SX1A 1IVXA 1YVSA 1LVNA 3AMOB 4AEQA 1KWIA 1GMRA 5EQLA 1HYFA 5M18A 1FA3A 5FGOA 2W6JH 3OWYA 3RDEA 1WMOA 4LYLB 1NDOB 3EN8A 5D83A 5AIFA 1RNBA 3FCSB 4RNTA 4CCVA 3D9RA 4AKYA 1PYLA 3J7Yd 5BU4A 1RRLA 4TX4A 1CYVA 3CPOA 1O7MB 3B4PA 1DMQA 4U13A 5STDA 3UL6A 1OF5A 4QWTA 2YFIB 5CF2A 4JRFA 8RNTA 2W03A 3X3ZA 5A0OB 1ROAA 4XBTA 4LMIA 1MWTA 4Q53A 4XBYA 3D5IA 1X1UA 3FZWA 1VQL3 1MNLA 1QMAA 1LQMB 3EQQB 1RN4A 2KXGA 2XSHB 1TUHA 2HMNB 2IYJA 2BNGA 2J8XB 1CYUA 2Y74A 4MMZB 4LGQA 1G02A 3MYTA 2ML5A 5EVHA 3LTAA 1BRGA 3AHSA 4GSPA 1X1XA 2A15A 1BSEA 1LRAA 1M1XB 4RNYA 3I563 1JB4A 1JZOA 1RMSA 4HJLB 1YHQ3 3EBYA 2L4VA 2H0GA 2RGQA 1VQ53 1J2BA 4KVHA 3RGAA 2IUJA 4L7KA 5AEUB 3O8YA 5DREA 2KRTA 5CXOA 1GYBA 3F14A 3CCV3 3EF8A 1ZGXA 3MHEA 4EW5A 1EUIC 2ML6A 5KP4A 2ZA4A 3DGYA 3U97A 2FGTA 1DYUA 1IK3A 1CH0A 2LQVA 3PGBA 4O02B 5M19A 1I3IA 5BVBA 2HMKB 1MWRA 2Z7AA 1A2VA 4XDWA 1GY5A 1I0XA 1N5PA 3D4AA 5IW9A 1FGTA 1DVCA 2W56B 3LT8A 1B20A 2D1WA 1UI7A 3CME3 1GSPA 1IU7A 1EKMA 1RSNA 3GWRA 3Q90A 2CIUA 1JB2A 1R4YA 1V57A 1VQO3 1OH0A 1X1WA 3HI7A 1BNJA 1STFI 2IUKA 2KCDA 2WOHA 4IIAA 1PFPA 3FH1A 3FKAA 1A2PA 1LOWA 1W4NA 4FMDA 4R80A 5IEPA 2W9PA 3EC9A 1STDA 1YIT3 2CFDA 1UW1A 1IVWA 3NBRA 1BSBA 1E3RA 2QEX3 2SARA 1WQLB 3K7CA 2RBIA 1I70A 1A2KA 2B24B 1TU5A 3CC23 3X41A 1NB3I 3FF0A 2CFWA 3JVCA 3STDA 2W2CA 1B2SA 2OOVA 2UUGC 3RGRA 2BMQB 4R4KA 2UGIA 3EBTA 1PU4A 1YVBI 3ECFA 7RNTA 1KC84 2QA43 1RGCA 1TRQA 3G16A 2QIYA 1LOXA 1JZDA 1JBTA 1LQGC 1EG9B 1BIRA 1RCKA 1MOLA 3BB9A 5IG5A 4K90B 2C11A 2HMLB 3NV0A 4HM7B 3SOAA 5D82A 3LT9A 4EV5A 1Q7HA 1UCIA 1OUNA 4KZ1A 3T8NA 3MSOA 1A67A 2OCTA 4MJDA 1Q7Y4 2P09A 3CCU3 1AR0A 1W00A 1EEJA 2K54A 2LYXA 3X42A 1BUQA 2CW9A 4LSOA 1OHOA 1BRSA 1FGQA 1YGEA 3BNBA 1BVIA 5TGNA 2L1SA 5BIRA 1RHLA 1VQK3 3N54B 1VQN3 3F40A 3UB1A 3HK4A 4KT3B 3MPHA 5IG0A 1AVKA 4ILFA 3NBJA 1LXEA 5IG4A 1AV4A 1M1K4 4HM8B 4NREA 5EEOA 3OX9A 1UCLA 3MKIA 1GOVA 4FMBA 4N6OB 1GOUA 1JRQA 2BT3A 3PCSA 4FMCA 4WP5A 2CG1A 4CDLA 2P0XA 2CG0A 3ER7A 1AQZA 1O7GB 3F7XA 2BU4A 1SPUA 4PEJA 4WYKB 2H0HA 3RNTA 4HM2B 3DMCA 6STDA 1BRKA 5G1LA 1FZUA 4HM0B 4N6UA 2XGNA 1EQKA 1W02A 3CU3A 1W2B2 2HMOB 3FG1A 3M8CA 4RBNA 1IQ8A 2RSXA 1TIJA 1X1YA 2BIRA 3LH4A 4HYZA 5AYRB 4RZMA 1B2UA 1RTUA 1B3SA 1O7PB 5IEOA 2GXFA 5JPUA 5KP1A 1K734 1W7CA 1RGAA 1S723 4K61A 1BNSA 2BO9B 3BLZA 5AI1A 1N9EA 4CPKA 1FW7A 3NXJA 1K8A4 1B27A 2XR8B 1D6UA 3G8ZA 1GMPA 4J9AA 1WMNA 4WHAA 1LNIA 1UGIA 3KFQC 2RNTA 1VZZA 2P05A 3NQZA 3UJMA 1PY3A 1QAKA 2F99A 3GZRA 3SXXA 4AKZA 4H3UA 4GB5A 1RN7A 2ZDJA 4FCJA 2KF4A 2MF7A 1MWUA 1OACA 2F86B 4BTXA 4EYCA 5D81A 3CCE3 3WMDA 1B2MA 3FGYA 3GRDA 4KFFA 2GSPA 1MGWA 2P38A 4XM4A 4HM5B 1VQP3 1V74A 1W6YA 1S5AA 2OOVC 2STDA 3V98A 3WHOA 2I9WA 4BU4A 4DKIA 3GZBA 1R4CA 1SJWA 4NPBA 1BNFA 5ELJA 5ELUA 3S5CA 1ASKA 1IT7A 2YFJB 3JUOA 4K1UA 3EN1B 2O3OA 4MMXB 2XSOB 1Q42A 1UGHI 1VQQA 3JUNA 4EC6A 5IG3A 1IYYA 1NNVA 1FGMA 2QGUA 5HOHA 5JPPA 2IMJA 4XB5A 3DUKA 1LNHA 5BXQA 3GZXB 1DETA 1N5HA 1RGLA 1T3BA 3FLJA 1TP6A 2CC3A 3PYJA 9RNTA 2BMRB 1KD14 2CH9A 4R1KA 1FYSA 2PNCA 4J8TA 2ZHXB 4R9KA 3IPTA 3MWZA 3PCRA 1C7HA 1GD4A 4IT7A 2V1LA 1AY7A 4OVMA 3K63A 1QVG2 2YFLB 3CMA3 1UCKA 3A5EA 2W56A 3CCS3 3CNMA 1O7HB 3GZYB 2CFLA 2CHCA 3TDGA 3JUMA 8CHOA 1O7NB 1WNHA 2C10A 1E3VA 1QAFA 2HMMB 1W2ZA 2XGLA 3HIGA 1YJ93 1RJOA 1HKXA 4NHFA 1C54A 1BSAA 1BNIA 3U1WA 2OQEC 2O9UX 1OHPA 2R4IA 3LOYA 4BL3A 2CWVA 1DMMA 1RN1A 3UNLA 1O7WB 5AEWB 1Q40A 1NJI4 1B21A 3SEDA 3CCJ3 2Y73A 2OTL3 3MG2A 4J5GA 2E2UA 3N9HA 3WOEB 1TJDA 1US1A 3H51A 3D79A 1M9GA 3NM2A 4FCZA 1ROVA 1NO3A 3WA3A 1IQXA 2FXTA 1KSIA 5LC7A 4K1VA 1IV7A 4N6NB 1JB5A 3CC43 1RNTA 5I97A 1RGKA 1HZ1A 1Q40B 3JUQA 3N8BA 2OWPA 1N8R4 4I4KA 1K9M4 4KFEA 4BIRA 2B1XB 4HVNA 3CCL3 1RCLA 1QJGA 3OWUA 4EV2A 4HM3B 3F7SA 4HBRA 4HM6B 3SOYA 7GSPA 3G0KA 3B4OA 4RNZA 3KSED 1N9JA 1JN5B 4FMAA 1I2GA 3F9SA 2XEPA 1SARA 1G96A 1K28A 1EA2A 3HZPA 1LOVA 1IT8A 1T2HA 3B7CA 1UUGB 2OTJ3 3JUPA 5CF1A 5IENA 3SLUA 3DM8A 1I2EA 2HOHA 3I553 3PS8A 2XRXB 3FSDA 4N6LA 