1UMHA

Structural basis of sugar-recognizing ubiquitin ligase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
184
structure length
184
Chain Sequence
GSHFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of sugar-recognizing ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords F-box only protein 2
total genus 38
structure length 184
sequence length 184
ec nomenclature ec 6.3.2.19: Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45.
pdb deposition date 2003-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1umhA00
2VC9A 3DECA 3LE0A 3T2OA 2BGPA 3THDA 1XNTA 2WBKA 2QQJA 4CUAA 3I3DA 5EJZB 4QDSA 2W92A 2JKXA 1OH4A 4E8CA 3MO4A 4YPJA 5JXJA 3EB7A 3WNPA 1UXXX 4HG6B 2VTFA 1GUIA 1NAEA 3AC0A 4BDVB 2QQKA 4E8DA 4M4PA 4D0QA 5EIYB 2VCAA 3WNKA 2Y6HA 1JHJA 3MBWA 2DCJA 3WNLA 1UYYA 3WNMA 2X09A 3LEIA 3C7EA 3I97A 1J84A 2WQ8A 2YG0A 5F7UA 3LEGA 1UY3A 1P8JA 2J1UA 2YC2A 3NRUA 3ZM8A 4KMQA 1JI6A 4XURA 4UOJA 4W8JA 1TVGA 2Y64A 3GGLA 3OGSA 1KEXA 2J1EA 3D3AA 1PMHX 5J1XA 1JU3A 1ULOA 1W8OA 2VJXA 2VQTA 3DYPA 4XUTA 5LA1A 1RYYA 4QPWA 4DEQA 3ECQA 4AG4A 4OZOA 3WQBA 3EYPA 2W1QA 3HOBA 4ET7A 2DCKA 5JXIA 3HNMA 1F4HA 3LPFA 2E31A 2Y6KA 3FN9A 1JYNA 4D8MA 3A23A 4OYUA 1GQPA 4GZ9A 2VZUA 4TXWA 2JE8A 2W9XA 3IDAA 3C7OA 4RYDA 1UYXA 2RV9A 1MPXA 4QB2A 1SDDB 2YFZA 4UI9L 4A42A 1US2A 1YQ2A 4LHSA 4MGQA 2J1SA 1CIYA 2W94A 2RJ2A 1UMIA 2BGOA 3I2IA 3T0DA 5IFTA 1GOGA 2WYSA 3LEKA 3FHAA 4PT6A 3JXSA 3W5MA 3PUIA 2WAOA 2VO5A 3T0AA 4ARYA 1PX3A 3BN6A 3I3EA 3CKHA 2WN3A 3BGAA 3T0BA 3SEPA 1O8PA 3LPGA 4JKMA 1CX1A 2VCCA 2QQIA 2B9VA 4RN5A 3U37A 2YC4A 1DP0A 2Z4FA 2J1TA 3E1F1 2Y6LA 1UY2A 3MUZ1 2X05A 5B4XA 1H6XA 3UESA 2VM9A 2JD9A 3T2PA 3OB8A 3T08A 4CUBA 3I2FA 2VZRA 3NNGA 4JKLA 3OG2A 3I2GA 1L7RA 1LNSA 1WCQA 2BERA 1JZ6A 5IJRA 3NQHA 2ZEYA 1NKGA 2VZ3A 1O8SA 1UWWA 2XQXA 2W1UA 2ID4A 1UY1A 2QQLA 5CZKA 4OMDA 5JMOA 1JZ2A 2VR4A 5HXMA 4BK5A 2WN2A 5C7GA 2WUHA 2ORXA 2ZXQA 4GWJA 3C8XA 2W87A 4P5YA 3GXUA 3I3BA 4LPLA 3IIIA 2KD7A 1J83A 1CZSA 4LQRA 1K42A 4GWIA 2WZ8A 3K4DA 4XZUG 2XHNA 5LA2A 4A4AA 2E26A 3CDZB 2J7MA 5DQ0A 3HJRA 2CDPA 2B4KA 1JYVA 3FL7A 3ACIA 2Y6GA 2VZQA 2VMCA 4JKKA 1HN1A 2J22A 3I2KA 1UZ0A 1W0NA 1WKYA 1JZ3A 1W9WA 1UY0A 1CZTA 5DN2A 2QBXA 2E33A 1XC6A 2WO2A 1SHWB 2VZPA 3K4ZA 4P00B 4QX1A 3K4AA 1XPWA 2W1WA 4QX0A 3WF2A 4P02B 1DYOA 4KWUA 1K12A 4CU7A 3WNNA 3VD5A 3VD7A 2ZEXA 4JHZA 4DUXA 3ACFA 2QQMA 4A44A 4ZXEA 2CDOA 2W91A 4CU6A 1UXZA 5JXHA 2QQNA 1GMMA 1GNYA 1I5PA 2WABA 1W8NA 3WSOA 1W99A 1NUKA 1O59A 2VMDA 2VMFA 3NJVA 3OGRA 2WO3A 2VZVA 3VDBA 2XONA 3HN3A 2BZDA 3THCA 2C4XA 2ZEWA 1H6YA 3NJXA 1K45A 5A1AA 1OF3A 2V4VA 3P1IA 4CUCA 2YFUA 1IQDC 2W3JA 4XVHA 1F4AA 2JDAA 2VZ1A 2OKXA 4IUGA 2Y8KA 2W46A 2J1AA 2EIEA 1BHGA 2C9KA 2V72A 5C70A 2C26A 3T09A 3CIHA 3A7QA 1UYZA 3GDBA 2LS6A 3MUY1 2EICA 1JZ5A 3K75B 4CU8A 2YB7A 4QX3A 4FI9A 3WF1A 5JXGA 3CQOA 3ABZA 3WF0A 2RVAA 4PF1A 1EUTA 3W5NA 1GOHA 3CMGA 3OEBA 1W9TA 3VDAA 2W95A 2V5DA 2EIBA 4A41A 3SKVA 3HNBM 3HPNA 2HYXA 4XUNA 3ACHA 1SG3A 1NX9A 3MV11 4KI5M 4MO3M 4ZZ8A 3CZUA 3OBAA 5EJ1B 4LKSA 5JUVA 1UY4A 3FHQA 3LQCA 4DUWA 5CYYA 4ZY9A 3C7GA 4Z2AA 4QDQA 2J1VA 2ZEZA 2XOMA 4A45A 5HPOA 2WDBA 2VQUA 4DEVA 3I2JA 1R64A 2EIDA 3T2QA 5JR2A 1EUUA 2J1RA 3K46A 1GOFA 5FUIA 3C7FA 3C7HA 3A22A 1K3IA 4DXRA 2PQSA 4CU9A 2ORZA 1JZ8A 3IB3A 4UAPA 4OMCA 2VZOA 2W1SA 4W4ZA 3UNPA 4QDRA 1JYWA 1PMJX 5IHRA 5G05L 2BBAA 2L9LA 2R7EB 2X10A 4MADA 1OT5A 3J7HA 2W47A 4BXSV 5B4NA 1UX7A 4MGSA 5IFPA 2W5FA 3SKJE 3CZJA 2Y6JA 3F2ZA 4MOAA 3OEAA 4AAXA 1L7QA 2VZSA 4XUQA 5DPNA 4M4RA 3ACGA 5G04L 5I0DA 4DUVA 1JZ4A 3A21A 4QB6A 4XUOA 1W9SA 1CZVA 1ULPA 4W50A 4P08A 3WNOA 3VD9A 1TG7A 1JYXA 2HLEA 3P6BA 3SEEA 3MV01 3WEZA 2WO1A 2DDUA 3IAQA 1T2XA 1PX4A 2WZEA 3GM8A 3VDCA 4QB1A 4JX0A 4QAWA 4OUEA 4A3ZA 1GU3A 1KGYA 3DYOA 5C71A 3IAPA 4DXTA 4BK4A 1JU4A 4QX2A 5DMYA 4CVUA 2VZTA 3HEIA 1XNAA 4TTGA 4L0PA 2LW8A 5LCWL 1JZ7A 4ARXA 5LA0A 3VD4A 4DXSA 3I2HA 1OD3A 3ETPA 1UMHA 3K77A 3HNYM 2VMEA 1US3A 5IYYA 4XUPA 2E32A 2VCBA 3VD3A 4BJ0A 2WAAA 3UETA 4PQQA 2VL4A 3PUHA 1OF4A 1DLCA 2VOTA 3OGVA 2QQOA 3WF4A 3DYMA 4ZZ5A 1D7PM 3WF3A 4A6OA
chains in the Genus database with same CATH superfamily
2DF7A 2X05A 1OUXA 2AYHA 3LE0A 5IK4A 5C3RA 5C8CC 3LOIA 1JUHA 1W6MB 2Q30A 2BFUL 4AEDA 5KXCA 1DIWA 2VTXA 3I3DA 3U0ZA 5GLZA 1IKPA 1OH4A 3FX3A 3MPBA 1AXYA 3H50A 4NHLA 4KNCA 5F5IA 4YPJA 1UXXX 3ZFFA 1NAEA 2CWMA 4EN8B 5JSRA 4QHOA 1QMJA 1L3JA 4E8DA 3AYEA 1NQJA 3KT1A 5A1LA 2D5HA 5ACA2 3RVHA 2HWC1 1LAJA 5FPUA 1RUH1 5A70A 5FY4A 4CCKA 4OHVA 3WNLA 1X33A 3HBKA 1Q56A 3MW2A 4Y4YA 1K5MB 2YMZA 3I2DA 2X09A 4NOTA 3KMHA 1MZFA 1NCRA 1XNKA 3I97A 3HWJA 4FOQA 3ZR5A 4LIUA 3AKPA 2B45X 4OHYA 2GP3A 2H6BA 1UY3A 4IDZA 2J1UA 5GZDA 3ZM8A 1VBB2 4IE4A 4KMQA 4UOJA 2BGCA 3KGZA 3ZMNA 2XDVA 2WNOA 4X8NA 3RFRA 1O4ZA 1PHMA 5FKCA 1KEXA 2XBO2 3FFQA 3IIAA 1GZWB 3AMNA 3T4VA 1DGWA 1U0AA 4K8RB 1H2MA 2BQPA 2A3WA 2ARCA 3JQXA 5F2SA 3WXPA 1RYYA 1LHUA 2WL1A 4QPWA 1AR91 4NWVA 1RTVA 5BNNB 4HPKA 4DEQA 4COVA 3B93A 2CNAA 2BOJA 1DLLA 3E5QA 5K9YA 2GALA 5LBCA 3HOBA 4ET7A 1F2NA 4B1LA 3LPFA 3AP5A 2HKXA 2ZMLA 4JDNA 4KU7A 4MGZE 4XPVA 3VBUC 4AI1A 3D0SA 3HN1A 1H9WA 4CPBD 1AYM1 4UFHA 2XXZA 1AF9A 1HV1A 3ZO0B 4FVVA 4CUGA 2BBVA 1W6QA 4D8MA 1C5HA 1RUF3 1YQ6A 4OYUA 1BMV2 2FDKA 1GQPA 4QWNA 4AOCA 2YROA 4GZ9A 4YZ1A 3N35A 2VZUA 2ARXA 2ZGNA 1UU4A 3DPRB 4P9XA 1VJ2A 4EJRA 1MPXA 2RDRA 4XFIA 1YXWA 1YJKA 1AL0G 1UN1A 4META 4QHBA 2YFZA 3NV4A 4Q1PA 4HKWA 4A42A 3BI3A 3ILNA 2ZX1A 1RHI3 1US2A 4Y22B 4MGTA 4FFGA 4ZU4A 1U5ZA 4WVZA 1T6BX 4YZ2A 4HN1A 1DYPA 4Y5TA 2GNTA 3WINE 3ZN6A 4I02A 2GU9A 4K40A 4FTSA 1TNFA 3FHAA 4PT6A 5EXOA 3SCFA 2VGDA 1GZWA 4IEOA 3UKTA 4A3XA 1H4HA 5C3SA 3MFAA 5FJKA 3PUIA 3ZYBA 1HIXA 5BNPA 4ARYA 5DUWA 3BIEA 3T1LA 5FZFA 2VW2A 1BEV3 2WNVA 2N7GA 2WQZC 1EAH2 2XJSA 3CKHA 4MGYE 4G9SB 3N3HA 5J3UA 4PDWA 3WD5A 4LBNA 4Q8LA 3T0BA 3SEPA 3AVSA 4D6RA 1OA3A 4PBPA 4JKMA 4Q4W3 2VNVA 1GICA 3OBRA 2XJRA 4IE0A 4L99A 1SCSA 2QQIA 3KQ4B 4RN5A 2ZA9A 4QXHA 1ND3B 1DFQA 1OOPC 3QD6A 4NIIA 3ZYJB 1B35B 1NY71 1RMU1 3PJYA 4CEWC 1LHNA 4E4ZA 2IXIA 4UFKA 4YZ5A 3SMHA 2O0OA 1QJX2 2IXHA 5FWEA 4KWKA 1C8M1 2O8QA 3OYWA 1AYN1 3CEWA 2RJKA 1RUC1 2A6ZA 4QU1A 3VZJA 3T2PA 4H2AA 1O3QA 3J4UH 5E6HA 4AQTA 2QQUA 3VBRC 5T5OA 2JDZA 4IV1A 1HQNA 4DIQA 3JD72 