1ULRA

Crystal structure of tt0497 from thermus thermophilus hb8
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
87
structure length
87
Chain Sequence
b'PRLVALVKGRVQGVGYRAFAQKKALELGLSGYAENLPDGRVEVVAEGPKEALELFLHHLKQGPRLARVEAVEVQWGEEAGLKGFHVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative acylphosphatase
publication title Crystal structure of tt0497 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 23
structure length 87
sequence length 87
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ulrA00
2HIQA 2IYIA 2QLXA 4ZA1A 4HL9A 5B09A 3BF4A 1JWWA 3QMQA 2HLUA 2OFHX 4OJ3A 4Y2MA 2FTRA 2VV5A 3T9NA 2OD4A 1URRA 2W4CA 2QIFA 1Y3JA 2ROGA 1FE4A 1S6UA 3F44A 3KNGA 1TR0A 1TUVA 2RMLA 3LGMA 4OIXA 2XMUA 1Y9OA 1CPZA 4OJ1A 1OSDA 2AJ1A 3FMBA 3FRYA 2ROEA 1APSA 4HH0A 1W2IA 4U9RA 1SI9A 1R6YA 2OKQA 2GCFA 3HHLD 5B0CA 5B0AA 2K1RA 3HF5A 4OJHA 1V3ZA 2IYGA 4FNIA 4DN9A 1OQ6A 2ASYA 2GGPB 3KG1A 4Q2MA 1KVJA 5IXUA 1Q8BA 2GA7A 2XMJA 4NPOA 2BBEA 3TNVA 2QLWA 4YEAA 5F0UA 3FGVA 3DXSX 1S6OA 5B0GA 5B0DA 1WD6A 1Q4RA 3MZIA 1GXTA 2KT2A 2OMOA 3DCAA 4HI1A 1Y0HA 4F67A 1TZ0A 3IWLA 3BB5A 2LQBA 1TL4A 2K7KA 3BM7A 3K7RA 2W4DA 2FHMA 3HHLC 2AW0A 2ROPA 3LO3A 3CJKA 2JDJA 3BR8A 5B0EA 4Y2IA 1RJJA 3KKFA 2LDIA 2Q3PA 4HH1A 2IFXA 2K1RB 5B0FA 1AFIA 1XBWA 2FIUA 2KYZA 2XMTA 3TOQA 2KT3A 1YRXA 1YJUA 1FEEA 2PD1A 2BJEA 2VH7A 2GV1A 3MCSA 5T7LA 1FVSA 1ULRA 2N4DA 4FNHA 4YDXA 5B0BA 2LQ9A 3QGPA 1AW0A 2N4CA 1KQKA 1CC7A 1YJTA 5A6WA 2OFGX 3IWXA 1Q53A 3HDSA 4A47A 1LQ9A 1CC8A 1FESA 1OQ3A 1P8GA 2XMVA 3BDEA 2K7JA 2OD6A 4ZOSA 1U7LA 1N5QA 3GZ7A 2BYCA 5K9FA 3VTIA 1N5TA 1VQYA 2HFOA 1TL5A 1FE0A 1X0PA 1YJVA 2G9OA 3CJKB 4A4JA 1X8DA 2HQIA 1N5VA 1GXUA 2HLTA 1IUJA 2ZDOA 1MWYA 4NL5A 5KAKA 1FD8A 3HX9A 1AFJA 2AJ0A 2W4PA 3BN7A 2ACYA 2EW9A 1QUPA 2PGCA 5T7LB 3BGUA 4DL0C 2AP6A 2XMKA 4DPOA 1KVIA 3HFKA 1SQEA 1Q8LA 2RILA 1P6TA 3KG0A 3UDCA 2L3MA 2GO8A 1YJRA 1YG0A 4QOTA 4Q2LA 3TRGA 1FVQA 1X7VA 1VQSA 2BUNA 1Y3KA 3LGNA 4HI2A 3WDOA 2LXFA 1SB6A 2XMMA 4Y2KA 5B08A 2GFFA 5A6PA 2HFNA 2ZDPA 3I9ZA 1OPZA 2QYCA 3E8OA 1JK9B 4OJGA 2FB0A 2OP5A 4EFAC 2RU9A 2XMWA 2K2PA 2CRLA 3HHLB 1MWZA 4A46A 2KKHA 4A48A 2RSQA 2N7YA 2OAUA 3HHLA 2GGPA 1N5SA 1K0VA 2BJDA 5F0WA
chains in the Genus database with same CATH superfamily
5J1EB 1WUUA 3CJQA 1BC6A 1JLBA 3OVSA 1RTHA 2O66A 3VHQA 1Y9OA 2J76E 2LEBA 5FIIA 3LOUA 3RBEA 2DNRA 2FC8A 4O44A 2G13A 4KQZA 3C6UB 1OIAA 3L95X 3T9ZA 2UU9J 2HHPA 1T95A 2IM1A 5CYJA 5DS7A 4JI7J 4KBIA 4WP9A 2KI2A 4AD6A 3M8RA 2MZTA 4PQUA 4WU2A 3G71S 2KVIA 1U45A 4A47A 4LBIA 2C2OB 4ELVA 5K9FA 2ZEJA 1XR5A 3KFWX 1UFLA 3M2UB 1Q7LB 3D67A 2CJAA 4KJIA 1H3DA 3OLAA 5HLFA 3IR5B 4ZCIA 4CI0B 3TWZA 2RF2B 3B4MA 2VBZA 4J9RA 4CH7A 1FDDA 2W25A 1BGXT 2R7SA 2YY3A 3VAFA 2V6AA 3PYEA 3FCHA 1S9GA 4BC7A 1RYRA 2W9CA 1SUQB 4RNOA 3IMQJ 4KFBA 1UPMB 3GIIA 3CNQP 3M8YA 1TL1A 5EHHA 4DF4A 1M5SA 3AQPA 3ENVA 3W9HA 5AE1A 3M8PA 1SPBP 3DOLA 2FHMA 1RHMB 1N0UA 3OLBA 5CABA 5DQHA 4WZQA 4ZJQA 1N34J 4J9VA 2FLOA 1S57A 2VG6B 2Z8QA 4J9SA 3KTQA 3Q8UA 2HBRB 2E5GA 4UZBA 2IDLA 2G2YA 5ETQA 3GFXA 1A0OB 4ANDA 3MR6A 2ZVIA 4C8ZA 2WB1D 2YX7A 5IC6B 3R5DA 3MOZA 3E2EA 2AGPA 2KHDA 3FMWA 3ZFVA 4LF9F 2UV8A 1JIHA 3DRXA 3D1QA 2BRLA 3Q2SC 2VKZG 5HBMA 4ID8A 4LF7F 4K4ZA 2NLWA 3QWPA 4EGLA 2DXFA 3K5NA 1LWEA 4LSLB 2E1MC 2H1YA 1NK7A 3E8OA 2NREA 3P6YC 2N7YA 4DPUA 3IS9A 3MM9A 3KLHB 5DZ7A 5L1JA 2UXCJ 1OSDA 1ZA1B 3NXZA 1I6JA 3HHLD 2CDRB 4HT5A 1YDLA 2AV5A 1X5TA 5F41A 5L46A 1C0UB 5BXIA 5HK4A 3UNYA 4YEAA 3DLHA 3D66A 4QR0A 4DS5A 2ATCB 2X1GA 4IRCA 2UXDJ 3VQTA 5B0EA 2VPWB 1RZMA 5ETKA 3EGNA 1S0VA 3JAMY 1TU0B 5G0RB 2ALZA 3ET6B 4WFZA 2K7JA 2BYCA 3IFEA 3NBPB 1IR2A 4I68A 4M5HA 4NA3A 2HBYB 1RWUA 5J2PB 2RILA 2F3JA 4NA1A 3MEDB 1FDAA 4GVBB 3TX0A 1FRJA 3PIPQ 3PRDA 5B08A 2EWHA 1REVB 2XCAA 4A48A 3L7OA 2NSBA 1HQUB 3N0VA 2HNZA 4DX5A 1KWMA 2HVIA 5LSRA 1RTHB 4LBPA 1UETA 3Q8SB 1L3KA 1X4GA 5KG4A 3NL0A 5B0CA 1YK9A 1HA1A 3IO1A 3CCLS 2X51A 4KE5A 4O44B 3SCLE 3SV4A 3FC9A 1IBMJ 2QG9B 3J80U 4FVCA 4DR5F 4ICLB 5GAHI 2DGQA 3B8HA 4A8OA 2J7WA 3PIOQ 2ZZMA 2PA3A 3CJKA 4PQUB 2FZGB 2UV8G 2B4UA 5J2QB 1UJ6A 4ZP9A 2CVEA 5CD4H 2V4QA 4I67A 1FXDA 5E3QA 1FCAA 3M2VA 1HNZF 2A18A 2EPIA 3N28A 2HHHJ 2FY1A 1ZOTA 1K8AT 1YG0A 3NNCA 4USUA 5DDOC 2L08A 3C6TB 3HHLA 4B3TJ 4ZLPA 3LGHA 2FTRA 3MMJA 3KK1A 1JLGA 2E7XA 4B02A 1Q5YA 1VFJA 1Y3JA 2RHSB 2F65A 1VRUA 2W9CB 3FMBA 4DG1B 2W2OP 7AT1B 4ED3A 4KFBB 3LALA 3KMQA 3HF5A 1FD2A 1TL1B 3I5BA 3I55S 4FPRA 4ED0A 3TZXA 4B9UA 4GVLA 1U09A 4CLWA 2AGOA 2ZH4A 3DOLB 2HNDA 2JVRA 2YXLA 3S01A 4ECXA 3TA1A 1AA1B 2ZH6A 7FD1A 5KFNA 3OR2A 4OHXA 2PN6A 1DZ5A 3MPUB 4H4MA 3LF0A 2PD1A 1K44A 2QA4S 1S6QA 2LU2A 4NYPA 4DV2J 2NS1B 1HL6A 3D3BJ 4RLEA 2AJFE 3PX6A 2R2SA 3ENWA 5KOXA 3A8JA 1NU4A 5ETOA 2UUCJ 1NK9A 2DR9A 5DO2A 2R7XA 2KFYA 3TANA 5HBMB 2FLLA 1HWLA 2BE2A 3CIMA 4FYDA 3VGSA 2ZE2A 1VJQA 1LWEB 1IWAA 3U02A 3MAQA 3QT8A 4WK1A 4FF4A 2RJZA 2GIRA 3IS9B 3MM9B 2R2UA 3W2WA 3CCZA 1VQMS 3BH6B 2CPEA 3V6KA 1QTNB 1SH3A 1VQ9S 4DLEA 2FVRA 3D6MB 3GIRA 4C0OC 2OSRA 1VRTA 3EZUA 3L9ZA 4NMLA 1KHWA 2XYGB 1YJWS 4NASA 1H7XA 4ITSA 4ECYA 3W64A 3AQOA 2DGOA 1JJ2R 3D1HA 4M5JA 1SJRA 2Y8YA 