1ULMA

Crystal structure of pokeweed lectin-d2 complexed with tri-n-acetylchitotriose
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
82
structure length
82
Chain Sequence
APECGERASGKRCPNGKCCSQWGYCGTTDNYCGQGCQSQCDYWRCGRDFGGRLCEEDMCCSKYGWCGYSDDHCEDGCQSQCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin-D2
publication title Similarity between protein-protein and protein-carbohydrate interactions, revealed by two crystal structures of lectins from the roots of pokeweed.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 26
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1ulmA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1ulmA01
2LB7A 1P9ZA 1ULNA 9WGAA 1K7UA 1WGCA 1HEVA 4MPIA 1WGTA 4AMLA 1ULMA 1K7TA 2UVOA 2CWGA 1P9GA 1Q9BA 1WKXA 1ULKA 1UHAA 2X3TA 2X52A 4WP4A 1K7VA 2DKVA 7WGAA 2WGCA
chains in the Genus database with same CATH superfamily
1TIHA 2KCXA 3UFFA 2B8TA 2L7XA 1H0ZA 1OYVI 2LUYA 1TBOA 2YQPA 4L9MA 1DS3I 4UXHA 2ORVA 1WGCA 1PJUA 2SGQI 3FSXA 3FSYA 4JCVE 1WGTA 1PPFI 2CJSC 2BUSA 1CGII 3UGLA 2ODDA 3TJQA 4DNCA 1MJAA 3UGIA 1TGSI 1PCEA 2SGDI 3R5AA 5J8CA 5E3RA 2V53A 2KMPA 5CCLA 1FYBA 1BMOA 1P9GA 2ERWA 1WKXA 1UUCA 2QQ0A 2KMOA 1DS2I 5HI7A 1KMAA 1V1HA 1UHAA 2JXDA 4OVOA 2WCYA 1HDLA 1KBFA 3TO7A 4UXJA 1SGDI 2JYYA 1IY5A 2GKTI 2GVIA 2GKVA 2OD1A 3VE5A 7WGAA 3FC3A 1OMTA 2DB6A 2V1CC 2JW6A 2LB7A 1S20A 2M5XA 1MT1A 1UVGA 3BJIA 3MEKA 4UXIA 2E73A 2QQDA 3R5CA 5HQ8A 1K7UA 2CWHA 3OVOA 2QPOA 3PDNA 4MPIA 4FKDA 1FAQA 1HEVA 1CT0I 3TOBA 1R0RI 1LR9A 3B4VC 2FNFX 4GI3C 4A24A 1UVFA 4AMLA 2W0TA 5JHWC 1R79A 1W3SA 1MJ9A 1Y1BA 1TBQR 2ARPF 3RU0A 2VRWB 3R5DA 1VDDA 1PTRA 1WTJA 2YUUA 1Y8FA 1OMUA 2OU2A 3HH2C 1Z2IA 2UZ3A 1N13A 3E2IA 4SGBI 3SGBI 3UGDA 1SGPI 1IW4A 1ULKA 3R5BA 5J8FA 2LEOA 3QTLD 1XA6A 1M8CA 1HPTA 5E3QA 4WP4A 3OXGA 2ELIA 2Y0MA 1X4SA 2DKVA 2J9RA 1TBRR 3TO9A 4B6DA 1YTPA 3GOXA 1YU6C 1CE3A 1XBTA 9WGAA 1IY6A 2K9HA 2OZUA 5E3PA 2WVJA 1SGYI 2N71A 1KBEA 1OVOA 1TBNA 2DIPA 1LR7A 1ULMA 2A20A 2NU0I 5FUYA 2J87A 3UOEA 1TUSA 1FARA 2UVOA 1NXUA 1CSOI 4E1RA 3KY9A 2CWGA 