1DQ2A 1L7RA 3MICA 1PMIA 1V9U2 1RUJ3 3PMEA 5FCCA 1WA4A 1W28A 1E5RA 1ZZ6A 4IE5A 2OA2A 2ZMKA 3VL9A 5CZKA 5GLVA 4H7LA 4Y5SA 5JMOA 1JZ2A 5EFUA 3H7YA 2G19A 4Q2FA 5BUVA 1EV11 5H9PA 1N1TA 3CJXA 4PBOA 1BLZA 1FT9A 5A3LA 1VB2A 3SH5A 2R1DA 5F5CA 3UYJA 1PVC1 3PVOA 2BVBA 3MGUA 1C8M2 4CP9A 1GZCA 5E89A 1UZYA 3MIBA 4FP3A 4XABA 1V6KA 5CKQA 5FZ8A 1G6NA 1NE6A 2KD7A 2VG9A 3IIIA 1MS5A 1YUDA 3Q8CA 5FPBA 1RUI2 1EV12 2JXAA 2PA7A 3HD8B 5FP9A 4URAA 2XHNA 4PJYA 5LA2A 1FV3A 3M2MA 3POSA 1LOCA 4A4AA 4GD4A 2E26A 2BJSA 1KJRA 1CWPA 4XC9A 1N3QA 3ZPOA 4XCAA 3H3ZA 4LBKA 4WM8A 1H0BA 3FL7A 3ACIA 3ENRA 4CP9B 2WC2A 3T3YA 1V9U1 1QNWA 2VMCA 4I0BA 4FT8A 4BQXA 2C24A 1LHVA 4N43A 4YGBA 1J58A 3M70A 2P17A 3I2KA 1UZ0A 1JZ3A 2ZS6B 5GZCA 2P34A 5FXZA 2BEOA 3RSJA 3AXEA 2RMU2 1EPWA 4Z07A 4KL1A 5DN2A 3WG4A 4XXPA 3ZR6A 5LBFA 5J7MA 1ZRCA 3WDXA 1RJ8A 2D40A 1C28A 1SFYA 5F1RA 4MG2A 1NXMA 4RSUA 1GWMA 4XMIA 3CL1A 1RUG1 4CDWC 4CXXA 1ULFA 2AREA 3PVEA 2A7AA 1QY4A 3HIFA 1AHSA 1GQGA 3AZWA 3GYDA 3H9AA 4QX5A 5KHHA 2NPIA 2IXKA 3TEWA 2WT1A 1D4M1 5FZGA 5K0UA 4GAZA 5FYZA 1H4GA 4QX0A 4E9KA 2ZOEB 3RJRA 5L7OA 5KHJA 4P02B 5BNNA 1AXZA 2FDIA 3LF7A 2YPDA 5A7WA 1CD3G 1K12A 4Y26A 4LNVA 4LHKA 2Q1FA 2BNMA 4JTNA 2A6YA 3THPA 4YSFA 2EF6A 5EV7A 1RUD3 5A3OA 2OUJA 2QQMA 3JB8A 3SCGA 1GZTA 5FPLA 1V6MA 1W6NB 1X8MA 2WNUA 1B35A 1OVPA 3LA2A 4HT1T 5JXHA 1GMMA 4UBHA 3J9SA 5EP9A 5CEHA 2JENA 1ND2A 2O14A 1YFWA 4FPEA 5T5JA 2Y34A 5FYUA 2WNVB 5CKMA 4NHYA 4B4PA 4YW4A 2RR12 5DDJ2 1X50A 5DAWA 1ZRIA 1AR82 2RS12 3ZKYA 3U11A 2VMDA 1FOD2 1SLAA 3WZ1A 3OGRA 1F8VA 2FDGA 4CCOA 1OVSA 2WO3A 3NAPA 1WMEA 2ZCWA 3PMSA 3MLJA 4XJWA 3H1WA 3CO2A 4GB31 1Y9MA 4QPGA 4Y3OA 2WS93 5FP4A 1ZVFA 2XUMA 1O7FA 1S4CA 4XBQA 1OXCA 3ZN6B 5A6XA 1UKRA 3EHKA 5A1AA 2HWC2 4CUCA 4OVEA 4E4HA 3E6DA 4FPOB 2I07B 4J1XA 3AMPA 3BALA 5DUXA 4DINB 4D6QA 2WO7A 4XVHA 1FPN1 1GP4A 1F4AA 2GMEA 4COYA 2Y8KA 1C4RA 1X7NA 2J1AA 1MZ5A 1W05A 4YW7A 4M3CA 2C26A 5CFCC 4XQDA 3BU0A 4YM0A 1GYKA 1LB2A 1RUI1 3MUY1 4QPGB 1YQ8A 2PLV2 3DEMA 3K75B 1MS8A 1O6UA 4XE9A 4K1ZA 1Q43A 1HB1A 4LBOA 4Q4X2 4XIKA 2Q8EA 3TRSB 4QX3A 4FI9A 4HN0A 4BA6A 3WF1A 1ZRRA 2YDEA 2DBIA 2PXJA 1LESA 4LR4A 3W5NA 4N53A 4V1PA 1GOHA 3BKZA 3W20A 2JJ6A 4NROA 3ZDSA 4AW7A 4CPBA 2AR6A 5C4WC 4MUVA 4E4DX 3LFIA 4OZXA 2OVUA 2HEVF 2QQPA 1GR3A 1RHI1 1MZEA 1R092 3GJAA 4SBVA 5F5QA 3DN7A 3AP4A 2E7QA 1NX9A 2CYFA 1LR5A 4Z92B 4I0WB 1UMZA 4COWA 3MV11 3UKNA 4ZZ8A 4XTPA 1QJU2 3CJIA 1WA6X 4K7JA 2ARAA 4LK7A 3UKVA 2XKOA 4QM9A 3FHQA 5FO9B 2Q8DA 1UU6A 3G6JB 2EVXA 3W9AA 1PZ8A 1G86A 5E1RA 3C7GA 1MS3A 3S0MA 3MIHA 4FQZA 1HN0A 1POV3 4CE8A 5ABJA 4N7IA 5FREA 1IG3A 2XOMA 2ZEZA 1CAVA 2ZGLA 4XQ4A 5FIXA 3RWNA 5B4NA 2FDFA 4HK9A 4CRQA 4HMZA 4L9BA 2VQUA 1UOGA 2EIDA 1Z7S3 3MLKA 4ZS2A 3U78A 3WCSA 5JR2A 1VP6A 1YO8A 1FATA 2BYVE 4GIQA 4NPLA 2CSGA 1N1SA 1GOFA 1J3PA 4LLFA 2NMOA 2VVFA 3FJSA 2NZ9A 5FP7A 4OQ8A 2PQSA 1XE7A 1IKQA 1SDWA 4CTEA 4Y1UA 4XF0A 2ORZA 1APNA 1L7LA 1D0HA 5IK8A 2VZOA 4W4ZA 4FPYA 4RR3A 5FYIA 3TEXA 1JYWA 2HWB2 4YG3A 4FXGB 2WKKA 1CQ9A 1KDKA 5G05L 5IHRA 4BLIA 5IK5A 1QH7A 2BV4A 4K9SA 2R30A 1OBNA 1W6NA 1W8TA 4BXSV 1NLRA 4C1WA 1GP6A 5AC93 5CU1A 4JDOA 2GSYA 1W6OA 3WNXA 1CR7A 3VBSB 3AMHA 5FZIA 2ZAHA 4IEYA 1HV0A 4LO4B 5F6LB 2OQ6A 3KV4A 1N47A 3DKWA 4HSLA 5IW0A 4NAMA 2JB8A 1MQTB 2VOKA 3VHOA 1VRH2 2ZPXA 1XJAA 3WQ0A 1XU2A 3H8OA 2BNNA 1JZ4A 3OBZA 3A21A 1OMIA 4QB6A 4UW3A 1AL22 1S2EA 3FUQA 3OJBA 3KF3A 4IE6A 4XEZA 3SQOA 3K48A 4UFMA 5FUNA 3LEMA 2P3IA 4W65A 4W50A 3TNPB 4PLNA 4KU8A 3WNOA 5IVCA 2UU8A 1ULGA 2NLRA 1UCXA 2ZHKA 2DVFA 2ADDA 1ENQA 3WDUA 5EWSA 4AL9A 1CN1A 4E4SA 5A3PA 3ASIA 2Q8CA 3ZSEA 2XBO3 4XDQA 2QZ2A 1G9CA 3SEEA 4WM7B 2GC1A 4YW2A 1O4TA 3NMBA 2WO1A 3LDKA 4HKOA 3VLBB 4CDUC 5KBFA 3IAQA 5A32B 1CAUA 2JE9A 5FZKA 3GM8A 3IDBB 3VDCA 1W0OA 4JX0A 4P5HA 5F3GA 4OUEA 4A3ZA 2VOXA 4BWOA 1GU3A 2VW0A 4KG0A 4TLFA 2GN3A 2WQ4A 2WWSA 2DUQA 5J48A 2JDUA 1SLCA 2R071 5F9TA 3CNAA 2AEYA 3OYWB 4NIAA 2Y0OA 5DMYA 3GBFA 2C9AA 2R063 1OLMA 3D82A 2R49A 1XNAA 1OC1A 2WLPA 1HRI3 5HI0A 1YFYA 5I8YA 1OFNA 5FYBA 1JZ7A 1VPHA 4RGAA 3GNEA 5F5AA 5DAQA 2CAVA 4CP2A 2JIGA 3ETPA 4JGZA 4JHTA 4XJUA 1C1FA 1RHI2 1S2BA 1DHKB 3R0RA 3JBG1 1RUF1 3JUUA 4EN9B 1BKZA 1R081 2E32A 3A0NA 4P9IA 3VD3A 4BJ0A 3J7NA 5FO8B 3BOWA 3O0VA 2HJIA 3VDDB 2VL4A 1D2QA 2CWSA 2PHLA 4OHWA 5D21A 4DNYA 2EXJA 4MHUA 3OGVA 3D5OA 1VBC2 2FBEA 3O0XA 4XF1A 4B7KA 4MXWB 3WF3A 2PLV1 3AVRA 1W6QB 2HH9A 3T2OA 2R041 4B3NA 4IV3A 4P9YA 1S0EA 2D5FA 2G4IA 4XF4A 3VBFC 3OGGA 4KGGA 3PIJA 4BM8A 5JOWA 1XNTA 1QQP2 2VUAA 4U36A 5CFDB 5CFDA 4CUAA 3CLPA 2DFBA 4XYXA 5IAVA 4XJZA 5CNAA 4YNIA 4E8CA 4L92A 5JXJA 2YV8A 4GH4C 5DG1A 3BOPA 3ZFEA 5I0UA 1GUIA 2IXJA 3L2HA 2CV6A 3B5LB 4PQ9A 3AC0A 1ZM1A 4XJ9A 2WZR3 5DAPA 2RS33 2XPJA 2FCUA 4HETA 3WNKA 3RZJA 1AL21 4JRLA 5A3UA 3CU7A 3VKLA 4AGRA 4QKBA 3J8F1 2JECA 1ZBA2 1O3SA 1MEC3 4EZ4A 4LXLA 3O1RA 1TE1B 2XWBB 4QPIA 1DZQA 3C7EA 5HV4A 4ATEA 1RUJ2 2K9ZA 4YVWA 2WQ8A 5F7UA 5IVFA 1D2SA 3FBMA 4IL7A 1CX4A 3NRUA 1I9RA 2P2KA 3VKNA 3WG2A 2Y60A 4W8JA 4UF0A 1TVGA 2Y64A 3IZOA 5FPVA 3J7MA 3VBOB 4CCMA 1COV3 3NNFA 1ASJ1 1U12A 4I09A 1REFA 3RZGA 1QEXA 1JU3A 2FCVA 2VJXA 3DYPA 4H7MA 5IVYA 1HDKA 1OHFA 1W04A 3KV9A 3ECQA 4N53B 5APAA 2R073 4AAPA 4XDOA 5HCHA 3H3LA 4CCDA 5A3TA 4O9EA 5C9AA 2QTWB 3LOBA 1NA1A 5DUUA 3VBFB 4LO5B 3AM2A 4HBNA 1W6MA 3WW4A 3FN9A 2ARBA 3LWCA 1NLQA 3RMYA 5IVBA 2AENA 3VN4A 3IMMA 2GN7A 4WM7A 1VMFA 3A23A 1EV13 1WLTA 1X9PA 3KV5A 3NNLA 5IT6A 5FXWA 2ZKNA 5CAZA 2OQ7A 3C7OA 2IWGB 1RL3A 3DKQA 1MQTC 1O5UA 4JQRA 1X9TA 1OD5A 1SDDB 1OA2A 2XVGA 3ORJA 2CU5A 4FPCA 4LHSA 3ZIXA 1LENA 2B42B 2UWCA 2FZ2A 4QT6A 4Y20B 3POIA 1W3VA 4IGQA 4LITA 1QU0A 1W2AX 4B4QA 1COV1 3JXSA 2CHHA 5T52A 2VO5A 5A6ZA 1UOBA 4GMP0 3RYKA 3SNMA 5FY5A 4QQOA 4KGQA 2G9ZA 4L2NA 5FMBA 5FMDA 5LRRA 3BGAA 2PMWB 5FYVA 2WRAA 3VDDC 1AX2A 1UKGA 1O8PA 3OF1A 3P3PA 2I2SA 4AQSA 2OZJA 3A0KA 1CX1A 1W8ZA 4ZU5A 2B9VA 1PO13 4DPNA 1QJY1 2GDFA 5FYCA 1F31A 2OPWA 2Z4FA 3LFMA 1BBT1 4CCEA 3E1F1 4F83A 5JMCA 4BLJA 5KWRA 1HB4A 1J3QA 5SV8A 1O4YA 5T5PA 4NUBA 1VBA1 3TAYA 1DU3D 4ES8A 2GMMA 5HCBA 1H6XA 1R1A3 4EZHA 1YCIA 1PVC2 5D1IA 4WZCA 5LB6A 5FY0A 4BPZA 2JD9A 4LBQB 2W39A 4YWAA 4CYDA 2VXJA 3OB8A 3MDPA 1PGL1 1AX0A 5FRAA 3O1PA 4FSJA 5FYTA 1UQXA 1B09A 3I2FA 4CUBA 2VVDA 4QXBA 5SV5A 