2EFPA 3FBBA 5DRKA 3TARA 3MPWA 4BWJA 2KRRA 4OZLA 2Q3PA 3LP2A 2BA9A 5LMNF 1UVIA 4I6WA 4CLTA 2GV1A 1P27B 2LCWA 1PYTA 1EIYB 3G9CA 3G8TA 4DL4A 3IWXA 1T7PA 4WXWA 3KWMA 4EYHB 1S76D 1HBMA 2JZ5A 1O51A 3IM9A 3QGGA 1LWCB 3KJFB 5KAKA 2RQMA 2YPYA 3HT3A 1B64A 4MIAA 2VDHA 2JRSA 4U67Q 5KFHA 3V6JA 4OV1A 2MQOA 3T3FA 3DNCA 1U0SA 2HNZB 2OEKA 1X5SA 5K8OA 2A3JA 4WTYA 2W4CA 4LVNP 2XMUA 1NDLA 1R7IA 2F8MA 1HNWJ 4DV7J 3NCPA 3NGDA 4ZLNA 5JJBA 3FNNA 2PE8A 3SIPB 3HPOA 2DISA 2AEJA 3C19A 3K7RA 2XQCA 2ZH7A 4X4UA 2Z2MA 5L8RC 3DRSA 5BJRA 3CB4A 1KDNA 2AKWB 4ZP7A 3E01A 4WFBQ 4HHJA 3M2VB 5E3RA 1M0SA 2JLEA 1PJ6A 2AX0A 3G2XA 1N48A 2DGSA 2K3KA 1ZM4A 3RG6A 3HO1A 2V63A 1U2FA 5RUBA 5J2MA 1X9SA 2ZVSA 1NDKA 1T03B 5KFEA 4F04B 4I2PA 3Q8VA 2E1AA 1RWWB 1DQAA 4ECQA 1HHSA 2RD5C 5C25A 3HHLB 2C2KB 4CNZA 2JFKA 3EDRB 3T1AA 4CO4A 1BQXA 5DDPC 2COLA 1H72C 4DV0J 4BDPA 2J9EA 1YZ6A 1GH8A 3KYLA 3VZHA 3Q22A 2AQ4A 4IQMA 2K06A 2EFOA 4M5KA 2VG5A 4DPWA 4E0DA 1N34F 3Q83A 2HNDB 2GMJA 5BR8J 1RHKB 3PO4A 1IKVA 3QZ8A 2J8AA 4WCEQ 4H4MB 1R0CB 2IM2A 1HQEA 1S6QB 5L38A 2V68A 1EX8A 3UDVA 2DPJA 2CJBA 2OLWA 2MKYA 2ZOGA 2XB2D 1IKXA 5K8PA 3DMJA 1CJVA 2IY5B 1VQNS 2RUGA 5H1SV 1XC9A 4P2SA 2FJWA 3BBFA 3KDOA 3PYGA 3I4HX 4R8UB 3M7VA 1Q8IA 2BE2B 3FJ2A 3NEKA 2ZE2B 3P5TL 1Y3KA 1UZDA 2A0FB 3CC7S 3LUYA 4LF2A 2DGUA 2HURA 3C15B 1WF0A 3AODA 3L3CA 2UXCF 4Z37A 2QLJB 3K59A 2QN6B 2A6OA 3KNGA 3MTJA 2I5JA 4QIFA 4ZCKA 1PYOB 3UW1A 4O3OA 5DGAA 2I9SA 3AJ1A 2D7SA 2W9AA 3IR6B 3FBEA 1PILA 1CS4A 3J80Y 2GA7A 1MU2A 2B8QA 2CXEA 2UXDF 3HSJA 1QAXA 2MSTA 1U6BA 4N76A 4LRAA 1RT7A 1V3RA 2DR8A 3OTEA 1RTIB 4HHUA 5KFVA 1FVSA 4IG3A 4YDXA 2FJAB 3EVOA 3K8WA 1T3NA 4ZOSA 2YPZA 1HBMB 4IO9Q 1MG7A 3TX8A 2ZBRA 5KFKA 3FBFA 4Q0BA 3RRHA 4YQWA 4YB5A 3IA0A 3OVAA 2UUAJ 5CH7B 4RW8A 4H4OA 1JB0C 4AL5A 3SBMA 4AT1B 5KFOA 3H2UB 3OT9A 3I9ZA 4LT6A 1S49A 2BW2A 4J9OA 4L76A 2CYYA 3PZPA 5T14A 3MCOA 1IBMF 2HHQA 2RKIB 2ROEA 1NO8A 3HFVA 2IC3A 3J7A1 4MFBA 3MR7A 2CJYB 1WOPA 4FNIA 2LU1A 4P71A 3F73A 5KG3A 3OXFA 4DUZF 2CIMA 4OX6A 4ZPVR 2WTFA 3BR9A 2MY7A 2M8HA 5LOQA 2VG7A 2KT3A 2HMIA 2DNZA 3NS5A 3QRRA 3ONQA 3E01B 4FXDA 3KJQB 3GV8B 4HDHA 3GIKA 1B4SA 5HROA 2HHHF 2E44A 1N5VA 4NA2A 2LA6A 3IM8A 4AXIA 3C46A 3I4PA 5KTQA 4B3TF 4CRJA 3MUTP 3CGIA 2JEGA 4OJGA 1FFGB 4CDIA 4ES1A 1ELOA 5CAAA 4NPOA 3FZ2A 3M6UA 1VYAA 4IRDA 4P2XA 2B9XA 3PVXA 1FDNA 1MLAA 1D09B 1S0MA 1JLCA 3OFEA 1WWHA 4KGXB 5AJ3J 2G4BA 1FTRA 2OPPB 2R8IA 1RTJA 1WORA 4FKYA 4PXDA 3W2VA 2VC1A 2CQ2A 2KFZA 2QA2A 1U1NA 4DV2F 1LXJA 2FHOB 5A0YA 5HN0A 1HQEB 4MIBA 2VBXA 2MB0B 4K7QA 4OI4A 3DDIA 1EQMA 2G1HA 1X4DA 2UUCF 3H5YA 1SC3B 3PJWA 1IQZA 2EFGA 4DCOB 3OW2R 1IKXB 3CVKA 3KUGA 3DMJB 1CJVB 1K73T 5EX0A 3R7NB 2DBBA 4TLRA 3KLIA 2KVQE 3ZZ0A 1HBNB 2KRBA 1FNXH 2QA1A 4IH6A 3G6VA 4FPIA 4NYZA 3MFHA 1K0VA 4RW9B 3SQOP 3GV5B 4C3KA 4CLUA 1KD1T 1Q81T 2I5JB 4LFAJ 4KB7A 1WI8A 3CEDA 4LBHA 4DI6A 3KLEA 1Y4ZB 4F0HA 5DZ6A 2RVJA 2M7SA 1MU2B 4FYXB 3WC2A 1TAQA 3GU0A 1NK4A 3UN5A 2AZ3A 3QLHA 2XS7A 5KT7A 4LUBA 4LREA 5HI7A 1HNXJ 2E7WA 1TL4A 3H59A 3TVKA 1I94J 3BR8A 1RT7B 2V2QA 1WG1A 3U7JA 4Z2XA 3CD6S 3IR7B 3SQGA 1QY7A 5C42A 2XY6A 4IG3B 3PRBA 1T02A 4KT0C 3M2RA 3PFEA 2PIIA 1Q53A 3VAKA 2AGQA 4TYAA 4YN3B 2VPZB 3IN5A 3EE3A 3QIPA 3N6NA 4Q8FA 4DR1J 3V5RA 4Q0BB 3NS7B 4B08A 2Y1RI 1YRTA 4EI2A 4RW8B 1SQEA 2XI3A 1IKYA 1YJ7A 3HVWA 2L3MA 2MDAA 2YVSA 1CJUB 1NK6A 3UWTA 3VAGA 4X84A 1WC5A 5F0WA 4MTPA 4LRDA 2DNPA 4DV7F 1HNWF 1NJZA 5E41A 1AZSA 2ZH1A 2RUSA 1VLOA 3I0RA 2ZM6J 3C2PA 2RRAA 3H2LA 2XO6A 4EBCA 4ATNA 4KKOA 4JI8J 3VZIA 2FHJA 3H40A 4Y2IA 2VG7B 1FXRA 1NEEA 2HMIB 4AUKA 3RR8A 1S4FA 4B3MJ 3DLBA 3BDEA 5HROB 2YQ0A 2XCPA 2E66A 5DDQC 3EXCX 4FF1A 2DIVA 2M4MA 3M8QB 3K89A 2V0NA 2P6TA 4USVA 4J9LA 5IC4B 2W7AA 2CQ3A 5D4OA 2LMIA 2AD9A 2XMWA 1OJ4A 3M32A 4ZA1A 2I0XA 3BYPA 1CQMA 1DAXA 3MAHA 3ICLA 1JLCB 2XLIA 4KTQA 4DV4F 2HWIA 3GJTB 3KUHA 1RTJB 3W2VB 2DPIA 3MZIA 2KT2A 4ES3A 4JV2A 2NSCA 5A0YB 3AD9C 4O3SA 1XBWA 3JSMB 4NCBA 3QBCA 4DL3A 2JEFA 4TY8A 5KFAA 4DL5A 4WFNQ 2B6AA 4HYKA 4NLWA 4KGKA 2G0JA 3HX9A 3KLIB 3DHWC 2A2DA 1U1LA 4PYAA 1S9EB 4RNHA 1YI2S 2G2OA 5F3ZA 1SL2A 4K8RA 1HBUA 4G1PA 2L9DA 1UVJA 1IXKA 1RABB 1MW7A 2DVIA 5CD4A 3KLEB 2UVWA 1FRIA 3CCSS 5CYMB 2YQ3A 5F0UA 3Q0AA 1F9EB 3QLHB 4CTAA 5B0DA 2YWFA 1RBOB 3NGRA 1WI6A 4TQSA 2H4YB 2VODA 4Y00A 2VU5A 2MHEA 3DLGB 5C42B 4C0HA 3US5A 4JBCA 4NLGA 3R5GA 5D6GA 5LMUF 2HPUA 3QIPB 2UUAF 2CPXA 5T41A 2DITA 3CDWA 2AT1B 3RBXA 3SYZA 1IJEB 2W4PA 3R2CJ 2L41A 2OO4A 4CLZA 2CVIA 4YUDA 2OEJA 1IKYB 2B5JA 3I5AA 2BM0A 4Q2LA 1NPPA 3DGVA 1C4CA 2QRRA 4LQ9A 2B56A 4Q7AA 1ZPVA 1MN7A 3T6BA 2NXEA 5J1PA 1WHWA 2HAFA 2RHQB 3LGMA 2C3PA 3KLFA 1TTHB 3MCNA 2K8GA 2FGOA 4K4XA 2K1RA 1V3ZA 3RB4A 1HWIA 2ABYA 4KYZA 4NLDA 3FKBA 3VAIA 2A6MA 2ADCA 2EG2A 1S97A 5EN1A 4XDDA 4KKOB 2XNQA 3M6XA 2CWKA 3AXMA 3OHAA 4KGMA 2DTJA 3TOQA 1RDRA 1EQ0A 3BSAA 5IM0B 1TP7A 1TUGB 3PJXA 3H4BA 1IQTA 3PW5A 2MJNA 2HBZB 3C14A 1YKWA 3TP2A 1TV6A 3VTIA 2GZOA 2L9WA 5IQQA 1JJCB 4B17A 3BN7A 2DXEA 3OR1A 4WTOB 2ZKTA 5KFSA 2QMUB 4DPOA 4TY9A 3LWMA 2DRBA 3M32B 3PACA 1YSJA 4ECVA 2OAUA 3ULHA 4RBVA 3QRPA 4OI1A 3MM6A 2EFQA 3MOJB 3FSYA 2CWXA 3MGJA 5AJ3F 3TRGA 