1ULNA

Crystal structure of pokeweed lectin-d1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
APECGERASGKRCPNGKCCSQWGYCGTTDNYCGQGCQSQCDYWRCGRDFGGRLCEEDMCCSKYGWCGYSDDHCEDGCQSQCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin-D
publication title Structures of two lectins from the roots of pokeweed (Phytolacca americana).
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 25
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1ulnA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1ulnA01
1Q9BA 7WGAA 1HEVA 1ULNA 1K7TA 2X52A 1K7UA 4MPIA 1ULMA 2LB7A 4AMLA 1WKXA 9WGAA 2DKVA 2X3TA 1P9GA 1WGCA 1K7VA 2WGCA 1WGTA 1ULKA 2CWGA 1P9ZA 2UVOA 4WP4A 1UHAA
chains in the Genus database with same CATH superfamily
4OVOA 4GI3C 7WGAA 2GKRI 1HEVA 1V1IA 1FAQA 3FC3A 1XA6A 1ULNA 2F3CI 1UUCA 1K7UA 1S20A 2RC4A 2RIJA 5FUVA 3SEKC 4AMLA 1HDLA 5HI7A 1CGII 2J87A 2OU2A 2DB6A 2N1AB 2YUUA 4HGUA 1W4RA 3UOEA 2OD1A 2ROWA 2CWHA 4L9MA 1X4SA 4UXHA 1IW4A 2N52A 2WCYA 2OZUA 1TBRR 1ULKA 2NU1I 3BJIA 3UEJA 2E73A 1IY6A 1FYBA 2ENZA 2JW6A 1P9ZA 1SGNI 5E3QA 1VDDA 1TBOA 1PTRA 4UXJA 5EX3A 1Y8FA 4JCVE 2B8TA 1SGYI 2A20A 3UEYA 2W0TA 4E1PA 1M8BA 1OVOA 1Q9BA 3SGBI 1TIHA 2Y0MA 2NU3I 4MPIA 1V1HA 1HJAI 5J8FA 2JXDA 1WKXA 5EX0A 3TO7A 2SGEI 2OVOA 1MJBA 2NU2I 3OL0A 1NUBA 1HPTA 1XBTA 1MT1A 2FNFX 2X3TA 3VE5A 1P9GA 1X74A 2ELIA 1CT2I 3R5AA 2V1CC 5E3RA 1M8CA 1PJUA 1SGRI 1U5KA 5HQ8A 1NXUA 2WVJA 1WGTA 1XX6A 4FKDA 3R5CA 3KY9A 1PCEA 2CWGA 3E59A 3FSXA 2QPOA 2UVOA 1TUSA 3HH2C 2B0UC 1N13A 2KMQA 3OVOA 1UHAA 1BMOA 1WTJA 1DS2I 1Z7KB 1Y1CA 2ORVA 5CCLA 1R79A 2K9HA 1FARA 2KCXA 2GIVA 2N17A 2UZ3A 2ERWA 1SGPI 1TOTA 3TOAA 5FUXA 3MEKA 1TURA 2SGPI 3R5DA 4B6DA 2L7XA 5FUWA 1Z2IA 2QQCA 1IY5A 2CJSC 1YTPA 2PQ8A 9WGAA 2LEOA 2DKVA 5J8CA 1R0RI 3QTLD 5FUYA 1BUSA 5CCMA 1DS3I 1W3SA 1Y1BA 2ARPF 2GKVA 1OMTA 4SGBI 3UFFA 2XRCA 1AN1I 1K7VA 1UVFA 2NU4I 2KMRA 2WGCA 2ORWA 1LR8A 5JHWC 1LR9A 4A24A 2JZMA 1SGQI 3TOBA 1PPFI 2GVIA 3OXLA 3R5BA 1KBEA 1OYVI 3FSYA 3PDNA 1CE3A 2SGDI 2CWFA 2V1CA 3GOXA 1CGJI 1TBQR 3UGDA 1H0ZA 1TGSI 2SGFI 2VRWB 1KMAA 1K7TA 1PTQA 5E3PA 2X52A 1UVGA 1MJ9A 2JA1A 4DNCA 1ULMA 2J9RA 2LB7A 1CT0I 2QQDA 3OXGA 3RU0A 3SGQI 4E1RA 1KBFA 1CT4I 2QQEA 3UGLA 3VDPA 3QAHA 2KMPA 3TO9A 1OMUA 1WGCA 1SGDI 3UGIA 2N71A 1MJAA 3CXLA 3B4VC 2SGQI 2ODDA 2NU0I 3OXFA 3TO6A 2DIPA 5DAEA 2GKTI 2V53A 3QWPA 2KMOA 1RFHA 4UXIA 3E2IA 1YU6C 2ENNA 2BUSA 2JYYA 2QQ0A 2LUYA 1CHOI 1FY7A 1SGEI 1TBNA 2M5XA 2P6AC 1CSOI 3D00A 3VDUA 2YQPA 2E5RA 4WP4A 3TJQA 1LR7A 2L8EA
chains in the Genus database with same CATH topology
1Q9BA 7WGAA 1HEVA 1ULNA 1K7TA 2X52A 1K7UA 4MPIA 1ULMA 2LB7A 4AMLA 1WKXA 9WGAA 2DKVA 2X3TA 1P9GA 1WGCA 1K7VA 2WGCA 1WGTA 1ULKA 2CWGA 1P9ZA 2UVOA 4WP4A 1UHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9B A;  7WGA A;  1HEV A;  1ULN A;  1K7T A;  2X52 A;  1K7U A;  4MPI A;  1ULM A;  2LB7 A;  4AML A;  1WKX A;  9WGA A;  2DKV A;  2X3T A;  1P9G A;  1WGC A;  1K7V A;  2WGC A;  1WGT A;  1ULK A;  2CWG A;  1P9Z A;  2UVO A;  4WP4 A;  1UHA A; 