1LNSA 5J98B 4NO4A 3BTXA 1AXKA 5A33B 5A33A 1W06A 4ATFA 4KH9A 4P9LA 1AR61 3FBYA 4Y1ZA 1J59A 2PAEA 2XVKA 5IJRA 4A7YA 2VZ3A 1V00A 1QJU1 2D97A 5FDBA 2XQXA 2HWD1 2RR13 1HQWA 1UY1A 2QQLA 4X8PA 1Q8QA 2FQPA 1FOD3 5BNOC 1DBNA 3KT4A 4LBQA 4HONA 2RM21 5FWJA 1Q8PA 2WN2A 4UT5A 4CP0A 5HXMA 3M3CA 5HBAA 4N43B 1JYTA 4GB32 3B9CA 1I3HA 5FMOS 1V6JA 2W08A 2FDJA 2ZXQA 2VVEA 4QPIB 1RVF1 4GWNA 1S55A 3P5BA 1K5MA 2ZGRA 3RI9A 2VECA 3H0OA 1RUJ1 2W87A 3URFA 5LEKA 1XE8A 4P5YA 1PK6A 2Z69A 3I3BA 2DCTA 1QJZA 4HKLA 1NZCA 3TN93 5FZBA 3FMGA 5FZEA 3IWZA 4S2GA 3RDIA 2IVJA 1VBE1 4UFJA 1NCQC 3V64A 2WZ8A 1AYM2 3K3OA 5D8AC 4BIOA 3J7LA 3O1TA 2QFEA 1H30A 3CDZB 2VNGA 1PGW2 4RS5C 3TYJA 2B46X 5DQ0A 1DGRN 1PO23 1EAH1 4E2QA 1DGRA 3W21A 5GZFA 2BWCA 1FXZA 2Y6GA 4LUMA 1OFSA 3RG0A 4XXAA 3BTZA 3RPQA 2YXSA 1QJY3 4IEXA 4IW3A 4XTMA 4XAAA 2Q8OA 4AFAA 1HN1A 1GBGA 2CL2A 3GZAA 3RRDA 2VBPA 4U2AA 1O91A 4O9GA 1S0CA 5GZGA 1ASJ2 1XYPA 5JZGA 3H7JA 1WKYA 1W0NA 1W9WA 3PUQA 1RUH3 1R093 4R9AA 1CZTA 2JG9C 1LOBA 4XFFA 1Q8OA 3ZX7A 1FPN3 2P6CA 4QKNA 2XWJB 5LBBA 5BNOB 5DXDA 4OI0A 2E33A 1SQ4A 1ZA7A 1ODNA 5JCTA 1SHWB 2YBSA 3K4ZA 3IPVB 4AQ6A 3I59A 2JB4A 3PLQA 3TEYA 2PHXA 2Z79A 3VKFC 3E97A 5LBEA 1WZXA 1HQLA 2RM22 4QX1A 4DO0A 4Y33A 4FPKA 3PIGA 2WFF1 2F4PA 2A3YA 1XPWA 1FV2A 4KQ7A 1ENRA 1PZ9A 4MZUA 3S7EA 2F17A 1VBD3 5IAXA 2ATFA 2ZGUA 2B5HA 3WNNA 4CU7A 4LA3A 1H8TA 2O8OA 2ZEXA 4DUXA 1J1TA 1Z7S2 1ZZCA 2G1MA 4LBMA 5I0TA 2WSUA 5FP3A 4AVCA 1QQP1 4ZXEA 3LIGA 1ST8A 3S57A 2P3KA 3AXDA 4AFDA 3AL6A 4CU6A 1JYCA 1ND3A 3ZFGB 3WG3A 1YIPA 1GNYA 1WMFA 1DG6A 2WYFA 4FXKB 3KT7A 1RGSA 2D6LX 1PIV3 3CJIB 4MHRA 4FPHA 4NRQA 4QGNA 5FZMA 4GQ7A 1DQ4A 1KQRA 3L2YA 2BRTA 2D6PA 2DVAA 1AR73 1NUKA 2ET1A 1MACA 2PYTA 2HWB3 3HQXA 4YYOA 2VMFA 3NJVA 2WFF3 1LRHA 4PLOA 2HEWF 2J42A 3R4SA 4BE3A 1RUE2 1SLBA 1Y3TA 2VZVA 3VDBA 2W68A 1JUIA 1LTEA 1R082 1W8HA 5FXVA 2ZGMA 4IETA 4LA2A 4MH0E 3NJXA 1SZBA 3IT8A 2EXHA 2ZHMA 4FPFA 1T6GC 1OF3A 2YY1A 3P1IA 1A8MA 3SHRA 3AKTA 3SH4A 5C8CB 4P14A 2BP6A 2QQWA 2VNRA 1WW4A 1WUVA 4GMP3 4KWLA 3POGA 1UF2C 4IUGA 1WCKA 4S2FA 5FPZA 5FY1A 4WV8A 2EIEA 1BHGA 5C70A 1NA1B 5A7QA 1SCRA 4CP1A 4IEUA 3O12A 2DU0A 1TME2 1WBLA 4M3CE 3VBSA 1RXFA 4PIXA 3THTA 2ZX4A 2BPA2 1QJEA 3R6SA 2WZR1 2WFPA 1GNZA 2C6SA 1A78A 2EICA 4DFSA 4BQ5A 3O1VA 5E16A 3DF0A 4CDXA 1RUC2 4A7KA 4Q4V2 3VBHA 4DOUA 5C8CA 3CQOA 1VR3A 2RVAA 3X29B 1BVP1 2R6QA 5J09A 2A1XA 1WGPA 2R16A 3OTFA 3OEBA 1Q5OA 5FOBB 3IMNA 3OUHA 3VDAA 1TMF2 4RHV1 4BU2A 4NIDA 2ZMNA 5DZFA 5EHDA 2V73A 5EYXA 3ZFFC 2EIBA 3HNBM 3TOJA 5L19A 3M7AA 1JMUB 3HPNA 2HYXA 5GJ6A 1GANA 4XUNA 4XF3A 1SG3A 4RGKA 1ZRDA 4CA9A 1J1LA 3AYCA 2VPVA 1W6PA 3KCCA 3JU9A 5A7OA 2AACA 4HANA 3NV3A 4YGDA 3EO6A 3POYA 5TSWA 3M3EA 1G9FA 1VALA 2JG9B 3LQCA 4CSWA 1W8FA 4ZY9A 5FY8A 1NCRC 2PTMA 4YGEA 2TUNA 5L9VA 2OX0A 3I3QA 2HWE3 4Q4V1 3VBUB 3U4SA 4FFFA 4AXOA 4X6RB 4IXLA 1OPOA 3MLLA 4K21A 4J1WA 3EQEA 3ZSMA 3C3VA 4A45A 4E2SA 5A7WB 2WDBA 1NCQB 3FFZA 5ACA3 1QJFA 4ISRA 3ZFFB 4BQWA 3I2JA 1R64A 2E7AA 3RZHA 1ENSA 2Q1MA 4YVSA 5FZ4A 3K46A 2DURA 2XL7A 3J8F2 4Y4RA 1LGCA 1DQ1A 3C7FA 3C7HA 3RNSA 1OI6A 2OXBA 2OIIA 1K3IA 2VH9A 3DPRA 5F8PA 5IVEA 4MV2A 4N7UA 2V4AA 1HB2A 1VBB3 2QJVA 2TNFA 5A7NA 1AYN3 4DXZA 5CG9A 4OMCA 2E9QA 4HFSA 5JAXA 3UNPA 3AMMA 1WW5A 3BODA 1VBA3 2XJQA 3BIWE 3LAGA 3ZXJA 2DVBA 4P9GA 5FK8A 2R7EB 2WJSA 4MADA 3RMXA 1QQP3 3PJQA 3BYWA 1S0BA 1RITA 1RUD1 5HXVA 1YWKA 1BJQA 1YLLA 2UYBA 4XZPA 4YM3A 1AZDA 1VBD1 1XRUA 4YG0A 5C3QA 5JI9A 4MGSA 2C1FA 3H1MA 3CHXA 4Q0QA 2VUDA 2RS32 4IEPA 2QQVA 3WG1A 1AJKA 1VBC1 3ZSLA 3N36A 4HXCA 2XR4A 4NE9A 3ZDVA 1X8EA 3PNAA 1TNRA 4CXYA 1RUNA 4FO9A 4LUKA 5DPNA 2WWJA 4GKYA 1S0GA 3KWVA 3AP6A 4M4RA 4AFCA 3OSDA 5I0DA 2JG8A 4I30A 5GLUA 4LBQD 4AHXA 1VAKA 5I0SA 1W9SA 4LORA 1MVQA 1BK1A 3I8TA 2WR9A 2YU1A 3Q8EA 4LLOA 1H1AA 4PDWC 5CIRA 2WZPP 1CESA 2ES3A 2Z5WA 1RB8G 1SLIA 2D3RA 1FI2A 1TG7A 3MW3A 4LTAA 1OOPA 4YZ4A 4C1XA 5CKNA 1XNDA 4UW6A 1JHNA 3INAA 4AFMA 1NYWA 2K46A 4JVAA 3MV01 4Q8KA 2QCSB 3WEZA 2IXCA 4BIFA 1DYKA 1LGBA 2DDUA 4QQHA 3WDWA 4GXLA 5I8TA 1RUOA 1BXHA 1POV0 3RGBA 1VB4A 4FTEA 2R042 4Y5Z0 3WCRA 4CCNA 5B2GB 1EAH3 5JOYA 1D0GA 4FOVA 4XETA 4LKEA 1PGSA 2RDQA 3ILFA 2DFCA 2JKBA 3DYOA 3R05A 1HXS3 4Q4W2 4ORFA 1OLME 2X5IB 3VBRA 3IM0A 1PVXA 4IV1C 4LHNA 3ZYIB 4BK4A 2YPJA 4AR2A 1AR93 1Y9GA 3LA7A 4IEWA 4R4XA 5F3IA 3V0AA 1IG0A 4LBJA 2XJPA 1Z7S1 2JWPA 3HEIA 4ZS3A 3ROUA 4TTGA 1XQNA 1UIJA 1QKQA 2ZGOA 3D4KA 3O0WA 4JV4A 1UL9A 4Z1VA 4ZHNA 3AJZA 1CJDA 4Q29A 4BXFA 4ES9A 5LA0A 2RDSA 1HX6A 4DY5A 3WP6A 3VD4A 1OURA 5GLTA 3GZEA 1OD3A 5FZ9A 4DZGA 3BUCA 4XDPA 3I3MA 1LOAA 2MEV2 3F95A 3UL2A 1H9PA 1US3A 1POV1 3FHIB 4WM8B 2VCBA 3ZFGC 1MEC1 1SLTA 2VMIA 3ZIWA 2RJLA 5F37A 3SLIA 4M3CB 1VE0A 3KS7A 5C5TA 4NPMA 3PUHA 4LO6B 1OF4A 3HBZA 2W0XA 1S0IA 5C3OA 5T54A 2GAUA 4RR3B 3DYMA 5FLHA 4OHZA 5A6QA 4OQ9A 4OUMA 4PI0A 4ZZ5A 3FLRA 4XW3A 5EPAA 3RZKA 5E8AA 3SITA 1XU1A 4XJAA 3H1YA 2BGPA 3M4FA 3PVNA 4Q26A 2OYZA 3THDA 4FAHA 1DDLA 2JD4A 5JSPA 4X6QB 2ZHLA 3MPPG 2P4EA 3POJA 2VQAA 4YVSB 3FZ3A 5IATA 5EJZB 4AHYA 2RS51 2W92A 2JKXA 3N9PA 4LOTA 5F39A 3MO4A 1JN2P 2VD7A 4HG6B 4JTOA 4WM8C 1C8M3 3E6BA 2A6XA 1C1LA 1LKNA 1NE4A 1R1A2 2X5IC 5FZ0A 5A6YA 4D6SA 1JS9A 1VMJA 1NCRB 2QQKA 4E27A 3AZZA 4M4PA 4D0QA 3W59A 1D4VB 1UPSA 2JIJA 3IKWA 2HYKA 1SLLA 2Y6HA 4N43C 5LZ6A 1RUI3 2DCJA 1GSLA 1DQ5A 1LOFC 2R32A 1UYYA 3ON7A 4Q5OA 3LEIA 3EBRA 3JBG3 5GKAC 1YC61 2YG0A 3HR9A 1NXD1 3WP4A 5FFOC 4BMEA 4AZZA 1P8JA 2JDHA 3AL5A 5GZEA 4R9CA 4EWEA 1OKOA 3Q8AA 3AX4A 2CGPA 4HVQA 5BV6A 1QH6A 3NKTA 3GGLA 1UZZA 2GNMA 1XYOA 5F32A 3GALA 2A6VA 3KCYA 4WVMB 1M06G 5J1XA 5K0UC 4XFCA 1ULOA 3DXTA 2LTNA 1W8OA 2WWUA 4WZFA 4AQ2A 2VQTA 5L7OC 1MR5A 2DTYA 4XUTA 5LA1A 3WW2A 3C2UA 3HT2A 2XKPA 5FBZA 5FPXA 5IK7A 4IEVA 2A73B 4CDQA 4TYSA 3WQBA 5J37A 1AR62 2VBBA 5K7PA 5FYYA 5EZWA 5JXIA 1F4HA 4UWDA 2WNUC 3N9QA 1GP5A 3USSA 3VZLA 3U14A 4AVSA 1TZOA 4CZSA 3BPZA 4D7TA 3IDEA 3VZOA 5I91A 2LRPA 1UO9A 1YI9A 1LGNA 1PGL2 1TMF1 4TZDA 4JCKA 1AYM3 1A8DA 4XFBA 4TXWA 2JE8A 2W9XA 3IDAA 2VU9A 2Y26A 1FMD3 1UYXA 4NMIA 4RYDA 4QB2A 1URXA 4QU2A 2UWBA 4W6YA 2WT0A 3U07A 4CDQB 1YQ2A 3N9NA 1GFF2 3PDQA 1OA4A 1SFPA 2WSVA 3RYRA 3WY6A 3WUDA 5KC5A 4QPGC 1CIYA 2W94A 4RQPA 4PDWB 1UMIA 1X36A 2BGOA 4RHV3 2DYCA 4Y1YA 4OI4A 5A7PA 4CVUA 5IFTA 