2ORWA 1Q9BA 1TURA 2KMQA 2ENZA 2KMRA 5FUWA 1SGNI 3TOAA 2NU1I 5DAEA 2ROWA 5CCMA 2GIVA 3SGQI 5FUXA 2V1CA 5FUVA 5EX0A 2JZMA 2NU3I 5EX3A 1K7VA 1CT2I 1MJBA 2N52A 3UEYA 2SGPI 2E5RA 3OXLA 1RFHA 2XRCA 2WGCA 2L8EA 1V1IA 3VDUA 1BUSA 3CXLA 1P9ZA 1ULNA 2SGFI 3QWPA 3SEKC 3QAHA 4E1PA 1CT4I 2CWFA 3OL0A 1U5KA 2RIJA 1HJAI 2NU2I 3D00A 1SGEI 4HGUA 2QQCA 2RC4A 3UEJA 1SGQI 1LR8A 1CGJI 2NU4I 2GKRI 2OVOA 3E59A 1Y1CA 2P6AC 2JA1A 1FY7A 1K7TA 2B0UC 1W4RA 3VDPA 1SGRI 2ENNA 1CHOI 1PTQA 3OXFA 1M8BA 2F3CI 2SGEI 1NUBA 2N1AB 1TOTA 2QQEA 2X3TA 2PQ8A 2X52A 3TO6A 1XX6A 1AN1I 1X74A 1Z7KB 2N17A
chains in the Genus database with same CATH topology
2LB7A 1P9ZA 1ULNA 9WGAA 1K7UA 1WGCA 1HEVA 4MPIA 1WGTA 4AMLA 1ULMA 1K7TA 2UVOA 2CWGA 1P9GA 1Q9BA 1WKXA 1ULKA 1UHAA 2X3TA 2X52A 4WP4A 1K7VA 2DKVA 7WGAA 2WGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LB7 A;  1P9Z A;  1ULN A;  9WGA A;  1K7U A;  1WGC A;  1HEV A;  4MPI A;  1WGT A;  4AML A;  1ULM A;  1K7T A;  2UVO A;  2CWG A;  1P9G A;  1Q9B A;  1WKX A;  1ULK A;  1UHA A;  2X3T A;  2X52 A;  4WP4 A;  1K7V A;  2DKV A;  7WGA A;  2WGC A; 
#chains in the Genus database with same CATH topology
 1TIH A;  2KCX A;  3UFF A;  2B8T A;  2L7X A;  1H0Z A;  1OYV I;  2LUY A;  1TBO A;  2YQP A;  4L9M A;  1DS3 I;  4UXH A;  2ORV A;  1WGC A;  1PJU A;  2SGQ I;  3FSX A;  3FSY A;  4JCV E;  1WGT A;  1PPF I;  2CJS C;  2BUS A;  1CGI I;  3UGL A;  2ODD A;  3TJQ A;  4DNC A;  1MJA A;  3UGI A;  1TGS I;  1PCE A;  2SGD I;  3R5A A;  5J8C A;  5E3R A;  2V53 A;  2KMP A;  5CCL A;  1FYB A;  1BMO A;  1P9G A;  2ERW A;  1WKX A;  1UUC A;  2QQ0 A;  2KMO A;  1DS2 I;  5HI7 A;  1KMA A;  1V1H A;  1UHA A;  2JXD A;  4OVO A;  2WCY A;  1HDL A;  1KBF A;  3TO7 A;  4UXJ A;  1SGD I;  2JYY A;  1IY5 A;  2GKT I;  2GVI A;  2GKV A;  2OD1 A;  3VE5 A;  7WGA A;  3FC3 A;  1OMT A;  2DB6 A;  2V1C C;  2JW6 A;  2LB7 A;  1S20 A;  2M5X A;  1MT1 A;  1UVG A;  3BJI A;  3MEK A;  4UXI A;  2E73 A;  2QQD A;  3R5C A;  5HQ8 A;  1K7U A;  2CWH A;  3OVO A;  2QPO A;  3PDN A;  4MPI A;  4FKD A;  1FAQ A;  1HEV A;  1CT0 I;  