5FW5A 4X2OA 2RFRA 4HM4B 1UI8A 1WTHA 3S29A 2WGQA 3KCHA 1M904 3AMOA 4HM1B 2Q07A 5G1KA 3VSYA 1RRHA 5RNTA 1U8CB 5AIHA 3VGNA 1BNGA 1YIJ3 3DY5A 1JJ22 2SBLA 3ZG5A 2BMOB 3AHWA 2BHMA 2OQEA 4BTYA 1N8QA 1IDPA 1RKYA 3OW22 1SIIA 1IV9A 3D5GA 3I0YA 4GHOA 2UX0A 3CXC2 3Q3FA 3FF2A 1VQM3 3MG1A 1YJN3 5M1AA 1JN5A 3DGNA 2CWUA 2K0MA 2KF3A 1ZO2A 2KF5A 1UUVB 1V58A 4L8OA 5KP3A 1FUWA 1UUWB 2CFKA 3CD63 2GBWB 1BRHA 1G0TA 1SQWA 1VQ93 1QVF2 1ISKA 3KE7A 2C4BA 2JQ5A 1BAOA 3X40A 5AIGA 4BL2A 1E97A 2Z76A 1I2FA 3NV0B 4R9LA 3GAXA 5G2GA 3ZFZA 5IF6A 1NU3A 5AYSC 1MGRA 6GSPA 3H3HA 1JBSA 1BNEA 1SIHA 2WOFA 1ULJB 3F8XA 3MG3A 1I3FA 3L0RA 3BIRA 3NQYA 2R41A 1FGRA 2GEXA 4MMYB 4JF8A 4N6MA 4HZBB 1Z1SA 4XDVA 1BSCA 2Z77A 1JKGB 2P0MA 4CJNA 3G713 3WOFB 1K41A 1UDII 4N6TA 2XH9A 1U5OA 4LZIA 2W04A 1D6YA 3EHCA 1CEWI 3T8UA 1W6CA 1VQ73 3LYGA 4BTWA 1BRIA 1VQ83 3F8HA 3HIIA 4WWUC 2FNQA 4WYKA 1BOXA 4MEIA 3LTBA 3BNEA 1BGSA 1B2ZA 1W5ZA 3SYUA 1RLSA 1BNRA 1BUJA 4N6V0 2E2TA 3V99A 2XF3A 1T2IA 4ORLA 3PZWA 6RNTA 2M7OA 1NB5I 2W9QA 1RDSA 3FG3A 3LTDA 1AVLA 3OV4A 2WO0A 3BNDA 3EX9A 4HKVB 1YGWA 1Q824 1DE3A 4N3VA 4FCMA 4X2HA 2HMJB 1VQ43 2KAAA 3IJEB 1Q814 1ULIB 1GS3A 1QALA 1WMPA 4XBXA 3WR2A 4HZ9B 1JBRA 1OGXA 1TFOA 4HAAA 2F56A 1GD3A 3LZAA 3S27A 1OPYA 2CK3H 3D3LA 2F4YA 3KZTA 3T0UA 1Y4KA 3X3YA 3Q1CA 1L5GB 4G1MB 4H61A 1IVUA 1CQSA 4OUQA 1Q864 3QK9A 1ZX2A 3NM7A 2CX1A 3ALAA 2YX9A 1LOYA 4O3VA 2GBXB 3NX0A 5LC6A 1JKGA 3KKGA 1IVVA 2F5WA 1W01A 3A76A 2CKFB 3DGMA 4O8SA 2GU3A 1D6ZA 3OWSA 4IPBA 3X3XA 1JNQA 3K5TA 5AIIA 1F8NA 2GEYA 4OK0A 4I5QA 1TRPA 1RGHA 4HOHA 4STDA 3CC73 2D42A 3EE1A 1NWWA 2XFTA 3AGNA 3KN4A 1B2XA 3BU4A 3DH2A 3Q2PA 2GU1A 1DMNA 1BSDA 4FR9A 2IY2A 2AADA 3KIIA 3CCQ3 1FUSA 3HX8A 1GY7A 3WODG 4EBGA 3EB8A 1BU4A 1HU9A 2CWTA 3EJVA 1A90A 1TTOA 2KF6A 3CNXA 1I0VA 3DGOA 1RGFA 3S67A 1DVDA 4O2HA 2MC8A 2Z6BA 2CFGA 1ZS7A 3ZG0A 5IERA 2H0IA 4L8PA 1OF5B 1I8VA 3SVAA 1TFKA 1RGEA 2W0QA 2WGOA 3CCR3 4EXRA 3NBBA 1RGGA 1YNVX 2E2VA 2IA7A 3G4S3 2INXA 1JV2B 3K0ZA 3AGOA 4J5KA 1OGZA 1OHSA 1GMQA 3B8LA 4LEHA 5CLKA 3WDGB 7STDA 3ROBA 3GSPA 2RCDA 1YI23 1OCVA 3BNCA 5JBSA 1T5YA 1MWSA 1W6GA 4GL6A 2AAEA 3S28A 2XFSA 1FGOA 3G6E3 1BRNL 3NUVA 1BANA 3DGLA 3UL5A 1GY6A 2F5MA 3PXMA 4ZM8A 3OXAA 1BRJA 4KFDA 3KSPA 3FG4A 3V92A 3URPA 5HGRA 1YJW3 2ZL8A 1IQYA
chains in the Genus database with same CATH topology
3LMLA 3CPW2 1VQ63 3VF1A 2JDIH 3QRDA 3K9MC 5CK6A 3E99A 3IMAB 3LXUX 3LTCA 1KQS2 2F98A 4WFOA 2PZVA 3DXOA 3CCM3 3NHXA 5DRVA 3DZLA 3WA2X 3SX1A 1IVXA 1LVNA 3AMOB 4AEQA 1KWIA 5EQLA 1FA3A 5FGOA 2W6JH 3OWYA 3RDEA 1WMOA 1NDOB 3EN8A 5D83A 5AIFA 3FCSB 4CCVA 3D9RA 4AKYA 3J7Yd 1RRLA 4TX4A 1CYVA 3CPOA 1O7MB 3B4PA 1DMQA 4U13A 5STDA 3UL6A 1OF5A 4QWTA 2YFIB 5CF2A 4JRFA 2W03A 3X3ZA 5A0OB 1ROAA 4XBTA 4LMIA 4Q53A 4XBYA 3FZWA 1VQL3 1MNLA 1QMAA 3EQQB 2KXGA 2XSHB 1TUHA 2HMNB 1CYUA 2BNGA 2Y74A 4MMZB 4LGQA 3MYTA 2ML5A 5EVHA 3LTAA 2A15A 1M1XB 4RNYA 1JB4A 4HJLB 1YHQ3 3EBYA 2L4VA 2RGQA 1VQ53 1J2BA 4KVHA 3RGAA 2IUJA 4L7KA 5AEUB 3O8YA 5DREA 2KRTA 5CXOA 1GYBA 3F14A 3CCV3 3EF8A 3MHEA 5KP4A 2ML6A 3U97A 2FGTA 1DYUA 1IK3A 2LQVA 3PGBA 4O02B 5BVBA 2HMKB 2Z7AA 1A2VA 4XDWA 1GY5A 1N5PA 5IW9A 3I563 2W56B 1FGTA 1DVCA 3LT8A 2D1WA 3CME3 1UI7A 1IU7A 1EKMA 3GWRA 3Q90A 2CIUA 1JB2A 1VQO3 1OH0A 3HI7A 1STFI 2IUKA 2KCDA 2WOHA 4IIAA 1PFPA 3FH1A 3FKAA 1W4NA 5IEPA 4FMDA 4R80A 2W9PA 3EC9A 1STDA 1YIT3 2CFDA 1UW1A 1IVWA 3NBRA 1E3RA 2QEX3 1WQLB 3K7CA 1A2KA 2B24B 1TU5A 3CC23 3X41A 1NB3I 3FF0A 2CFWA 3JVCA 3STDA 2W2CA 2OOVA 3RGRA 2BMQB 4R4KA 1KC84 3EBTA 1PU4A 1YVBI 3ECFA 2QA43 3G16A 2QIYA 1LOXA 1EG9B 1MOLA 3BB9A 5IG5A 4K90B 2C11A 2HMLB 3NV0A 4HM7B 3SOAA 5D82A 3LT9A 4EV5A 3T8NA 4KZ1A 1OUNA 3MSOA 1A67A 2OCTA 4MJDA 1Q7Y4 2P09A 3CCU3 1AR0A 1W00A 2K54A 2LYXA 1BUQA 3X42A 2CW9A 4LSOA 1OHOA 1FGQA 1YGEA 3BNBA 5TGNA 1VQK3 3N54B 1VQN3 3F40A 3UB1A 3HK4A 3MPHA 5IG0A 1AVKA 3NBJA 1LXEA 5IG4A 1AV4A 1M1K4 4HM8B 4NREA 5EEOA 3OX9A 4N6OB 3MKIA 4FMBA 4WP5A 1JRQA 2BT3A 3PCSA 4FMCA 