1GOGA 1UOJA 4A2UA 4HK8A 2ZKLA 1HRV1 3W5MA 1CJPA 3MIDA 4UW5A 2WNUB 3OCPA 3DUIA 2QE3A 4QXKA 4NHMA 1BK0A 1UU5A 1Z0HA 1YYNA 3BN6A 3D6EA 1QNYA 3I3EA 4M01A 4MXWA 4V2WA 4FP2A 3UT0A 5DDJ3 3AMQA 1IGOA 2A3XA 3AFKA 3LPGA 5HCAA 1SPPB 3FLTA 4HL0A 4NVPA 4CEYA 5FYSA 3U37A 2VY0A 3E6CC 2JX9A 2YC4A 5BPXA 5KHIA 3VBOC 3ZXEA 2Y6LA 1NG0A 1UY2A 1H8TB 1W9FA 3MUZ1 1OUSA 4GMP1 4KG8A 2B9UA 5CVRA 2EALA 2D6OX 2E53A 4LO7A 4Q4Y2 5DDJ1 1YQCA 2H0BA 3IPVA 4UBGA 4N53C 3UESA 2VM9A 2HWF3 5C4WA 3QOPA 2ZBJA 3RWKX 2C5DA 4IGPA 5KHGA 1UOFA 3T08A 4OUSA 3VBHB 4JRAA 4PHZA 5C5UA 2X29A 4QGLA 4GJYA 3Q9OA 1CONA 5EYYA 1CAUB 1WCUA 2VZRA 3NNGA 4YVWB 3RJ2X 3ETQA 3V0AB 4OCTA 3HMYA 1H8VA 2P6HA 1ZA4A 5J36A 2ZEYA 1NKGA 1PIV2 1ZBE2 2R0FA 4YZ3A 1ZBE1 1CAVB 3VL8A 1O8SA 3MIGA 5FYMA 1V6NA 2ZHNA 3LSDA 2YGLA 2VR4A 4JGYA 4RFT0 2OZ6A 3HVDA 2DVGA 1PNFA 1A3KA 4M0HA 4LMFA 1XNCA 1K5JA 3PU3A 2JICA 4BK5A 4EWDA 4QKDA 4XOGA 5C7GA 3O1UA 5FPAA 5ABJC 4ZXKA 4AHWA 2CTVA 2DBNA 3S30A 5L36A 1YFXA 2EXKA 2SLIA 4GWJA 3C8XA 1AR81 3JCIA 3M1HA 2P3JA 2F6BA 1UAIA 2ZABA 4XHXA 2GH2A 4OFGA 5I93A 2OT7A 3NSTA 3H3UA 4TSVA 1BMV1 3LIHA 4XHBA 3ZXDA 4B1MA 4GULA 3WP5A 1CZSA 4GWIA 5A7SA 2FD8A 2PHFA 4R8HA 3R4UA 2EAAA 3PUSA 4AEDC 4ITCA 5LW9A 5CA6A 2YBPA 5JIAA 2A70A 3WDYA 3ZN5A 1UIKA 1JXNA 2GC2A 2TBVA 2XUEA 3QBQA 1RINA 1RUC3 4I2OA 3POEA 2MHFA 1RC6A 1JYVA 2D93A 5JPNB 2JDMA 2HBTA 2BDRA 4EQVA 5A3WA 4XQWA 1ONAA 3ZYRA 1KS5A 1Y9QA 4Q4W1 2AGSA 2YHJA 1W39A 4NRMA 2J22A 4D7YA 3VKMA 4PF5A 1GLHA 1UY0A 4MYEA 5KHKA 4EN6B 3UJQA 1H1MA 4AEJA 1QDOA 4M0NA 5LK7B 5DABA 1XC6A 4CDUB 2WO2A 4Y24A 1EYBA 2XJUA 2KXLA 4C0BA 3MIEA 1CAWB 2DWRA 4YG6A 3UGHA 3T30A 1F5FA 5ISLA 3N7MA 1YFUA 2GP5A 2XJVA 3V65A 2HWE2 5DAVA 4FPJA 3LKJA 3WF2A 1ZREA 4ASLA 2VCMA 5LY2A 2NYYA 3GZUC 4LHLA 2WA4A 2ZJCA 3GCWA 3PHMA 3VD5A 3ACFA 3E5XA 2VAUA 2BNOA 1HRV2 4CDUA 3VBUA 2BW8A 3RS6A 5IVVA 3UV9A 2CDOA 2IZWA 1MS4A 5BNPB 2YUEA 3VZNA 4JC1A 4YW1A 1Q8SA 2Q0AA 1I6XA 5FZ7A 5LRSA 5IVJA 4HOOA 1I5PA 2W52A 2WABA 1OQEA 4NHKA 3TWIA 1BEV2 1QIQA 4F7ZA 1W8NA 1SBEA 4LKDA 2Y33A 3WSOA 5D8AB 4INDA 4K3UA 4PLMA 3ZMOA 1O59A 4S2DA 3KF5A 5K4LA 1QXRA 5K0UB 2AH2A 1D4M3 2QNKA 2JE7A 2XONA 2YBKA 3HN3A 4C0HA 5GM0A 4RQPB 1AR71 1K45A 1YNAA 4DY3A 3N4MA 3NV2A 4H14A 4Q27A 1QJX3 4I01A 5C3PA 2FMYA 1IQDC 2W3JA 3AZXA 1W2NA 1WW6A 4LE4A 2PAMA 4E2GA 5BNPC 1WMXA 2OKXA 1N1VA 3OD4A 2WNVC 4YM2A 2W46A 1BBT3 3TNQA 2C9KA 1SMVA 2ZX2A 4LOSA 5FZHA 1MS0A 1Y4WA 3FLPA 3T09A 1HRI2 4AK3A 3JD73 2NN8A 4D94A 5A3MA 2YC0A 1UYZA 4NJ4A 1OKQA 1U5YA 4MGKE 3GDBA 1JZ5A 4QM8A 3MEPA 1V9U3 3VGIA 4CEWA 1WLCA 2YB7A 2LROA 3UGFA 3KD4A 4IV3C 2PHDA 1G9BA 4NIHA 3VBFA 2ZZJA 3H8RA 3L9JT 1V6OA 5FK7A 5FQ0B 1EUTA 5EJ3A 4WVVA 1HKDA 3HQUA 4YGCA 1CAXB 3CMGA 1W9TA 3K3NA 3V0BB 4ZU7A 3PUAA 4BMBA 1LEMA 5LEJA 2W95A 3ITQA 2V5DA 5FXXA 4A41A 4AEMA 4LKFA 3SKVA 3VBRB 3KGLA 1VBC3 1VRBA 4HVOA 3WX5A 2R043 3FC0A 4OULA 2OS2A 4KI5M 4MO3M 1A34A 3S6PA 1MS1A 3CZUA 1ACCA 5EJ1B 3O1OA 1HXS2 2QDRA 1PIV1 4LKSA 2V5YA 3NW4A 5JUVA 1DQ6A 4DUWA 4QPIC 4R4ZA 4DS0A 2LM3A 3ST7A 4EN7B 5FR3A 3ATGA 3ILRA 5AFBA 2DV9A 1W3XA 2ERFA 4QDQA 5D2AA 4AI8A 4Z2AA 5LWBA 1SBDA 4MXVA 1ZX5A 2Z42A 4XCBA 2B7YA 3KV6A 3LZZA 2JDKA 3QACA 4P9WA 4YW5A 5HPOA 2WZR2 3DGTA 1VBB1 2JDNA 1SEFA 4DEVA 1WBFA 2MEV3 2XVLA 3T2QA 3TN91 4J6GA 2Q5TA 4HZFA 2J1RA 3KHCA 2ZTNA 5FO7B 1MEC2 3AZVA 1OQDA 4UFIA 2XHKA 3A22A 3I49A 2TEPA 2R061 1NA1C 2I74A 4H3WA 4IV3B 5JVVA 4DXRA 2ADEA 4QGMA 4CU9A 2RMU3 4L8QA 5JPMB 4FOYA 2H0VA 1ULEA 1JZ8A 4A7ZA 5C6CA 1C5IA 2CGOA 3ZPYA 3MZHA 3FUOA 1Q3EA 1PMJX 3N7LA 1V0AA 3WVJA 5HV0A 1RUE1 3M3IA 1JH5A 4BHPA 1FOD1 1RMU3 1OT5A 3J7HA 3AKQA 4B4RA 2W47A 4IGOA 5E88A 5C8WA 2FHRA 2R072 1FNYA 2XBO1 2BUKA 3MFCA 1VIWB 4W6XA 1XNBA 4D69A 4QX8A 2W5FA 3WW3A 3CZJA 4FAGA 5JWPA 4HSJA 2SBAA 2Y6JA 4XJ8A 5H9SA 1IHMA 3OEAA 4AAXA 1L7QA 1BZWA 3ZXKA 4XUQA 1RUD2 2AZ5A 1KFXL 2YU2A 4R9BA 1HJGA 3U1XA 3HAGA 4CDWA 2JEMA 3ACGA 5G04L 1ND2B 1R1ZA 4XUOA 1VBE3 3H8XA 3JBG2 3MIFA 4YM1A 1CZVA 4LE3A 5LASA 1ULPA 3I54A 2DUOA 1STMA 2D6MA 2WNEA 4P08A 3VD9A 3NAPB 2LUWA 3I2OA 1IOAA 5BNNC 4MX3A 1AR83 1ZYBA 2HLEA 2RS13 2NP0A 5F6KA 3T4HB 1G9DA 4XAEA 4LULA 2XQRA 1I1EA 1RUG2 3KB5A 1UYPA 3PU8A 1KITA 1REDA 3P3NA 2KA3A 2BOIA 1W9YA 2WS92 3KHBA 3WQ7A 1S0JA 5CB7A 5M0TA 1W2OA 2D98A 1HW5A 2WA3A 2WZEA 1B35C 1AVBA 1YEWA 3M3QA 4IE7A 1LU2A 4QAWA 2VTXJ 3MF9A 3APBA 4N90A 4A6SA 1DZRA 1ND2C 2QUOA 1E5HA 3E5UA 1S2KA 2PQQA 4DXTA 3MYXA 4QX2A 4DQAA 3JQWA 2ZGPA 1PO12 2XLFA 2GC3A 1CAXA 1V6IA 2D44A 3GBWA 3OD0A 2VZTA 4QPYA 4RD7A 2G9FA 5A1FA 4O61A 4OHXA 3WUCA 2V09A 3O7OA 3NAPC 2DTWA 4NN0A 4L0PA 5LCWL 1HXS1 2QDNA 3CF6E 4FQ4A 1NOVA 5AVAA 2HWB1 4XILA 1FMD2 2WT2A 3N9MA 5JIUA 4L97A 2HWF1 1EPZA 3I2HA 2AC1A 1PVC3 1UMHA 3K77A 1QOTA 1R1A1 3CBNA 4QX7A 1XYNA 2VMEA 3WHTA 4RS5B 5IYYA 4XUPA 3OOXA 1Z78A 3RYPA 2EA7A 2WAAA 3UETA 1S0FA 4PQQA 2PELA 3BB6A 3WLUA 3ZVXA 5FZ6A 5CFCA 3O5SA 3Q8BA 4I0AA 5CFCB 2VOTA 3B01A 3N9LA 3WF4A 5C33A 5JZGB 1ZNPA 1RVF2 3OY8B 2HEYF 1H1IA 2VOWA 1D7PM 5K8SA 1XSQA 3Q8FA 2DVDA 2ENRA 3VHRA 1DQ0A 1Y7BA 2VC9A 3DECA 4Y22A 4S2HA 4A6OA 4BQ1A 4K20A 4TWTA 3EXUA 4QQLA 1NCQA 5FP8A 5JDBA 2WBKA 1MVEA 4XBLA 3EMRA 4K8FA 3OPTA 2QQJA 3TBDA 4QDSA 2HWD2 3VHNA 2OPKA 3USUB 2PHUA 3WV6A 3AP9A 3EB7A 1RJ7A 3SH3A 3WNPA 4LO8A 2E7TA 2VTFA 2F4LA 1WMDA 4Q4Y3 4O7XA 3QLQA 4BDVB 1V6LA 3NWKA 5EIYB 2E63A 2VCAA 4GKXA 1GNHA 5L9BA 1GZ9A 2HBUA 5LY1A 1FMD1 2PHRA 4N9HA 3U10A 1JHJA 2Z2SB 5JZGC 3CJIC 3MBWA 4PIZA 4LT5A 1WWYA 1GV9A 1DCSA 2ETEA 2IFRA 4JZRA 1W90A 2JG9A 3ACLA 4FOWA 3KQRA 4AF9A 4N9IA 3UJOA 3WNMA 3RZZA 1SPPA 2RE9A 2I45A 1J84A 3AFGA 4JGZB 1QJX1 1BEV1 1QGLA 3LEGA 4QD2A 2YC2A 3B7MA 3J26N 2FZ1A 3BTAA 3NJYA 1JI6A 1KD7A 4XURA 5LATA 3ZYPA 5L7OB 4BZ4A 1PO21 1DGWX 2OUHA 3OGSA 4UXAA 3WDVA 2J1EA 1KFUL 1QJY2 2W2IA 3DXUA 3N7KA 4COZA 1JYIA 5DG2A 4QHZA 4P9JA 3D3AA 1PMHX 4YW3A 4AEDB 1WW7A 1PNGA 4COUA 1LECA 3B69A 1ODMA 3GZTB 4CCCA 2QZ3A 1WCDJ 5AC92 2P3YA 2ILMA 2ZACA 4RGGA 1J3RA 4AG4A 4OZOA 3USUA 3EYPA 1FPN2 2W1QA 4CDXB 3TEZA 2DCKA 4BQ2A 3HNMA 1X82A 4URTA 3LGRA 2DCZA 2E31A 2D7FA 2Y6KA 1JYNA 3NV1A 4RR3C 1H2LA 4HLTA 3O1SA 1ZZ9A 3GBGA 4Y1VA 1VRH3 4DB5A 4R9DA 3G7DA 2RM23 1N3OA 3LDBA 1GQHA 5T5LA 2VOVA 4H55A 2NMNA 1AL23 4ASKA 2RV9A 1ZZ8A 1U5XA 1QHDA 1YRZA 3IN9A 2RS31 4UI9L 2D43A 5BYNA 2G9GA 3OGJA 