2ZHOA 2WONB 3DI6B 3MPYA 1QSSA 5FLXY 3GWCA 1VBXA 2E5JA 1HHQA 4HI1A 3U1MA 5DQGA 3RR7A 2W9BA 2Y0SD 1RHQB 4TVAB 4Y3CA 6FD1A 4ZPBA 5HMWA 2J7UA 3UR0A 1FFSB 2FYXA 2CJQA 4D3GA 3Q8YA 3AXKA 1GNKA 2B6AB 3GZ7A 4RW6A 3UD3P 1TMJA 2M3DA 7FDRA 4QIWD 2W8LA 4X62J 1S72S 3LP1B 3QQCD 2OTJS 3BV8A 5F8LA 3T19A 4KHPF 2HHVA 1PAEX 4FDFA 1NDPA 2LDYA 1HYSA 2J9CA 3DOMA 4HDGA 1V6HA 3SI8A 4OZ1A 2C3OA 2IJNA 2QFIA 3BPDA 2M52A 3HKWA 3UFCX 2HVDA 3D0IE 1X0FA 1H0HB 3GJRB 1Y11A 1U8SA 4O3RA 1HNXF 1JX4A 4QWEA 1F0XA 4I7FA 3D4JA 1I94F 4CTAB 2GVDA 3O2IA 1H6KX 1C0TB 3MUMP 2V9WA 1M5KC 3SFUA 4Q44A 2PMZD 3BS9A 1FO1A 2FIUA 4IR9A 4JYAJ 5T7LA 3R97A 1CULA 2BJ1A 1VQOS 5F9NA 4ZCLA 2QL5B 1FRLA 4QPXA 4OYIA 4RW4B 1G6BA 3RZAA 1VQ5S 2KJVA 1KBRA 4MK8A 1AB8A 1RISA 4DR6J 4NXMF 2CNKB 2B5JB 3VWSA 1N5YB 2R7RA 1YJRA 1SB6A 4Y2KA 1LWFB 1WACA 2FGCA 3SCKE 5AXKA 3FVYA 2ASJA 1YIJS 5E0OA 1RLCL 2WZ1A 1D0EA 2ZFHA 2ZM6F 5EGYA 3KLFB 4K4SA 2FJVA 1CSJA 5JXSA 1WG5A 4U96A 3M9MB 1RAEB 4JI8F 2XZWA 4QYRA 1S6OA 4YDDB 2OMOA 1BUXA 1UJ4A 3MXHP 4ZPDA 2W4DA 1WNEA 1NRKA 3VAJA 4B3MF 2BACA 4DFJA 3CC2S 1NK5A 3C14B 4I2QA 1SH2A 5D0GA 4NYOA 2IBOA 1XJWB 2CPFA 1F2HA 1GX5A 5CQGA 3GCWP 2SXLA 2D41A 2ADBA 4ZPCA 2H48B 4PPDA 4USMA 4Y0FA 5DQIA 2MQPA 1V5VA 4J9MA 1R8CA 2DNKA 1WKLA 3M30A 3SSRA 4V1Ak 4M5GA 3G8SA 3MM6B 2Z30B 3C3LA 2W2NP 1CVJA 2YNGA 4X4PA 3MAAA 1OPIA 2N7CA 1T05A 1MSWD 1H73A 4ZVSB 4O4GA 2V50A 3BEGB 5FDLB 3PHEA 5CCLA 2ACMA 5L9NA 1HW8A 2KO1A 3HSGA 3DLEB 2XTJP 3U1LA 3A3OB 4G6VB 4MMOA 3HHLC 4F0MA 1DARA 4MK9A 3GPAA 1F5AA 3UD4P 1TMMA 4NCGA 2OI2A 2OUGA 2BE7D 1RSCA 1UEUA 2PMHA 4RW6B 2DD8S 2HKEA 3LH2S 2KXHA 3D5MA 3PTWA 1UZHA 2C2RA 4PWWA 2C42A 3EVMA 2CQDA 3VGTA 4USIA 5HQ8A 2VOOA 3N4WA 2HHUA 3ZZPA 4C7QA 1WKKA 3O3LA 2HRYA 1HYSB 3DOMB 4UZCA 2IYIA 2MGZA 4EK2A 1YZ7A 3HHEA 5EX3A 2QIFA 3EICA 4IFVB 1XWLA 2A2CA 4P2MA 1V5IB 3HFZB 4X66J 5HVGA 3D28A 1ZS6A 4FVMA 1FT8A 1N6QA 1JLQB 3EYZA 1OQ6A 2B4PA 1UWAA 3U27A 1ZAVA 1NSPA 2GVDB 1ZAXA 2WSCC 3KG4A 3H25A 5KFJA 3CTRA 4PXEA 1OYDA 3MMCB 5IT9U 4IOBA 3N6LA 3AB2B 2F9DA 4F36A 1T9XA 3N01A 1CULB 2WVCA 3WZ0A 2OFGX 2HS3A 4DR7J 2KM8B 6FDRA 2QT7A 1DJ0A 4UF4A 3EX7B 1WOSA 3KK3A 1VQKS 2UUTA 3CD0A 3GG0A 3V81A 1F9FA 2ZZTA 5IT4A 3ZZOA 1OO0B 3I31A 3LW5C 5E3AA 2XY5A 4ANCA 5DJBA 4L3NA 5ETMA 4F4YA 4YHHJ 2HK2A 4QWDA 3H4DA 3UNGC 4AE5A 3BREA 3B6BA 1GQEA 1DFDA 5KFXA 4OJ1A 3DGPB 1TVRB 1W2IA 4OYWA 5H9EK 1RHUB 2R8GA 4M95A 4WXOA 2OJ3A 4WIQA 2YX4A 3OFHA 1Q8BA 2QGFB 4NRTA 1WSVA 4ECSA 2RRBA 1LW2B 4FYVB 3LA0A 3IRWP 3R7BB 3LAMA 2CPJA 3OVBA 4UOGA 4GMKA 3DDKA 3K8VA 5EDWA 4BLGA 1TKDA 4YMEA 4QWAA 2YNHB 3FRZA 4JI2J 2DHXA 2DXDA 1PJ5A 2GAGC 2P8IA 3NMAA 1HBOB 3CXCR 1OYEA 4C4WA 4AYBD 1XNRJ 4HT7A 5KFUA 2G0IA 1B7FA 2ZJPQ 1HPZA 3D54A 5KFZA 4PZVA 1U1QA 5BYQA 4ZHRB 4KGVB 3K57A 1FWKA 2D3ZA 2QL7B 1KEKA 2HRTA 2RDDA 3TEGA 2KH9A 3GJQB 4EFAC 3M30B 4OLPA 3ELHA 3JSRA 4HL9A 3BF4A 2HLUA 3R5BA 2RQKA 2BJ3A 4LRFA 2V8VA 2C28A 3N9UC 2XYHB 3ILJA 3TUJC 5CXTA 3CJRA 4HTJA 3THPA 2J0XA 1W2BR 2QEXS 4ED4A 2IA0A 3ETMA 4DR3J 1EKSA 1IBCB 3K17A 1UW9A 4DCPB 2B3TB 3T6JA 3NAHA 3LO3A 2OPRA 3N6MA 1VIXA 4I56A 1F5CA 1FJ7A 1W7WA 4NE9C 5H9EJ 1EETA 4DEZA 2M5YA 3JS9A 5ITHA 2X1AA 2XO7A 1S48A 1N36J 3HT0A 2MZJA 1ZTTA 2F1FA 3MD3A 2W2MP 4X62F 3MUVP 1FKPA 3DDNA 1FD8A 2BW7A 3OSPA 2HS0A 4LFBF 2MHNA 3BKTA 1X7VA 2LXFA 1WEYA 4F4WA 4ED6A 5A8KA 2IVYA 2KT5A 3NS6A 2MGZB 4NZ6A 1HI1A 3MECA 3UN3A 4HR2A 3EVWA 1LK5A 2RB7A 4CO5A 1DBDA 1L3UA 3FEYB 4DFKA 2I1RA 5KG0A 1Q82T 2GCFA 1P9YA 2ASLA 3FSXA 5GMKa 1PGZA 4H54A 3KMSA 3JTOA 2DY9A 4JYAF 1JJ4A 2WK4A 1RCOB 1UW4A 5KG5A 3QT6A 1LW0A 2W8KA 2P6SA 4IFYA 4KPYA 1RTDA 3I96A 2ZBIA 1VS3A 4DR6F 4DHVA 2Z2LA 2G9OA 2HRUA 2RDIA 1Q8KA 2UZAA 5LJ5Y 4OYBA 3Q24A 3V81B 1BQMB 2CQBA 3TYTA 3P8BB 2W2QP 4ZP8A 1U6ZA 3TAPA 3M8ZA 3R5JB 3CCWA 2ZBCA 1MROB 2HK3A 2DRAA 2WSFC 4OQJA 1VBKA 2G2ZA 3ZZYA 3PJ9A 4OHZA 3BN4A 1RT3A 2HVEA 4N8NA 2ZBQA 2YWEA 4RUCA 1NAQA 2MYFA 5KFGA 1YBUA 1U47A 3MM7A 1QJHA 4ECTA 2CQPA 5AXNA 2BE9B 2AJ4A 3GIJA 2AYEA 4GKKJ 5F8MA 1RBLA 3CJ8A 3QRQA 1N5TA 4N41A 2CJ9A 3M05A 2RF2A 4J7CA 3FBCA 1HPZB 3NNHA 1IVZA 2PGCA 2MQMA 4PG8A 1WKJA 3DXBA 3WX8A 4K4YA 1SUQA 1U1RA 3GONA 3NG8A 3VVTA 2OEMA 3T9NA 3KXDA 2O67A 2YKMA 1BWVA 1RWOB 1FX2A 3R1LA 3EDQB 2DNMA 4YB6A 2HZVA 3J81j 1N32J 2XNRA 1KS2A 3PX4A 1TFYA 4QBUA 2M9KA 2HBQB 5HJYA 1ZZFA 4RU2A 5IT9Y 2BOAA 2GIFA 2GJ2A 2GMHA 3HLUA 1EETB 2VH7A 3BJYA 1RA7A 2BKPA 4USJC 3RGIA 2N3OA 4M5DA 4UY8T 2OD6A 3T5JA 1RKIA 1JKHA 1EZZB 2B8PA 1FKPB 1JMTA 4A8YA 1ZBTA 2GNKA 4ZVFA 3CCUS 4MJKA 2C3UA 3AOAA 4UOHA 1ZTWA 5LXYA 3TAQA 2V8HA 1M90T 3NGSA 3W63A 1MWZA 4ZIVA 4HKQA 3ILOA 3RB6A 3MECB 3HZGA 5B09A 4X66F 2R7UA 3HHNB 1QE1A 2A1BA 3NGKA 3R6LB 2DGWA 2R42A 2HFSA 3S8SA 5GAHU 3GSDA 3A3NB 4U7CA 4LJMA 4GC6A 2E1PA 4DL7A 1WTBA 5G0RA 1VIOA 3GQCA 1RXOB 1DRZA 4DU7A 2IM3A 3AOBA 1FRHA 3GFHA 2DIUA 1NHVA 2U2FA 4DR7F 1LW0B 2IMWP 5D77A 4C9DA 1RTDB 3HCXA 4A8KA 4U6PA 3AY0A 4EYIB 3LAKA 1QLNA 4LR9A 4Z7CA 4WPAA 3NCRA 5K14B 1GXUA 3DC2A 1AXQA 1REVA 3BQ0A 3KHGA 3G8QA 4LFCJ 1PC5A 1HQUA 3EPGA 4FF2A 4YHHF 4EO6A 3UQSA 2CZ9A 3QZ7A 2FC9A 1REGX 1BXNA 4WYLA 2V4JB 2ZWPA 3PR4A 1TAUA 3HMJG 3MDFA 5D3GB 4ICLA 5DETA 