1ULIB

Biphenyl dioxygenase (bpha1a2) derived from rhodococcus sp. strain rha1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
177
structure length
177
Chain Sequence
FRTKPAPVDPSLQHEIEQFYYWEAKLLNDRRFQEWFDLLAEDIHYFMPIRTTRIMRETAQEYSGAREYAHFDDNAQMMRGRLRKITSDVSWSENPASRTRHVISNVMIVDGEKPGEYHVSSVFIVYRNRLERQLDIFAGERKDILRRTGSEAGFELAKRTILIDQSTILSNNLSFFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Terminal Oxygenase Component of Biphenyl Dioxygenase Derived from Rhodococcus sp. Strain RHA1
pubmed doi rcsb
molecule keywords biphenyl dioxygenase large subunit
molecule tags Oxidoreductase
source organism Rhodococcus sp.
total genus 52
structure length 177
sequence length 177
chains with identical sequence D, F
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1uliB00
4WYKB 1DMMA 1JB5A 3M8CA 1NU3A 5IG0A 3D9RA 1O7NB 1O7GB 3HX8A 2R4IA 2HMMB 5JPPA 2JQ5A 5FW5A 3EF8A 3ER7A 3UNLA 2F98A 1ZO2A 3MG1A 3EN1B 1JKGA 3CPOA 3F40A 3NV0B 3FGYA 3SOYA 3KE7A 4HM1B 3IPTA 3ROBA 4HM4B 2HMNB 3I0YA 3GZBA 5HGRA 5D81A 2Z76A 1Q40B 5CF2A 3G0KA 3MKIA 1QMAA 1O7WB 4HJLB 3F8XA 5D83A 3H3HA 3GZXB 2CHCA 3GZRA 1GYBA 3GZYB 5IERA 4FCJA 2YFJB 3G8ZA 3FLJA 4LMIA 4PEJA 3EN8A 4HM3B 5AEUB 4L8PA 1JN5A 1QJGA 5JPUA 3JUMA 5CXOA 1E3RA 4XM4A 3GWRA 3F7XA 1Q42A 1ISKA 2HMJB 3NXJA 2XRXB 2IMJA 1GS3A 5IEOA 5AI1A 3JUQA 4XBYA 3A76A 5IEPA 3MHEA 4OVMA 3LZAA 1C7HA 3VSYA 2HMLB 2XSOB 3EBTA 3WMDA 1BUQA 4HM2B 1IDPA 4X2HA 1NWWA 4KVHA 2RFRA 1HKXA 3GRDA 1OUNA 5AIHA 3T8NA 4XDWA 3S5CA 3VGNA 2GEYA 4HKVB 2HMKB 2YFLB 3DM8A 2B24B 3OWSA 5DRVA 4XDVA 1OCVA 4K1UA 4ORLA 7STDA 2Z77A 3LYGA 3EJVA 3FKAA 1TUHA 2XSHB 5TGNA 5IF6A 1JKGB 3CNXA 1OHPA 3CU3A 3EBYA 4HM5B 2XR8B 4OUQA 5CLKA 3T8UA 1ZX2A 4L7KA 5AIFA 4HZ9B 3EHCA 4R9KA 6STDA 4H3UA 3ECFA 3NHXA 4I4KA 2Z7AA 1GY6A 4XBTA 2K54A 3HZPA 1ULJB 5KP1A 3B4OA 3JUNA 2BMQB 3F9SA 5STDA 4R1KA 2CKFB 1OGXA 5AEWB 3STDA 3OWUA 3DXOA 3NBRA 1JN5B 5DREA 3MSOA 2A15A 4J8TA 4CDLA 4XBXA 2F99A 4U13A 1GY5A 2GXFA 1O7PB 2I9WA 4HM7B 4L8OA 1E97A 1CQSA 3MG2A 3G16A 5BVBA 2UX0A 3DMCA 3B8LA 4IIAA 3F14A 1Z1SA 3FZWA 3NM2A 2BMOB 5BXQA 1ASKA 3RGAA 3DUKA 3H51A 4STDA 3B7CA 5IG4A 3OX9A 4X2OA 3JUPA 5IG3A 2BMRB 3K7CA 1OHOA 3K0ZA 1O7HB 4WWUC 1U5OA 1W6YA 5CK6A 1SJWA 2YFIB 2B1XB 1W01A 1JB4A 1OF5A 3OWYA 3EX9A 1NDOB 1OHSA 1UUVB 4LGQA 2RGQA 3FSDA 1OGZA 4WYKA 2GBWB 4WP5A 3OV4A 3F7SA 5D82A 3KKGA 3KZTA 2GBXB 3UJMA 1W00A 4XB5A 5G2GA 1EG9B 4HM8B 1W02A 4K1VA 3BB9A 1GY7A 1AR0A 4HM6B 4MJDA 5IENA 4GB5A 1O7MB 1STDA 3NV0A 1A2KA 3Q90A 2F86B 1TP6A 2PZVA 3NUVA 1WQLB 2QIYA 2INXA 2W2CA 3HK4A 4HM0B 3EC9A 5IG5A 1Q40A 3FF0A 1VZZA 1K41A 4J9AA 1OH0A 1DMQA 3F8HA 1JB2A 3B4PA 2HMOB 4RZMA 5CF1A 5AIIA 2RCDA 3FH1A 4HZBB 3OXAA 3SEDA 3SOAA 1E3VA 1OPYA 1UUWB 8CHOA 1S5AA 4Q53A 5KP4A 3JUOA 2STDA 3CNMA 1EA2A 2QGUA 3KSPA 4HVNA 4N3VA 3BLZA 3MG3A 4FCMA 2BNGA 4R9LA 3MYTA 1ULIB 1DMNA 2GEXA 5EVHA 1OF5B 3E99A 4LEHA 3RGRA 2OWPA 3FF2A 5AIGA 3EQQB 5KP3A 3DZLA
chains in the Genus database with same CATH superfamily
4JRFA 4WYKB 1DMMA 4LSOA 2K3DA 3LTAA 1JB5A 3BIRA 3M8CA 1NU3A 5AYSC 3UL6A 3X3XA 3QK9A 4O8SA 1SIIA 1TIJA 5IG0A 2CFDA 3DH2A 3D9RA 3NBBA 1CH0A 1O7NB 3O8YA 1JJ22 1O7GB 1V58A 1VQO3 1BAOA 1QAKA 3HX8A 2R4IA 5GSPA 2HMMB 5JPPA 2JQ5A 1VQ63 5FW5A 1RGGA 2CFWA 4BTXA 3EF8A 3DGYA 4FMDA 3ER7A 3KIIA 3UNLA 1FA3A 3PS8A 4BTYA 3CC73 4EV5A 1I8VA 2F98A 1ZO2A 2CFGA 3JVCA 1LXEA 3MG1A 6RNTA 3EN1B 1JKGA 2W9PA 3CPOA 4ZM8A 1A67A 3HOHA 3F40A 1KD14 3NV0B 1IVXA 2IA7A 2XFTA 1MGWA 3X3YA 1IQYA 2OCTA 3FGYA 3SOYA 2R41A 1B2MA 2OTL3 3K63A 1B27A 1BRJA 3IPTA 3KE7A 1LRAA 1N9EA 3PCSA 4HM1B 3ROBA 1UCKA 1BSAA 3D79A 2XF3A 2QEX3 4HM4B 4H61A 1VQN3 3CD63 2HMNB 3I0YA 4OK0A 5LC7A 2YX9A 3GAXA 1EEJA 3KFQC 1B2SA 3GZBA 1RGFA 2BT3A 4HBRA 5HGRA 5D81A 8RNTA 1QVG2 2GU3A 1TRQA 2UGIA 2Z76A 2W56A 1Q40B 5CF2A 3CXC2 3G0KA 3MKIA 1FGOA 1QMAA 2OOVC 3CC43 1AVLA 1BRGA 1O7WB 2ZA4A 1BUJA 4HJLB 1G02A 3U1WA 2OTJ3 3CCJ3 1TU5A 1GOVA 3F8XA 3WODG 4NHFA 1LVNA 1QVF2 1B20A 5D83A 4I5QA 4BL3A 1IK3A 3H3HA 4EYCA 2KF4A 3GZXB 2CW9A 2CHCA 1B2ZA 3GZRA 1JZOA 1GYBA 3BNDA 3Q1CA 1IQXA 3GZYB 3WA3A 5ELJA 4BU4A 1B21A 2CH9A 1FGTA 5IERA 1RMSA 1ROVA 1WMOA 2FNQA 1VQ43 4IPBA 2W9QA 4FCJA 4FMBA 1AV4A 2SBLA 2YFJB 3FLJA 3G8ZA 4KZ1A 4LMIA 1RKYA 1VQ53 2IUKA 1N8QA 4PEJA 2Q07A 1RTUA 2M7OA 4HYZA 3EN8A 4HM3B 5AEUB 2UUGC 1GMRA 4L8PA 3X3ZA 1JN5A 1PYLA 1QJGA 5JPUA 2CFKA 