4Q4X1 4QQPA 1UNBA 2B39A 5BNQA 2R1BA 5I8SA 4BOWA 4MGQA 2H6CA 2J1SA 4NWWA 2RJ2A 4QKFA 3I2IA 3T0DA 3KZ4C 1O3RA 2WYSA 3LEKA 2RS53 4FFIA 1RIRA 3NVCA 4MVTA 3WHUA 3ZKUA 4AI2A 3K51A 1SACA 2AUYA 4XFAA 2WAOA 2A71A 3DL3A 5I0RA 3T0AA 2UWAA 5FYHA 1UZVA 3OPZA 4UF0B 3AZYA 1WLWA 1PX3A 1VAMA 1JODA 4XF9A 3ZXFA 2WN3A 4XMAA 2DCYA 2GNBA 1V70A 3N9OA 2WFF2 3U75A 4PIYA 3VHPA 1G8WA 1YQ5A 2VCCA 4TN7A 3VBSC 5CBLA 1E5SA 2R062 4LIVA 3AKSA 5FJHA 1DP0A 3BPSA 5C9AB 3QH6A 2J1TA 4LJHA 4AVVA 1IPJA 3WP3A 4CDXC 2PHTA 4NIGA 1OSGA 5KC6A 3SXWA 3VBHC 2IFWA 1SFNA 5B4XA 1VMHA 5T55A 2GC0A 1C57A 1CAWA 5IUQA 4YLZA 4FFHA 3N7JA 2QVSB 3PTYA 4IEZA 2WINB 1HRV3 4IEQA 4AVBA 1S1AA 5ANNA 1F15A 5L73A 3W58A 4JKLA 1JW6A 2UYAA 4TLGA 1HRI1 3OG2A 3I2GA 1QWRA 1WCQA 4YARA 5LA9A 1LCLA 5C4WB 3QCWA 4IQPA 1NZIA 4AFBA 2K2SA 3ZXAC 2BERA 1JZ6A 3NQHA 2ZGSA 2VUCA 3OY8A 1UWWA 4IESA 5AC91 1O5LA 4WVMA 1ZZ7A 2W1UA 2ID4A 3GJBA 4QQ2A 4OMDA 2GH8A 4EYUA 5HCFA 3R4DB 1LOEA 1D4M2 4JGZC 4Z82A 1CIWA 4XIOA 4AEKA 4BB3A 1TMF3 3B94A 2B8MA 3TB0A 2VUJA 3ZFEB 1E57A 2WUHA 2ORXA 3MF6A 4F3JA 1I5ZA 1NT0A 4LBLA 2VE1A 1UZWA 2A5ZA 1QF3A 3WQ1A 4AI0A 1CPMA 1RXGA 3LD8A 2DUPA 4RL7A 4I3GA 5FMCA 2ET7A 5L9RA 3T1MA 1IS3A 2EIGA 3GXUA 1W0PA 4YVSC 4LPLA 3NO8A 2YZ4A 4YRDA 1BBT2 1J83A 2XMLA 5FLJA 5FMOL 3VUOA 5FV3A 1OLQA 1RUF2 5KXDA 3DV8A 3DPRC 4LQRA 5LK5A 4B8EA 1K42A 4XZUG 1ZBA3 3K4DA 5FY7A 1E5IA 4M3CF 3POWA 5F2WA 5CFDC 1AUYA 2J7MA 5T3NA 4OI1A 3HJRA 1PK6B 2CDPA 1XXNA 3AP7A 4GH4A 2B4KA 5KXEA 1M4WA 2XGXA 3ME2A 3I4IA 3ZFEC 3KLSA 4BQ4A 1COV2 2VZQA 3LSEA 2PFWA 1QXJA 4JKKA 5FZOB 3S5QA 3WW1A 5EQUA 2E6VA 1W03A 2FCTA 2RDNA 1F9KA 1MS9A 2EXIA 3JD71 4WVWA 5FOJB 3J8F3 3ZSKA 5FLIA 1CPNA 4K6BA 1OQ1A 4IV1B 1QOOA 3B00A 4K1YA 5JLVA 1AYN2 4GJZA 2D3PA 2QBXA 2ZAAA 3GHNA 1W2UA 4XFHA 4YVWC 4AGGA 1VBA2 4J25A 4OI2A 3ZLIA 2VZPA 2JG8C 3FWEA 4I3PA 4P00B 5J96B 1JOJA 2MPFA 5FBJA 1DZTA 4CXWA 4GA9A 5GALA 3K4AA 4XFGA 4FCAA 2FMDA 2W1WA 3UGGA 4DRVA 4YFZA 4R52A 1JOPA 3BCWA 4ZPIA 4BYYA 4M00A 1DYOA 5DZEA 1IS6A 4PI2A 5FY9A 4KWUA 5C9AC 1UX6A 1XBFA 3V0BA 4NPRA 3VD7A 3POFA 1YHFA 4JHZA 3LB9A 1LODA 2Q1ZB 3A4UA 3OPWA 1IQAA 1VLNA 4A44A 5F3CA 5CISA 1GWLA 4OLLA 1JTZX 3T2TA 2W91A 1UXZA 4QXCA 2QQNA 1WCSA 2WLQA 3MHZA 4G3YC 3ZXGA 4WM7C 1UW8A 4CEWB 4Q0UA 2JG8B 5A3NA 1IS5A 5H9QA 1W99A 1MQTA 1WLDA 2BFUS 3VZKA 4Z2WA 2WS91 5BY5A 1MZ6A 3GHMA 4ISQA 5FTTC 2UURA 1F5JA 1NY72 1RMU2 2BZDA 3THCA 3M8LA 2C4XA 2ZEWA 1IZ3A 3OBTA 4CCJA 1H6YA 4AE2A 4BQYA 1FNZA 2NM1A 2IUWA 1CGPA 2V4VA 1XSRA 3GCXA 2VW1A 2YFUA 4DMIA 3M3OA 1G9AA 1N1YA 3BTYA 2CAUA 4KBBA 4W6WA 4YW6A 4AVAA 2JDAA 2VZ1A 4Z8BA 3PTRB 5ANQA 2XG3A 3AB0A 3ZFGA 2PAKA 1AR92 2AEZA 2BVVA 1DF0A 2V72A 1PGW1 2VNOA 4UW4A 3NKGA 1G7YA 3VDDA 4V2VA 1PO11 4MGIE 5JOZA 4UFLA 5JOXA 2D6NA 3SCHA 3CIHA 3A7QA 1VBE2 5H9RA 3ALQA 3LDRA 1AJOA 3NJZA 5DAXA 2LS6A 1YJLA 5JR7B 4CU8A 1ULDA 4JQTA 4BQ3A 1U5IA 1JOBA 2X8KA 3PVBB 4MSVA 5JXGA 4Q4Y1 3ABZA 3WF0A 4BH9A 1SBFA 1XE0A 4G4FA 4PF1A 4HPKB 1DGLA 1KDMA 1LJ7A 1TEIA 1UD1A 2YGMA 3O14A 2JDPA 1FAYA 2VULA 1ZBA1 3ZOIA 1RUG3 2IC1A 3WR0A 1LHWA 4B29A 4ZKTB 4SLIA 4GB33 4EE2A 1LHOA 1YI7A 2YYOA 4KWJA 3KVAA 2X5IA 2IXLA 5FQ0A 2KM2A 1LU1A 3B9IA 3ACHA 4NAOA 5KR7A 1YIFA 4NHXA 1R091 2Y38A 2A6WA 2EAKA 2VXRA 3ZYFA 5F3EA 4QMAA 2VQ0A 4LEJA 3OBAA 3IBMA 5T50A 4B7EA 1LOFA 4RA0A 1GKBA 1UY4A 3AYDA 3TN92 5CYYA 3MW4A 2LALA 3ZXLA 2GNDA 5BNOA 1LULA 4RFRB 2CGNA 2BWAA 2IVIB 1NLSA 2D6KA 4LK6A 3S5AA 2J1VA 3I59B 4Y1XA 1PO22 1KRIA 1UPIA 5A80A 1BQPA 1JBCA 4AGVA 1K5MC 4ZONA 3MI8A 1CVNA 1XB9A 4NRPA 1H2NA 3LA3A 2KR2A 3D0JA 2OW4A 1EUUA 4C90A 3RZLA 2X53S 1PK6C 4Q1RA 3I7DA 4CDWB 2ZX0A 2E51A 1F35A 5FUIA 4JAAA 1ASJ3 4CDQC 5FUPA 2XB6C 3WOGA 1EY2A 3V56A 1RUH2 4HVRA 5D8AA 3DCQA 1VAVA 4EROA 5ACA1 3POBA 1RVF3 3HT1A 3IB3A 4FPGA 4UAPA 1WD4A 1H2KA 1OPMA 2W1SA 1W8UA 1TQ5A 3JB4C 4L11A 4RS5A 2UY8A 4QDRA 1HB3A 4AVTA 1KJLA 4D3WA 1ZRFA 1C3HA 2C0ZA 2RG4A 1HJFA 2BBAA 2L9LA 2XL9A 3JZVA 2X10A 4GH4B 4MLOA 4N8MA 5ERLA 3VZMA 1QOSA 1C8NA 1EP0A 2VMHA 4EV0A 2BTVC 2RS11 4UYBA 5KXBA 2GMPA 2P1BA 2ZX3A 3OUIA 3NNJA 4JDMA 2RR11 3VKOA 1UX7A 2CY6A 2HWD3 3ZYGA 4AYUA 4EN0A 2HWC3 3U4XA 2MNGA 2PHWA 1ALYA 5FZLA 1WD3A 1AR63 5IFPA 2XLGA 3ES4A 2Q4SA 5FZDA 3SKJE 2K0GA 3D8CA 3F2ZA 3RI8A 4Q0PA 4RQPC 1A6CA 1BCXA 2RHPA 1VBD2 4MOAA 2JDYA 4FPLA 2VZSA 1IPSA 2VMGA 1QXPA 1KS4A 3H42B 1Q8VA 1FYUA 2PN5A 3K2OA 4IERA 4JGYB 4O65A 5FZ1A 4BCUA 1QDCA 5FZCA 2BU9A 5CG8A 4DUVA 2A75A 4GWMA 4XBNA 2Y0IA 5AFEA 3B02A 2PLV3 2NQYA 4Q4X3 3SC7X 3RZMA 2Y6FA 3FE5A 3PL0A 3IDCB 3KSCA 4CEYC 4Q0SA 5ABJB 1AR72 5A32A 1LEDA 3AYAA 3KM5A 5DUVA 1BVVA 1JYXA 5IWFA 3UK9A 3P6BA 4RHV2 3VBOA 4C8DA 4C91A 2ZGKA 1PM7A 1RUE3 1H8TC 2XJTA 3B3QE 3OUJA 4Q0VA 2XH6A 4KBZA 1R083 5JI7A 1LOGA 3PURA 1VRH1 5FKBA 5BXXA 5FZOA 2VBDA 2P5BA 3ZYHA 2XLAA 4ASMB 1ENXA 4BISA 1T2XA 1O3TA 1PX4A 2ZGTA 4AHZA 4AWDA 4QB1A 4D7SA 3H8UA 3ES1A 1GWKA 1ND3C 1OOPB 1XOYA 2RMU1 4WBBA 3WT3A 1IS4A 1PM4A 3BU7A 1KGYA 1Y43B 3AK0A 1QJU3 1HLCA 1S0DA 3IAPA 3KCXA 5C71A 2P37A 1JU4A 1TME1 4Y20A 5AVPA 2UY9A 1ULCA 3AJYA 4YFWA 1W6PB 4AI9A 1TME3 1KXGA 2LW8A 2QKDA 3BVCA 4XACA 3NNMA 1OH3A 2ZGQA 2D3SA 4ONUA 1ZZBA 5GLWA 3HQRA 4EWAA 4ARXA 1W8WA 3O1MA 2MEV1 3AKRA 5FZAA 1W2TA 2O1QA 4DXSA 5FAXA 5CADA 2GZWA 3EJKA 4JGYC 3VV1A 3NL1A 1REEA 1W6OB 2HWE1 4Q4V3 2HWF2 4DRRA 2ZZQA 3ZSJA 5FZ3A 4FBFA 4AI3A 3HNYM 4F8AA 4CCLA 3S7IA 1POQA 3QH7A 1AX1A 3RQ0A 1NQDA 3ZN4A 4NR1A 2RS52 3SISA 5DZGA 3LCPA 3WDTA 4PCRA 2DU1A 4FTBA 3ELNA 1BYHA 1DLCA 4CEYB 1FX5A 2QQOA 2WIIB 3GF6A 4GALA 1ZBE3 3KVBA 1N3PA 1IPKA 1OLRA 2R0HA 3VB9A 1PZ7A 5JSOA 2FDHA
chains in the Genus database with same CATH topology