3CDUA 4DFPA 4K2XA 3PR5B 1F3FA 1SI9A 3I9V9 2IYGA 2Z0GA 4URGA 1RT3B 5IXUA 5J2QA 2WOMA 2RS8A 1KLNA 5IV4A 5IS2A 3PYFA 3MM7B 3L09A 1RACB 2RT3A 3CWJA 1SKUB 3H90A 2Z4PA 4JI2F 4UUWA 1FEHA 3BO2A 3OV7A 3KHHA 1RADB 2XY7A 4X65J 8RUCA 3Q8QB 1XNRF 2XULA 3F0NA 2H5JB 1OWXA 3ZTQA 4GO7X 4Y28C 4TQRA 3A1YG 1NZAA 1YWXA 3C6TA 2APOA 4J91A 2MLYA 1JXVA 2Q79A 2D74B 2X1BA 2YTCA 2V2ZA 1RAGB 1D9FA 2DR6A 2R4FA 1KTVA 1L5UA 4WYWA 4DG1A 2J9DE 2VA3A 2FB0A 4EZ6A 2VL1A 4LF4J 3CCRS 2CNOB 3QNWB 3UCGA 2MPUA 3MEGB 1WC4A 4IO1A 2XS5A 2YKMB 2W1BA 3CMQA 4HH0A 1BQNB 4RUAA 4DR3F 1IR0A 4XO0A 3JYTB 2P2CB 2ZC4A 1SQFA 1UFKA 3NOGA 4KO0A 2YQ1A 1SBRA 1VCTA 3D1OA 4ZVRB 1N36F 1HI0P 3B82A 5D0EA 3FCWA 3P5BP 4M5DB 4U8VA 3G6XA 1JKHB 1FE0A 1X0PA 1NK0A 3OTCA 2ZHBA 3BKFA 2NQPA 1I51B 1XERA 1J2VA 2AJ0A 4DS4A 2FZKB 1RU1A 1AUDA 1TKZB 3HJFA 2YKNB 3CJ5A 4NRUA 3UPFA 4KAIA 5EWEA 3PKYA 1Q78A 5J2NB 2WVEA 4LF6J 2E1RA 2XWXA 3DU5A 2DGXA 2ROGA 4BCAA 1QE1B 1VQLS 5IV3A 4OX7A 3NGTA 4YP3A 4C11A 2YNIA 2HQGA 3BGLA 1RBAA 2QV6A 5M2PA 1J27A 1FHTA 2GGPB 1PKUA 2XBPA 2B43A 3R8YA 4YOEA 4LRBA 1UFWA 1SJQA 3L7UA 1AFIA 2QLBB 2HSEB 4YB1P 1F9HA 1LWCA 4ZVGA 4FNHA 5B0BA 2IRUA 4MKYA 3AD7C 1Z2ZA 2CQCA 5M2UA 2XLKA 1JJHA 2EEYA 1DQ9A 3W9IA 1LNQA 4XK8C 1FKOB 3H42A 2IVMA 2MQ8A 3HZEA 1SKSA 5L1IA 5KFBA 1UP1A 4HI2A 1RB0A 4LR7A 2YWKA 4MK7A 5A6PA 4X4TA 1OPZA 2VQEJ 1UAWA 3R27A 2DH9A 1VQ7S 2X1FA 2KB2A 2OSQA 3GYNA 3VGUA 3D9BA 2DGVA 4NZ0A 1QSYA 3HD2A 2WVBA 4D3HA 3HK2A 3CCVS 4J37A 4R5PA 1VOMA 2WOMB 1WSRA 4LSNA 2DR7A 3FQLA 3HVTB 3DCAA 1TZ0A 5IZHA 4HH1A 4JI5F 2OGUA 3UN2A 1MN9A 4DSLA 3OHBA 1RT1B 4DPTA 1FJEB 4OZ5A 1T03A 3K2YA 3HXMA 1L3TA 3PRVA 5AE2A 2NYIA 4NXNJ 2GQCA 2HFOA 4DJBA 5GAEU 1VBYA 4A4JA 2L48A 2HLTA 4B9MA 1MWYA 1TL3A 2M88A 2HWTA 5HQLA 3QIDA 1IBKJ 2XMKA 4XAKA 5E7OB 2ATLA 2HHXA 1DHMA 3LGNA 4RO0A 1SKRA 2MQNA 3ETOA 2IHR1 3X1LB 4M63A 2JSXA 2OTLS 3ZZRA 1ACMB 1HR0J 3SXLA 4JI0J 3O5TB 1X60A 4CO0A 5KT4A 2PSZA 1N32F 1R31A 3OL6A 3QT5A 4DQRA 4C6AA 5B0GA 1S59A 1HFEL 4KO0B 2CPZA 1T9YA 2B9EA 5CZXA 3HKZD 2LDIA 1NSAA 4DV3F 1O8BA 3WQPA 4ID5B 2DYAA 2LQ9A 3NAIA 1F3VA 4R8UA 2C2DA 3NWGA 1DTQA 1R3NA 1UMJA 3QJJA 3ILLA 3GYXB 4OZ3A 2KG0A 2EI5A 2LQJA 3T1HJ 3JSYA 3C15A 4KSEB 2B9WA 3NMRA 4DLGA 2EW9A 2NXUA 4ZVQB 1A9NB 3CF5Q 2DR5A 3NOCA 1DY3A 3NWRA 2X7IA 1WDDA 2XMMA 2VC0A 3TJAA 1KRPA 1Q79A 3SDEB 2FJBB 3W66A 1S6UA 1RA6A 3QGHA 3PXGa 4EO8A 4C11B 1SJ1A 1WC3A 2YNIB 1VQPS 3AOCA 4LIWA 1RTIA 1U0HA 2J6TA 1KVJA 3RAXA 4RPFA 2F4FA 1CJKB 3VV2B 1H98A 5JUMA 2CADA 1Y5IB 1B70B 4UY85 1S0NA 5JVGQ 1WELA 2J7KA 2BZ2A 3KKFA 1DQ8A 2CQ0A 2AEMA 3IRXA 4WE1B 1RQ0A 2FLNA 2DCUB 4AFFA 1OMSA 1RWPB 1AW0A 3I87A 4LFCF 1B0TA 3CJSA 5HMYA 2F4VJ 1U24A 3MTKA 5ETSA 4HEA9 2JJ4D 2R8JA 3PFOA 3T41A 1S9FA 1U6FA 4PYDA 2GS8A 1LOUA 3MMAA 1W26A 4QOTA 1QDUB 1VRQC 2RKIA 4Q43A 2UU9F 4JI7F 1N5SA 3PDNA 1IM4A 2DHGA 2E5LJ 4FXVA 1IR1A 1KHVA 3GB0A 2OIHA 1PCAA 1N4LA 1Q16B 1RAIB 1U2RA 4R5PB 4X4QA 4LSNB 2DNNA 4LF7J 4IOCQ 2BABA 3MWBA 4M5LA 3CDBA 3LP0A 4HACA 1RE1B 5E3CA 2D69A 4X65F 2ROPA 1Y00A 1UJ5A 3CDAA 4PWUA 2VD3A 2QMWA 1XMBA 3ZZTA 3UE2A 1EAYC 1X8DA 4PABA 1Y7PA 2BMBA 2YWHA 1TL3B 5DLFA 3AFGA 2ACYA 1QUPA 2JC0A 4LF4F 3UDCA 1BD6A 4IRKA 2OPPA 2C3YA 1RCXB 3QSIA 4N5SA 4L74A 2ZHAA 4CNYA 1GT8A 2HQCA 5KFIA 1UPPA 1T0TV 3DM2A 3JTPA 4B3SJ 5KFQA 2ILZA 4MH8A 2OPQB 4XIUA 1WHXA 5HAOA 3VGVA 4F4AA 2AWZA 2XHCA 3CCMS 2QL9B 3IG1B 4C8MA 4EBEA 5F8JA 2HQ3A 2CDQA 4A8QA 4GKJJ 1S1UB 1S7IA 5GAEI 1HBNA 3HM9A 1TFWA 1DTQB 1DURA 3RAMA 1T9TA 4GRSA 3V4MA 2VBYA 5F3TA 4ZITA 1KR4A 3SCIE 4DR5J 2CG8A 4RW9A 1GX6A 2Z58B 4OI3A 4USKA 3RYLA 1HKAA 2P5VA 2VHGA 3A3PB 4LF6F 2JFDA 4K50A 4JI4J 4IH5A 1DLOB 2AYMA 3ADAC 3H5SA 2QE5A 3D2WA 4DSJA 3N5BA 2OPSB 1S1VB 3UVJB 1Q95G 2LECA 3ZXWA 2R2TA 4Q5VA 4K0KJ 1U0HB 4WKRA 5HVHA 4KRWA 3QWUA 3HSZA 2BBEA 3O1LA 2VQFJ 4CZCA 2I8EA 4LSZB 4EZ9A 3EPIA 5C24A 4NLPA 3IBWA 3S6EA 5AXLA 4B9TA 1RI7A 3IRXB 4K4UA 4BWMA 3GILA 3KDNA 3K5MA 2V34A 3FEXB 4EEYA 1F1BB 1HNVA 3S7RA 5AE3A 4OZ2A 1HD1A 3JTNA 2EKYA 2XGQA 3MM5B 1YJVA 1O0PA 1AUSL 3DOKB 3TJ9A 3W7BA 1CJUA 4F4KA 4WIIA 4DSIA 2OMLA 1F2GA 4CLPA 3CJTA 3UI3A 5KFDA 5FD1A 2WVFA 1XR7A 3C8YA 4ED2A 4OYXA 1P6TA 3MMAB 1LFWA 3QAEA 2VFVA 1TKTA 3JXOA 4MT1A 1JK9B 1RAJA 4CT8A 1PG5B 1S4EA 3DRYA 2BANB 3I32A 2M70A 2KYXA 5LJ3Y 3D0GE 3TI0A 4DOZA 2Y1IA 1RT4A 4ECRA 1NPKA 4C8OA 4MKVA 4PXCA 3LP0B 4HACB 4RWWA 2LA4A 1H7WA 1B0VA 1R43A 1KP6A 1NKBA 3M8QA 4P75A 4NXNF 3RTVA 1YJTA 1XQIA 3QPIA 1UA1A 2I2YA 1JNZB 2VFSA 2BVZA 2E9RX 1N5QA 1UEKA 3J7ZT 3HULA 1IBKF 3BKUA 2PC6A 3TUIC 3PW0A 9ATCB 3OD2A 2QYGA 2KXNB 1YQHA 1RT5A 3JQMA 2RRNA 3BH7B 1T94A 2ILYA 3E51A 2ZD1A 1X9MA 1HR0F 4R0EA 4JI0F 1PSDA 1L3VA 4QW9A 4IOAQ 1N33J 4ZVHA 3PNIA 3RRKA 5K8NA 5SUHA 4F50A 5HQMA 3VAMA 1MMNA 2RE1A 3DM2B 3THVA 3DLKA 1G7CB 3JSMA 5KOWA 4QIGA 5E33A 1VK8A 3P96A 2LKZA 3MHYA 3TNVA 4PWDA 4ZK7M 2XMAA 2ZJRQ 4F67A 2ZUAA 3PO5A 1QM9A 1FI4A 3ZTOA 2LXIA 3WHIA 1SQGA 5THWA 1H74A 5BYRA 1RHJB 3MCSA 3T1HF 4EMDA 2W7PA 4CO2A 1S9EA 4KH0B 4J5OA 2OHDA 1S1WB 4CIOA 2ZH9A 2CNNB 1NJXA 4OLOA 4I0WA 1VQ4S 4O0NA 4C8KA 5JMNA 3H5UA 3ISNC 5A8RB 3F41A 2HGLA 2EFVA 2FLPA 4I4BA 1ZH5A 4KV8A 3AB4B 2H54B 5CYMA 4RUHA 