1ULNA

Crystal structure of pokeweed lectin-d1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
82
structure length
82
Chain Sequence
b'APECGERASGKRCPNGKCCSQWGYCGTTDNYCGQGCQSQCDYWRCGRDFGGRLCEEDMCCSKYGWCGYSDDHCEDGCQSQCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lectin-D
publication title Structures of two lectins from the roots of pokeweed (Phytolacca americana).
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 25
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1ulnA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1ulnA01
1UHAA 1P9ZA 2DKVA 1Q9BA 2UVOA 1HEVA 2X3TA 1WKXA 2WGCA 1ULMA 7WGAA 1ULKA 1K7UA 9WGAA 4MPIA 2LB7A 2X52A 1ULNA 1P9GA 2CWGA 4AMLA 1K7VA 1WGCA 1WGTA 4WP4A 1K7TA
chains in the Genus database with same CATH superfamily
2ARPF 1TBQR 1R79A 2B0UC 1TIHA 1TUSA 3UOEA 2FNFX 3R5BA 1Y1CA 1HEVA 2ORVA 2YUUA 2F3CI 1Z7KB 2WCYA 2CJSC 2GKVA 1UVFA 1SGNI 2ENNA 1ULKA 2J9RA 2NU3I 2V1CA 3OL0A 2KMOA 1FAQA 2K9HA 1M8CA 2LB7A 1KBEA 1CSOI 3QWPA 2CWGA 1P9GA 3TO6A 1CT4I 2ODDA 1MJAA 1SGYI 1XA6A 3HH2C 3KY9A 3PDNA 1KBFA 1PCEA 1SGEI 2NU0I 5DAEA 2BUSA 3FSXA 1CGII 1V1HA 1WGCA 1U5KA 2N71A 2SGFI 1TGSI 2PQ8A 3D00A 3TO9A 2L7XA 2OU2A 1YU6C 1OMUA 4GI3C 2ERWA 5J8FA 2NU2I 1CE3A 2A20A 1TOTA 2ENZA 2KCXA 1WTJA 5E3PA 4B6DA 2V1CC 1VDDA 1BUSA 4FKDA 1YTPA 3UGDA 1NUBA 1IY5A 1V1IA 2SGDI 1N13A 4DNCA 1SGPI 3VDUA 1LR9A 2N1AB 1X74A 4HGUA 1WKXA 1LR7A 2X3TA 5FUXA 1S20A 5FUYA 5JHWC 2WGCA 2M5XA 2QQEA 1K7UA 1PTRA 2QPOA 1NXUA 2VRWB 2JA1A 3VDPA 1BMOA 2OVOA 2CWFA 3QAHA 5FUWA 4UXIA 1MT1A 3UGLA 1CT2I 1XBTA 3QTLD 2UZ3A 1Y8FA 4SGBI 2L8EA 3TOBA 3FC3A 4L9MA 3R5CA 3TJQA 2B8TA 4OVOA 5CCLA 2QQDA 3R5DA 2DB6A 2SGEI 1HPTA 1TURA 2JW6A 1OMTA 1K7TA 5EX0A 3E59A 2JYYA 2XRCA 1R0RI 3VE5A 1FARA 1RFHA 1UHAA 2RC4A 1W4RA 3OXFA 2SGQI 2DKVA 2J87A 1Q9BA 2OZUA 3TOAA 2UVOA 1CGJI 2GKRI 1FYBA 2P6AC 2ROWA 2SGPI 3SEKC 7WGAA 3UGIA 4UXHA 2Y0MA 2KMRA 1CT0I 2KMQA 4MPIA 1AN1I 1MJ9A 2QQCA 2X52A 2YQPA 1TBNA 1Z2IA 1OYVI 2ORWA 3MEKA 1XX6A 2GIVA 3SGQI 2W0TA 3E2IA 3OXLA 4AMLA 