2VC9A 3DECA 3LE0A 3T2OA 2BGPA 3THDA 1XNTA 2WBKA 2QQJA 4CUAA 3I3DA 5EJZB 4QDSA 2W92A 2JKXA 1OH4A 4E8CA 3MO4A 4YPJA 5JXJA 3EB7A 3WNPA 1UXXX 4HG6B 2VTFA 1GUIA 1NAEA 3AC0A 4BDVB 2QQKA 4E8DA 4M4PA 4D0QA 5EIYB 2VCAA 3WNKA 2Y6HA 1JHJA 3MBWA 2DCJA 3WNLA 1UYYA 3WNMA 2X09A 3LEIA 3C7EA 3I97A 1J84A 2WQ8A 2YG0A 5F7UA 3LEGA 1UY3A 1P8JA 2J1UA 2YC2A 3NRUA 3ZM8A 4KMQA 1JI6A 4XURA 4UOJA 4W8JA 1TVGA 2Y64A 3GGLA 3OGSA 1KEXA 2J1EA 3D3AA 1PMHX 5J1XA 1JU3A 1ULOA 1W8OA 2VJXA 2VQTA 3DYPA 4XUTA 5LA1A 1RYYA 4QPWA 4DEQA 3ECQA 4AG4A 4OZOA 3WQBA 3EYPA 2W1QA 3HOBA 4ET7A 2DCKA 5JXIA 3HNMA 1F4HA 3LPFA 2E31A 2Y6KA 3FN9A 1JYNA 4D8MA 3A23A 4OYUA 1GQPA 4GZ9A 2VZUA 4TXWA 2JE8A 2W9XA 3IDAA 3C7OA 4RYDA 1UYXA 2RV9A 1MPXA 4QB2A 1SDDB 2YFZA 4UI9L 4A42A 1US2A 1YQ2A 4LHSA 4MGQA 2J1SA 1CIYA 2W94A 2RJ2A 1UMIA 2BGOA 3I2IA 3T0DA 5IFTA 1GOGA 2WYSA 3LEKA 3FHAA 4PT6A 3JXSA 3W5MA 3PUIA 2WAOA 2VO5A 3T0AA 4ARYA 1PX3A 3BN6A 3I3EA 3CKHA 2WN3A 3BGAA 3T0BA 3SEPA 1O8PA 3LPGA 4JKMA 1CX1A 2VCCA 2QQIA 2B9VA 4RN5A 3U37A 2YC4A 1DP0A 2Z4FA 2J1TA 3E1F1 2Y6LA 1UY2A 3MUZ1 2X05A 5B4XA 1H6XA 3UESA 2VM9A 2JD9A 3T2PA 3OB8A 3T08A 4CUBA 3I2FA 2VZRA 3NNGA 4JKLA 3OG2A 3I2GA 1L7RA 1LNSA 1WCQA 2BERA 1JZ6A 5IJRA 3NQHA 2ZEYA 1NKGA 2VZ3A 1O8SA 1UWWA 2XQXA 2W1UA 2ID4A 1UY1A 2QQLA 5CZKA 4OMDA 5JMOA 1JZ2A 2VR4A 5HXMA 4BK5A 2WN2A 5C7GA 2WUHA 2ORXA 2ZXQA 4GWJA 3C8XA 2W87A 4P5YA 3GXUA 3I3BA 4LPLA 3IIIA 2KD7A 1J83A 1CZSA 4LQRA 1K42A 4GWIA 2WZ8A 3K4DA 4XZUG 2XHNA 5LA2A 4A4AA 2E26A 3CDZB 2J7MA 5DQ0A 3HJRA 2CDPA 2B4KA 1JYVA 3FL7A 3ACIA 2Y6GA 2VZQA 2VMCA 4JKKA 1HN1A 2J22A 3I2KA 1UZ0A 1W0NA 1WKYA 1JZ3A 1W9WA 1UY0A 1CZTA 5DN2A 2QBXA 2E33A 1XC6A 2WO2A 1SHWB 2VZPA 3K4ZA 4P00B 4QX1A 3K4AA 1XPWA 2W1WA 4QX0A 3WF2A 4P02B 1DYOA 4KWUA 1K12A 4CU7A 3WNNA 3VD5A 3VD7A 2ZEXA 4JHZA 4DUXA 3ACFA 2QQMA 4A44A 4ZXEA 2CDOA 2W91A 4CU6A 1UXZA 5JXHA 2QQNA 1GMMA 1GNYA 1I5PA 2WABA 1W8NA 3WSOA 1W99A 1NUKA 1O59A 2VMDA 2VMFA 3NJVA 3OGRA 2WO3A 2VZVA 3VDBA 2XONA 3HN3A 2BZDA 3THCA 2C4XA 2ZEWA 1H6YA 3NJXA 1K45A 5A1AA 1OF3A 2V4VA 3P1IA 4CUCA 2YFUA 1IQDC 2W3JA 4XVHA 1F4AA 2JDAA 2VZ1A 2OKXA 4IUGA 2Y8KA 2W46A 2J1AA 2EIEA 1BHGA 2C9KA 2V72A 5C70A 2C26A 3T09A 3CIHA 3A7QA 1UYZA 3GDBA 2LS6A 3MUY1 2EICA 1JZ5A 3K75B 4CU8A 2YB7A 4QX3A 4FI9A 3WF1A 5JXGA 3CQOA 3ABZA 3WF0A 2RVAA 4PF1A 1EUTA 3W5NA 1GOHA 3CMGA 3OEBA 1W9TA 3VDAA 2W95A 2V5DA 2EIBA 4A41A 3SKVA 3HNBM 3HPNA 2HYXA 4XUNA 3ACHA 1SG3A 1NX9A 3MV11 4KI5M 4MO3M 4ZZ8A 3CZUA 3OBAA 5EJ1B 4LKSA 5JUVA 1UY4A 3FHQA 3LQCA 4DUWA 5CYYA 4ZY9A 3C7GA 4Z2AA 4QDQA 2J1VA 2ZEZA 2XOMA 4A45A 5HPOA 2WDBA 2VQUA 4DEVA 3I2JA 1R64A 2EIDA 3T2QA 5JR2A 1EUUA 2J1RA 3K46A 1GOFA 5FUIA 3C7FA 3C7HA 3A22A 1K3IA 4DXRA 2PQSA 4CU9A 2ORZA 1JZ8A 3IB3A 4UAPA 4OMCA 2VZOA 2W1SA 4W4ZA 3UNPA 4QDRA 1JYWA 1PMJX 5IHRA 5G05L 2BBAA 2L9LA 2R7EB 2X10A 4MADA 1OT5A 3J7HA 2W47A 4BXSV 5B4NA 1UX7A 4MGSA 5IFPA 2W5FA 3SKJE 3CZJA 2Y6JA 3F2ZA 4MOAA 3OEAA 4AAXA 1L7QA 2VZSA 4XUQA 5DPNA 4M4RA 3ACGA 5G04L 5I0DA 4DUVA 1JZ4A 3A21A 4QB6A 4XUOA 1W9SA 1CZVA 1ULPA 4W50A 4P08A 3WNOA 3VD9A 1TG7A 1JYXA 2HLEA 3P6BA 3SEEA 3MV01 3WEZA 2WO1A 2DDUA 3IAQA 1T2XA 1PX4A 2WZEA 3GM8A 3VDCA 4QB1A 4JX0A 4QAWA 4OUEA 4A3ZA 1GU3A 1KGYA 3DYOA 5C71A 3IAPA 4DXTA 4BK4A 1JU4A 4QX2A 5DMYA 4CVUA 2VZTA 3HEIA 1XNAA 4TTGA 4L0PA 2LW8A 5LCWL 1JZ7A 4ARXA 5LA0A 3VD4A 4DXSA 3I2HA 1OD3A 3ETPA 1UMHA 3K77A 3HNYM 2VMEA 1US3A 5IYYA 4XUPA 2E32A 2VCBA 3VD3A 4BJ0A 2WAAA 3UETA 4PQQA 2VL4A 3PUHA 1OF4A 1DLCA 2VOTA 3OGVA 2QQOA 3WF4A 3DYMA 4ZZ5A 1D7PM 3WF3A 4A6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VC9 A;  3DEC A;  3LE0 A;  3T2O A;  2BGP A;  3THD A;  1XNT A;  2WBK A;  2QQJ A;  4CUA A;  3I3D A;  5EJZ B;  4QDS A;  2W92 A;  2JKX A;  1OH4 A;  4E8C A;  3MO4 A;  4YPJ A;  5JXJ A;  3EB7 A;  3WNP A;  1UXX X;  4HG6 B;  2VTF A;  1GUI A;  1NAE A;  3AC0 A;  4BDV B;  2QQK A;  4E8D A;  4M4P A;  4D0Q A;  5EIY B;  2VCA A;  3WNK A;  2Y6H A;  1JHJ A;  3MBW A;  2DCJ A;  3WNL A;  1UYY A;  3WNM A;  2X09 A;  3LEI A;  3C7E A;  3I97 A;  1J84 A;  2WQ8 A;  2YG0 A;  5F7U A;  3LEG A;  1UY3 A;  1P8J A;  2J1U A;  2YC2 A;  3NRU A;  3ZM8 A;  4KMQ A;  1JI6 A;  4XUR A;  4UOJ A;  4W8J A;  1TVG A;  2Y64 A;  3GGL A;  3OGS A;  1KEX A;  2J1E A;  3D3A A;  1PMH X;  5J1X A;  1JU3 A;  1ULO A;  1W8O A;  2VJX A;  2VQT A;  3DYP A;  4XUT A;  5LA1 A;  1RYY A;  4QPW A;  4DEQ A;  3ECQ A;  4AG4 A;  4OZO A;  3WQB A;  3EYP A;  2W1Q A;  3HOB A;  4ET7 A;  2DCK A;  5JXI A;  3HNM A;  1F4H A;  3LPF A;  2E31 A;  2Y6K A;  3FN9 A;  1JYN A;  4D8M A;  3A23 A;  4OYU A;  1GQP A;  4GZ9 A;  2VZU A;  4TXW A;  2JE8 A;  2W9X A;  3IDA A;  3C7O A;  4RYD A;  1UYX A;  2RV9 A;  1MPX A;  4QB2 A;  1SDD B;  2YFZ A;  4UI9 L;  4A42 A;  1US2 A;  1YQ2 A;  4LHS A;  4MGQ A;  2J1S A;  1CIY A;  2W94 A;  2RJ2 A;  1UMI A;  2BGO A;  3I2I A;  3T0D A;  5IFT A;  1GOG A;  2WYS A;  3LEK A;  3FHA A;  4PT6 A;  3JXS A;  3W5M A;  3PUI A;  2WAO A;  2VO5 A;  3T0A A;  4ARY A;  1PX3 A;  3BN6 A;  3I3E A;  3CKH A;  2WN3 A;  3BGA A;  3T0B A;  3SEP A;  1O8P A;  3LPG A;  4JKM A;  1CX1 A;  2VCC A;  2QQI A;  2B9V A;  4RN5 A;  3U37 A;  2YC4 A;  1DP0 A;  2Z4F A;  2J1T A;  3E1F 1;  2Y6L A;  1UY2 A;  3MUZ 1;  2X05 A;  5B4X A;  1H6X A;  3UES A;  2VM9 A;  2JD9 A;  3T2P A;  3OB8 A;  3T08 A;  4CUB A;  3I2F A;  2VZR A;  3NNG A;  4JKL A;  3OG2 A;  3I2G A;  1L7R A;  1LNS A;  1WCQ A;  2BER A;  1JZ6 A;  5IJR A;  3NQH A;  2ZEY A;  1NKG A;  2VZ3 A;  1O8S A;  1UWW A;  2XQX A;  2W1U A;  2ID4 A;  1UY1 A;  2QQL A;  5CZK A;  4OMD A;  5JMO A;  1JZ2 A;  2VR4 A;  5HXM A;  4BK5 A;  2WN2 A;  5C7G A;  2WUH A;  2ORX A;  2ZXQ A;  4GWJ A;  3C8X A;  2W87 A;  4P5Y A;  3GXU A;  3I3B A;  4LPL A;  3III A;  2KD7 A;  1J83 A;  1CZS A;  4LQR A;  1K42 A;  4GWI A;  2WZ8 A;  3K4D A;  4XZU G;  2XHN A;  5LA2 A;  4A4A A;  2E26 A;  3CDZ B;  2J7M A;  5DQ0 A;  3HJR A;  2CDP A;  2B4K A;  1JYV A;  3FL7 A;  3ACI A;  2Y6G A;  2VZQ A;  2VMC A;  4JKK A;  1HN1 A;  2J22 A;  3I2K A;  1UZ0 A;  1W0N A;  1WKY A;  1JZ3 A;  1W9W A;  1UY0 A;  1CZT A;  5DN2 A;  2QBX A;  2E33 A;  1XC6 A;  2WO2 A;  1SHW B;  2VZP A;  3K4Z A;  4P00 B;  4QX1 A;  3K4A A;  1XPW A;  2W1W A;  4QX0 A;  3WF2 A;  4P02 B;  1DYO A;  4KWU A;  1K12 A;  4CU7 A;  3WNN A;  3VD5 A;  3VD7 A;  2ZEX A;  4JHZ A;  4DUX A;  3ACF A;  2QQM A;  4A44 A;  4ZXE A;  2CDO A;  2W91 A;  4CU6 A;  1UXZ A;  5JXH A;  2QQN A;  1GMM A;  1GNY A;  1I5P A;  2WAB A;  1W8N A;  3WSO A;  1W99 A;  1NUK A;  1O59 A;  2VMD A;  2VMF A;  3NJV A;  3OGR A;  2WO3 A;  2VZV A;  3VDB A;  2XON A;  3HN3 A;  2BZD A;  3THC A;  2C4X A;  2ZEW A;  1H6Y A;  3NJX A;  1K45 A;  5A1A A;  1OF3 A;  2V4V A;  3P1I A;  4CUC A;  2YFU A;  1IQD C;  2W3J A;  4XVH A;  1F4A A;  2JDA A;  2VZ1 A;  2OKX A;  4IUG A;  2Y8K A;  2W46 A;  2J1A A;  2EIE A;  1BHG A;  2C9K A;  2V72 A;  5C70 A;  2C26 A;  3T09 A;  3CIH A;  3A7Q A;  1UYZ A;  3GDB A;  2LS6 A;  3MUY 1;  2EIC A;  1JZ5 A;  3K75 B;  4CU8 A;  2YB7 A;  4QX3 A;  4FI9 A;  3WF1 A;  5JXG A;  3CQO A;  3ABZ A;  3WF0 A;  2RVA A;  4PF1 A;  1EUT A;  3W5N A;  1GOH A;  3CMG A;  3OEB A;  1W9T A;  3VDA A;  2W95 A;  2V5D A;  2EIB A;  4A41 A;  3SKV A;  3HNB M;  3HPN A;  2HYX A;  4XUN A;  3ACH A;  1SG3 A;  1NX9 A;  3MV1 1;  4KI5 M;  4MO3 M;  4ZZ8 A;  3CZU A;  3OBA A;  5EJ1 B;  4LKS A;  5JUV A;  1UY4 A;  3FHQ A;  3LQC A;  4DUW A;  5CYY A;  4ZY9 A;  3C7G A;  4Z2A A;  4QDQ A;  2J1V A;  2ZEZ A;  2XOM A;  4A45 A;  5HPO A;  2WDB A;  2VQU A;  4DEV A;  3I2J A;  1R64 A;  2EID A;  3T2Q A;  5JR2 A;  1EUU A;  2J1R A;  3K46 A;  1GOF A;  5FUI A;  3C7F A;  3C7H A;  3A22 A;  1K3I A;  4DXR A;  2PQS A;  4CU9 A;  2ORZ A;  1JZ8 A;  3IB3 A;  4UAP A;  4OMC A;  2VZO A;  2W1S A;  4W4Z A;  3UNP A;  4QDR A;  1JYW A;  1PMJ X;  5IHR A;  5G05 L;  2BBA A;  2L9L A;  2R7E B;  2X10 A;  4MAD A;  1OT5 A;  3J7H A;  2W47 A;  4BXS V;  5B4N A;  1UX7 A;  4MGS A;  5IFP A;  2W5F A;  3SKJ E;  3CZJ A;  2Y6J A;  3F2Z A;  4MOA A;  3OEA A;  4AAX A;  1L7Q A;  2VZS A;  4XUQ A;  5DPN A;  4M4R A;  3ACG A;  5G04 L;  5I0D A;  4DUV A;  1JZ4 A;  3A21 A;  4QB6 A;  4XUO A;  1W9S A;  1CZV A;  1ULP A;  4W50 A;  4P08 A;  3WNO A;  3VD9 A;  1TG7 A;  1JYX A;  2HLE A;  3P6B A;  3SEE A;  3MV0 1;  3WEZ A;  2WO1 A;  2DDU A;  3IAQ A;  1T2X A;  1PX4 A;  2WZE A;  3GM8 A;  3VDC A;  4QB1 A;  4JX0 A;  4QAW A;  4OUE A;  4A3Z A;  1GU3 A;  1KGY A;  3DYO A;  5C71 A;  3IAP A;  4DXT A;  4BK4 A;  1JU4 A;  4QX2 A;  5DMY A;  4CVU A;  2VZT A;  3HEI A;  1XNA A;  4TTG A;  4L0P A;  2LW8 A;  5LCW L;  1JZ7 A;  4ARX A;  5LA0 A;  3VD4 A;  4DXS A;  3I2H A;  1OD3 A;  3ETP A;  1UMH A;  3K77 A;  3HNY M;  2VME A;  1US3 A;  5IYY A;  4XUP A;  2E32 A;  2VCB A;  3VD3 A;  4BJ0 A;  2WAA A;  3UET A;  4PQQ A;  2VL4 A;  3PUH A;  1OF4 A;  1DLC A;  2VOT A;  3OGV A;  2QQO A;  3WF4 A;  3DYM A;  4ZZ5 A;  1D7P M;  3WF3 A;  4A6O A; 
#chains in the Genus database with same CATH topology
 2DF7 A;  2X05 A;  1OUX A;  2AYH A;  3LE0 A;  5IK4 A;  5C3R A;  5C8C C;  3LOI A;  1JUH A;  1W6M B;  2Q30 A;  2BFU L;  4AED A;  5KXC A;  1DIW A;  2VTX A;  3I3D A;  3U0Z A;  5GLZ A;  1IKP A;  1OH4 A;  3FX3 A;  3MPB A;  1AXY A;  3H50 A;  4NHL A;  4KNC A;  5F5I A;  4YPJ A;  1UXX X;  3ZFF A;  1NAE A;  2CWM A;  4EN8 B;  5JSR A;  4QHO A;  1QMJ A;  1L3J A;  4E8D A;  3AYE A;  1NQJ A;  3KT1 A;  5A1L A;  2D5H A;  5ACA 2;  3RVH A;  2HWC 1;  1LAJ A;  5FPU A;  1RUH 1;  5A70 A;  5FY4 A;  4CCK A;  4OHV A;  3WNL A;  1X33 A;  3HBK A;  1Q56 A;  3MW2 A;  4Y4Y A;  1K5M B;  2YMZ A;  3I2D A;  2X09 A;  4NOT A;  3KMH A;  1MZF A;  1NCR A;  1XNK A;  3I97 A;  3HWJ A;  4FOQ A;  3ZR5 A;  4LIU A;  3AKP A;  2B45 X;  4OHY A;  2GP3 A;  2H6B A;  1UY3 A;  4IDZ A;  2J1U A;  5GZD A;  3ZM8 A;  1VBB 2;  4IE4 A;  4KMQ A;  4UOJ A;  2BGC A;  3KGZ A;  3ZMN A;  2XDV A;  2WNO A;  4X8N A;  3RFR A;  1O4Z A;  1PHM A;  5FKC A;  1KEX A;  2XBO 2;  3FFQ A;  3IIA A;  1GZW B;  3AMN A;  3T4V A;  1DGW A;  1U0A A;  4K8R B;  1H2M A;  2BQP A;  2A3W A;  2ARC A;  3JQX A;  5F2S A;  3WXP A;  1RYY A;  1LHU A;  2WL1 A;  4QPW A;  1AR9 1;  4NWV A;  1RTV A;  5BNN B;  4HPK A;  4DEQ A;  4COV A;  3B93 A;  2CNA A;  2BOJ A;  1DLL A;  3E5Q A;  5K9Y A;  2GAL A;  5LBC A;  3HOB A;  4ET7 A;  1F2N A;  4B1L A;  3LPF A;  3AP5 A;  2HKX A;  2ZML A;  4JDN A;  4KU7 A;  4MGZ E;  4XPV A;  3VBU C;  4AI1 A;  3D0S A;  3HN1 A;  1H9W A;  4CPB D;  1AYM 1;  4UFH A;  2XXZ A;  1AF9 A;  1HV1 A;  3ZO0 B;  4FVV A;  4CUG A;  2BBV A;  1W6Q A;  4D8M A;  1C5H A;  1RUF 3;  1YQ6 A;  4OYU A;  1BMV 2;  2FDK A;  1GQP A;  4QWN A;  4AOC A;  2YRO A;  4GZ9 A;  4YZ1 A;  3N35 A;  2VZU A;  2ARX A;  2ZGN A;  1UU4 A;  3DPR B;  4P9X A;  1VJ2 A;  4EJR A;  1MPX A;  2RDR A;  4XFI A;  1YXW A;  1YJK A;  1AL0 G;  1UN1 A;  4MET A;  4QHB A;  2YFZ A;  3NV4 A;  4Q1P A;  4HKW A;  4A42 A;  3BI3 A;  3ILN A;  2ZX1 A;  1RHI 3;  1US2 A;  4Y22 B;  4MGT A;  4FFG A;  4ZU4 A;  1U5Z A;  4WVZ A;  1T6B X;  4YZ2 A;  4HN1 A;  1DYP A;  4Y5T A;  2GNT A;  3WIN E;  3ZN6 A;  4I02 A;  2GU9 A;  4K40 A;  4FTS A;  1TNF A;  3FHA A;  4PT6 A;  5EXO A;  3SCF A;  2VGD A;  1GZW A;  4IEO A;  3UKT A;  4A3X A;  1H4H A;  5C3S A;  3MFA A;  5FJK A;  3PUI A;  3ZYB A;  1HIX A;  5BNP A;  4ARY A;  5DUW A;  3BIE A;  3T1L A;  5FZF A;  2VW2 A;  1BEV 3;  2WNV A;  2N7G A;  2WQZ C;  1EAH 2;  2XJS A;  3CKH A;  4MGY E;  4G9S B;  3N3H A;  5J3U A;  4PDW A;  3WD5 A;  4LBN A;  4Q8L A;  3T0B A;  3SEP A;  3AVS A;  4D6R A;  1OA3 A;  4PBP A;  4JKM A;  4Q4W 3;  2VNV A;  1GIC A;  3OBR A;  2XJR A;  4IE0 A;  4L99 A;  1SCS A;  2QQI A;  3KQ4 B;  4RN5 A;  2ZA9 A;  4QXH A;  1ND3 B;  1DFQ A;  1OOP C;  3QD6 A;  4NII A;  3ZYJ B;  1B35 B;  1NY7 1;  1RMU 1;  3PJY A;  4CEW C;  1LHN A;  4E4Z A;  2IXI A;  4UFK A;  4YZ5 A;  3SMH A;  2O0O A;  1QJX 2;  2IXH A;  5FWE A;  4KWK A;  1C8M 1;  2O8Q A;  3OYW A;  1AYN 1;  3CEW A;  2RJK A;  1RUC 1;  2A6Z A;  4QU1 A;  3VZJ A;  3T2P A;  4H2A A;  1O3Q A;  3J4U H;  5E6H A;  4AQT A;  2QQU A;  3VBR C;  5T5O A;  2JDZ A;  4IV1 A;  1HQN A;  4DIQ A;  3JD7 2;  1DQ2 A;  1L7R A;  3MIC A;  1PMI A;  1V9U 2;  1RUJ 3;  3PME A;  5FCC A;  1WA4 A;  1W28 A;  1E5R A;  1ZZ6 A;  4IE5 A;  2OA2 A;  2ZMK A;  3VL9 A;  5CZK A;  5GLV A;  4H7L A;  4Y5S A;  5JMO A;  1JZ2 A;  5EFU A;  3H7Y A;  2G19 A;  4Q2F A;  5BUV A;  1EV1 1;  5H9P A;  1N1T A;  3CJX A;  4PBO A;  1BLZ A;  1FT9 A;  5A3L A;  1VB2 A;  3SH5 A;  2R1D A;  5F5C A;  3UYJ A;  1PVC 1;  3PVO A;  2BVB A;  3MGU A;  1C8M 2;  4CP9 A;  1GZC A;  5E89 A;  1UZY A;  3MIB A;  4FP3 A;  4XAB A;  1V6K A;  5CKQ A;  5FZ8 A;  1G6N A;  1NE6 A;  2KD7 A;  2VG9 A;  3III A;  1MS5 A;  1YUD A;  3Q8C A;  5FPB A;  1RUI 2;  1EV1 2;  2JXA A;  2PA7 A;  3HD8 B;  5FP9 A;  4URA A;  2XHN A;  4PJY A;  5LA2 A;  1FV3 A;  3M2M A;  3POS A;  1LOC A;  4A4A A;  4GD4 A;  2E26 A;  2BJS A;  1KJR A;  1CWP A;  4XC9 A;  1N3Q A;  3ZPO A;  4XCA A;  3H3Z A;  4LBK A;  4WM8 A;  1H0B A;  3FL7 A;  3ACI A;  3ENR A;  4CP9 B;  2WC2 A;  3T3Y A;  1V9U 1;  1QNW A;  2VMC A;  4I0B A;  4FT8 A;  4BQX A;  2C24 A;  1LHV A;  4N43 A;  4YGB A;  1J58 A;  3M70 A;  2P17 A;  3I2K A;  1UZ0 