3JUMA 5CXOA 1E3RA 4XM4A 2MC8A 1RLSA 3GWRA 3LTBA 1OACA 3F7XA 1Q9EA 1SQWA 1Q42A 1YI23 1ISKA 1R4CA 3CCS3 2HMJB 3NXJA 3CCL3 1YJN3 2XRXB 2IMJA 1GS3A 5IEOA 4HOHA 5AI1A 1W2B2 3U97A 1A90A 1IT8A 3JUQA 4XBYA 1IQ8A 3A76A 3AHSA 1FZUA 3MHEA 4KT3B 1V57A 4OVMA 5IEPA 2H0HA 3LZAA 3LT8A 2W0QA 4MMZB 1C7HA 1X1UA 2HMLB 1GOYA 1UGIA 2XSOB 3EBTA 3VSYA 3X42A 3WMDA 1VQM3 1YNVX 3PZWA 4RNZA 1BUQA 4EC6A 4HM2B 4FMAA 1IDPA 4X2HA 1NWWA 4KVHA 3CCU3 5A0OB 1RCKA 1B3SA 2RFRA 4LZIA 4N6OB 1HKXA 3WHOA 1BSEA 2J8XB 3MPHA 3S28A 3SVAA 3GRDA 2XGNA 1FUSA 1OUNA 1A2PA 5AIHA 3T8NA 4XDWA 1BNSA 3S5CA 1UDII 3NX0A 2D1WA 1DVCA 3VGNA 1RGAA 1US1A 2GEYA 1YVBI 2F56A 3SX1A 1YIT3 2WO0A 4J5KA 3PGBA 4R80A 4HKVB 2HMKB 2YFLB 3J7Yd 4NREA 3DM8A 2OOVA 2B24B 3OWSA 5DRVA 1X1WA 4XDVA 3BNCA 1OCVA 1AQZA 2CG0A 4O02B 1GMQA 4K1UA 1UUGB 4ORLA 3AMOA 7STDA 2RBIA 2F5MA 4RBNA 1G96A 1YJ93 2Z77A 3LYGA 3EJVA 5IW9A 1NNVA 1VQQA 3FKAA 1TUHA 3LXUX 2XSHB 5TGNA 1I2GA 5IF6A 1JKGB 4N6V0 3IMAB 1WMPA 1I2FA 2WOFA 3CNXA 1YJW3 1N5HA 1PFPA 2C11A 1OHPA 1RN1A 3CU3A 1BU4A 1VQ93 2W03A 1EUIC 3LTDA 1FGRA 1GD3A 1SARA 4ILFA 5AYRB 7RNTA 1MNLA 1Y4KA 6GSPA 2F5WA 3EBYA 3GSPA 2ZDJA 5BU4A 1MWRA 1D6ZA 4HM5B 1RGEA 2XR8B 1RN4A 4OUQA 5CLKA 2AADA 1ZX2A 1BSBA 4L7KA 5AIFA 1L5GB 3T8UA 3V99A 1RJOA 1MWUA 4CCVA 1EQKA 1NB3I 2L4VA 2WGOA 1BRNL 1BNRA 2W56B 1T3BA 2WOHA 1KWIA 4HZ9B 3EHCA 3MWZA 1MWTA 4K90B 1K734 3CMA3 1KSIA 9RNTA 4R9KA 1RNTA 1BNGA 1UI8A 1LOXA 1BSDA 4FCZA 4H3UA 6STDA 2WGQA 3ECFA 4KFEA 3NHXA 1TFKA 2XFSA 3FG4A 2E2TA 4I4KA 2KAAA 2Z7AA 4KFDA 3S29A 1W6CA 3HIGA 2V1LA 2BO9B 3D3LA 1GY6A 3FG3A 1BIRA 4XBTA 4O3VA 2K54A 1D6YA 2KF6A 1VQK3 3G6E3 3CCM3 3HZPA 1ULJB 3DGMA 3K5TA 5KP1A 1IV9A 3B4OA 1SIHA 3WOEB 1IYYA 2KF5A 3JUNA 2BMQB 3BNEA 3X41A 3URPA 3F9SA 1N9JA 4N6NB 5STDA 1PU4A 3D5IA 1RDSA 1LQGC 2CK3H 4R1KA 2CKFB 4AKZA 1OGXA 4GL6A 1Q864 5AEWB 2CX0A 3HI7A 3K9MC 4R4KA 2K0MA 3RDEA 3STDA 1IVVA 2ZL8A 3Q2PA 3OWUA 3DXOA 2L1SA 5EEOA 1LQMB 1LNIA 1M1K4 3NBRA 1JN5B 4EXRA 4K61A 3ZG0A 5DREA 3RNTA 3DGLA 1Q824 3WOFB 3MSOA 1MWSA 1ZS7A 2A15A 4KFFA 4BTWA 4J8TA 1V74A 4N6UA 4CDLA 1GMPA 2C4BA 4EBGA 4XBXA 1W4NA 4RNYA 3AGOA 3S27A 5G1KA 2F99A 1ROAA 4U13A 2BHMA 4G1MB 1GY5A 2GXFA 1O7PB 2I9WA 4HM7B 1IVUA 4L8OA 3UL5A 1E97A 1CQSA 3MG2A 3G16A 1NB5I 1VQ83 1BNIA 1TRPA 2FXTA 1HYFA 5BVBA 3CCR3 2UX0A 3DMCA 3LTCA 3PYJA 4IT7A 3B8LA 3KSED 1VQ73 1M904 1A2VA 1EKMA 1JRQA 4IIAA 4CJNA 3F14A 1Z1SA 2ML6A 1GOUA 1QAFA 3FZWA 2ML5A 3BNBA 3NM2A 1JZDA 2KXGA 3CME3 2BMOB 5BXQA 1K9M4 2CWUA 4N6LA 3SLUA 1ASKA 4NPBA 3RGAA 1IU7A 3X40A 2H0GA 4AEQA 1I0VA 2OQEA 1AVKA 1SPUA 2LQVA 3AHWA 1AY7A 3DUKA 3H51A 4STDA 2XEPA 1T2HA 3N54B 1D6UA 1X1YA 2E2UA 4MMYB 1FGMA 2IUJA 3B7CA 4JF8A 5IG4A 2P09A 4WHAA 3OX9A 1GD4A 1FW7A 4X2OA 3JUPA 4N6MA 5IG3A 5RNTA 2BMRB 2CFLA 1OHOA 1BNFA 2GSPA 1RGLA 1RGHA 1TFOA 3K0ZA 3K7CA 1O7HB 4J5GA 2D42A 3VF1A 1CYVA 1G0TA 1DE3A 1U8CB 1PY3A 1Q7Y4 4WWUC 1U5OA 3WDGB 3OW22 4GSPA 1W6YA 5CK6A 1M9GA 3V98A 1UI7A 2SARA 1YHQ3 2PNCA 7GSPA 2KF3A 3AMOB 1SJWA 2QA43 2YFIB 2B1XB 1W01A 4QWTA 5M19A 1JBSA 1JB4A 1BVIA 1STFI 1HU9A 1MGRA 1OF5A 3QRDA 1B2XA 1UCIA 1RHLA 3ALAA 2LYXA 3FCSB 3N8BA 3NM7A 3OWYA 2XGLA 3G4S3 3LOYA 3EX9A 1NJI4 1NDOB 1DVDA 1IVWA 1W2ZA 3SYUA 5EQLA 2JDIH 2E2VA 1OHSA 3I563 1LNHA 1UUVB 3PCRA 4LGQA 4LYLB 5LC6A 1DETA 3T0UA 2RGQA 1I0XA 1OGZA 3FSDA 4WYKA 2GBWB 2OQEC 4RNTA 4WP5A 3OV4A 4GHOA 1RN7A 4BL2A 3F7SA 4FMCA 5D82A 2P05A 1S723 5JBSA 2CWTA 3KKGA 1WMNA 1W7CA 2GBXB 3KZTA 3DY5A 3UJMA 2CIUA 1LOVA 1W00A 4XB5A 1KQS2 4DKIA 2GU1A 2KCDA 2HOHA 4EV2A 2C10A 1Q7HA 1RGKA 5G2GA 1BGSA 2Y74A 1BANA 1K8A4 4FR9A 1EG9B 4HM8B 3L0RA 1W02A 3AGNA 3BB9A 1GY7A 1AR0A 1R4YA 1YGWA 4HM6B 4K1VA 4MJDA 5M18A 1N8R4 1UCLA 4GB5A 1O7MB 1STDA 2KRTA 2Z6BA 1CYUA 1DYUA 3NV0A 1UW1A 2BU4A 2Y73A 4N6TA 1VQL3 1A2KA 3Q90A 1I3IA 1TJDA 2F86B 1TP6A 3EB8A 3LH4A 3V92A 5BIRA 3SXXA 2MF7A 2PZVA 1K28A 1WQLB 1ZGXA 3IJEB 3NUVA 3CCQ3 1RRHA 2P38A 2P0XA 3CCV3 3CPW2 4O2HA 2QIYA 1FUTA 4HAAA 1C54A 2CG1A 2P0MA 2INXA 2W2CA 3HK4A 4HM0B 3EC9A 5IG5A 1I3FA 1FUWA 1Q40A 3I553 3FF0A 1VZZA 1K41A 4J9AA 1CEWI 1UGHI 3G713 1OH0A 1DMQA 3F8HA 1MOLA 2BIRA 3DGNA 3NQYA 1YIJ3 1Q814 1JB2A 1RRLA 3B4PA 2HMOB 1T2IA 5FGOA 3WA2X 1RNBA 1X1XA 2H0IA 4RZMA 3LT9A 1BRHA 1B2UA 1RGCA 1FGQA 1RCLA 3PXMA 4WFOA 3D5GA 3UB1A 2IY2A 2RCDA 5AIIA 5CF1A 3FH1A 4HZBB 4MMXB 1J2BA 3OXAA 1VQP3 1W5ZA 1FYSA 1WNHA 4CPKA 1GSPA 5M1AA 3SEDA 