2CG1A 4CDLA 2P0XA 2CG0A 3ER7A 1O7GB 3F7XA 1SPUA 4PEJA 4WYKB 4HM2B 3DMCA 6STDA 4HM0B 4N6UA 2XGNA 1EQKA 1W02A 3CU3A 1W2B2 2HMOB 3FG1A 3M8CA 4RBNA 1IQ8A 2RSXA 1TIJA 3LH4A 4HYZA 5AYRB 4RZMA 1K734 1O7PB 5IEOA 2GXFA 5JPUA 5KP1A 1W7CA 1S723 4K61A 2BO9B 3BLZA 5AI1A 1N9EA 3NXJA 1K8A4 2XR8B 1D6UA 3G8ZA 4J9AA 1WMNA 4WHAA 3KFQC 1VZZA 2P05A 3NQZA 3UJMA 1QAKA 2F99A 3GZRA 3SXXA 4AKZA 4H3UA 4GB5A 1RN7A 2ZDJA 4FCJA 2MF7A 2F86B 1OACA 4BTXA 4EYCA 3CCE3 5D81A 3WMDA 3FGYA 3GRDA 4KFFA 2P38A 4XM4A 4HM5B 1VQP3 1V74A 1W6YA 1S5AA 2OOVC 2STDA 3V98A 2I9WA 3GZBA 1R4CA 1SJWA 5ELJA 5ELUA 3S5CA 1ASKA 1IT7A 2YFJB 3JUOA 4K1UA 3EN1B 2O3OA 4MMXB 2XSOB 1Q42A 3JUNA 4EC6A 5IG3A 1FGMA 2QGUA 5JPPA 2IMJA 4XB5A 3DUKA 1LNHA 5BXQA 3GZXB 1N5HA 3FLJA 3PYJA 1TP6A 2CC3A 1KD14 2BMRB 2CH9A 4R1KA 2PNCA 4J8TA 4R9KA 3IPTA 3MWZA 3PCRA 1C7HA 1GD4A 4IT7A 2V1LA 4OVMA 3K63A 1QVG2 2YFLB 3CMA3 2W56A 3CCS3 3CNMA 1O7HB 3GZYB 2CFLA 2CHCA 3TDGA 3JUMA 8CHOA 1O7NB 1WNHA 2C10A 1E3VA 1QAFA 2HMMB 1W2ZA 2XGLA 3HIGA 1YJ93 1RJOA 1HKXA 4NHFA 3U1WA 2OQEC 2O9UX 1OHPA 2R4IA 3LOYA 5AEWB 2CWVA 1DMMA 3UNLA 1NJI4 1O7WB 1Q40A 3SEDA 3CCJ3 2Y73A 2OTL3 3MG2A 2E2UA 3N9HA 3WOEB 1US1A 3H51A 3NM2A 1M9GA 4FCZA 1ROVA 1NO3A 3WA3A 1IQXA 2FXTA 1KSIA 5LC7A 4K1VA 1IV7A 4N6NB 1JB5A 3CC43 5I97A 1Q40B 3JUQA 3N8BA 2OWPA 1N8R4 4I4KA 1K9M4 4KFEA 2B1XB 4HVNA 3CCL3 1QJGA 3OWUA 4EV2A 4HM3B 3F7SA 4HBRA 4HM6B 3SOYA 3G0KA 3B4OA 4RNZA 3KSED 1N9JA 1JN5B 4FMAA 3F9SA 2XEPA 1G96A 1K28A 1EA2A 3HZPA 1IT8A 3B7CA 2OTJ3 3JUPA 5CF1A 5IENA 3DM8A 3I553 3PS8A 2XRXB 3FSDA 4N6LA 5FW5A 4X2OA 2RFRA 4HM4B 1UI8A 1WTHA 3S29A 2WGQA 1M904 3AMOA 4HM1B 2Q07A 3VSYA 1RRHA 1U8CB 5AIHA 3VGNA 1YIJ3 3DY5A 1JJ22 2SBLA 4BTYA 2BMOB 2OQEA 2BHMA 3OW22 1N8QA 1IDPA 1RKYA 1SIIA 1IV9A 3I0YA 2UX0A 3CXC2 3FF2A 1VQM3 3MG1A 1YJN3 1JN5A 3DGNA 2CWUA 2K0MA 1ZO2A 1UUVB 4L8OA 5KP3A 1FUWA 1UUWB 2CFKA 3CD63 2GBWB 1SQWA 1VQ93 1QVF2 1ISKA 3KE7A 2JQ5A 3X40A 5AIGA 1E97A 2Z76A 3NV0B 4R9LA 3GAXA 5G2GA 5IF6A 1NU3A 5AYSC 3H3HA 1SIHA 2WOFA 1ULJB 3F8XA 3MG3A 3L0RA 3NQYA 4N6MA 4XDVA 1FGRA 2GEXA 4MMYB 4JF8A 3SLUA 4HZBB 1Z1SA 2Z77A 1JKGB 2P0MA 3G713 3WOFB 1K41A 4N6TA 2XH9A 1U5OA 4LZIA 2W04A 1D6YA 3EHCA 1CEWI 3T8UA 1W6CA 1VQ73 3LYGA 4BTWA 1VQ83 3F8HA 3HIIA 4WWUC 2FNQA 4WYKA 4MEIA 3LTBA 3BNEA 1W5ZA 4N6V0 2E2TA 3V99A 2XF3A 4ORLA 3PZWA 2M7OA 1NB5I 2W9QA 3FG3A 3LTDA 1AVLA 3OV4A 2WO0A 3BNDA 3EX9A 4HKVB 1Q824 4N3VA 4FCMA 4X2HA 2HMJB 1VQ43 3IJEB 1Q814 1ULIB 1GS3A 1QALA 1WMPA 4XBXA 4HZ9B 1OGXA 1TFOA 1GD3A 3LZAA 3S27A 1OPYA 2CK3H 3D3LA 3KZTA 3T0UA 3X3YA 1Y4KA 3Q1CA 1L5GB 4G1MB 4H61A 1IVUA 1CQSA 4OUQA 1Q864 3QK9A 1ZX2A 3NM7A 3ALAA 2YX9A 4O3VA 2GBXB 3NX0A 5LC6A 1JKGA 3KKGA 1IVVA 4O8SA 1W01A 3A76A 2CKFB 3DGMA 3X3XA 2GU3A 1D6ZA 3OWSA 4IPBA 1JNQA 3K5TA 5AIIA 1F8NA 2GEYA 4OK0A 4STDA 3CC73 2D42A 3EE1A 1NWWA 2XFTA 3KN4A 3Q2PA 2GU1A 1DMNA 4FR9A 3KIIA 3CCQ3 3HX8A 1GY7A 3WODG 4EBGA 3EB8A 1HU9A 2CWTA 3EJVA 1A90A 3CNXA 3DGOA 3S67A 1DVDA 4O2HA 2MC8A 2Z6BA 2CFGA 5IERA 4L8PA 1OF5B 3SVAA 1TFKA 2W0QA 2WGOA 3CCR3 4EXRA 3NBBA 2E2VA 2IA7A 3G4S3 2INXA 1JV2B 3K0ZA 1OGZA 1OHSA 3B8LA 5CLKA 4LEHA 3WDGB 7STDA 3ROBA 1YI23 2RCDA 1OCVA 3BNCA 5JBSA 1T5YA 4GL6A 1W6GA 3S28A 2XFSA 1FGOA 3G6E3 3NUVA 3DGLA 3UL5A 1GY6A 3PXMA 4ZM8A 3OXAA 4KFDA 3KSPA 3FG4A 3V92A 5HGRA 1YJW3 2ZL8A 1IQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGR A;  3FLJ A;  2BMQ B;  1TP6 A;  2GEX A;  4XDV A;  2BMR B;  4HZB B;  1Z1S A;  3EBT A;  4R1K A;  3ECF A;  4J8T A;  2Z77 A;  1JKG B;  3G16 A;  3IPT A;  2QIY A;  4R9K A;  3E99 A;  5CK6 A;  1K41 A;  1C7H A;  1U5O A;  1EG9 B;  4OVM A;  5BXQ A;  2YFL B;  3EHC A;  2F98 A;  3T8U A;  5IG5 A;  3BB9 A;  2PZV A;  3LYG A;  3CNM A;  1O7H B;  3DXO A;  3GZY B;  3F8H A;  2CHC A;  2HML B;  3DZL A;  3JUM A;  3NHX A;  3NV0 A;  4HM7 B;  4WWU C;  4WYK A;  1O7N B;  3SOA A;  8CHO A;  5D82 A;  3SED A;  1E3V A;  3T8N A;  1OUN A;  2HMM B;  3MSO A;  3OWY A;  4MJD A;  3S5C A;  1HKX A;  