#chains in the Genus database with same CATH topology
 4OVO A;  4GI3 C;  7WGA A;  2GKR I;  1HEV A;  1V1I A;  1FAQ A;  3FC3 A;  1XA6 A;  1ULN A;  2F3C I;  1UUC A;  1K7U A;  1S20 A;  2RC4 A;  2RIJ A;  5FUV A;  3SEK C;  4AML A;  1HDL A;  5HI7 A;  1CGI I;  2J87 A;  2OU2 A;  2DB6 A;  2N1A B;  2YUU A;  4HGU A;  1W4R A;  3UOE A;  2OD1 A;  2ROW A;  2CWH A;  4L9M A;  1X4S A;  4UXH A;  1IW4 A;  2N52 A;  2WCY A;  2OZU A;  1TBR R;  1ULK A;  2NU1 I;  3BJI A;  3UEJ A;  2E73 A;  1IY6 A;  1FYB A;  2ENZ A;  2JW6 A;  1P9Z A;  1SGN I;  5E3Q A;  1VDD A;  1TBO A;  1PTR A;  4UXJ A;  5EX3 A;  1Y8F A;  4JCV E;  2B8T A;  1SGY I;  2A20 A;  3UEY A;  2W0T A;  4E1P A;  1M8B A;  1OVO A;  1Q9B A;  3SGB I;  1TIH A;  2Y0M A;  2NU3 I;  4MPI A;  1V1H A;  1HJA I;  5J8F A;  2JXD A;  1WKX A;  5EX0 A;  3TO7 A;  2SGE I;  2OVO A;  1MJB A;  2NU2 I;  3OL0 A;  1NUB A;  1HPT A;  1XBT A;  1MT1 A;  2FNF X;  2X3T A;  3VE5 A;  1P9G A;  1X74 A;  2ELI A;  1CT2 I;  3R5A A;  2V1C C;  5E3R A;  1M8C A;  1PJU A;  1SGR I;  1U5K A;  5HQ8 A;  1NXU A;  2WVJ A;  1WGT A;  1XX6 A;  4FKD A;  3R5C A;  3KY9 A;  1PCE A;  2CWG A;  3E59 A;  3FSX A;  2QPO A;  2UVO A;  1TUS A;  3HH2 C;  2B0U C;  1N13 A;  2KMQ A;  3OVO A;  1UHA A;  1BMO A;  1WTJ A;  1DS2 I;  1Z7K B;  1Y1C A;  2ORV A;  5CCL A;  1R79 A;  2K9H A;  1FAR A;  2KCX A;  2GIV A;  2N17 A;  2UZ3 A;  2ERW A;  1SGP I;  1TOT A;  3TOA A;  5FUX A;  3MEK A;  1TUR A;  2SGP I;  3R5D A;  4B6D A;  2L7X A;  5FUW A;  1Z2I A;  2QQC A;  1IY5 A;  2CJS C;  1YTP A;  2PQ8 A;  9WGA A;  2LEO A;  2DKV A;  5J8C A;  1R0R I;  3QTL D;  5FUY A;  1BUS A;  5CCM A;  1DS3 I;  1W3S A;  1Y1B A;  2ARP F;  2GKV A;  1OMT A;  4SGB I;  3UFF A;  2XRC A;  1AN1 I;  1K7V A;  1UVF A;  2NU4 I;  2KMR A;  2WGC A;  2ORW A;  1LR8 A;  5JHW C;  1LR9 A;  4A24 A;  2JZM A;  1SGQ I;  3TOB A;  1PPF I;  2GVI A;  3OXL A;  3R5B A;  1KBE A;  1OYV I;  3FSY A;  3PDN A;  1CE3 A;  2SGD I;  2CWF A;  2V1C A;  3GOX A;  1CGJ I;  1TBQ R;  3UGD A;  1H0Z A;  1TGS I;  2SGF I;  2VRW B;  1KMA A;  1K7T A;  1PTQ A;  5E3P A;  2X52 A;  1UVG A;  1MJ9 A;  2JA1 A;  4DNC A;  1ULM A;  2J9R A;  2LB7 A;  1CT0 I;  2QQD A;  3OXG A;  3RU0 A;  3SGQ I;  4E1R A;  1KBF A;  1CT4 I;  2QQE A;  3UGL A;  3VDP A;  3QAH A;  2KMP A;  3TO9 A;  1OMU A;  1WGC A;  1SGD I;  3UGI A;  2N71 A;  1MJA A;  3CXL A;  3B4V C;  2SGQ I;  2ODD A;  2NU0 I;  3OXF A;  3TO6 A;  2DIP A;  5DAE A;  2GKT I;  2V53 A;  3QWP A;  2KMO A;  1RFH A;  4UXI A;  3E2I A;  1YU6 C;  2ENN A;  2BUS A;  2JYY A;  2QQ0 A;  2LUY A;  1CHO I;  1FY7 A;  1SGE I;  1TBN A;  2M5X A;  2P6A C;  1CSO I;  3D00 A;  3VDU A;  2YQP A;  2E5R A;  4WP4 A;  3TJQ A;  1LR7 A;  2L8E A; 
#chains in the Genus database with same CATH homology
 1Q9B A;  7WGA A;  1HEV A;  1ULN A;  1K7T A;  2X52 A;  1K7U A;  4MPI A;  1ULM A;  2LB7 A;  4AML A;  1WKX A;  9WGA A;  2DKV A;  2X3T A;  1P9G A;  1WGC A;  1K7V A;  2WGC A;  1WGT A;  1ULK A;  2CWG A;  1P9Z A;  2UVO A;  4WP4 A;  1UHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...