3SOAA 1LOYA 1BSCA 5G1LA 1E3VA 3S67A 1LOWA 3KCHA 1RSNA 2IYJA 2W6JH 1F8NA 3ZG5A 1OPYA 1UUWB 3NBJA 8CHOA 2FGTA 3FG1A 3CCE3 1S5AA 5I97A 3TDGA 1TTOA 1BRIA 1T5YA 3BU4A 4Q53A 1BNEA 5KP4A 2RSXA 3JUOA 2STDA 1JV2B 1EA2A 3CNMA 2QGUA 3ZFZA 2CWVA 2W04A 2RNTA 3KSPA 4HVNA 4N3VA 1N5PA 1QALA 3BLZA 3HIIA 1YGEA 2CC3A 3MG3A 4FCMA 4BIRA 2ZHXB 2O9UX 1JBRA 5IENA 3A5EA 3NQZA 3N9HA 2BNGA 3CC23 1YVSA 3D4AA 3EE1A 5HOHA 3KN4A 2XH9A 1M1XB 1NO3A 4MEIA 4R9LA 3MYTA 1ULIB 2F4YA 1I70A 3WR2A 3LMLA 1IT7A 1HZ1A 3Q3FA 1BOXA 1W6GA 1WTHA 1DMNA 2O3OA 1IV7A 2GEXA 1BRKA 5EVHA 2CX1A 1OF5B 3E99A 1JBTA 4LEHA 3RGRA 2OWPA 1JNQA 3FF2A 4TX4A 4AKYA 5AIGA 2AAEA 1BNJA 3EQQB 5KP3A 1KC84 1BRSA 3DZLA 1I2EA 1UCJA 3DGOA 5ELUA 4EW5A
chains in the Genus database with same CATH topology
4JRFA 4WYKB 1DMMA 4LSOA 3LTAA 1JB5A 3M8CA 1NU3A 5AYSC 3UL6A 3X3XA 3QK9A 4O8SA 1SIIA 1TIJA 5IG0A 2CFDA 3NBBA 3D9RA 3O8YA 1JJ22 1O7NB 1O7GB 1VQO3 1QAKA 3HX8A 2R4IA 2HMMB 5JPPA 2JQ5A 1VQ63 5FW5A 2CFWA 4BTXA 3EF8A 4FMDA 3ER7A 3KIIA 3UNLA 1FA3A 3PS8A 4BTYA 3CC73 4EV5A 2F98A 1ZO2A 2CFGA 3JVCA 1LXEA 3MG1A 3EN1B 1JKGA 2W9PA 3CPOA 4ZM8A 1A67A 3F40A 1KD14 3NV0B 1IVXA 2IA7A 2XFTA 3X3YA 1IQYA 2OCTA 3FGYA 3SOYA 2OTL3 3K63A 3KE7A 3IPTA 4HM1B 3PCSA 1N9EA 3ROBA 2XF3A 2QEX3 4HM4B 4H61A 1VQN3 3CD63 2HMNB 3I0YA 4OK0A 5LC7A 2YX9A 3GAXA 3KFQC 3GZBA 2BT3A 4HBRA 5HGRA 5D81A 1QVG2 2GU3A 2Z76A 2W56A 1Q40B 5CF2A 3CXC2 3G0KA 3MKIA 2OOVC 1FGOA 1QMAA 3CC43 1AVLA 1O7WB 4HJLB 3U1WA 2OTJ3 3CCJ3 1TU5A 3F8XA 3WODG 4NHFA 1LVNA 1QVF2 5D83A 1IK3A 3H3HA 4EYCA 3GZXB 2CW9A 2CHCA 3GZRA 1GYBA 3BNDA 3Q1CA 1IQXA 3GZYB 3WA3A 5ELJA 5IERA 2CH9A 1FGTA 1WMOA 1ROVA 2FNQA 1VQ43 4IPBA 2W9QA 4FCJA 4FMBA 1AV4A 2SBLA 2YFJB 3FLJA 3G8ZA 4KZ1A 4LMIA 1RKYA 1VQ53 2IUKA 1N8QA 4PEJA 2Q07A 2M7OA 4HYZA 3EN8A 4HM3B 5AEUB 4L8PA 3X3ZA 1JN5A 1QJGA 5JPUA 2CFKA 3JUMA 5CXOA 1E3RA 4XM4A 2MC8A 3GWRA 3LTBA 1OACA 3F7XA 1SQWA 1Q42A 1YI23 1ISKA 1R4CA 3CCS3 2HMJB 3NXJA 3CCL3 1YJN3 2XRXB 2IMJA 1GS3A 5IEOA 5AI1A 1W2B2 3U97A 1A90A 1IT8A 3JUQA 4XBYA 1IQ8A 3A76A 3MHEA 4OVMA 5IEPA 3LZAA 3LT8A 2W0QA 4MMZB 1C7HA 3VSYA 2HMLB 2XSOB 3EBTA 3X42A 3WMDA 1VQM3 3PZWA 4RNZA 1BUQA 4EC6A 4HM2B 4FMAA 1IDPA 4X2HA 1NWWA 4KVHA 3CCU3 5A0OB 2RFRA 4LZIA 4N6OB 1HKXA 3MPHA 3S28A 3SVAA 3GRDA 2XGNA 1OUNA 5AIHA 3T8NA 4XDWA 3S5CA 3NX0A 2D1WA 1DVCA 3VGNA 1US1A 2GEYA 1YVBI 3SX1A 1YIT3 2WO0A 3PGBA 4R80A 4HKVB 2HMKB 2YFLB 3J7Yd 4NREA 3DM8A 2OOVA 2B24B 3OWSA 5DRVA 4XDVA 3BNCA 1OCVA 2CG0A 4O02B 4K1UA 4ORLA 3AMOA 7STDA 1YJ93 4RBNA 1G96A 2Z77A 3LYGA 3EJVA 5IW9A 3FKAA 3LXUX 1TUHA 2XSHB 5TGNA 5IF6A 1JKGB 4N6V0 3IMAB 1WMPA 2WOFA 3CNXA 1YJW3 1N5HA 1PFPA 2C11A 1OHPA 3CU3A 1VQ93 2W03A 3LTDA 5AYRB 1FGRA 1GD3A 1MNLA 1Y4KA 3EBYA 2ZDJA 1D6ZA 4HM5B 2XR8B 4OUQA 5CLKA 3T8UA 1ZX2A 4L7KA 1L5GB 5AIFA 3V99A 1RJOA 4CCVA 1EQKA 1NB3I 2L4VA 2WGOA 2W56B 2WOHA 1KWIA 4HZ9B 3EHCA 3MWZA 3CMA3 4K90B 1K734 1KSIA 4R9KA 1UI8A 6STDA 1LOXA 4FCZA 4H3UA 2WGQA 3ECFA 4KFEA 3NHXA 2XFSA 1TFKA 3FG4A 2E2TA 4I4KA 4KFDA 2Z7AA 3S29A 1W6CA 3HIGA 2V1LA 2BO9B 3D3LA 1GY6A 3FG3A 4XBTA 4O3VA 2K54A 1D6YA 1VQK3 3G6E3 3CCM3 3HZPA 1ULJB 3DGMA 3K5TA 5KP1A 1IV9A 3B4OA 1SIHA 3WOEB 3JUNA 2BMQB 3BNEA 3X41A 3F9SA 1N9JA 4N6NB 5STDA 1PU4A 2CK3H 4R1KA 2CKFB 4AKZA 1OGXA 4GL6A 1Q864 5AEWB 3HI7A 3K9MC 4R4KA 2K0MA 3RDEA 3STDA 1IVVA 2ZL8A 3Q2PA 3OWUA 3DXOA 5EEOA 1M1K4 3NBRA 1JN5B 4EXRA 4K61A 5DREA 3DGLA 1Q824 3WOFB 3MSOA 2A15A 4KFFA 4BTWA 4J8TA 1V74A 4N6UA 4CDLA 4EBGA 4XBXA 1W4NA 4RNYA 3S27A 2F99A 1ROAA 4U13A 2BHMA 4G1MB 1GY5A 2GXFA 1O7PB 2I9WA 4HM7B 1IVUA 4L8OA 3UL5A 1E97A 1CQSA 3MG2A 3G16A 1NB5I 1VQ83 2FXTA 3CCR3 5BVBA 2UX0A 3DMCA 3LTCA 3PYJA 4IT7A 3B8LA 3KSED 1VQ73 1M904 1A2VA 1EKMA 1JRQA 4IIAA 3F14A 1Z1SA 2ML6A 1QAFA 3FZWA 2ML5A 3BNBA 3NM2A 3CME3 2KXGA 2BMOB 5BXQA 1K9M4 2CWUA 4N6LA 3SLUA 1ASKA 3RGAA 1IU7A 3X40A 4AEQA 2OQEA 1AVKA 1SPUA 2LQVA 3DUKA 3H51A 4STDA 2XEPA 3N54B 1D6UA 2E2UA 4MMYB 2IUJA 1FGMA 3B7CA 4JF8A 5IG4A 2P09A 4WHAA 3OX9A 1GD4A 4X2OA 3JUPA 4N6MA 5IG3A 1YIJ3 2BMRB 2CFLA 1OHOA 3K0ZA 3K7CA 1TFOA 1O7HB 2D42A 3VF1A 1CYVA 1U8CB 1Q7Y4 4WWUC 1U5OA 3WDGB 3OW22 1W6YA 5CK6A 1M9GA 3V98A 1UI7A 1YHQ3 2PNCA 3AMOB 1SJWA 2QA43 2YFIB 2B1XB 1W01A 4QWTA 1JB4A 1STFI 1HU9A 1OF5A 3QRDA 3FCSB 3ALAA 5JBSA 3OWYA 2LYXA 3NM7A 3N8BA 2XGLA 3G4S3 3LOYA 3EX9A 1NJI4 1NDOB 1DVDA 1IVWA 1W2ZA 5EQLA 2JDIH 2E2VA 1OHSA 