1NDCA 5FLXU 4XPCA 3CMES 2PFDA 3M6WA 1NJYA 3JQJA 2AMCB 2WBMA 2XSJA 3JB9k 4UQTA 5C5JA 1KTQA 1TUVA 2VKRA 4ILRA 4S0MA 4X4OA 3D6HB 3GTYX 4P7VA 1R6YA 2PFFB 4RW7A 2Y8WA 3DLGA 2V8PA 4DN9A 1SIZA 4RUBA 3DXSX 1X31C 4OHYA 3GCXP 1WD6A 2QC3A 4NLYA 5J1NA 2QSFA 5KFCA 3H5XA 5C24B 4BHQA 4PR6A 3G96A 4E2FB 1VMBA 3GR0A 3RBZA 4IDKA 4M8LA 2F4VF 4DX7A 2HHWA 4YY3J 1HNVB 3LWLA 1GTHA 1T9UA 2HGNA 4N8OA 4QYZK 3CT9A 2QZ8A 5U47A 1RKJA 4P74A 1Q86T 3TUPA 2V94A 4ILLA 4X4NA 2CQIA 4EUVA 4JV5J 4NEZA 4J9PA 1F6TA 1TKTB 4ER8A 2E5LF 2H4WB 1ZPWX 1SKWA 3A8IA 1I3OB 4IG0B 3V6HA 1IM6A 2Y0BB 4NLQA 1WC1A 1M5OC 2VV5A 1TQLA 1XTZA 2YNFA 1S6PA 4ZLLA 2V9KA 4ZVOB 4B3OB 4DFMA 2IPOB 1RT4B 2KHCA 5IM0A 5K20B 1JLFB 1Z2LA 3H7HB 3FGVA 1KOHA 5H9FK 2Y1LB 3ZTPA 1HWUA 5KG1A 2Y1JA 4G1QA 1T9VA 3HSDA 1R8AA 3CE8A 3MEEB 2CNLB 5DLGA 1B7YB 2AHOB 3SEOA 1KOOA 1S5ZA 1GTEA 2DK2A 2R7QA 3AH6A 2KJWA 2AJQA 3RJMB 2MZ1A 4CLFA 4YR0A 2H5IB 1QVGR 1R0AA 4DV0F 1H2UX 3H8YA 1RT5B 2DCLA 3MMBA 3CC4S 1PIEA 4ZVTB 3WIVA 1GFWB 2ZD1B 1FKAF 1VQSA 2WONA 1C1CA 3DI6A 2CPHA 2RQCA 3O6QA 1RWXB 5BR8F 5KFWA 4F26A 3NY0A 4QYZJ 5CHCB 2AX1A 2KL8A 2CZ4A 1HNIA 4B3SF 4C2MA 3FRYA 3U1NA 2PEHA 2OKQA 2DO4A 3DLKB 4DZ6A 3D3CJ 5B7WA 3SSQA 4PWDB 2NZCA 4K5RA 1JLBB 1K47A 1VQ8S 3IWLA 4GKJF 4QR1A 4OI2A 2GHWA 3TR5A 2AJ2A 5JVHQ 3OXLA 1M1KT 4BC9A 4QR2A 3X3UA 3BGRA 3TJ8A 1LQ9A 3PEHA 2QFJA 2BKOA 3LP1A 3OBIA 1RK8A 4OYPA 5H9FJ 2ZOMA 2VBWA 4DUZJ 4Q8EA 4CM2A 5L1KA 4V19J 1XMOJ 2QSWA 2LQ5A 4JI4F 1M5VC 1RT2A 2R7VA 2GJFA 4WU3A 2A10A 3MR2A 3AT1B 3F56A 4KV8B 4L73A 3QFWA 1D8ZA 1UVMA 4A8SA 4DV5J 2ZNZA 1RWVB 2XSJB 1U25A 5G4DA 4P10A 1PC4A 3EXYA 2XC9A 2H9ZA 4K0KF 2GAHC 1C0TA 3H0PA 2C3MA 1GMUA 1VQ6S 3P45B 5HLFB 2VQFF 4RW7B 2V2VA 1Q1KA 4IYQA 2P9CA 2WW4A 3FFIA 4B9SA 4FN5A 3EGVA 3DRRA 5EWFA 1S9GB 1XEZA 2M0GB 2EBGA 2PMWA 4Q45A 4E8UA 2MZQA 3RAQA 2VICA 4RW4A 2XMTA 1YITS 8AT1B 1WEZA 5IFMA 4CYUA 4IDKB 1K1QA 1KFSA 2N4DA 5E5NA 1XMQJ 1BLUA 1NJIT 2GVZA 1N5YA 3T5LA 3M8PB 1YRUA 4USWA 2MY8A 1LWFA 3MURP 3EWGA 1HWKA 3K0JA 3SSSA 3CDEA 1OY9A 3VQSA 4XTTA 2XHWA 2F8HA 3UR3C 1NKCA 4WZMA 4LF1A 3M8WA 4UOFA 2RSQA 3EUNA 3AA9A 5F8NA 1ZA2B 2IJFA 4LF5J 2YNFB 1S6PB 1I1GA 1CPZA 2Z57B 2VB6A 1WOOA 2R8KA 4NLUA 4RX6A 3ZZZA 2ASYA 5K8MA 4BS2A 2XMJA 2JEIA 1H2VZ 4L6V3 2R3VA 4I69A 3BGFA 4PEOA 4DSKA 5SZTA 4G1QB 2K3IA 2DNGA 3M4XA 5HL7Q 1NB2A 2DKOB 2FY8A 3HI9A 4JV1A 4OX9J 4FBTA 3K5OA 3OL7A 4U95A 3DKDA 4NI2A 2NPFA 2PI4A 5KFTA 4KGZB 2E9TA 4TN2A 4MYUA 1R0AB 3CO0P 1RAAB 2CPDA 3PX0A 3T5KA 3I82A 3P3DA 2WW8A 3MMBB 4DWIA 2HVZA 1N33F 2UUWA 2DH7A 2MLXA 2NYHA 2YKAA 2HWHA 1SC6A 1C1CB 1T11A 4C3LA 4WFXA 2R9LA 2GFFA 4LMZA 3M9NB 2CRLA 3RW6A 3J7YU 4FXWA 4CLYA 4CH0S 5GADU 2W2PP 2DJWA 2EC0A 1KN6A 5FDLA 1X4BA 2V2KA 1HNIB 4PAAA 3RBDA 3DLEA 3OXGA 4HVZA 4JB8B 2CJKA 1UTAA 3GIMA 3RB0A 1WJ9A 4N47A 4DV6J 2AU0A 1TL7A 1J5OA 5KFLA 2HEKA 1MMLA 4ENOA 4PCQA 1S0OA 3MPVA 4CM0A 4PKDB 2DB1A 4Y2AA 3J7Z5 3M8SA 5KFFA 2N3LA 3G86A 3V6DA 3I5CA 5I3UA 1V9OA 4RU9A 3TO8A 3BGRB 1CC7A 1E6YA 5A76A 3AHPA 1VQYA 1TL5A 3CJKB 4C98A 4ZVPB 3HHKA 4LFAF 1T8EA 2XLJA 4DUTA 1IWGA 4P52A 3OQ2A 2ZH3A 1RT2B 4IKAA 2Z2YB 4ZMMA 2BM1A 4RKUC 3G6YA 2YH0A 4IFVA 3D6FB 3GP9A 1NZ8A 1XIQA 5IOLA 1JLQA 4O0IA 2C1EB 2WBRA 1GMWD 2DNLA 2MZRA 1ZM2A 1YLXA 3CMAS 3R1HA 5HANA 3CCJS 2DT9A 1NCLA 1U8WA 5CYQA 3A4TA 3ILIA 2OH2A 3OTOJ 2NXNA 1J5EJ 4WP3A 2RNEA 1ZETA 3MMCA 3J7AN 2P9GA 4TKTA 4KPCA 1EHWA 4USHA 3KK1B 3FFIB 1JLGB 4DR1F 4NMXA 3N5FA 3DRRB 1NJWA 1QAYA 2BR0A 3HJVA 1I5OB 1VRUB 3FUYA 2KXFA 4YY3F 1CEZA 1KC8T 5B0FA 2HZAA 4CYUB 2G1DA 5HVFA 3IBCB 2NPIA 5CA5A 2GVZB 3BQ1A 4DV4J 4W90B 2E29A 4WWSA 2W01A 1RWKB 3CJ0A 3OR2B 5KG2A 4JV5F 2IRXA 4LF8J 5KFPA 3T5HA 2YBVA 2CPYA 4DR2J 3RB3A 1Q7YT 3DGPA 1HMVA 1TVRA 2IM0A 4LQ3A 1NKEA 4PPZA 4UQGA 1UVKA 1UL3A 4FP9A 1N56A 4ZDNA 1LW2A 5D0HA 3IC1A 1IJFB 1KQGB 4CLKA 4U9RA 4YR2A 1ZYQA 4F25A 3I0SA 3KLGA 4WK3A 3K5PA 3W2WB 4ED1A 5KT3A 2YNHA 1GXTA 1HI8A 1HBOA 1C1BA 4L3KA 1VRTB 1M5PC 1S1TA 2HVHA 1RTZA 1XN9A 4L75A 5A6WA 4ZHRA 4NI2B 1NSKL 2H5EA 4ZN1A 1SV5A 2C2MB 4Y6IA 2FDNA 2FD2A 3FDSA 3LP2B 3SZ2A 1UA0A 2EBEA 1YVFA 2POKA 2FVPA 2ZZNA 1GMWA 2AP6A 4QQBA 2B4VA 2Q6CA 4HTIA 3KJVA 2F40A 1HIYA 3PY8A 4OYMA 5I3QA 2RU9A 1VBZA 2FJXA 1UWBA 5KG6A 5LMUJ 2FJDB 5MLCV 3KOAA 3CJ3A 3PG9A 2FHKA 5C7PA 1OSCA 1D8YA 2HFUA 4ANEA 4NCAA 5DDRC 4CP5A 3POTA 4FYYB 4WF9Q 4F3MA 4OJHA 5ETTA 1TL7B 3KG1A 1J5OB 4MYTA 5KT2A 1PJ7A 3BSOA 2HG4A 1Y0HA 3BB5A 2LP4A 3TZYA 2RS2A 2ASDA 5D78A 3V6DB 1WEXA 5I3UB 1S77D 2IVFB 1YJNS 1E6YB 2VOPA 1L3SA 2C22A 4F8RA 1XMOF 2IMOA 4ED8A 3DRSB 4JI6J 4AL6A 4QU7A 3SFGA 2BEFA 4DPYA 1KQSR 4L72B 1Q8LA 4X2BA 5C2GA 4DV5F 2HQFA 3J7YI 4DSFA 1FRMA 5GADI 1HW9A 4K5SA 3CULA 3PW2A 4Y65A 1FNOA 3R5AA 5J2MB 3BPSP 5CYQB 2VONA 5I3PA 4PG7A 3Q8RB 4B3RJ 1WF2A 4I2PB 1SC1B 3OPKA 1C2PA 3R5CA 2UVRA 1JLEA 1AROP 5C25B 4H4KA 2FPHX 2LVWA 2QLWA 1LWXA 4O23A 1D9DA 3FZBA 3TZZA 4ZJLA 3BSCA 3GE9A 1NPRA 5D4LA 3CCTA 1FERA 1B3TA 3M9OB 1XMQF 1RJJA 2IFXA 2GC8A 1R6VA 1YRXA 3W9JA 1BQMA 2EVZA 2VA2A 4NLSA 2VG5B 1YX2A 2JLGA 1VI7A 2BQ3A 1IKVB 1JXEA 4C8NA 3H20A 3D7SB 4JUZA 3HFKA 1P1TA 1MROA 3CJ2A 2VUGA 2FHJD 4K4VA 4N7TA 1SL0A 1HMVB 2JLFA 4TU8A 2E9ZA 