1NDO B;  4ORL A;  3EN8 A;  5D83 A;  1AR0 A;  1W00 A;  2K54 A;  5AIF A;  5DRV A;  5G2G A;  3D9R A;  1BUQ A;  2R4I A;  1OHP A;  3OV4 A;  5AEW B;  3UNL A;  1DMM A;  1OHO A;  1O7W B;  3CPO A;  1Q40 A;  3EX9 A;  1O7M B;  3B4P A;  1DMQ A;  4HKV B;  4FCM A;  4N3V A;  4U13 A;  2HMJ B;  1OF5 A;  4X2H A;  2YFI B;  5STD A;  5CF2 A;  1ULI B;  3MG2 A;  1GS3 A;  5TGN A;  4XBT A;  4LMI A;  4Q53 A;  4XBX A;  4XBY A;  4HZ9 B;  3F40 A;  3H51 A;  3HK4 A;  1OGX A;  3NM2 A;  5IG0 A;  3LZA A;  3FZW A;  1OPY A;  1QMA A;  3KZT A;  5IG4 A;  3EQQ B;  1CQS A;  4OUQ A;  2XSH B;  1TUH A;  2HMN B;  4K1V A;  2BNG A;  1JB5 A;  1ZX2 A;  4HM8 B;  4LGQ A;  1Q40 B;  3JUQ A;  3MYT A;  2OWP A;  3OX9 A;  4I4K A;  3MKI A;  4WP5 A;  5EVH A;  2GBX B;  2B1X B;  4HVN A;  1JKG A;  3KKG A;  4CDL A;  1QJG A;  1W01 A;  3A76 A;  2CKF B;  2A15 A;  3ER7 A;  3F7S A;  3OWS A;  1O7G B;  3OWU A;  3F7X A;  1JB4 A;  4HM3 B;  4HM6 B;  3G0K A;  5AII A;  3B4O A;  4PEJ A;  4HJL B;  4WYK B;  2GEY A;  3EBY A;  4HM2 B;  3DMC A;  6STD A;  5IF6 A;  1JN5 B;  4HM0 B;  2RGQ A;  4STD A;  3F9S A;  4KVH A;  3RGA A;  1W02 A;  3CU3 A;  4L7K A;  5AEU B;  2HMO B;  3M8C A;  1EA2 A;  3HZP A;  5DRE A;  5CXO A;  1NWW A;  1GYB A;  3B7C A;  3F14 A;  3EF8 A;  3JUP A;  4RZM A;  1DMN A;  3MHE A;  1O7P B;  5IEO A;  2GXF A;  3DM8 A;  5CF1 A;  5IEN A;  5JPU A;  5KP1 A;  5KP4 A;  2XRX B;  3FSD A;  3HX8 A;  5FW5 A;  1GY7 A;  3BLZ A;  4X2O A;  2RFR A;  4HM4 B;  5AI1 A;  3NXJ A;  3EJV A;  4HM1 B;  5BVB A;  2XR8 B;  3VSY A;  3G8Z A;  2HMK B;  3CNX A;  4J9A A;  5AIH A;  3VGN A;  2Z7A A;  4XDW A;  1GY5 A;  2BMO B;  1VZZ A;  1IDP A;  3UJM A;  2F99 A;  3GZR A;  4H3U A;  3I0Y A;  2UX0 A;  4GB5 A;  5IER A;  4L8P A;  1OF5 B;  3FF2 A;  4FCJ A;  3MG1 A;  3SOY A;  1JN5 A;  3GWR A;  3Q90 A;  2F86 B;  1JB2 A;  1ZO2 A;  5D81 A;  1UUV B;  2INX A;  4L8O A;  3WMD A;  5KP3 A;  3K0Z A;  3FGY A;  1UUW B;  1OGZ A;  1OHS A;  3B8L A;  2GBW B;  1OH0 A;  3GRD A;  4LEH A;  5CLK A;  4XM4 A;  4HM5 B;  7STD A;  4IIA A;  1W6Y A;  2RCD A;  3ROB A;  3KE7 A;  1S5A A;  1OCV A;  3FH1 A;  3FKA A;  2JQ5 A;  5IEP A;  2STD A;  5AIG A;  1E97 A;  2I9W A;  1STD A;  2Z76 A;  3EC9 A;  3GZB A;  1SJW A;  3NBR A;  3NUV A;  3NV0 B;  4R9L A;  1GY6 A;  1ASK A;  1NU3 A;  2YFJ B;  3JUO A;  1E3R A;  3EN1 B;  4K1U A;  3OXA A;  1WQL B;  3K7C A;  2XSO B;  1Q42 A;  3JUN A;  1A2K A;  2B24 B;  5IG3 A;  1ISK A;  2QGU A;  3FF0 A;  3KSP A;  5JPP A;  3H3H A;  2IMJ A;  3STD A;  4XB5 A;  2W2C A;  5HGR A;  3DUK A;  1ULJ B;  3F8X A;  3GZX B;  3MG3 A; 
#chains in the Genus database with same CATH topology
 3LML A;  1FUT A;  3CPW 2;  3HOH A;  1VQ6 3;  3VF1 A;  2JDI H;  3QRD A;  3K9M C;  5CK6 A;  3E99 A;  3IMA B;  3LXU X;  5GSP A;  3LTC A;  2CX0 A;  2K3D A;  1KQS 2;  1UCJ A;  1GOY A;  2F98 A;  4WFO A;  2PZV A;  1Q9E A;  3DXO A;  3CCM 3;  3NHX A;  5DRV A;  3DZL A;  3WA2 X;  3SX1 A;  1IVX A;  1YVS A;  1LVN A;  3AMO B;  4AEQ A;  1KWI A;  1GMR A;  5EQL A;  1HYF A;  5M18 A;  1FA3 A;  5FGO A;  2W6J H;  3OWY A;  3RDE A;  1WMO A;  4LYL B;  1NDO B;  3EN8 A;  5D83 A;  5AIF A;  1RNB A;  3FCS B;  4RNT A;  4CCV A;  3D9R A;  4AKY A;  1PYL A;  3J7Y d;  5BU4 A;  1RRL A;  4TX4 A;  1CYV A;  3CPO A;  1O7M B;  3B4P A;  1DMQ A;  4U13 A;  5STD A;  3UL6 A;  1OF5 A;  4QWT A;  2YFI B;  5CF2 A;  4JRF A;  8RNT A;  2W03 A;  3X3Z A;  5A0O B;  1ROA A;  4XBT A;  4LMI A;  1MWT A;  4Q53 A;  4XBY A;  3D5I A;  1X1U A;  3FZW A;  1VQL 3;  1MNL A;  1QMA A;  1LQM B;  3EQQ B;  1RN4 A;  2KXG A;  2XSH B;  1TUH A;  2HMN B;  2IYJ A;  2BNG A;  2J8X B;  1CYU A;  2Y74 A;  4MMZ B;  4LGQ A;  1G02 A;  3MYT A;  2ML5 A;  5EVH A;  3LTA A;  1BRG A;  3AHS A;  4GSP A;  1X1X A;  2A15 A;  1BSE A;  1LRA A;  1M1X B;  4RNY A;  3I56 3;  1JB4 A;  1JZO A;  1RMS A;  4HJL B;  1YHQ 3;  3EBY A;  2L4V A;  2H0G A;  2RGQ A;  1VQ5 3;  1J2B A;  4KVH A;  3RGA A;  2IUJ A;  4L7K A;  5AEU B;  3O8Y A;  5DRE A;  2KRT A;  5CXO A;  1GYB A;  3F14 A;  3CCV 3;  3EF8 A;  1ZGX A;  3MHE A;  4EW5 A;  1EUI C;  2ML6 A;  5KP4 A;  2ZA4 A;  3DGY A;  3U97 A;  2FGT A;  1DYU A;  1IK3 A;  1CH0 A;  2LQV A;  3PGB A;  4O02 B;  5M19 A;  1I3I A;  5BVB A;  2HMK B;  1MWR A;  2Z7A A;  1A2V A;  4XDW A;  1GY5 A;  1I0X A;  1N5P A;  3D4A A;  5IW9 A;  1FGT A;  1DVC A;  2W56 B;  3LT8 A;  1B20 A;  2D1W A;  1UI7 A;  3CME 3;  1GSP A;  1IU7 A;  1EKM A;  1RSN A;  3GWR A;  3Q90 A;  2CIU A;  1JB2 A;  1R4Y A;  1V57 A;  1VQO 3;  1OH0 A;  1X1W A;  3HI7 A;  1BNJ A;  1STF I;  2IUK A;  2KCD A;  2WOH A;  4IIA A;  1PFP A;  3FH1 A;  3FKA A;  1A2P A;  1LOW A;  1W4N A;  4FMD A;  4R80 A;  5IEP A;  2W9P A;  3EC9 A;  1STD A;  1YIT 3;  2CFD A;  1UW1 A;  1IVW A;  3NBR A;  1BSB A;  1E3R A;  2QEX 3;  2SAR A;  1WQL B;  3K7C A;  2RBI A;  1I70 A;  1A2K A;  2B24 B;  1TU5 A;  3CC2 3;  3X41 A;  1NB3 I;  3FF0 A;  2CFW A;  3JVC A;  3STD A;  2W2C A;  1B2S A;  2OOV A;  2UUG C;  3RGR A;  2BMQ B;  4R4K A;  2UGI A;  3EBT A;  1PU4 A;  1YVB I;  3ECF A;  7RNT A;  1KC8 4;  2QA4 3;  1RGC A;  1TRQ A;  3G16 A;  2QIY A;  1LOX A;  1JZD A;  1JBT A;  1LQG C;  1EG9 B;  1BIR A;  1RCK A;  1MOL A;  3BB9 A;  5IG5 A;  4K90 B;  2C11 A;  2HML B;  3NV0 A;  4HM7 B;  3SOA A;  5D82 A;  3LT9 A;  4EV5 A;  1Q7H A;  1UCI A;  1OUN A;  4KZ1 A;  3T8N A;  3MSO A;  1A67 A;  2OCT A;  4MJD A;  1Q7Y 4;  2P09 A;  3CCU 3;  1AR0 A;  1W00 A;  1EEJ A;  2K54 A;  2LYX A;  3X42 A;  1BUQ A;  2CW9 A;  4LSO A;  1OHO A;  1BRS A;  1FGQ A;  1YGE A;  3BNB A;  1BVI A;  5TGN A;  2L1S A;  5BIR A;  1RHL A;  1VQK 3;  3N54 B;  1VQN 3;  3F40 A;  3UB1 A;  3HK4 A;  4KT3 B;  3MPH A;  5IG0 A;  1AVK A;  4ILF A;  3NBJ A;  1LXE A;  5IG4 A;  1AV4 A;  1M1K 4;  4HM8 B;  4NRE A;  5EEO A;  3OX9 A;  1UCL A;  3MKI A;  1GOV A;  4FMB A;  4N6O B;  1GOU A;  1JRQ A;  2BT3 A;  3PCS A;  4FMC A;  4WP5 A;  2CG1 A;  4CDL A;  2P0X A;  2CG0 A;  3ER7 A;  1AQZ A;  1O7G B;  3F7X A;  2BU4 A;  1SPU A;  4PEJ A;  4WYK B;  2H0H A;  3RNT A;  4HM2 B;  3DMC A;  6STD A;  1BRK A;  5G1L A;  1FZU A;  4HM0 B;  4N6U A;  2XGN A;  1EQK A;  1W02 A;  3CU3 A;  1W2B 2;  2HMO B;  3FG1 A;  3M8C A;  4RBN A;  1IQ8 A;  2RSX A;  1TIJ A;  1X1Y A;  2BIR A;  3LH4 A;  4HYZ A;  5AYR B;  4RZM A;  1B2U A;  1RTU A;  1B3S A;  1O7P B;  5IEO A;  2GXF A;  5JPU A;  5KP1 A;  1K73 4;  1W7C A;  1RGA A;  1S72 3;  4K61 A;  1BNS A;  2BO9 B;  3BLZ A;  5AI1 A;  1N9E A;  4CPK A;  1FW7 A;  3NXJ A;  1K8A 4;  1B27 A;  2XR8 B;  1D6U A;  3G8Z A;  1GMP A;  4J9A A;  1WMN A;  4WHA A;  1LNI A;  1UGI A;  3KFQ C;  2RNT A;  1VZZ A;  2P05 A;  3NQZ A;  3UJM A;  1PY3 A;  1QAK A;  2F99 A;  3GZR A;  3SXX A;  4AKZ A;  4H3U A;  4GB5 A;  1RN7 A;  2ZDJ A;  4FCJ A;  2KF4 A;  2MF7 A;  1MWU A;  1OAC A;  2F86 B;  4BTX A;  4EYC A;  5D81 A;  3CCE 3;  3WMD A;  1B2M A;  3FGY A;  3GRD A;  4KFF A;  2GSP A;  1MGW A;  2P38 A;  4XM4 A;  4HM5 B;  1VQP 3;  1V74 A;  1W6Y A;  1S5A A;  2OOV C;  2STD A;  3V98 A;  3WHO A;  2I9W A;  4BU4 A;  4DKI A;  3GZB A;  1R4C A;  1SJW A;  4NPB A;  1BNF A;  5ELJ A;  5ELU A;  3S5C A;  1ASK A;  1IT7 A;  2YFJ B;  3JUO A;  4K1U A;  3EN1 B;  2O3O A;  4MMX B;  2XSO B;  1Q42 A;  1UGH I;  1VQQ A;  3JUN A;  4EC6 A;  5IG3 A;  1IYY A;  1NNV A;  1FGM A;  2QGU A;  5HOH A;  5JPP A;  2IMJ A;  4XB5 A;  3DUK A;  1LNH A;  5BXQ A;  3GZX B;  1DET A;  1N5H A;  1RGL A;  1T3B A;  3FLJ A;  1TP6 A;  2CC3 A;  3PYJ A;  9RNT A;  2BMR B;  1KD1 4;  2CH9 A;  4R1K A;  1FYS A;  2PNC A;  4J8T A;  2ZHX B;  4R9K A;  3IPT A;  3MWZ A;  3PCR A;  1C7H A;  1GD4 A;  4IT7 A;  2V1L A;  1AY7 A;  4OVM A;  3K63 A;  1QVG 2;  2YFL B;  3CMA 3;  1UCK A;  3A5E A;  2W56 A;  3CCS 3;  3CNM A;  1O7H B;  3GZY B;  2CFL A;  2CHC A;  3TDG A;  3JUM A;  8CHO A;  1O7N B;  1WNH A;  2C10 A;  1E3V A;  1QAF A;  2HMM B;  1W2Z A;  2XGL A;  3HIG A;  1YJ9 3;  1RJO A;  1HKX A;  4NHF A;  1C54 A;  1BSA A;  1BNI A;  3U1W A;  2OQE C;  2O9U X;  1OHP A;  2R4I A;  3LOY A;  4BL3 A;  2CWV A;  1DMM A;  1RN1 A;  3UNL A;  1O7W B;  5AEW B;  1Q40 A;  1NJI 4;  1B21 A;  3SED A;  3CCJ 3;  2Y73 A;  2OTL 3;  3MG2 A;  4J5G A;  2E2U A;  3N9H A;  3WOE B;  1TJD A;  1US1 A;  3H51 A;  3D79 A;  1M9G A;  3NM2 A;  4FCZ A;  1ROV A;  1NO3 A;  3WA3 A;  1IQX A;  2FXT A;  1KSI A;  5LC7 A;  4K1V A;  1IV7 A;  4N6N B;  1JB5 A;  3CC4 3;  1RNT A;  5I97 A;  1RGK A;  1HZ1 A;  1Q40 B;  3JUQ A;  3N8B A;  2OWP A;  1N8R 4;  4I4K A;  1K9M 4;  4KFE A;  4BIR A;  2B1X B;  4HVN A;  3CCL 3;  1RCL A;  1QJG A;  3OWU A;  4EV2 A;  4HM3 B;  3F7S A;  4HBR A;  4HM6 B;  3SOY A;  7GSP A;  3G0K A;  3B4O A;  4RNZ A;  3KSE D;  1N9J A;  1JN5 B;  4FMA A;  1I2G A;  3F9S A;  2XEP A;  1SAR A;  1G96 A;  1K28 A;  1EA2 A;  3HZP A;  1LOV A;  1IT8 A;  1T2H A;  3B7C A;  1UUG B;  2OTJ 3;  3JUP A;  5CF1 A;  5IEN A;  3SLU A;  3DM8 A;  1I2E A;  2HOH A;  3I55 3;  3PS8 A;  2XRX B;  3FSD A;  4N6L A;  5FW5 A;  4X2O A;  2RFR A;  4HM4 B;  1UI8 A;  1WTH A;  3S29 A;  2WGQ A;  3KCH A;  1M90 4;  3AMO A;  4HM1 B;  2Q07 A;  5G1K A;  3VSY A;  1RRH A;  5RNT A;  1U8C B;  5AIH A;  3VGN A;  1BNG A;  1YIJ 3;  3DY5 A;  1JJ2 2;  2SBL A;  3ZG5 A;  2BMO B;  3AHW A;  2BHM A;  2OQE A;  4BTY A;  1N8Q A;  1IDP A;  1RKY A;  3OW2 2;  1SII A;  1IV9 A;  3D5G A;  3I0Y A;  4GHO A;  2UX0 A;  3CXC 2;  3Q3F A;  3FF2 A;  1VQM 3;  3MG1 A;  1YJN 3;  5M1A A;  1JN5 A;  3DGN A;  2CWU A;  2K0M A;  2KF3 A;  1ZO2 A;  2KF5 A;  1UUV B;  1V58 A;  4L8O A;  5KP3 A;  1FUW A;  1UUW B;  2CFK A;  3CD6 3;  2GBW B;  1BRH A;  1G0T A;  1SQW A;  1VQ9 3;  1QVF 2;  1ISK A;  3KE7 A;  2C4B A;  2JQ5 A;  1BAO A;  3X40 A;  5AIG A;  4BL2 A;  1E97 A;  2Z76 A;  1I2F A;  3NV0 B;  4R9L A;  3GAX A;  5G2G A;  3ZFZ A;  5IF6 A;  1NU3 A;  5AYS C;  1MGR A;  6GSP A;  3H3H A;  1JBS A;  1BNE A;  1SIH A;  2WOF A;  1ULJ B;  3F8X A;  3MG3 A;  1I3F A;  3L0R A;  3BIR A;  3NQY A;  2R41 A;  1FGR A;  2GEX A;  4MMY B;  4JF8 A;  4N6M A;  4HZB B;  1Z1S A;  4XDV A;  1BSC A;  2Z77 A;  1JKG B;  2P0M A;  4CJN A;  3G71 3;  3WOF B;  1K41 A;  1UDI I;  4N6T A;  2XH9 A;  1U5O A;  4LZI A;  2W04 A;  1D6Y A;  3EHC A;  1CEW I;  3T8U A;  1W6C A;  1VQ7 3;  3LYG A;  4BTW A;  1BRI A;  1VQ8 3;  3F8H A;  3HII A;  4WWU C;  2FNQ A;  4WYK A;  1BOX A;  4MEI A;  3LTB A;  3BNE A;  1BGS A;  1B2Z A;  1W5Z A;  3SYU A;  1RLS A;  1BNR A;  1BUJ A;  4N6V 0;  2E2T A;  3V99 A;  2XF3 A;  1T2I A;  4ORL A;  3PZW A;  6RNT A;  2M7O A;  1NB5 I;  2W9Q A;  1RDS A;  3FG3 A;  3LTD A;  1AVL A;  3OV4 A;  2WO0 A;  3BND A;  3EX9 A;  4HKV B;  1YGW A;  1Q82 4;  1DE3 A;  4N3V A;  4FCM A;  4X2H A;  2HMJ B;  1VQ4 3;  2KAA A;  3IJE B;  1Q81 4;  1ULI B;  1GS3 A;  1QAL A;  1WMP A;  4XBX A;  3WR2 A;  4HZ9 B;  1JBR A;  1OGX A;  1TFO A;  4HAA A;  2F56 A;  1GD3 A;  3LZA A;  3S27 A;  1OPY A;  2CK3 H;  3D3L A;  2F4Y A;  3KZT A;  3T0U A;  1Y4K A;  3X3Y A;  3Q1C A;  1L5G B;  4G1M B;  4H61 A;  1IVU A;  1CQS A;  4OUQ A;  1Q86 4;  3QK9 A;  1ZX2 A;  3NM7 A;  2CX1 A;  3ALA A;  2YX9 A;  1LOY A;  4O3V A;  2GBX B;  3NX0 A;  5LC6 A;  1JKG A;  3KKG A;  1IVV A;  2F5W A;  1W01 A;  3A76 A;  2CKF B;  3DGM A;  4O8S A;  2GU3 A;  1D6Z A;  3OWS A;  4IPB A;  3X3X A;  1JNQ A;  3K5T A;  5AII A;  1F8N A;  2GEY A;  4OK0 A;  4I5Q A;  1TRP A;  1RGH A;  4HOH A;  4STD A;  3CC7 3;  2D42 A;  3EE1 A;  1NWW A;  2XFT A;  3AGN A;  3KN4 A;  1B2X A;  3BU4 A;  3DH2 A;  3Q2P A;  2GU1 A;  1DMN A;  1BSD A;  4FR9 A;  2IY2 A;  2AAD A;  3KII A;  3CCQ 3;  1FUS A;  3HX8 A;  1GY7 A;  3WOD G;  4EBG A;  3EB8 A;  1BU4 A;  1HU9 A;  2CWT A;  3EJV A;  1A90 A;  1TTO A;  2KF6 A;  3CNX A;  1I0V A;  3DGO A;  1RGF A;  3S67 A;  1DVD A;  4O2H A;  2MC8 A;  2Z6B A;  2CFG A;  1ZS7 A;  3ZG0 A;  5IER A;  2H0I A;  4L8P A;  1OF5 B;  1I8V A;  3SVA A;  1TFK A;  1RGE A;  2W0Q A;  2WGO A;  3CCR 3;  4EXR A;  3NBB A;  1RGG A;  1YNV X;  2E2V A;  2IA7 A;  3G4S 3;  2INX A;  1JV2 B;  3K0Z A;  3AGO A;  4J5K A;  1OGZ A;  1OHS A;  1GMQ A;  3B8L A;  4LEH A;  5CLK A;  3WDG B;  7STD A;  3ROB A;  3GSP A;  2RCD A;  1YI2 3;  1OCV A;  3BNC A;  5JBS A;  1T5Y A;  1MWS A;  1W6G A;  4GL6 A;  2AAE A;  3S28 A;  2XFS A;  1FGO A;  3G6E 3;  1BRN L;  3NUV A;  1BAN A;  3DGL A;  3UL5 A;  1GY6 A;  2F5M A;  3PXM A;  4ZM8 A;  3OXA A;  1BRJ A;  4KFD A;  3KSP A;  3FG4 A;  3V92 A;  3URP A;  5HGR A;  1YJW 3;  2ZL8 A;  1IQY A; 