3I563 1LNHA 1UUVB 3PCRA 4LGQA 5LC6A 3T0UA 2RGQA 3FSDA 1OGZA 4WYKA 2GBWB 2OQEC 4WP5A 3OV4A 1RN7A 3F7SA 4FMCA 5D82A 2P05A 1S723 2CWTA 3KKGA 1WMNA 1W7CA 2GBXB 3KZTA 3DY5A 3UJMA 2CIUA 1KQS2 1W00A 4XB5A 2GU1A 2KCDA 4EV2A 2C10A 5G2GA 2Y74A 1K8A4 4FR9A 1EG9B 4HM8B 3L0RA 1W02A 4K1VA 3BB9A 1GY7A 1AR0A 4HM6B 4MJDA 5IENA 1N8R4 4GB5A 1O7MB 1STDA 2KRTA 2Z6BA 1CYUA 1DYUA 3NV0A 1UW1A 2Y73A 4N6TA 1VQL3 1A2KA 3Q90A 2F86B 1TP6A 3EB8A 3LH4A 3V92A 3SXXA 2MF7A 2PZVA 1K28A 1WQLB 3IJEB 3NUVA 3CCQ3 1RRHA 2P38A 2P0XA 3CCV3 3CPW2 4O2HA 2QIYA 2CG1A 2P0MA 2INXA 2W2CA 3HK4A 4HM0B 3EC9A 5IG5A 1FUWA 1Q40A 3I553 3FF0A 1VZZA 1K41A 4J9AA 1CEWI 3G713 1OH0A 1DMQA 3F8HA 1MOLA 3DGNA 3NQYA 1Q814 1JB2A 1RRLA 3B4PA 2HMOB 5FGOA 3WA2X 4RZMA 3LT9A 1FGQA 3PXMA 4WFOA 3UB1A 5CF1A 5AIIA 2RCDA 3FH1A 4HZBB 4MMXB 1J2BA 3OXAA 1VQP3 1W5ZA 1WNHA 3SEDA 3SOAA 1E3VA 3S67A 2W6JH 1F8NA 1OPYA 1UUWB 3NBJA 8CHOA 2FGTA 3FG1A 3CCE3 1S5AA 5I97A 3TDGA 1T5YA 4Q53A 5KP4A 2RSXA 3JUOA 2STDA 1JV2B 1EA2A 3CNMA 2QGUA 2CWVA 2W04A 3KSPA 4HVNA 4N3VA 1N5PA 1QALA 3BLZA 3HIIA 1YGEA 2CC3A 3MG3A 4FCMA 2O9UX 3NQZA 3CC23 3N9HA 2BNGA 3EE1A 3KN4A 2XH9A 1M1XB 1NO3A 4MEIA 4R9LA 3MYTA 1ULIB 3LMLA 1IT7A 1W6GA 1WTHA 1DMNA 2O3OA 1IV7A 2GEXA 5EVHA 1OF5B 3E99A 4LEHA 3RGRA 2OWPA 1JNQA 3FF2A 4TX4A 4AKYA 5AIGA 3EQQB 5KP3A 1KC84 3DZLA 3DGOA 5ELUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WYK B;  1DMM A;  1JB5 A;  3M8C A;  1NU3 A;  5IG0 A;  3D9R A;  1O7N B;  1O7G B;  3HX8 A;  2R4I A;  2HMM B;  5JPP A;  2JQ5 A;  5FW5 A;  3EF8 A;  3ER7 A;  3UNL A;  2F98 A;  1ZO2 A;  3MG1 A;  3EN1 B;  1JKG A;  3CPO A;  3F40 A;  3NV0 B;  3FGY A;  3SOY A;  3KE7 A;  4HM1 B;  3IPT A;  3ROB A;  4HM4 B;  2HMN B;  3I0Y A;  3GZB A;  5HGR A;  5D81 A;  2Z76 A;  1Q40 B;  5CF2 A;  3G0K A;  3MKI A;  1QMA A;  1O7W B;  4HJL B;  3F8X A;  5D83 A;  3H3H A;  3GZX B;  2CHC A;  3GZR A;  1GYB A;  3GZY B;  5IER A;  4FCJ A;  2YFJ B;  3G8Z A;  3FLJ A;  4LMI A;  4PEJ A;  3EN8 A;  4HM3 B;  5AEU B;  4L8P A;  1JN5 A;  1QJG A;  5JPU A;  3JUM A;  5CXO A;  1E3R A;  4XM4 A;  3GWR A;  3F7X A;  1Q42 A;  1ISK A;  2HMJ B;  3NXJ A;  2XRX B;  2IMJ A;  1GS3 A;  5IEO A;  5AI1 A;  3JUQ A;  4XBY A;  3A76 A;  5IEP A;  3MHE A;  4OVM A;  3LZA A;  1C7H A;  3VSY A;  2HML B;  2XSO B;  3EBT A;  3WMD A;  1BUQ A;  4HM2 B;  1IDP A;  4X2H A;  1NWW A;  4KVH A;  2RFR A;  1HKX A;  3GRD A;  1OUN A;  5AIH A;  3T8N A;  4XDW A;  3S5C A;  3VGN A;  2GEY A;  4HKV B;  2HMK B;  2YFL B;  3DM8 A;  2B24 B;  3OWS A;  5DRV A;  4XDV A;  1OCV A;  4K1U A;  4ORL A;  7STD A;  2Z77 A;  3LYG A;  3EJV A;  3FKA A;  1TUH A;  2XSH B;  5TGN A;  5IF6 A;  1JKG B;  3CNX A;  1OHP A;  3CU3 A;  3EBY A;  4HM5 B;  2XR8 B;  4OUQ A;  5CLK A;  3T8U A;  1ZX2 A;  4L7K A;  5AIF A;  4HZ9 B;  3EHC A;  4R9K A;  6STD A;  4H3U A;  3ECF A;  3NHX A;  4I4K A;  2Z7A A;  1GY6 A;  4XBT A;  2K54 A;  3HZP A;  1ULJ B;  5KP1 A;  3B4O A;  3JUN A;  2BMQ B;  3F9S A;  5STD A;  4R1K A;  2CKF B;  1OGX A;  5AEW B;  3STD A;  3OWU A;  3DXO A;  3NBR A;  1JN5 B;  5DRE A;  3MSO A;  2A15 A;  4J8T A;  4CDL A;  4XBX A;  2F99 A;  4U13 A;  1GY5 A;  2GXF A;  1O7P B;  2I9W A;  4HM7 B;  4L8O A;  1E97 A;  1CQS A;  3MG2 A;  3G16 A;  5BVB A;  2UX0 A;  3DMC A;  3B8L A;  4IIA A;  3F14 A;  1Z1S A;  3FZW A;  3NM2 A;  2BMO B;  5BXQ A;  1ASK A;  3RGA A;  3DUK A;  3H51 A;  4STD A;  3B7C A;  5IG4 A;  3OX9 A;  4X2O A;  3JUP A;  5IG3 A;  2BMR B;  3K7C A;  1OHO A;  3K0Z A;  1O7H B;  4WWU C;  1U5O A;  1W6Y A;  5CK6 A;  1SJW A;  2YFI B;  2B1X B;  1W01 A;  1JB4 A;  1OF5 A;  3OWY A;  3EX9 A;  1NDO B;  1OHS A;  1UUV B;  4LGQ A;  2RGQ A;  3FSD A;  1OGZ A;  4WYK A;  2GBW B;  4WP5 A;  3OV4 A;  3F7S A;  5D82 A;  3KKG A;  3KZT A;  2GBX B;  3UJM A;  1W00 A;  4XB5 A;  5G2G A;  1EG9 B;  4HM8 B;  1W02 A;  4K1V A;  3BB9 A;  1GY7 A;  1AR0 A;  4HM6 B;  4MJD A;  5IEN A;  4GB5 A;  1O7M B;  1STD A;  3NV0 A;  1A2K A;  3Q90 A;  2F86 B;  1TP6 A;  2PZV A;  3NUV A;  1WQL B;  2QIY A;  2INX A;  2W2C A;  3HK4 A;  4HM0 B;  3EC9 A;  5IG5 A;  1Q40 A;  3FF0 A;  1VZZ A;  1K41 A;  4J9A A;  1OH0 A;  1DMQ A;  3F8H A;  1JB2 A;  3B4P A;  2HMO B;  4RZM A;  5CF1 A;  5AII A;  2RCD A;  3FH1 A;  4HZB B;  3OXA A;  3SED A;  3SOA A;  1E3V A;  1OPY A;  1UUW B;  8CHO A;  1S5A A;  4Q53 A;  5KP4 A;  3JUO A;  2STD A;  3CNM A;  1EA2 A;  2QGU A;  3KSP A;  4HVN A;  4N3V A;  3BLZ A;  3MG3 A;  4FCM A;  2BNG A;  4R9L A;  3MYT A;  1ULI B;  1DMN A;  2GEX A;  5EVH A;  1OF5 B;  3E99 A;  4LEH A;  3RGR A;  2OWP A;  3FF2 A;  5AIG A;  3EQQ B;  5KP3 A;  3DZL A; 