2ZOFA 4LF5F 1RYSA 3GFZA 4R0JA 2ZDPA 3LANA 4ZLJA 4DQPA 1NH7A 2XG8A 4KR0B 3NRBA 2CQHA 3GJSB 5HSPA 2J5AA 2M8DB 4JV0A 2DHAA 1KKHA 2AF6A 3DU6A 4NX9A 3KHLA 2HHSA 4B9LA 3I0SB 3KLGB 2CG4A 3JQKA 4WP8A 2RU3A 3W65A 1FA0A 4KC5A 4C8LA 1Q4RA 4LR8A 4KHPJ 3MR5A 1X4FA 3PM9A 4OX9F 2JL9A 2MKKA 1C1BB 1Y10A 3CCQS 4F3OA 1S1TB 1FEEA 1CS4B 3QAUA 3B54A 3TA2A 4QIEA 2N4CA 1JNRB 4RNFA 4C3MA 1SV5B 1WC6A 2BXJA 4WKYA 2IJRA 3HVRA 3FEZA 4NLTA 4DDFA 1CLFA 3AA8A 4NL5A 4WFYA 5ETVA 2EXUA 1X5PA 1AFJA 3K5LA 2AIRB 5A2QU 3J81U 4W92B 4QJVA 2XI2A 3W1YC 2GO8A 1U1OA 4F02A 2D9PA 3KJVB 3QATA 3P4UB 4E98A 3OL8A 4O3PA 3NP5A 1UWBB 4TYBA 2CAJA 4DV1J 1JWWA 3QMQA 4DV6F 2BOPA 4H4OB 4URSA 3TW0A 2GMLA 4OYOA 3POTB 2ZWOA 4DR4J 2XM3A 1RUSA 1ZM9A 1PO6A 4NXMJ 1QSLA 1Z4UA 4F3QA 1WC0A 3OUYA 4JI1J 3DHXA 4RNNA 3MM8A 3IWNC 1WG4A 1E6VA 1D1UA 1VJWA 4TU9A 2VIHA 1JLAA 1RAFB 4X4SA 2IC3B 1FJCA 4MFBB 2AZ1A 2MKJA 4OFZA 4O3NA 4PRFA 2EG1A 2GHPA 3EM1A 1P8GA 4LIRA 1N0VC 3CD5A 4PG6A 4ED5A 2QO3A 1Z1ZA 3BDPA 4XDCA 1SC4B 1FTCA 2HFVA 2UXBJ 4UTGA 1URNA 3KG0A 2ZITA 4DQIA 1CQNA 4USTA 5CCMA 4ALZA 1YGYA 2Z56B 1G3OA 3V2UC 3OTOF 4AQYJ 3CPWR 2B7BB 2HIQA 1J5EF 4DF8A 5IQ6A 4OJ3A 2PT0A 3F44A 4KH1B 2LFVA 1U02A 2GO9A 3PV8A 2FVQA 4ZVEA 1JLEB 3MF5A 4X4RA 3PCOB 3OL9A 1B99A 4AXJA 1ITPA 2NR0A 3EZ5A 1DTTA 3Q89A 3VCDA 1NUEA 3FQKA 1WDTA 3KNAA 1EP4A 2BKNA 2K7KA 3ZNJ1 5K14A 1YHQS 2KYZA 4Y2CA 2XZTB 2W24A 1FJGJ 2CQ1A 4LF8F 3A8KA 5GAGU 2RDJA 2MEWA 5HO4A 2PEBA 1JXLA 4DR2F 5A8WA 2HQIA 2V4JA 1QVFR 2O3DA 4QZVB 4ECZA 3ZTSA 2O1PA 5D3GA 2NCKL 5IWAJ 1RHRB 5LM7E 3TZWA 4FBUA 3TEHB 1NH8A 2HFNA 2PA8D 5LSLA 2ZKUA 2Q6BA 2QLXA 1SXLA 1TKXA 2BJ7A 6AT1B 2HZCA 2QTWA 2AJ1A 2GQ2A 2V8GA 4I1TA 2BRKA 4OI0A 1X4CA 1Q0NA 1KSPA 3KUEA 1S10A 3UCUP 3R6GB 2XEXA 4ECUA 2GHVC 4UW2A 2QLFB 1M5HA 3TAMA 4ELUA 3BSNA 2IAJA 4NLOA 2F9JA 2B0GA 1YJUA 4CWBA 2V69A 3BGOP 1FFWB 1M1GA 3JSBA 1U2CA 5F8IA 3R7SB 2DHHA 2YKQA 2LQ8A 2VFTA 3MPDA 3GV7B 1K0TA 3KJNB 1HD0A 3SQGB 2KDOA 3WIUA 4MAKA 4M5MA 3NNAA 3M2RB 3MEGA 3PEJA 1HHTP 1NMEB 3QYYA 2BUNA 3CJ4A 3PHTA 3UO0A 1BQNA 2QYCA 1IKWA 1BY9A 4UT4A 5HP1A 3GR1A 1TK0A 3JYTA 1BMQB 1FE4A 2WSEC 2LYVA 2FVCA 4F2SA 2P9EA 5GMEA 5GMDA 3W8PA 2V5HG 4YS2A 3AJ2A 1SJFA 3OUYB 3CSKA 1BWEA 2DNOA 1R8PA 3MM8B 2LEAA 4DBQA 1MWQA 4TLQA 1N8RT 4G3IA 3CO9A 2XWYA 2E5HA 1E6VB 1AZSB 4CT9A 1JLAB 1U1KA 1OY6A 3I0RB 3LPYA 4ETZA 2MKHA 2RQ4A 2VJVA 3VF0B 4TXSA 1FK9A 4FF3A 4JI6F 1SVDA 3BBCA 1TKZA 4C97A 4ZKAA 1VLYA 2YKNA 1YTYA 1FX4A 4F2RA 1S79A 4PUOA 4F7VA 5KG7A 2O01C 1RT6A 4K59A 2FQQB 5DG8A 2R7TA 2BX6A 3EJMA 5J2NA 2MZSA 3BQ2A 2R8HA 2G0CA 4YB7A 2HGMA 2HS4A 2EK1A 3TUZC 2LLZA 3UDEA 5L9XA 1QTMA 4B3RF 2OP5A 3IBFB 4OYZA 2D3UA 3GLJA 2GGPA 1WHYA 3KHRA 3CD7A 4LVOP 1KLMA 1Y5LB 4Y2MA 4J9QA 1S7HA 1O6XA 2WB4A 2EK6A 2IRYA 4OHVA 1H2TZ 5IT0A 1DTTB 1U4BA 1NHKL 4Y34A 1RAOA 4OV6A 4TU7A 4J9NA 3PYDA 1EP4B 3OTDA 3P49B 2XSFA 3AD8C 1FKOA 1NM2A 4DSEA 2MKSA 2C2EA 3WC0A 3EGWB 4ELTA 2KU7A 1UKUA 1ICEB 3PKMA 1FESA 2J6UA 1N54B 3RUBL 1XNQJ 5A8WB 3DRPA 1AYEA 2ZDOA 1RAHB 2D9OA 2QX0A 2YX1A 1R89A 2V67A 2E7VA 3GG1A 2KZMA 5A2QY 3J81Y 4TY8B 4HHHA 3KK2A 3G4SS 3N79A 3NLCA 3HHDA 1KNZA 3FCVA 2HIYA 2R7WA 2F5GA 2RH3A 2ZC3A 4KY3A 2JVOA 4ZCMA 2VF3A 2JH3A 4ED7A 5ETLA 1TKXB 3HVTA 2YKPA 3VALA 2XS2A 1HBUB 2WHOA 1Q5VA 1LKZA 4LFBJ 1HWJA 3AJDA 2YWWA 3Q2TC 5AT1B 3HD1A 1PYSB 2NXJA 1RT1A 3UD5A 1M1HA 4A8XA 2GX8A 1F5BA 3PW4A 4QCLA 3TAMB 2UP1A 2HYIB 2DNQA 2IAJB 3IXQA 2O5DA 1S1XA 1TELA 4M1KA 2R2RA 4CQ1A 5GAGI 3L4BC 2C2NA 3ENQA 2LXUA 4B9VA 2BQRA 5E2QA 1EJ7L 4UOCA 2Y9HA 2B7CB 2HAIA 2XMVA 1GAOA 4QWCA 1KVKA 4NZ7A 2ZNYA 3NKYA 2VFUA 5K5MA 4QWBA 2BDPA 5I4MA 2VASA 4IH7A 1W25A 1X9WA 2JOQA 4ZVUB 1XR6A 3W60A 1X5OA 4DV1F 2FJEB 2J6SA 4B9NA 1IKWB 2IBKA 4XPEA 1NK8A 5HP1B 4FS1A 4DR4F 4N77A 3GSIA 3VR1A 4DUYJ 5LSOA 4JI1F 3RRGA 1CBKA 1F60B 1PBAA 2H65B 4GO5X 4M5NA 1TK5A 2V4RA 4ID5A 5D4NA 3HP6A 5F8GA 3ISZA 5KFYA 4A8WA 4AL7A 5HMZA 2JDJA 1FWPA 3EZOA 3VVUA 2K1RB 2IIHA 4DX8H 4ZPAA 1FK9B 3QO9A 2DRDA 2KZZA 4OMFG 4ZJOA 2J8SA 4QU6A 1MMDA 2MQLA 4I6AA 1HARA 4PUOB 3TQ1A 2ZH5A 2UXBF 3D68A 1RT6B 2VPXB 3CIZA 3PW7A 3SDEA 3G82A 3W5XA 3S1TA 2MQQA 1KQFB 1QD1A 4U7UD 1X4EA 4AQYF 1TV6B 4ERDA 2MKIA 2W7OA 2R7OA 2XZDB 3OR1B 1KLMB 1NHUA 1VDHA 4FYWB 2NZ4A 2OFHX 1OS5A 1CJKA 5L39A 2EFNA 5KT6A 3B4DA 2KN4A 1LFPA 1T9WA 3R3TA 1EB0A 4DL2A 1U1PA 2V8DA 4WE1A 2QMXA 4R25A 2X3GA 5BYSA 4O4RA 5DG7A 2JX2A 2ZBPA 3E3XA 1VHFA 2UUBJ 1ZZNA 1FJGF 1UVLA 4NLXA 3THTA 3C16A 3W62A 2OELA 1NSQA 3SV3A 5I42A 2DEJA 1ZAWA 3DYAA 2VJUA 2MTLA 1JQGA 3HDSA 5E3PA 2W9BB 3G87A 3DRPB 1XK8A 5F8HA 4X64J 5IWAF 2E1CA 3O44A 2WVDA 1N88A 1EARA 3W3SA 3KK2B 2BJ9A 4P2FA 4EWTA 1UCNA 1FF2A 4C0BA 1A6LA 4OYAA 4YR3A 2KG1A 2N82B 3T1YJ 1WHVA 3FK4A 1IBLJ 2BQUA 1KONA 1GK8A 5HATA 3BZQA 3M1VA 1URRA 3LQVA 1VGYA 4GKKF 4F0KA 3MD1A 2F63A 2HNYA 4PG4A 2GQQA 4RWXA 3QJLA 5LXRA 1GXLA 2MXYA 3IAM9 1G4CA 5KFRA 4DQQA 2CJXB 1TUWA 2MLZA 3BO3A 4ES2A 3WBZA 1S1XB 3V4IA 1V3SA 4K4WA 2MMYA 4OZJA 4N56A 4KHRA 4I7FB 3QFHA 1KQKA 4F4XA 1NB7A 4QIVA 4EU0A 3QGIA 4ZS6A 3A8EA 2EKNA 4IQXA 1VC0A 2MSSA 3QT7A 1S12A 5T7LB 4DL0C 4DPXA 5ADZA 3ISND 4K4TA 4ZPTR 4PG5A 3B78A 2Q43A 2NUHA 1G2EA 4JI3J 2H51B 