#chains in the Genus database with same CATH homology
 3LML A;  3CPW 2;  1VQ6 3;  3VF1 A;  2JDI H;  3QRD A;  3K9M C;  5CK6 A;  3E99 A;  3IMA B;  3LXU X;  3LTC A;  1KQS 2;  2F98 A;  4WFO A;  2PZV A;  3DXO A;  3CCM 3;  3NHX A;  5DRV A;  3DZL A;  3WA2 X;  3SX1 A;  1IVX A;  1LVN A;  3AMO B;  4AEQ A;  1KWI A;  5EQL A;  1FA3 A;  5FGO A;  2W6J H;  3OWY A;  3RDE A;  1WMO A;  1NDO B;  3EN8 A;  5D83 A;  5AIF A;  3FCS B;  4CCV A;  3D9R A;  4AKY A;  3J7Y d;  1RRL A;  4TX4 A;  1CYV A;  3CPO A;  1O7M B;  3B4P A;  1DMQ A;  4U13 A;  5STD A;  3UL6 A;  1OF5 A;  4QWT A;  2YFI B;  5CF2 A;  4JRF A;  2W03 A;  3X3Z A;  5A0O B;  1ROA A;  4XBT A;  4LMI A;  4Q53 A;  4XBY A;  3FZW A;  1VQL 3;  1MNL A;  1QMA A;  3EQQ B;  2KXG A;  2XSH B;  1TUH A;  2HMN B;  1CYU A;  2BNG A;  2Y74 A;  4MMZ B;  4LGQ A;  3MYT A;  2ML5 A;  5EVH A;  3LTA A;  2A15 A;  1M1X B;  4RNY A;  1JB4 A;  4HJL B;  1YHQ 3;  3EBY A;  2L4V A;  2RGQ A;  1VQ5 3;  1J2B A;  4KVH A;  3RGA A;  2IUJ A;  4L7K A;  5AEU B;  3O8Y A;  5DRE A;  2KRT A;  5CXO A;  1GYB A;  3F14 A;  3CCV 3;  3EF8 A;  3MHE A;  5KP4 A;  2ML6 A;  3U97 A;  2FGT A;  1DYU A;  1IK3 A;  2LQV A;  3PGB A;  4O02 B;  5BVB A;  2HMK B;  2Z7A A;  1A2V A;  4XDW A;  1GY5 A;  1N5P A;  5IW9 A;  3I56 3;  2W56 B;  1FGT A;  1DVC A;  3LT8 A;  2D1W A;  3CME 3;  1UI7 A;  1IU7 A;  1EKM A;  3GWR A;  3Q90 A;  2CIU A;  1JB2 A;  1VQO 3;  1OH0 A;  3HI7 A;  1STF I;  2IUK A;  2KCD A;  2WOH A;  4IIA A;  1PFP A;  3FH1 A;  3FKA A;  1W4N A;  5IEP A;  4FMD A;  4R80 A;  2W9P A;  3EC9 A;  1STD A;  1YIT 3;  2CFD A;  1UW1 A;  1IVW A;  3NBR A;  1E3R A;  2QEX 3;  1WQL B;  3K7C A;  1A2K A;  2B24 B;  1TU5 A;  3CC2 3;  3X41 A;  1NB3 I;  3FF0 A;  2CFW A;  3JVC A;  3STD A;  2W2C A;  2OOV A;  3RGR A;  2BMQ B;  4R4K A;  1KC8 4;  3EBT A;  1PU4 A;  1YVB I;  3ECF A;  2QA4 3;  3G16 A;  2QIY A;  1LOX A;  1EG9 B;  1MOL A;  3BB9 A;  5IG5 A;  4K90 B;  2C11 A;  2HML B;  3NV0 A;  4HM7 B;  3SOA A;  5D82 A;  3LT9 A;  4EV5 A;  3T8N A;  4KZ1 A;  1OUN A;  3MSO A;  1A67 A;  2OCT A;  4MJD A;  1Q7Y 4;  2P09 A;  3CCU 3;  1AR0 A;  1W00 A;  2K54 A;  2LYX A;  1BUQ A;  3X42 A;  2CW9 A;  4LSO A;  1OHO A;  1FGQ A;  1YGE A;  3BNB A;  5TGN A;  1VQK 3;  3N54 B;  1VQN 3;  3F40 A;  3UB1 A;  3HK4 A;  3MPH A;  5IG0 A;  1AVK A;  3NBJ A;  1LXE A;  5IG4 A;  1AV4 A;  1M1K 4;  4HM8 B;  4NRE A;  5EEO A;  3OX9 A;  4N6O B;  3MKI A;  4FMB A;  4WP5 A;  1JRQ A;  2BT3 A;  3PCS A;  4FMC A;  2CG1 A;  4CDL A;  2P0X A;  2CG0 A;  3ER7 A;  1O7G B;  3F7X A;  1SPU A;  4PEJ A;  4WYK B;  4HM2 B;  3DMC A;  6STD A;  4HM0 B;  4N6U A;  2XGN A;  1EQK A;  1W02 A;  3CU3 A;  1W2B 2;  2HMO B;  3FG1 A;  3M8C A;  4RBN A;  1IQ8 A;  2RSX A;  1TIJ A;  3LH4 A;  4HYZ A;  5AYR B;  4RZM A;  1K73 4;  1O7P B;  5IEO A;  2GXF A;  5JPU A;  5KP1 A;  1W7C A;  1S72 3;  4K61 A;  2BO9 B;  3BLZ A;  5AI1 A;  1N9E A;  3NXJ A;  1K8A 4;  2XR8 B;  1D6U A;  3G8Z A;  4J9A A;  1WMN A;  4WHA A;  3KFQ C;  1VZZ A;  2P05 A;  3NQZ A;  3UJM A;  1QAK A;  2F99 A;  3GZR A;  3SXX A;  4AKZ A;  4H3U A;  4GB5 A;  1RN7 A;  2ZDJ A;  4FCJ A;  2MF7 A;  2F86 B;  1OAC A;  4BTX A;  4EYC A;  3CCE 3;  5D81 A;  3WMD A;  3FGY A;  3GRD A;  4KFF A;  2P38 A;  4XM4 A;  4HM5 B;  1VQP 3;  1V74 A;  1W6Y A;  1S5A A;  2OOV C;  2STD A;  3V98 A;  2I9W A;  3GZB A;  1R4C A;  1SJW A;  5ELJ A;  5ELU A;  3S5C A;  1ASK A;  1IT7 A;  2YFJ B;  3JUO A;  4K1U A;  3EN1 B;  2O3O A;  4MMX B;  2XSO B;  1Q42 A;  3JUN A;  4EC6 A;  5IG3 A;  1FGM A;  2QGU A;  5JPP A;  