#chains in the Genus database with same CATH topology
 4JRF A;  4WYK B;  1DMM A;  4LSO A;  2K3D A;  3LTA A;  1JB5 A;  3BIR A;  3M8C A;  1NU3 A;  5AYS C;  3UL6 A;  3X3X A;  3QK9 A;  4O8S A;  1SII A;  1TIJ A;  5IG0 A;  2CFD A;  3DH2 A;  3D9R A;  3NBB A;  1CH0 A;  1O7N B;  3O8Y A;  1JJ2 2;  1O7G B;  1V58 A;  1VQO 3;  1BAO A;  1QAK A;  3HX8 A;  2R4I A;  5GSP A;  2HMM B;  5JPP A;  2JQ5 A;  1VQ6 3;  5FW5 A;  1RGG A;  2CFW A;  4BTX A;  3EF8 A;  3DGY A;  4FMD A;  3ER7 A;  3KII A;  3UNL A;  1FA3 A;  3PS8 A;  4BTY A;  3CC7 3;  4EV5 A;  1I8V A;  2F98 A;  1ZO2 A;  2CFG A;  3JVC A;  1LXE A;  3MG1 A;  6RNT A;  3EN1 B;  1JKG A;  2W9P A;  3CPO A;  4ZM8 A;  1A67 A;  3HOH A;  3F40 A;  1KD1 4;  3NV0 B;  1IVX A;  2IA7 A;  2XFT A;  1MGW A;  3X3Y A;  1IQY A;  2OCT A;  3FGY A;  3SOY A;  2R41 A;  1B2M A;  2OTL 3;  3K63 A;  1B27 A;  1BRJ A;  3IPT A;  3KE7 A;  1LRA A;  1N9E A;  3PCS A;  4HM1 B;  3ROB A;  1UCK A;  1BSA A;  3D79 A;  2XF3 A;  2QEX 3;  4HM4 B;  4H61 A;  1VQN 3;  3CD6 3;  2HMN B;  3I0Y A;  4OK0 A;  5LC7 A;  2YX9 A;  3GAX A;  1EEJ A;  3KFQ C;  1B2S A;  3GZB A;  1RGF A;  2BT3 A;  4HBR A;  5HGR A;  5D81 A;  8RNT A;  1QVG 2;  2GU3 A;  1TRQ A;  2UGI A;  2Z76 A;  2W56 A;  1Q40 B;  5CF2 A;  3CXC 2;  3G0K A;  3MKI A;  1FGO A;  1QMA A;  2OOV C;  3CC4 3;  1AVL A;  1BRG A;  1O7W B;  2ZA4 A;  1BUJ A;  4HJL B;  1G02 A;  3U1W A;  2OTJ 3;  3CCJ 3;  1TU5 A;  1GOV A;  3F8X A;  3WOD G;  4NHF A;  1LVN A;  1QVF 2;  1B20 A;  5D83 A;  4I5Q A;  4BL3 A;  1IK3 A;  3H3H A;  4EYC A;  2KF4 A;  3GZX B;  2CW9 A;  2CHC A;  1B2Z A;  3GZR A;  1JZO A;  1GYB A;  3BND A;  3Q1C A;  1IQX A;  3GZY B;  3WA3 A;  5ELJ A;  4BU4 A;  1B21 A;  2CH9 A;  1FGT A;  5IER A;  1RMS A;  1ROV A;  1WMO A;  2FNQ A;  1VQ4 3;  4IPB A;  2W9Q A;  4FCJ A;  4FMB A;  1AV4 A;  2SBL A;  2YFJ B;  3FLJ A;  3G8Z A;  4KZ1 A;  4LMI A;  1RKY A;  1VQ5 3;  2IUK A;  1N8Q A;  4PEJ A;  2Q07 A;  1RTU A;  2M7O A;  4HYZ A;  3EN8 A;  4HM3 B;  5AEU B;  2UUG C;  1GMR A;  4L8P A;  3X3Z A;  1JN5 A;  1PYL A;  1QJG A;  5JPU A;  2CFK A;  3JUM A;  5CXO A;  1E3R A;  4XM4 A;  2MC8 A;  1RLS A;  3GWR A;  3LTB A;  1OAC A;  3F7X A;  1Q9E A;  1SQW A;  1Q42 A;  1YI2 3;  1ISK A;  1R4C A;  3CCS 3;  2HMJ B;  3NXJ A;  3CCL 3;  1YJN 3;  2XRX B;  2IMJ A;  1GS3 A;  5IEO A;  4HOH A;  5AI1 A;  1W2B 2;  3U97 A;  1A90 A;  1IT8 A;  3JUQ A;  4XBY A;  1IQ8 A;  3A76 A;  3AHS A;  1FZU A;  3MHE A;  4KT3 B;  1V57 A;  4OVM A;  5IEP A;  2H0H A;  3LZA A;  3LT8 A;  2W0Q A;  4MMZ B;  1C7H A;  1X1U A;  2HML B;  1GOY A;  1UGI A;  2XSO B;  3EBT A;  3VSY A;  3X42 A;  3WMD A;  1VQM 3;  1YNV X;  3PZW A;  4RNZ A;  1BUQ A;  4EC6 A;  4HM2 B;  4FMA A;  1IDP A;  4X2H A;  1NWW A;  4KVH A;  3CCU 3;  5A0O B;  1RCK A;  1B3S A;  2RFR A;  4LZI A;  4N6O B;  1HKX A;  3WHO A;  1BSE A;  2J8X B;  3MPH A;  3S28 A;  3SVA A;  3GRD A;  2XGN A;  1FUS A;  1OUN A;  1A2P A;  5AIH A;  3T8N A;  4XDW A;  1BNS A;  3S5C A;  1UDI I;  3NX0 A;  2D1W A;  1DVC A;  3VGN A;  1RGA A;  1US1 A;  2GEY A;  1YVB I;  2F56 A;  3SX1 A;  1YIT 3;  2WO0 A;  4J5K A;  3PGB A;  4R80 A;  4HKV B;  2HMK B;  2YFL B;  3J7Y d;  4NRE A;  3DM8 A;  2OOV A;  2B24 B;  3OWS A;  5DRV A;  1X1W A;  4XDV A;  3BNC A;  1OCV A;  1AQZ A;  2CG0 A;  4O02 B;  1GMQ A;  4K1U A;  1UUG B;  4ORL A;  3AMO A;  7STD A;  2RBI A;  2F5M A;  4RBN A;  1G96 A;  1YJ9 3;  2Z77 A;  3LYG A;  3EJV A;  5IW9 A;  1NNV A;  1VQQ A;  3FKA A;  1TUH A;  3LXU X;  2XSH B;  5TGN A;  1I2G A;  5IF6 A;  1JKG B;  4N6V 0;  3IMA B;  1WMP A;  1I2F A;  2WOF A;  3CNX A;  1YJW 3;  1N5H A;  1PFP A;  2C11 A;  1OHP A;  1RN1 A;  3CU3 A;  1BU4 A;  1VQ9 3;  2W03 A;  1EUI C;  3LTD A;  1FGR A;  1GD3 A;  1SAR A;  4ILF A;  5AYR B;  7RNT A;  1MNL A;  1Y4K A;  6GSP A;  2F5W A;  3EBY A;  3GSP A;  2ZDJ A;  5BU4 A;  1MWR A;  1D6Z A;  4HM5 B;  1RGE A;  2XR8 B;  1RN4 A;  4OUQ A;  5CLK A;  2AAD A;  1ZX2 A;  1BSB A;  4L7K A;  5AIF A;  1L5G B;  3T8U A;  3V99 A;  1RJO A;  1MWU A;  4CCV A;  1EQK A;  1NB3 I;  2L4V A;  2WGO A;  1BRN L;  1BNR A;  2W56 B;  1T3B A;  2WOH A;  1KWI A;  4HZ9 B;  3EHC A;  3MWZ A;  1MWT A;  4K90 B;  1K73 4;  3CMA 3;  1KSI A;  9RNT A;  4R9K A;  1RNT A;  1BNG A;  1UI8 A;  1LOX A;  1BSD A;  4FCZ A;  4H3U A;  6STD A;  2WGQ A;  3ECF A;  4KFE A;  3NHX A;  1TFK A;  2XFS A;  3FG4 A;  2E2T A;  4I4K A;  2KAA A;  2Z7A A;  4KFD A;  3S29 A;  1W6C A;  3HIG A;  2V1L A;  2BO9 B;  3D3L A;  1GY6 A;  3FG3 A;  1BIR A;  4XBT A;  4O3V A;  2K54 A;  1D6Y A;  2KF6 A;  1VQK 3;  3G6E 3;  3CCM 3;  3HZP A;  1ULJ B;  3DGM A;  3K5T A;  5KP1 A;  1IV9 A;  3B4O A;  1SIH A;  3WOE B;  1IYY A;  2KF5 A;  3JUN A;  2BMQ B;  3BNE A;  3X41 A;  3URP A;  3F9S A;  1N9J A;  4N6N B;  5STD A;  1PU4 A;  3D5I A;  1RDS A;  1LQG C;  2CK3 H;  4R1K A;  2CKF B;  4AKZ A;  1OGX A;  4GL6 A;  1Q86 4;  5AEW B;  2CX0 A;  3HI7 A;  3K9M C;  4R4K A;  2K0M A;  3RDE A;  3STD A;  1IVV A;  2ZL8 A;  3Q2P A;  3OWU A;  3DXO A;  2L1S A;  5EEO A;  1LQM B;  1LNI A;  1M1K 4;  3NBR A;  1JN5 B;  4EXR A;  4K61 A;  3ZG0 A;  5DRE A;  3RNT A;  3DGL A;  1Q82 4;  3WOF B;  3MSO A;  1MWS A;  1ZS7 A;  2A15 A;  4KFF A;  4BTW A;  4J8T A;  1V74 A;  4N6U A;  4CDL A;  1GMP A;  2C4B A;  4EBG A;  4XBX A;  1W4N A;  4RNY A;  3AGO A;  3S27 A;  5G1K A;  2F99 A;  1ROA A;  4U13 A;  2BHM A;  4G1M B;  1GY5 A;  2GXF A;  1O7P B;  2I9W A;  4HM7 B;  1IVU A;  4L8O A;  3UL5 A;  1E97 A;  1CQS A;  3MG2 A;  3G16 A;  1NB5 I;  1VQ8 3;  1BNI A;  1TRP A;  2FXT A;  1HYF A;  5BVB A;  3CCR 3;  2UX0 A;  3DMC A;  3LTC A;  3PYJ A;  4IT7 A;  3B8L A;  3KSE D;  1VQ7 3;  1M90 4;  1A2V A;  1EKM A;  1JRQ A;  4IIA A;  4CJN A;  3F14 A;  1Z1S A;  2ML6 A;  1GOU A;  1QAF A;  3FZW A;  2ML5 A;  3BNB A;  3NM2 A;  1JZD A;  2KXG A;  3CME 3;  2BMO B;  5BXQ A;  1K9M 4;  2CWU A;  4N6L A;  3SLU A;  1ASK A;  4NPB A;  3RGA A;  1IU7 A;  3X40 A;  2H0G A;  4AEQ A;  1I0V A;  2OQE A;  1AVK A;  1SPU A;  2LQV A;  3AHW A;  1AY7 A;  3DUK A;  3H51 A;  4STD A;  2XEP A;  1T2H A;  3N54 B;  1D6U A;  1X1Y A;  2E2U A;  4MMY B;  1FGM A;  2IUJ A;  3B7C A;  4JF8 A;  5IG4 A;  2P09 A;  4WHA A;  3OX9 A;  1GD4 A;  1FW7 A;  4X2O A;  3JUP A;  4N6M A;  5IG3 A;  5RNT A;  2BMR B;  2CFL A;  1OHO A;  1BNF A;  2GSP A;  1RGL A;  1RGH A;  1TFO A;  3K0Z A;  3K7C A;  1O7H B;  4J5G A;  2D42 A;  3VF1 A;  1CYV A;  1G0T A;  1DE3 A;  1U8C B;  1PY3 A;  1Q7Y 4;  4WWU C;  1U5O A;  3WDG B;  3OW2 2;  4GSP A;  1W6Y A;  5CK6 A;  1M9G A;  3V98 A;  1UI7 A;  2SAR A;  1YHQ 3;  2PNC A;  7GSP A;  2KF3 A;  3AMO B;  1SJW A;  2QA4 3;  2YFI B;  2B1X B;  1W01 A;  4QWT A;  5M19 A;  1JBS A;  1JB4 A;  1BVI A;  1STF I;  1HU9 A;  1MGR A;  1OF5 A;  3QRD A;  1B2X A;  1UCI A;  1RHL A;  3ALA A;  2LYX A;  3FCS B;  3N8B A;  3NM7 A;  3OWY A;  2XGL A;  3G4S 3;  3LOY A;  3EX9 A;  1NJI 4;  1NDO B;  1DVD A;  1IVW A;  1W2Z A;  3SYU A;  5EQL A;  2JDI H;  2E2V A;  1OHS A;  3I56 3;  1LNH A;  1UUV B;  3PCR A;  4LGQ A;  4LYL B;  5LC6 A;  1DET A;  3T0U A;  2RGQ A;  1I0X A;  1OGZ A;  3FSD A;  4WYK A;  2GBW B;  2OQE C;  4RNT A;  4WP5 A;  3OV4 A;  4GHO A;  1RN7 A;  4BL2 A;  3F7S A;  4FMC A;  5D82 A;  2P05 A;  1S72 3;  5JBS A;  2CWT A;  3KKG A;  1WMN A;  1W7C A;  2GBX B;  3KZT A;  3DY5 A;  3UJM A;  2CIU A;  1LOV A;  1W00 A;  4XB5 A;  1KQS 2;  4DKI A;  2GU1 A;  2KCD A;  2HOH A;  4EV2 A;  2C10 A;  1Q7H A;  1RGK A;  5G2G A;  1BGS A;  2Y74 A;  1BAN A;  1K8A 4;  4FR9 A;  1EG9 B;  4HM8 B;  3L0R A;  1W02 A;  3AGN A;  3BB9 A;  1GY7 A;  1AR0 A;  1R4Y A;  1YGW A;  4HM6 B;  4K1V A;  4MJD A;  5M18 A;  1N8R 4;  1UCL A;  4GB5 A;  1O7M B;  1STD A;  2KRT A;  2Z6B A;  1CYU A;  1DYU A;  3NV0 A;  1UW1 A;  2BU4 A;  2Y73 A;  4N6T A;  1VQL 3;  1A2K A;  3Q90 A;  1I3I A;  1TJD A;  2F86 B;  1TP6 A;  3EB8 A;  3LH4 A;  3V92 A;  5BIR A;  3SXX A;  2MF7 A;  2PZV A;  1K28 A;  1WQL B;  1ZGX A;  3IJE B;  3NUV A;  3CCQ 3;  1RRH A;  2P38 A;  2P0X A;  3CCV 3;  3CPW 2;  4O2H A;  2QIY A;  1FUT A;  4HAA A;  1C54 A;  2CG1 A;  2P0M A;  2INX A;  2W2C A;  3HK4 A;  4HM0 B;  3EC9 A;  5IG5 A;  1I3F A;  1FUW A;  1Q40 A;  3I55 3;  3FF0 A;  1VZZ A;  1K41 A;  4J9A A;  1CEW I;  1UGH I;  3G71 3;  1OH0 A;  1DMQ A;  3F8H A;  1MOL A;  2BIR A;  3DGN A;  3NQY A;  1YIJ 3;  1Q81 4;  1JB2 A;  1RRL A;  3B4P A;  2HMO B;  1T2I A;  5FGO A;  3WA2 X;  1RNB A;  1X1X A;  2H0I A;  4RZM A;  3LT9 A;  1BRH A;  1B2U A;  1RGC A;  1FGQ A;  1RCL A;  3PXM A;  4WFO A;  3D5G A;  3UB1 A;  2IY2 A;  2RCD A;  5AII A;  