4RNMA 3QSYB 3QJPA 4DMZA 1VHIA 2KKHA 3IGNA 3Q8PB 2OPQA 1D3WA 3H2VE 5DG9A 3W8GA 4OIXA 1TR0A 4LRCA 2PI5A 3I6PA 3IG1A 2J0WA 2RIJA 2FUG9 3SMZA 2IA6A 2WAQD 1S1UA 5HJXA 4RR5A 2LQBA 1CJTA 3K58A 3Q86A 2AW0A 3RW7A 1U49A 2CA9A 3TA0A 4DQSA 3QO9B 5L1LA 1YJ9S 4P6QA 4DU8A 4BBYA 1C4AA 1U7LA 1YBTA 1WTFA 4UUXA 5EUHA 3MFIA 2XYPB 1IUJA 4J9KA 4OZ0A 3G82B 1DLOA 2AEFA 4NLVA 2I6WA 2Q66A 4I2QB 2OPSA 4J90A 4ILMA 1S1VA 2Q1LA 3UVJA 2HFZA 4IUFA 3MEKA 4KHMA 3DFEA 1P9QC 4ZP6A 4KIAA 5LL6d 1QAJA 2J0QD 2MKCA 1FXLA 1R8BA 1NBEB 4QPTA 4A8MP 1SH0A 4FKXA 4OHWA 2HW3A 5M2RA 8ATCB 2GIQA 2B51A 2ZH8A 4C48A 1U1MA 3ZC4A 2YNGB 3W61A 4RL1A 3MAAB 1NNDA 2IDEA 3OTBA 1T05B 4DN0A 3MM5A 4ETXA 3DOKA 2VZ9A 4O4GB 4CO3A 3C16B 3SCJE 1PBUA 3G6ES 5I42B 1XNQF 3DYAB 4URQU 2DEIA 2ZH2A 3WX4A 4CCHA 4O3QA 2DNYA 3ZZUA 1CC8A 2AYBA 2VPYB 1FNMA 4WBFA 4J9UE 5D4PA 1H38A 3LTOA 2DGTA 4DX6A 2KM8C 5ETNA 2F7VA 4NCGB 4JP8A 3BGUA 4RBUA 2CFXA 2BANA 5D0RA 4LF9J 1VR6A 1FDBA 4A8FA 1SIWB 1X4HA 1RWNB 4ZPWR 2DY1A 1SL1A 3L7PA 2YH1A 4P7TA 1SJ4P 3M1VB 3TVYA 1APSA 3IGVA 1TK8A 2D3O1 2HNYB 1R0BG 1PAUB 4M5IA 3OSNA 4Q2MA 5DGBA 2GJIA 1WF1A 2LEPA 3C66A 4FS2A 2CQGA 3ITHA 9RUBA 1HLWA 3BM7A 3W5YA 1FWLA 4DZDA 3V4IB 3CW2C 4I64A 3MR3A 2JHEA 2DH8A 1N6QB 1FRKA 2QA4G 2JWNA 3QGPA 3KLVA 4G65A 4YFUA 1NXIA 2UVVA 2WRMA 3RU0A 1RGVA 2YKOA 2I38A 2JEJA 1LXNA 2J0SD 2BJ8A 4X4VA 4P72A 1OY8A 2Z2ZA 2XGPA 2NUUG 3FSIA 5HMXA 1FVQA 3MCMA 2KTQA 2CQ4A 1KFDA 1U48A 2HHTA 1R27B 4DUYF 5F9LA 3KK3B 4ZIWA 2D3OR 4P9SA 1VISA 1A7GE 1RLDA 3NCQA 5J1EA 5LT5A 5CZVA 2OD4A 5D8HB 4DCJB 4Z7YA 4JOUA 3ENAA 2VDIA 4OZNA 3O8WA 3A12A 4W4MA 1YBAA 2NXCA 4CH1A 1VK3A 5DM6Q 4CO1A 3C6UA 5KT5A 1HQ2A 1CJTB 2F8EX 1LV5A 2MJUA 1S1WA 2HQDA 4NWBA 3TQEA 2PO4A 2Y3YA 1CG2A 2CZVC 4U7UK 2KFNA 4MKAA 1ULRA 3JAMU 5A8RA 3CCES 3EGZA 4OX8A 1RWMB 4QW8A 4K2JA 3Q23A 5FJ4A 1K1SA 1O5JA 2EC2A 4MKBA 3ZNUA 4GC7A 4WJBA 4M94A 2ZUGA 1LEOA 3M2UA 1S99A 5C2CA 1HNZJ 2QJ3A 1QUVA 4OL8A 2DNHA 3D0HE 4JI5J 3TVZA 3DN9A 4CLLA 1BHNA 3UCZP 2BJDA 1ROFA 1BE4A 5ETPA 2ERRA 5D15A 1VC6A 4TNOA 3IAS9 3BO4A 2CKWA 3M6VA 5ETRA 1P1LA 1SJ3P 4FZVA 3A13A 2FZCB 3BBBA 2UUBF 1GEHA 4CLSA 1R8HA 2JC1A 2U1AA 2PDAA 3GFYA 1SCJB 4NEYA 4OI6A 1FRXA 2D1CA 2B9YA 3H98A 3HVAA 2BJEA 4P73A 2VG6A 1RP5A 5AXMA 4X64F 2VQEF 2J9DA 4MIWA 3DLLQ 4ZN3A 1OQ3A 3R9LA 2BV3A 2GW8A 4PXBA 4H4KC 3EMTA 2OPRB 3VAHA 2L9NA 4G1IA 2X3DA 4IG0A 3OJUA 3GYGA 2M2BA 3CUNA 1UVNA 3MI7X 3W5ZA 2H3EB 4DV3J 1RU2A 3T1YF 4EBDA 2ALYB 3ZO7A 3WDOA 1IBLF 3BYRA 4B3OA 1NLKL 5DM7Q 4LSLA 2K2PA 2ZJQQ 2AYGA 2RAQA 1AT1B 3OJSA 1JLFA 3GMGA 4DXLA 3LPEA 3KLHA 1G1XA 1N52B 1LK7A 2RMLA 3ZTRA 2DHSA 1QAIA 4I6YA 1K9MT 3MEEA 5A8KB 5KFMA 5B0AA 1IN0A 1C0UA 1X4AA 4RBTA 4RJVA 3ITHB 4V19X 2JNJA 3IP0A 5EWGA 4HLBA 1UEVA 2CPIA 2WCXA 2C2ZB 1D9AA 4IR1A 4NOHA 4F4ZA 1GMVA 2B4OA 1MNEA 3AAWB 1VC5A 2VFRA 1Y5NB 3R2DJ 5MAOA 1EKRA 5LMNJ 3ET6A 2UVUA 4NLRA 3NBPA 4C8YA 2E5IA 5GVQA 3UDLA 4IFYB 3D6TB 3I56S 4RZRA 1ZM3A 1KVIA 4JI3F 4WFAQ 2YWGA 4ECWA 5J2PA 2CUYA 3OFFA 3OFGA 3NGUA 3MEDA 4GVBA 2FVSA 2DO0A 1T3OA 3DLJA 4DL6A 4W98A 1B0PA 4PQAA 4A46A 4U8YA 1U26A
chains in the Genus database with same CATH topology
3SDEB 5J1EB 3NRBA 2CQHA 1BC6A 4OI1A 1JLBA 2EFQA 3MM6A 3OVSA 3MOJB 3FSYA 2FJBB 3MGJA 2J5AA 2M8DB 1RTHA 5AJ3F 3TRGA 4JV0A 2O66A 1S6UA 1Y9OA 2J76E 2ZHOA 1RA6A 2DHAA 3QGHA 2LEBA 3PXGa 2WONB 4EO8A 2AF6A 4C11B 5FIIA 1SJ1A 2YNIB 3DI6B 3MPYA 1VQPS 3DU6A 4NX9A 1QSSA 3LOUA 5FLXY 3GWCA 3KHLA 2HHSA 4B9LA 4LIWA 1RTIA 3I0SB 3KLGB 2J6TA 2CG4A 1KVJA 3RBEA 2DNRA 2FC8A 4O44A 1VBXA 3RAXA 2E5JA 2G13A 4KQZA 2RU3A 1FA0A 4KC5A 3C6UB 1OIAA 4C8LA 1Q4RA 3L95X 3T9ZA 4HI1A 2HHPA 3U1MA 5DQGA 1T95A 3MR5A 2IM1A 5CYJA 5DS7A 1H98A 5JUMA 3RR7A 1X4FA 2W9BA 3PM9A 1Y5IB 4OX9F 4UY85 1S0NA 2JL9A 2Y0SD 4KBIA 5JVGQ 1WELA 2J7KA 2KI2A 1C1BB 2MKKA 3M8RA 4Y3CA 2BZ2A 2MZTA 3KKFA 1DQ8A 4PQUA 6FD1A 2CQ0A 4ZPBA 5HMWA 3CCQS 4F3OA 1S1TB 3IRXA 4WE1B 1RQ0A 1FEEA 3QAUA 2FLNA 2DCUB 2J7UA 3TA2A 3UR0A 4QIEA 4WU2A 4AFFA 3G71S 1AW0A 2N4CA 1JNRB 2KVIA 2CJQA 1U45A 4RNFA 4A47A 4D3GA 4C3MA 3I87A 4ELVA 4LFCF 1SV5B 1B0TA 1GNKA 2B6AB 3GZ7A 5K9FA 4RW6A 2BXJA 5HMYA 3UD3P 4WKYA 3HVRA 3FEZA 1U24A 1XR5A 2M3DA 3KFWX 4NLTA 7FDRA 4DDFA 1CLFA 3AA8A 4NL5A 4QIWD 4WFYA 3MTKA 1X5PA 1UFLA 3M2UB 1AFJA 2W8LA 4HEA9 1Q7LB 2JJ4D 3K5LA 2R8JA 2CJAA 3PFOA 4W92B 1S9FA 1U6FA 1LOUA 1S72S 4QJVA 2XI2A 3MMAA 4KJIA 2GO8A 1U1OA 4QOTA 1H3DA 3LP1B 3OLAA 4F02A 2D9PA 5HLFA 2RKIA 3IR5B 4CI0B 4ZCIA 3KJVB 2OTJS 5F8LA 3T19A 4Q43A 2UU9F 2RF2B 3B4MA 4E98A 3OL8A 4KHPF 2VBZA 4J9RA 4CH7A 4O3PA 4JI7F 3NP5A 2HHVA 1FDDA 1UWBB 2W25A 4TYBA 1BGXT 1N5SA 2LDYA 3PDNA 2R7SA 2YY3A 1IM4A 1HYSA 2J9CA 3DOMA 4HDGA 1V6HA 3VAFA 2DHGA 3QMQA 1JWWA 3SI8A 4OZ1A 4DV6F 2BOPA 2C3OA 2IJNA 3FCHA 4FXVA 4H4OB 2M52A 1KHVA 4URSA 1S9GA 3GB0A 3TW0A 3HKWA 3UFCX 4BC7A 2GMLA 3POTB 1RYRA 3D0IE 1SUQB 2W9CA 2OIHA 4RNOA 1ZM9A 1PO6A 1N4LA 4KFBA 1QSLA 1Q16B 3GIIA 1X0FA 1H0HB 1Z4UA 1U2RA 4F3QA 1U8SA 3OUYA 1HNXF 4O3RA 4R5PB 1JX4A 1TL1A 3DHXA 4QWEA 1F0XA 4RNNA 4I7FA 4LSNB 2DNNA 4X4QA 3MM8A 1I94F 5EHHA 4CTAB 4DF4A 4IOCQ 1M5SA 3O2IA 3IWNC 3AQPA 2BABA 3ENVA 1H6KX 1WG4A 3MWBA 5AE1A 1C0TB 3M8PA 