1K7VA 3SGBI 4E1RA 5HQ8A 2ELIA 1HJAI 3UFFA 2GKTI 3B4VC 2CWHA 1LR8A 2NU1I 1MJBA 1PTQA 2OD1A 2V53A 5E3QA 2LEOA 5HI7A 1PPFI 4WP4A 1DS3I 3RU0A 4A24A 5FUVA 4E1PA 3OVOA 1IW4A 1UUCA 3OXGA 5J8CA 2E73A 1P9ZA 1H0ZA 3R5AA 1HDLA 3TO7A 2N17A 1TBRR 1TBOA 2JZMA 1ULMA 5CCMA 3BJIA 1FY7A 2GVIA 2RIJA 3CXLA 1SGRI 1W3SA 2LUYA 3FSYA 9WGAA 2NU4I 1X4SA 1PJUA 1IY6A 1SGQI 1ULNA 5EX3A 2N52A 1OVOA 4UXJA 3UEJA 2E5RA 2JXDA 2WVJA 3UEYA 1M8BA 1WGTA 2DIPA 2KMPA 5E3RA 2QQ0A 1DS2I 3GOXA 1SGDI 1Y1BA 1CHOI 4JCVE 1KMAA 1UVGA
chains in the Genus database with same CATH topology
1UHAA 1P9ZA 2DKVA 1Q9BA 2UVOA 1HEVA 2X3TA 1WKXA 2WGCA 1ULMA 7WGAA 1ULKA 1K7UA 9WGAA 4MPIA 2LB7A 2X52A 1ULNA 1P9GA 2CWGA 4AMLA 1K7VA 1WGCA 1WGTA 4WP4A 1K7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UHA A;  1P9Z A;  2DKV A;  1Q9B A;  2UVO A;  1HEV A;  2X3T A;  1WKX A;  2WGC A;  1ULM A;  7WGA A;  1ULK A;  1K7U A;  9WGA A;  4MPI A;  2LB7 A;  2X52 A;  1ULN A;  1P9G A;  2CWG A;  4AML A;  1K7V A;  1WGC A;  1WGT A;  4WP4 A;  1K7T A; 
#chains in the Genus database with same CATH topology
 2ARP F;  1TBQ R;  1R79 A;  2B0U C;  1TIH A;  1TUS A;  3UOE A;  2FNF X;  3R5B A;  1Y1C A;  1HEV A;  2ORV A;  2YUU A;  2F3C I;  1Z7K B;  2WCY A;  2CJS C;  2GKV A;  1UVF A;  1SGN I;  2ENN A;  1ULK A;  2J9R A;  2NU3 I;  2V1C A;  3OL0 A;  2KMO A;  1FAQ A;  2K9H A;  1M8C A;  2LB7 A;  1KBE A;  1CSO I;  3QWP A;  2CWG A;  1P9G A;  3TO6 A;  1CT4 I;  2ODD A;  1MJA A;  1SGY I;  1XA6 A;  3HH2 C;  3KY9 A;  3PDN A;  1KBF A;  1PCE A;  1SGE I;  2NU0 I;  5DAE A;  2BUS A;  3FSX A;  1CGI I;  1V1H A;  1WGC A;  1U5K A;  2N71 A;  2SGF I;  1TGS I;  2PQ8 A;  3D00 A;  3TO9 A;  2L7X A;  2OU2 A;  1YU6 C;  1OMU A;  4GI3 C;  2ERW A;  5J8F A;  2NU2 I;  1CE3 A;  2A20 A;  1TOT A;  2ENZ A;  2KCX A;  1WTJ A;  5E3P A;  4B6D A;  2V1C C;  1VDD A;  1BUS A;  4FKD A;  1YTP A;  3UGD A;  1NUB A;  1IY5 A;  1V1I A;  2SGD I;  1N13 A;  4DNC A;  1SGP I;  3VDU A;  1LR9 A;  2N1A B;  1X74 A;  4HGU A;  1WKX A;  1LR7 A;  2X3T A;  5FUX A;  