5CF1 A;  3FH1 A;  4HZB B;  4MMX B;  1J2B A;  3OXA A;  1VQP 3;  1W5Z A;  1FYS A;  1WNH A;  4CPK A;  1GSP A;  5M1A A;  3SED A;  3SOA A;  1LOY A;  1BSC A;  5G1L A;  1E3V A;  3S67 A;  1LOW A;  3KCH A;  1RSN A;  2IYJ A;  2W6J H;  1F8N A;  3ZG5 A;  1OPY A;  1UUW B;  3NBJ A;  8CHO A;  2FGT A;  3FG1 A;  3CCE 3;  1S5A A;  5I97 A;  3TDG A;  1TTO A;  1BRI A;  1T5Y A;  3BU4 A;  4Q53 A;  1BNE A;  5KP4 A;  2RSX A;  3JUO A;  2STD A;  1JV2 B;  1EA2 A;  3CNM A;  2QGU A;  3ZFZ A;  2CWV A;  2W04 A;  2RNT A;  3KSP A;  4HVN A;  4N3V A;  1N5P A;  1QAL A;  3BLZ A;  3HII A;  1YGE A;  2CC3 A;  3MG3 A;  4FCM A;  4BIR A;  2ZHX B;  2O9U X;  1JBR A;  5IEN A;  3A5E A;  3NQZ A;  3N9H A;  2BNG A;  3CC2 3;  1YVS A;  3D4A A;  3EE1 A;  5HOH A;  3KN4 A;  2XH9 A;  1M1X B;  1NO3 A;  4MEI A;  4R9L A;  3MYT A;  1ULI B;  2F4Y A;  1I70 A;  3WR2 A;  3LML A;  1IT7 A;  1HZ1 A;  3Q3F A;  1BOX A;  1W6G A;  1WTH A;  1DMN A;  2O3O A;  1IV7 A;  2GEX A;  1BRK A;  5EVH A;  2CX1 A;  1OF5 B;  3E99 A;  1JBT A;  4LEH A;  3RGR A;  2OWP A;  1JNQ A;  3FF2 A;  4TX4 A;  4AKY A;  5AIG A;  2AAE A;  1BNJ A;  3EQQ B;  5KP3 A;  1KC8 4;  1BRS A;  3DZL A;  1I2E A;  1UCJ A;  3DGO A;  5ELU A;  4EW5 A; 
#chains in the Genus database with same CATH homology
 4JRF A;  4WYK B;  1DMM A;  4LSO A;  3LTA A;  1JB5 A;  3M8C A;  1NU3 A;  5AYS C;  3UL6 A;  3X3X A;  3QK9 A;  4O8S A;  1SII A;  1TIJ A;  5IG0 A;  2CFD A;  3NBB A;  3D9R A;  3O8Y A;  1JJ2 2;  1O7N B;  1O7G B;  1VQO 3;  1QAK A;  3HX8 A;  2R4I A;  2HMM B;  5JPP A;  2JQ5 A;  1VQ6 3;  5FW5 A;  2CFW A;  4BTX A;  3EF8 A;  4FMD A;  3ER7 A;  3KII A;  3UNL A;  1FA3 A;  3PS8 A;  4BTY A;  3CC7 3;  4EV5 A;  2F98 A;  1ZO2 A;  2CFG A;  3JVC A;  1LXE A;  3MG1 A;  3EN1 B;  1JKG A;  2W9P A;  3CPO A;  4ZM8 A;  1A67 A;  3F40 A;  1KD1 4;  3NV0 B;  1IVX A;  2IA7 A;  2XFT A;  3X3Y A;  1IQY A;  2OCT A;  3FGY A;  3SOY A;  2OTL 3;  3K63 A;  3KE7 A;  3IPT A;  4HM1 B;  3PCS A;  1N9E A;  3ROB A;  2XF3 A;  2QEX 3;  4HM4 B;  4H61 A;  1VQN 3;  3CD6 3;  2HMN B;  3I0Y A;  4OK0 A;  5LC7 A;  2YX9 A;  3GAX A;  3KFQ C;  3GZB A;  2BT3 A;  4HBR A;  5HGR A;  5D81 A;  1QVG 2;  2GU3 A;  2Z76 A;  2W56 A;  1Q40 B;  5CF2 A;  3CXC 2;  3G0K A;  3MKI A;  2OOV C;  1FGO A;  1QMA A;  3CC4 3;  1AVL A;  1O7W B;  4HJL B;  3U1W A;  2OTJ 3;  3CCJ 3;  1TU5 A;  3F8X A;  3WOD G;  4NHF A;  1LVN A;  1QVF 2;  5D83 A;  1IK3 A;  3H3H A;  4EYC A;  3GZX B;  2CW9 A;  2CHC A;  3GZR A;  1GYB A;  3BND A;  3Q1C A;  1IQX A;  3GZY B;  3WA3 A;  5ELJ A;  5IER A;  2CH9 A;  1FGT A;  1WMO A;  1ROV A;  2FNQ A;  1VQ4 3;  4IPB A;  2W9Q A;  4FCJ A;  4FMB A;  1AV4 A;  2SBL A;  2YFJ B;  3FLJ A;  3G8Z A;  4KZ1 A;  4LMI A;  1RKY A;  1VQ5 3;  2IUK A;  1N8Q A;  4PEJ A;  2Q07 A;  2M7O A;  4HYZ A;  3EN8 A;  4HM3 B;  5AEU B;  4L8P A;  3X3Z A;  1JN5 A;  1QJG A;  5JPU A;  2CFK A;  3JUM A;  5CXO A;  1E3R A;  4XM4 A;  2MC8 A;  3GWR A;  3LTB A;  1OAC A;  3F7X A;  1SQW A;  1Q42 A;  1YI2 3;  1ISK A;  1R4C A;  3CCS 3;  2HMJ B;  3NXJ A;  3CCL 3;  1YJN 3;  2XRX B;  2IMJ A;  1GS3 A;  5IEO A;  5AI1 A;  1W2B 2;  3U97 A;  1A90 A;  1IT8 A;  3JUQ A;  4XBY A;  1IQ8 A;  3A76 A;  3MHE A;  4OVM A;  5IEP A;  3LZA A;  3LT8 A;  2W0Q A;  4MMZ B;  1C7H A;  3VSY A;  2HML B;  2XSO B;  3EBT A;  3X42 A;  3WMD A;  1VQM 3;  3PZW A;  4RNZ A;  1BUQ A;  4EC6 A;  4HM2 B;  4FMA A;  1IDP A;  4X2H A;  1NWW A;  4KVH A;  3CCU 3;  5A0O B;  2RFR A;  4LZI A;  4N6O B;  1HKX A;  3MPH A;  3S28 A;  3SVA A;  3GRD A;  2XGN A;  1OUN A;  5AIH A;  3T8N A;  4XDW A;  3S5C A;  3NX0 A;  2D1W A;  1DVC A;  3VGN A;  1US1 A;  2GEY A;  1YVB I;  3SX1 A;  1YIT 3;  2WO0 A;  3PGB A;  4R80 A;  4HKV B;  2HMK B;  2YFL B;  3J7Y d;  4NRE A;  3DM8 A;  2OOV A;  2B24 B;  3OWS A;  5DRV A;  4XDV A;  3BNC A;  1OCV A;  2CG0 A;  4O02 B;  4K1U A;  4ORL A;  3AMO A;  7STD A;  1YJ9 3;  4RBN A;  1G96 A;  2Z77 A;  3LYG A;  3EJV A;  5IW9 A;  3FKA A;  3LXU X;  1TUH A;  2XSH B;  5TGN A;  5IF6 A;  1JKG B;  4N6V 0;  3IMA B;  1WMP A;  2WOF A;  3CNX A;  1YJW 3;  1N5H A;  1PFP A;  2C11 A;  1OHP A;  3CU3 A;  1VQ9 3;  2W03 A;  3LTD A;  5AYR B;  1FGR A;  1GD3 A;  1MNL A;  1Y4K A;  3EBY A;  2ZDJ A;  1D6Z A;  4HM5 B;  2XR8 B;  4OUQ A;  5CLK A;  3T8U A;  1ZX2 A;  4L7K A;  1L5G B;  5AIF A;  3V99 A;  1RJO A;  4CCV A;  1EQK A;  1NB3 I;  2L4V A;  2WGO