3TOB A;  1R0R I;  1LR9 A;  3B4V C;  2FNF X;  4GI3 C;  4A24 A;  1UVF A;  4AML A;  2W0T A;  5JHW C;  1R79 A;  1W3S A;  1MJ9 A;  1Y1B A;  1TBQ R;  2ARP F;  3RU0 A;  2VRW B;  3R5D A;  1VDD A;  1PTR A;  1WTJ A;  2YUU A;  1Y8F A;  1OMU A;  2OU2 A;  3HH2 C;  1Z2I A;  2UZ3 A;  1N13 A;  3E2I A;  4SGB I;  3SGB I;  3UGD A;  1SGP I;  1IW4 A;  1ULK A;  3R5B A;  5J8F A;  2LEO A;  3QTL D;  1XA6 A;  1M8C A;  1HPT A;  5E3Q A;  4WP4 A;  3OXG A;  2ELI A;  2Y0M A;  1X4S A;  2DKV A;  2J9R A;  1TBR R;  3TO9 A;  4B6D A;  1YTP A;  3GOX A;  1YU6 C;  1CE3 A;  1XBT A;  9WGA A;  1IY6 A;  2K9H A;  2OZU A;  5E3P A;  2WVJ A;  1SGY I;  2N71 A;  1KBE A;  1OVO A;  1TBN A;  2DIP A;  1LR7 A;  1ULM A;  2A20 A;  2NU0 I;  5FUY A;  2J87 A;  3UOE A;  1TUS A;  1FAR A;  2UVO A;  1NXU A;  1CSO I;  4E1R A;  3KY9 A;  2CWG A;  2ORW A;  1Q9B A;  1TUR A;  2KMQ A;  2ENZ A;  2KMR A;  5FUW A;  1SGN I;  3TOA A;  2NU1 I;  5DAE A;  2ROW A;  5CCM A;  2GIV A;  3SGQ I;  5FUX A;  2V1C A;  5FUV A;  5EX0 A;  2JZM A;  2NU3 I;  5EX3 A;  1K7V A;  1CT2 I;  1MJB A;  2N52 A;  3UEY A;  2SGP I;  2E5R A;  3OXL A;  1RFH A;  2XRC A;  2WGC A;  2L8E A;  1V1I A;  3VDU A;  1BUS A;  3CXL A;  1P9Z A;  1ULN A;  2SGF I;  3QWP A;  3SEK C;  3QAH A;  4E1P A;  1CT4 I;  2CWF A;  3OL0 A;  1U5K A;  2RIJ A;  1HJA I;  2NU2 I;  3D00 A;  1SGE I;  4HGU A;  2QQC A;  2RC4 A;  3UEJ A;  1SGQ I;  1LR8 A;  1CGJ I;  2NU4 I;  2GKR I;  2OVO A;  3E59 A;  1Y1C A;  2P6A C;  2JA1 A;  1FY7 A;  1K7T A;  2B0U C;  1W4R A;  3VDP A;  1SGR I;  2ENN A;  1CHO I;  1PTQ A;  3OXF A;  1M8B A;  2F3C I;  2SGE I;  1NUB A;  2N1A B;  1TOT A;  2QQE A;  2X3T A;  2PQ8 A;  2X52 A;  3TO6 A;  1XX6 A;  1AN1 I;  1X74 A;  1Z7K B;  2N17 A; 
#chains in the Genus database with same CATH homology
 2LB7 A;  1P9Z A;  1ULN A;  9WGA A;  1K7U A;  1WGC A;  1HEV A;  4MPI A;  1WGT A;  4AML A;  1ULM A;  1K7T A;  2UVO A;  2CWG A;  1P9G A;  1Q9B A;  1WKX A;  1ULK A;  1UHA A;  2X3T A;  2X52 A;  4WP4 A;  1K7V A;  2DKV A;  7WGA A;  2WGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...