1S20 A;  5FUY A;  5JHW C;  2WGC A;  2M5X A;  2QQE A;  1K7U A;  1PTR A;  2QPO A;  1NXU A;  2VRW B;  2JA1 A;  3VDP A;  1BMO A;  2OVO A;  2CWF A;  3QAH A;  5FUW A;  4UXI A;  1MT1 A;  3UGL A;  1CT2 I;  1XBT A;  3QTL D;  2UZ3 A;  1Y8F A;  4SGB I;  2L8E A;  3TOB A;  3FC3 A;  4L9M A;  3R5C A;  3TJQ A;  2B8T A;  4OVO A;  5CCL A;  2QQD A;  3R5D A;  2DB6 A;  2SGE I;  1HPT A;  1TUR A;  2JW6 A;  1OMT A;  1K7T A;  5EX0 A;  3E59 A;  2JYY A;  2XRC A;  1R0R I;  3VE5 A;  1FAR A;  1RFH A;  1UHA A;  2RC4 A;  1W4R A;  3OXF A;  2SGQ I;  2DKV A;  2J87 A;  1Q9B A;  2OZU A;  3TOA A;  2UVO A;  1CGJ I;  2GKR I;  1FYB A;  2P6A C;  2ROW A;  2SGP I;  3SEK C;  7WGA A;  3UGI A;  4UXH A;  2Y0M A;  2KMR A;  1CT0 I;  2KMQ A;  4MPI A;  1AN1 I;  1MJ9 A;  2QQC A;  2X52 A;  2YQP A;  1TBN A;  1Z2I A;  1OYV I;  2ORW A;  3MEK A;  1XX6 A;  2GIV A;  3SGQ I;  2W0T A;  3E2I A;  3OXL A;  4AML A;  1K7V A;  3SGB I;  4E1R A;  5HQ8 A;  2ELI A;  1HJA I;  3UFF A;  2GKT I;  3B4V C;  2CWH A;  1LR8 A;  2NU1 I;  1MJB A;  1PTQ A;  2OD1 A;  2V53 A;  5E3Q A;  2LEO A;  5HI7 A;  1PPF I;  4WP4 A;  1DS3 I;  3RU0 A;  4A24 A;  5FUV A;  4E1P A;  3OVO A;  1IW4 A;  1UUC A;  3OXG A;  5J8C A;  2E73 A;  1P9Z A;  1H0Z A;  3R5A A;  1HDL A;  3TO7 A;  2N17 A;  1TBR R;  1TBO A;  2JZM A;  1ULM A;  5CCM A;  3BJI A;  1FY7 A;  2GVI A;  2RIJ A;  3CXL A;  1SGR I;  1W3S A;  2LUY A;  3FSY A;  9WGA A;  2NU4 I;  1X4S A;  1PJU A;  1IY6 A;  1SGQ I;  1ULN A;  5EX3 A;  2N52 A;  1OVO A;  4UXJ A;  3UEJ A;  2E5R A;  2JXD A;  2WVJ A;  3UEY A;  1M8B A;  1WGT A;  2DIP A;  2KMP A;  5E3R A;  2QQ0 A;  1DS2 I;  3GOX A;  1SGD I;  1Y1B A;  1CHO I;  4JCV E;  1KMA A;  1UVG A; 
#chains in the Genus database with same CATH homology
 1UHA A;  1P9Z A;  2DKV A;  1Q9B A;  2UVO A;  1HEV A;  2X3T A;  1WKX A;  2WGC A;  1ULM A;  7WGA A;  1ULK A;  1K7U A;  9WGA A;  4MPI A;  2LB7 A;  2X52 A;  1ULN A;  1P9G A;  2CWG A;  4AML A;  1K7V A;  1WGC A;  1WGT A;  4WP4 A;  1K7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...