A;  2W56 B;  2WOH A;  1KWI A;  4HZ9 B;  3EHC A;  3MWZ A;  3CMA 3;  4K90 B;  1K73 4;  1KSI A;  4R9K A;  1UI8 A;  6STD A;  1LOX A;  4FCZ A;  4H3U A;  2WGQ A;  3ECF A;  4KFE A;  3NHX A;  2XFS A;  1TFK A;  3FG4 A;  2E2T A;  4I4K A;  4KFD A;  2Z7A A;  3S29 A;  1W6C A;  3HIG A;  2V1L A;  2BO9 B;  3D3L A;  1GY6 A;  3FG3 A;  4XBT A;  4O3V A;  2K54 A;  1D6Y A;  1VQK 3;  3G6E 3;  3CCM 3;  3HZP A;  1ULJ B;  3DGM A;  3K5T A;  5KP1 A;  1IV9 A;  3B4O A;  1SIH A;  3WOE B;  3JUN A;  2BMQ B;  3BNE A;  3X41 A;  3F9S A;  1N9J A;  4N6N B;  5STD A;  1PU4 A;  2CK3 H;  4R1K A;  2CKF B;  4AKZ A;  1OGX A;  4GL6 A;  1Q86 4;  5AEW B;  3HI7 A;  3K9M C;  4R4K A;  2K0M A;  3RDE A;  3STD A;  1IVV A;  2ZL8 A;  3Q2P A;  3OWU A;  3DXO A;  5EEO A;  1M1K 4;  3NBR A;  1JN5 B;  4EXR A;  4K61 A;  5DRE A;  3DGL A;  1Q82 4;  3WOF B;  3MSO A;  2A15 A;  4KFF A;  4BTW A;  4J8T A;  1V74 A;  4N6U A;  4CDL A;  4EBG A;  4XBX A;  1W4N A;  4RNY A;  3S27 A;  2F99 A;  1ROA A;  4U13 A;  2BHM A;  4G1M B;  1GY5 A;  2GXF A;  1O7P B;  2I9W A;  4HM7 B;  1IVU A;  4L8O A;  3UL5 A;  1E97 A;  1CQS A;  3MG2 A;  3G16 A;  1NB5 I;  1VQ8 3;  2FXT A;  3CCR 3;  5BVB A;  2UX0 A;  3DMC A;  3LTC A;  3PYJ A;  4IT7 A;  3B8L A;  3KSE D;  1VQ7 3;  1M90 4;  1A2V A;  1EKM A;  1JRQ A;  4IIA A;  3F14 A;  1Z1S A;  2ML6 A;  1QAF A;  3FZW A;  2ML5 A;  3BNB A;  3NM2 A;  3CME 3;  2KXG A;  2BMO B;  5BXQ A;  1K9M 4;  2CWU A;  4N6L A;  3SLU A;  1ASK A;  3RGA A;  1IU7 A;  3X40 A;  4AEQ A;  2OQE A;  1AVK A;  1SPU A;  2LQV A;  3DUK A;  3H51 A;  4STD A;  2XEP A;  3N54 B;  1D6U A;  2E2U A;  4MMY B;  2IUJ A;  1FGM A;  3B7C A;  4JF8 A;  5IG4 A;  2P09 A;  4WHA A;  3OX9 A;  1GD4 A;  4X2O A;  3JUP A;  4N6M A;  5IG3 A;  1YIJ 3;  2BMR B;  2CFL A;  1OHO A;  3K0Z A;  3K7C A;  1TFO A;  1O7H B;  2D42 A;  3VF1 A;  1CYV A;  1U8C B;  1Q7Y 4;  4WWU C;  1U5O A;  3WDG B;  3OW2 2;  1W6Y A;  5CK6 A;  1M9G A;  3V98 A;  1UI7 A;  1YHQ 3;  2PNC A;  3AMO B;  1SJW A;  2QA4 3;  2YFI B;  2B1X B;  1W01 A;  4QWT A;  1JB4 A;  1STF I;  1HU9 A;  1OF5 A;  3QRD A;  3FCS B;  3ALA A;  5JBS A;  3OWY A;  2LYX A;  3NM7 A;  3N8B A;  2XGL A;  3G4S 3;  3LOY A;  3EX9 A;  1NJI 4;  1NDO B;  1DVD A;  1IVW A;  1W2Z A;  5EQL A;  2JDI H;  2E2V A;  1OHS A;  3I56 3;  1LNH A;  1UUV B;  3PCR A;  4LGQ A;  5LC6 A;  3T0U A;  2RGQ A;  3FSD A;  1OGZ A;  4WYK A;  2GBW B;  2OQE C;  4WP5 A;  3OV4 A;  1RN7 A;  3F7S A;  4FMC A;  5D82 A;  2P05 A;  1S72 3;  2CWT A;  3KKG A;  1WMN A;  1W7C A;  2GBX B;  3KZT A;  3DY5 A;  3UJM A;  2CIU A;  1KQS 2;  1W00 A;  4XB5 A;  2GU1 A;  2KCD A;  4EV2 A;  2C10 A;  5G2G A;  2Y74 A;  1K8A 4;  4FR9 A;  1EG9 B;  4HM8 B;  3L0R A;  1W02 A;  4K1V A;  3BB9 A;  1GY7 A;  1AR0 A;  4HM6 B;  4MJD A;  5IEN A;  1N8R 4;  4GB5 A;  1O7M B;  1STD A;  2KRT A;  2Z6B A;  1CYU A;  1DYU A;  3NV0 A;  1UW1 A;  2Y73 A;  4N6T A;  1VQL 3;  1A2K A;  3Q90 A;  2F86 B;  1TP6 A;  3EB8 A;  3LH4 A;  3V92 A;  3SXX A;  2MF7 A;  2PZV A;  1K28 A;  1WQL B;  3IJE B;  3NUV A;  3CCQ 3;  1RRH A;  2P38 A;  2P0X A;  3CCV 3;  3CPW 2;  4O2H A;  2QIY A;  2CG1 A;  2P0M A;  2INX A;  2W2C A;  3HK4 A;  4HM0 B;  3EC9 A;  5IG5 A;  1FUW A;  1Q40 A;  3I55 3;  3FF0 A;  1VZZ A;  1K41 A;  4J9A A;  1CEW I;  3G71 3;  1OH0 A;  1DMQ A;  3F8H A;  1MOL A;  3DGN A;  3NQY A;  1Q81 4;  1JB2 A;  1RRL A;  3B4P A;  2HMO B;  5FGO A;  3WA2 X;  4RZM A;  3LT9 A;  1FGQ A;  3PXM A;  4WFO A;  3UB1 A;  5CF1 A;  5AII A;  2RCD A;  3FH1 A;  4HZB B;  4MMX B;  1J2B A;  3OXA A;  1VQP 3;  1W5Z A;  1WNH A;  3SED A;  3SOA A;  1E3V A;  3S67 A;  2W6J H;  1F8N A;  1OPY A;  1UUW B;  3NBJ A;  8CHO A;  2FGT A;  3FG1 A;  3CCE 3;  1S5A A;  5I97 A;  3TDG A;  1T5Y A;  4Q53 A;  5KP4 A;  2RSX A;  3JUO A;  2STD A;  1JV2 B;  1EA2 A;  3CNM A;  2QGU A;  2CWV A;  2W04 A;  3KSP A;  4HVN A;  4N3V A;  1N5P A;  1QAL A;  3BLZ A;  3HII A;  1YGE A;  2CC3 A;  3MG3 A;  4FCM A;  2O9U X;  3NQZ A;  3CC2 3;  3N9H A;  2BNG A;  3EE1 A;  3KN4 A;  2XH9 A;  1M1X B;  1NO3 A;  4MEI A;  4R9L A;  3MYT A;  1ULI B;  3LML A;  1IT7 A;  1W6G A;  1WTH A;  1DMN A;  2O3O A;  1IV7 A;  2GEX A;  5EVH A;  1OF5 B;  3E99 A;  4LEH A;  3RGR A;  2OWP A;  1JNQ A;  3FF2 A;  4TX4 A;  4AKY A;  5AIG A;  3EQQ B;  5KP3 A;  1KC8 4;  3DZL A;  3DGO A;  5ELU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...