3MUMP 3CDBA 3LP0A 1E6VA 3DOLA 2V9WA 1D1UA 1VJWA 5E3CA 2FHMA 1M5KC 4TU9A 4X65F 2ROPA 1JLAA 3SFUA 1Y00A 4X4SA 2IC3B 4Q44A 1N0UA 1FJCA 4MFBB 3OLBA 2PMZD 3BS9A 5DQHA 1FO1A 2FIUA 4WZQA 2MKJA 4OFZA 1UJ5A 2FLOA 3CDAA 2VG6B 4IR9A 4O3NA 2Z8QA 4PRFA 2EG1A 4J9SA 5T7LA 3KTQA 2E5GA 2GHPA 4PWUA 3GFXA 1VQOS 5F9NA 2VD3A 4ZCLA 2QMWA 1XMBA 1P8GA 3ZZTA 3UE2A 3MR6A 4LIRA 4C8ZA 2WB1D 1FRLA 1N0VC 3CD5A 4PG6A 4ED5A 1X8DA 4QPXA 2YX7A 2QO3A 1Y7PA 1Z1ZA 3BDPA 4XDCA 4RW4B 1G6BA 3R5DA 3RZAA 1VQ5S 3MOZA 2KJVA 2AGPA 3E2EA 2YWHA 1TL3B 5DLFA 2KHDA 3FMWA 4MK8A 3ZFVA 2UV8A 4LF9F 2ACYA 1FTCA 1QUPA 1JIHA 1RISA 3DRXA 3D1QA 4NXMF 2BRLA 2B5JB 3Q2SC 3VWSA 1URNA 2VKZG 2JC0A 4LF4F 5HBMA 1N5YB 3KG0A 3UDCA 2ZITA 4ID8A 2R7RA 4DQIA 4LF7F 1YJRA 1CQNA 5CCMA 4K4ZA 2NLWA 3QWPA 4EGLA 3K5NA 1LWEA 1BD6A 4ALZA 1SB6A 4Y2KA 4LSLB 4IRKA 1YGYA 2E1MC 1LWFB 1WACA 1NK7A 1G3OA 3E8OA 2FGCA 3V2UC 2NREA 3SCKE 3P6YC 5AXKA 2N7YA 3FVYA 2OPPA 2ASJA 1YIJS 3OTOF 5E0OA 2C3YA 3IS9A 2B7BB 2HIQA 3MM9A 3CPWR 1J5EF 4N5SA 1D0EA 2ZFHA 4DF8A 5IQ6A 3KLHB 4OJ3A 2ZM6F 5EGYA 2PT0A 3F44A 2ZHAA 5L1JA 3KLFB 4CNYA 2GO9A 3PV8A 2FVQA 4K4SA 1GT8A 4ZVEA 2FJVA 1CSJA 1OSDA 5JXSA 5KFIA 1JLEB 1WG5A 3MF5A 4X4RA 1I6JA 3M9MB 3OL9A 3HHLD 4AXJA 4HT5A 2AV5A 1X5TA 3DM2A 5F41A 1C0UB 3JTPA 4JI8F 3EZ5A 2NR0A 5KFQA 1DTTA 2ILZA 2XZWA 4QYRA 4YEAA 3VCDA 4MH8A 3DLHA 2OPQB 4XIUA 1WHXA 1S6OA 4YDDB 3FQKA 2OMOA 3KNAA 4QR0A 1UJ4A 4DS5A 3MXHP 4ZPDA 1EP4A 2AWZA 2K7KA 2X1GA 4IRCA 2W4DA 1WNEA 3CCMS 3IG1B 1NRKA 4C8MA 3VQTA 3VAJA 5B0EA 2VPWB 5K14A 4EBEA 4B3MF 5F8JA 2BACA 4DFJA 1YHQS 2HQ3A 2CDQA 4A8QA 2KYZA 4Y2CA 3CC2S 1NK5A 1S1UB 3EGNA 1S0VA 2W24A 3JAMY 5GAEI 5G0RB 1HBNA 3HM9A 1TFWA 1DTQB 2CQ1A 4I2QA 2ALZA 1DURA 1SH2A 3RAMA 4LF8F 4WFZA 5GAGU 2RDJA 4NYOA 2IBOA 2K7JA 3V4MA 5HO4A 2BYCA 2VBYA 5F3TA 3IFEA 1JXLA 2CPFA 3NBPB 4DR2F 5A8WA 1KR4A 2HQIA 3SCIE 1GX5A 2V4JA 1QVFR 5CQGA 2O3DA 4QZVB 4ECZA 4I68A 2ADBA 2SXLA 2D41A 4ZPCA 4RW9A 4NA3A 2O1PA 1GX6A 5D3GA 1RWUA 5J2PB 4OI3A 2RILA 4PPDA 3RYLA 2F3JA 4NA1A 4Y0FA 2P5VA 5DQIA 3MEDB 1FDAA 4FBUA 2MQPA 4LF6F 2JFDA 1FRJA 4J9MA 3PIPQ 1R8CA 4K50A 3PRDA 2DNKA 5B08A 2EWHA 1NH8A 2HFNA 2PA8D 1REVB 5LSLA 2XCAA 2ZKUA 4A48A 3M30A 3SSRA 2Q6BA 3L7OA 2NSBA 4IH5A 1HQUB 1DLOB 3N0VA 2HNZA 3G8SA 2QLXA 2AYMA 3MM6B 1SXLA 3C3LA 3H5SA 2QE5A 3D2WA 4DSJA 2HVIA 5LSRA 1RTHB 1CVJA 1TKXA 3N5BA 2YNGA 4X4PA 2OPSB 1UETA 3Q8SB 1S1VB 1L3KA 1OPIA 1X4GA 2HZCA 2N7CA 1T05A 5KG4A 2AJ1A 2GQ2A 1MSWD 2V8GA 4I1TA 2LECA 3NL0A 2BRKA 5B0CA 2R2TA 4O4GA 1HA1A 4Q5VA 4OI0A 3IO1A 3CCLS 1X4CA 4KRWA 2X51A 4KE5A 4WKRA 1KSPA 4O44B 3QWUA 1S10A 3SCLE 3UCUP 3SV4A 2BBEA 3O1LA 2XEXA 4FVCA 4CZCA 2I8EA 3BEGB 4DR5F 4ECUA 4ICLB 5GAHI 5FDLB 3PHEA 2DGQA 2GHVC 5CCLA 4UW2A 3EPIA 4EZ9A 5L9NA 1HW8A 2KO1A 3B8HA 3DLEB 4A8OA 3U1LA 2J7WA 1M5HA 3TAMA 3PIOQ 4ELUA 5C24A 2ZZMA 4G6VB 4MMOA 4NLPA 3HHLC 3IBWA 2PA3A 3CJKA 3BSNA 2IAJA 3S6EA 4PQUB 4NLOA 5AXLA 2F9JA 4B9TA 2UV8G 1RI7A 3IRXB 1DARA 2B0GA 2B4UA 4MK9A 4K4UA 4BWMA 1F5AA 1YJUA 3UD4P 3GILA 4NCGA 5J2QB 3K5MA 1UJ6A 3FEXB 4ZP9A 4EEYA 3JSBA 5F8IA 2CVEA 5CD4H 2V4QA 1HNVA 1UEUA 3S7RA 5AE3A 4I67A 1FXDA 5E3QA 2PMHA 2YKQA 1N6QA 4RW6B 1HD1A 1FCAA 2DD8S 3JTNA 2EKYA 2VFTA 3M2VA 2XGQA 3MM5B 1YJVA 3GV7B 1HNZF 1K0TA 1O0PA 3DOKB 3LH2S 3W7BA 4F4KA 4WIIA 4DSIA 1HD0A 3SQGB 2OMLA 2KDOA 2KXHA 2A18A 1F2GA 4MAKA 3D5MA 3UI3A 5KFDA 5FD1A 2C2RA 2EPIA 2C42A 1XR7A 3N28A 3NNAA 3M2RB 3MEGA 3PEJA 2FY1A 3C8YA 4ED2A 1HHTP 2CQDA 1P6TA 3MMAB 3QYYA 1LFWA 1ZOTA 1K8AT 1YG0A 4USIA 5HQ8A 2VOOA 3N4WA 2BUNA 3QAEA 3NNCA 3CJ4A 2VFVA 1TKTA 5DDOC 2HHUA 3ZZPA 1BQNA 4C7QA 2QYCA 2L08A 1JK9B 1IKWA 1BY9A 1RAJA 3O3LA 4CT8A 3C6TB 3HHLA 2HRYA 4ZLPA 5HP1A 2FTRA 3MMJA 1HYSB 3GR1A 2IYIA 2MGZA 1TK0A 3KK1A 1JLGA 3JYTA 2E7XA 3DRYA 4B02A 3HHEA 5EX3A 1VFJA 1Y3JA 2QIFA 1FE4A 2WSEC 2LYVA 2BANB 3I32A 2M70A 1VRUA 2FVCA 4IFVB 2P9EA 1XWLA 2A2CA 3FMBA 2W9CB 4F2SA 4DG1B 2V5HG 4ED3A 4KFBB 3AJ2A 2KYXA 3LALA 3D28A 1SJFA 5LJ3Y 4FVMA 3KMQA 1FT8A 1JLQB 3D0GE 3HF5A 3OUYB 3TI0A 4DOZA 2Y1IA 1FD2A 1TL1B 3CSKA 3I5BA 3EYZA 1BWEA 1OQ6A 2DNOA 2B4PA 1R8PA 3I55S 3MM8B 4FPRA 2LEAA 1RT4A 4DBQA 4ECRA 3U27A 4ED0A 1ZAVA 1ZAXA 4TLQA 4B9UA 2WSCC 1U09A 1N8RT 2AGOA 4C8OA 4G3IA 3CO9A 2XWYA 4PXCA 3KG4A 3H25A 3LP0B 2E5HA 5KFJA 2ZH4A 1E6VB 3DOLB 2HNDA 2JVRA 4RWWA 4CT9A 3S01A 1JLAB 2LA4A 3CTRA 4PXEA 3TA1A 4ECXA 1H7WA 1B0VA 1R43A 1U1KA 2ZH6A 7FD1A 1NKBA 5KFNA 3I0RB 3MMCB 2PN6A 3OR2A 4OHXA 4IOBA 3N6LA 3LPYA 3AB2B 1DZ5A 4H4MA 2F9DA 3LF0A 3M8QA 4ETZA 2MKHA 2PD1A 2RQ4A 2QA4S 1S6QA 4NXNF 3RTVA 3N01A 3VF0B 2LU2A 4NYPA 4TXSA 1FK9A 4FF3A 1YJTA 3WZ0A 4JI6F 2OFGX 3QPIA 2HS3A 2NS1B 2KM8B 1TKZA 1HL6A 4C97A 1JNZB 1VLYA 2YKNA 4ZKAA 1YTYA 4RLEA 1UA1A 2I2YA 2AJFE 4F2RA 6FDRA 2VFSA 2BVZA 2QT7A 2E9RX 1N5QA 3PX6A 2R2SA 3ENWA 5KOXA 3J7ZT 1DJ0A 1IBKF 1S79A 4PUOA 1NU4A 5KG7A 1NK9A 2DR9A 2PC6A 3TUIC 2O01C 3PW0A 1RT6A 5DO2A 4K59A 3EX7B 3KK3A 1VQKS 5DG8A 2R7TA 2R7XA 2UUTA 3CD0A 5J2NA 2KFYA 3GG0A 2KXNB 3V81A 1F9FA 1YQHA 1RT5A 2MZSA 3TANA 3BQ2A 2R8HA 5HBMB 2G0CA 2FLLA 2RRNA 1HWLA 4YB7A 5IT4A 1T94A 2HGMA 2BE2A 3CIMA 4FYDA 2HS4A 3ZZOA 2ILYA 2EK1A 2ZE2A 1OO0B 2LLZA 3E51A<