2IMJ A;  4XB5 A;  3DUK A;  1LNH A;  5BXQ A;  3GZX B;  1N5H A;  3FLJ A;  3PYJ A;  1TP6 A;  2CC3 A;  1KD1 4;  2BMR B;  2CH9 A;  4R1K A;  2PNC A;  4J8T A;  4R9K A;  3IPT A;  3MWZ A;  3PCR A;  1C7H A;  1GD4 A;  4IT7 A;  2V1L A;  4OVM A;  3K63 A;  1QVG 2;  2YFL B;  3CMA 3;  2W56 A;  3CCS 3;  3CNM A;  1O7H B;  3GZY B;  2CFL A;  2CHC A;  3TDG A;  3JUM A;  8CHO A;  1O7N B;  1WNH A;  2C10 A;  1E3V A;  1QAF A;  2HMM B;  1W2Z A;  2XGL A;  3HIG A;  1YJ9 3;  1RJO A;  1HKX A;  4NHF A;  3U1W A;  2OQE C;  2O9U X;  1OHP A;  2R4I A;  3LOY A;  5AEW B;  2CWV A;  1DMM A;  3UNL A;  1NJI 4;  1O7W B;  1Q40 A;  3SED A;  3CCJ 3;  2Y73 A;  2OTL 3;  3MG2 A;  2E2U A;  3N9H A;  3WOE B;  1US1 A;  3H51 A;  3NM2 A;  1M9G A;  4FCZ A;  1ROV A;  1NO3 A;  3WA3 A;  1IQX A;  2FXT A;  1KSI A;  5LC7 A;  4K1V A;  1IV7 A;  4N6N B;  1JB5 A;  3CC4 3;  5I97 A;  1Q40 B;  3JUQ A;  3N8B A;  2OWP A;  1N8R 4;  4I4K A;  1K9M 4;  4KFE A;  2B1X B;  4HVN A;  3CCL 3;  1QJG A;  3OWU A;  4EV2 A;  4HM3 B;  3F7S A;  4HBR A;  4HM6 B;  3SOY A;  3G0K A;  3B4O A;  4RNZ A;  3KSE D;  1N9J A;  1JN5 B;  4FMA A;  3F9S A;  2XEP A;  1G96 A;  1K28 A;  1EA2 A;  3HZP A;  1IT8 A;  3B7C A;  2OTJ 3;  3JUP A;  5CF1 A;  5IEN A;  3DM8 A;  3I55 3;  3PS8 A;  2XRX B;  3FSD A;  4N6L A;  5FW5 A;  4X2O A;  2RFR A;  4HM4 B;  1UI8 A;  1WTH A;  3S29 A;  2WGQ A;  1M90 4;  3AMO A;  4HM1 B;  2Q07 A;  3VSY A;  1RRH A;  1U8C B;  5AIH A;  3VGN A;  1YIJ 3;  3DY5 A;  1JJ2 2;  2SBL A;  4BTY A;  2BMO B;  2OQE A;  2BHM A;  3OW2 2;  1N8Q A;  1IDP A;  1RKY A;  1SII A;  1IV9 A;  3I0Y A;  2UX0 A;  3CXC 2;  3FF2 A;  1VQM 3;  3MG1 A;  1YJN 3;  1JN5 A;  3DGN A;  2CWU A;  2K0M A;  1ZO2 A;  1UUV B;  4L8O A;  5KP3 A;  1FUW A;  1UUW B;  2CFK A;  3CD6 3;  2GBW B;  1SQW A;  1VQ9 3;  1QVF 2;  1ISK A;  3KE7 A;  2JQ5 A;  3X40 A;  5AIG A;  1E97 A;  2Z76 A;  3NV0 B;  4R9L A;  3GAX A;  5G2G A;  5IF6 A;  1NU3 A;  5AYS C;  3H3H A;  1SIH A;  2WOF A;  1ULJ B;  3F8X A;  3MG3 A;  3L0R A;  3NQY A;  4N6M A;  4XDV A;  1FGR A;  2GEX A;  4MMY B;  4JF8 A;  3SLU A;  4HZB B;  1Z1S A;  2Z77 A;  1JKG B;  2P0M A;  3G71 3;  3WOF B;  1K41 A;  4N6T A;  2XH9 A;  1U5O A;  4LZI A;  2W04 A;  1D6Y A;  3EHC A;  1CEW I;  3T8U A;  1W6C A;  1VQ7 3;  3LYG A;  4BTW A;  1VQ8 3;  3F8H A;  3HII A;  4WWU C;  2FNQ A;  4WYK A;  4MEI A;  3LTB A;  3BNE A;  1W5Z A;  4N6V 0;  2E2T A;  3V99 A;  2XF3 A;  4ORL A;  3PZW A;  2M7O A;  1NB5 I;  2W9Q A;  3FG3 A;  3LTD A;  1AVL A;  3OV4 A;  2WO0 A;  3BND A;  3EX9 A;  4HKV B;  1Q82 4;  4N3V A;  4FCM A;  4X2H A;  2HMJ B;  1VQ4 3;  3IJE B;  1Q81 4;  1ULI B;  1GS3 A;  1QAL A;  1WMP A;  4XBX A;  4HZ9 B;  1OGX A;  1TFO A;  1GD3 A;  3LZA A;  3S27 A;  1OPY A;  2CK3 H;  3D3L A;  3KZT A;  3T0U A;  3X3Y A;  1Y4K A;  3Q1C A;  1L5G B;  4G1M B;  4H61 A;  1IVU A;  1CQS A;  4OUQ A;  1Q86 4;  3QK9 A;  1ZX2 A;  3NM7 A;  3ALA A;  2YX9 A;  4O3V A;  2GBX B;  3NX0 A;  5LC6 A;  1JKG A;  3KKG A;  1IVV A;  4O8S A;  1W01 A;  3A76 A;  2CKF B;  3DGM A;  3X3X A;  2GU3 A;  1D6Z A;  3OWS A;  4IPB A;  1JNQ A;  3K5T A;  5AII A;  1F8N A;  2GEY A;  4OK0 A;  4STD A;  3CC7 3;  2D42 A;  3EE1 A;  1NWW A;  2XFT A;  3KN4 A;  3Q2P A;  2GU1 A;  1DMN A;  4FR9 A;  3KII A;  3CCQ 3;  3HX8 A;  1GY7 A;  3WOD G;  4EBG A;  3EB8 A;  1HU9 A;  2CWT A;  3EJV A;  1A90 A;  3CNX A;  3DGO A;  3S67 A;  1DVD A;  4O2H A;  2MC8 A;  2Z6B A;  2CFG A;  5IER A;  4L8P A;  1OF5 B;  3SVA A;  1TFK A;  2W0Q A;  2WGO A;  3CCR 3;  4EXR A;  3NBB A;  2E2V A;  2IA7 A;  3G4S 3;  2INX A;  1JV2 B;  3K0Z A;  1OGZ A;  1OHS A;  3B8L A;  5CLK A;  4LEH A;  3WDG B;  7STD A;  3ROB A;  1YI2 3;  2RCD A;  1OCV A;  3BNC A;  5JBS A;  1T5Y A;  4GL6 A;  1W6G A;  3S28 A;  2XFS A;  1FGO A;  3G6E 3;  3NUV A;  3DGL A;  3UL5 A;  1GY6 A;  3PXM A;  4ZM8 A;  3OXA A;  4KFD A;  3KSP A;  3FG4 A;  3V92 A;  5HGR A;  1YJW 3;  2ZL8 A;  1IQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...