A;  1JZ3 A;  2ZS6 B;  5GZC A;  2P34 A;  5FXZ A;  2BEO A;  3RSJ A;  3AXE A;  2RMU 2;  1EPW A;  4Z07 A;  4KL1 A;  5DN2 A;  3WG4 A;  4XXP A;  3ZR6 A;  5LBF A;  5J7M A;  1ZRC A;  3WDX A;  1RJ8 A;  2D40 A;  1C28 A;  1SFY A;  5F1R A;  4MG2 A;  1NXM A;  4RSU A;  1GWM A;  4XMI A;  3CL1 A;  1RUG 1;  4CDW C;  4CXX A;  1ULF A;  2ARE A;  3PVE A;  2A7A A;  1QY4 A;  3HIF A;  1AHS A;  1GQG A;  3AZW A;  3GYD A;  3H9A A;  4QX5 A;  5KHH A;  2NPI A;  2IXK A;  3TEW A;  2WT1 A;  1D4M 1;  5FZG A;  5K0U A;  4GAZ A;  5FYZ A;  1H4G A;  4QX0 A;  4E9K A;  2ZOE B;  3RJR A;  5L7O A;  5KHJ A;  4P02 B;  5BNN A;  1AXZ A;  2FDI A;  3LF7 A;  2YPD A;  5A7W A;  1CD3 G;  1K12 A;  4Y26 A;  4LNV A;  4LHK A;  2Q1F A;  2BNM A;  4JTN A;  2A6Y A;  3THP A;  4YSF A;  2EF6 A;  5EV7 A;  1RUD 3;  5A3O A;  2OUJ A;  2QQM A;  3JB8 A;  3SCG A;  1GZT A;  5FPL A;  1V6M A;  1W6N B;  1X8M A;  2WNU A;  1B35 A;  1OVP A;  3LA2 A;  4HT1 T;  5JXH A;  1GMM A;  4UBH A;  3J9S A;  5EP9 A;  5CEH A;  2JEN A;  1ND2 A;  2O14 A;  1YFW A;  4FPE A;  5T5J A;  2Y34 A;  5FYU A;  2WNV B;  5CKM A;  4NHY A;  4B4P A;  4YW4 A;  2RR1 2;  5DDJ 2;  1X50 A;  5DAW A;  1ZRI A;  1AR8 2;  2RS1 2;  3ZKY A;  3U11 A;  2VMD A;  1FOD 2;  1SLA A;  3WZ1 A;  3OGR A;  1F8V A;  2FDG A;  4CCO A;  1OVS A;  2WO3 A;  3NAP A;  1WME A;  2ZCW A;  3PMS A;  3MLJ A;  4XJW A;  3H1W A;  3CO2 A;  4GB3 1;  1Y9M A;  4QPG A;  4Y3O A;  2WS9 3;  5FP4 A;  1ZVF A;  2XUM A;  1O7F A;  1S4C A;  4XBQ A;  1OXC A;  3ZN6 B;  5A6X A;  1UKR A;  3EHK A;  5A1A A;  2HWC 2;  4CUC A;  4OVE A;  4E4H A;  3E6D A;  4FPO B;  2I07 B;  4J1X A;  3AMP A;  3BAL A;  5DUX A;  4DIN B;  4D6Q A;  2WO7 A;  4XVH A;  1FPN 1;  1GP4 A;  1F4A A;  2GME A;  4COY A;  2Y8K A;  1C4R A;  1X7N A;  2J1A A;  1MZ5 A;  1W05 A;  4YW7 A;  4M3C A;  2C26 A;  5CFC C;  4XQD A;  3BU0 A;  4YM0 A;  1GYK A;  1LB2 A;  1RUI 1;  3MUY 1;  4QPG B;  1YQ8 A;  2PLV 2;  3DEM A;  3K75 B;  1MS8 A;  1O6U A;  4XE9 A;  4K1Z A;  1Q43 A;  1HB1 A;  4LBO A;  4Q4X 2;  4XIK A;  2Q8E A;  3TRS B;  4QX3 A;  4FI9 A;  4HN0 A;  4BA6 A;  3WF1 A;  1ZRR A;  2YDE A;  2DBI A;  2PXJ A;  1LES A;  4LR4 A;  3W5N A;  4N53 A;  4V1P A;  1GOH A;  3BKZ A;  3W20 A;  2JJ6 A;  4NRO A;  3ZDS A;  4AW7 A;  4CPB A;  2AR6 A;  5C4W C;  4MUV A;  4E4D X;  3LFI A;  4OZX A;  2OVU A;  2HEV F;  2QQP A;  1GR3 A;  1RHI 1;  1MZE A;  1R09 2;  3GJA A;  4SBV A;  5F5Q A;  3DN7 A;  3AP4 A;  2E7Q A;  1NX9 A;  2CYF A;  1LR5 A;  4Z92 B;  4I0W B;  1UMZ A;  4COW A;  3MV1 1;  3UKN A;  4ZZ8 A;  4XTP A;  1QJU 2;  3CJI A;  1WA6 X;  4K7J A;  2ARA A;  4LK7 A;  3UKV A;  2XKO A;  4QM9 A;  3FHQ A;  5FO9 B;  2Q8D A;  1UU6 A;  3G6J B;  2EVX A;  3W9A A;  1PZ8 A;  1G86 A;  5E1R A;  3C7G A;  1MS3 A;  3S0M A;  3MIH A;  4FQZ A;  1HN0 A;  1POV 3;  4CE8 A;  5ABJ A;  4N7I A;  5FRE A;  1IG3 A;  2XOM A;  2ZEZ A;  1CAV A;  2ZGL A;  4XQ4 A;  5FIX A;  3RWN A;  5B4N A;  2FDF A;  4HK9 A;  4CRQ A;  4HMZ A;  4L9B A;  2VQU A;  1UOG A;  2EID A;  1Z7S 3;  3MLK A;  4ZS2 A;  3U78 A;  3WCS A;  5JR2 A;  1VP6 A;  1YO8 A;  1FAT A;  2BYV E;  4GIQ A;  4NPL A;  2CSG A;  1N1S A;  1GOF A;  1J3P A;  4LLF A;  2NMO A;  2VVF A;  3FJS A;  2NZ9 A;  5FP7 A;  4OQ8 A;  2PQS A;  1XE7 A;  1IKQ A;  1SDW A;  4CTE A;  4Y1U A;  4XF0 A;  2ORZ A;  1APN A;  1L7L A;  1D0H A;  5IK8 A;  2VZO A;  4W4Z A;  4FPY A;  4RR3 A;  5FYI A;  3TEX A;  1JYW A;  2HWB 2;  4YG3 A;  4FXG B;  2WKK A;  1CQ9 A;  1KDK A;  5G05 L;  5IHR A;  4BLI A;  5IK5 A;  1QH7 A;  2BV4 A;  4K9S A;  2R30 A;  1OBN A;  1W6N A;  1W8T A;  4BXS V;  1NLR A;  4C1W A;  1GP6 A;  5AC9 3;  5CU1 A;  4JDO A;  2GSY A;  1W6O A;  3WNX A;  1CR7 A;  3VBS B;  3AMH A;  5FZI A;  2ZAH A;  4IEY A;  1HV0 A;  4LO4 B;  5F6L B;  2OQ6 A;  3KV4 A;  1N47 A;  3DKW A;  4HSL A;  5IW0 A;  4NAM A;  2JB8 A;  1MQT B;  2VOK A;  3VHO A;  1VRH 2;  2ZPX A;  1XJA A;  3WQ0 A;  1XU2 A;  3H8O A;  2BNN A;  1JZ4 A;  3OBZ A;  3A21 A;  1OMI A;  4QB6 A;  4UW3 A;  1AL2 2;  1S2E A;  3FUQ A;  3OJB A;  3KF3 A;  4IE6 A;  4XEZ A;  3SQO A;  3K48 A;  4UFM A;  5FUN A;  3LEM A;  2P3I A;  4W65 A;  4W50 A;  3TNP B;  4PLN A;  4KU8 A;  3WNO A;  5IVC A;  2UU8 A;  1ULG A;  2NLR A;  1UCX A;  2ZHK A;  2DVF A;  2ADD A;  1ENQ A;  3WDU A;  5EWS A;  4AL9 A;  1CN1 A;  4E4S A;  5A3P A;  3ASI A;  2Q8C A;  3ZSE A;  2XBO 3;  4XDQ A;  2QZ2 A;  1G9C A;  3SEE A;  4WM7 B;  2GC1 A;  4YW2 A;  1O4T A;  3NMB A;  2WO1 A;  3LDK A;  4HKO A;  3VLB B;  4CDU C;  5KBF A;  3IAQ A;  5A32 B;  1CAU A;  2JE9 A;  5FZK A;  3GM8 A;  3IDB B;  3VDC A;  1W0O A;  4JX0 A;  4P5H A;  5F3G A;  4OUE A;  4A3Z A;  2VOX A;  4BWO A;  1GU3 A;  2VW0 A;  4KG0 A;  4TLF A;  2GN3 A;  2WQ4 A;  2WWS A;  2DUQ A;  5J48 A;  2JDU A;  1SLC A;  2R07 1;  5F9T A;  3CNA A;  2AEY A;  3OYW B;  4NIA A;  2Y0O A;  5DMY A;  3GBF A;  2C9A A;  2R06 3;  1OLM A;  3D82 A;  2R49 A;  1XNA A;  1OC1 A;  2WLP A;  1HRI 3;  5HI0 A;  1YFY A;  5I8Y A;  1OFN A;  5FYB A;  1JZ7 A;  1VPH A;  4RGA A;  3GNE A;  5F5A A;  5DAQ A;  2CAV A;  4CP2 A;  2JIG A;  3ETP A;  4JGZ A;  4JHT A;  4XJU A;  1C1F A;  1RHI 2;  1S2B A;  1DHK B;  3R0R A;  3JBG 1;  1RUF 1;  3JUU A;  4EN9 B;  1BKZ A;  1R08 1;  2E32 A;  3A0N A;  4P9I A;  3VD3 A;  4BJ0 A;  3J7N A;  5FO8 B;  3BOW A;  3O0V A;  2HJI A;  3VDD B;  2VL4 A;  1D2Q A;  2CWS A;  2PHL A;  4OHW A;  5D21 A;  4DNY A;  2EXJ A;  4MHU A;  3OGV A;  3D5O A;  1VBC 2;  2FBE A;  3O0X A;  4XF1 A;  4B7K A;  4MXW B;  3WF3 A;  2PLV 1;  3AVR A;  1W6Q B;  2HH9 A;  3T2O A;  2R04 1;  4B3N A;  4IV3 A;  4P9Y A;  1S0E A;  2D5F A;  2G4I A;  4XF4 A;  3VBF C;  3OGG A;  4KGG A;  3PIJ A;  4BM8 A;  5JOW A;  1XNT A;  1QQP 2;  2VUA A;  4U36 A;  5CFD B;  5CFD A;  4CUA A;  3CLP A;  2DFB A;  4XYX A;  5IAV A;  4XJZ A;  5CNA A;  4YNI A;  4E8C A;  4L92 A;  5JXJ A;  2YV8 A;  4GH4 C;  5DG1 A;  3BOP A;  3ZFE A;  5I0U A;  1GUI A;  2IXJ A;  3L2H A;  2CV6 A;  3B5L B;  4PQ9 A;  3AC0 A;  1ZM1 A;  4XJ9 A;  2WZR 3;  5DAP A;  2RS3 3;  2XPJ A;  2FCU A;  4HET A;  3WNK A;  3RZJ A;  1AL2 1;  4JRL A;  5A3U A;  3CU7 A;  3VKL A;  4AGR A;  4QKB A;  3J8F 1;  2JEC A;  1ZBA 2;  1O3S A;  1MEC 3;  4EZ4 A;  4LXL A;  3O1R A;  1TE1 B;  2XWB B;  4QPI A;  1DZQ A;  3C7E A;  5HV4 A;  4ATE A;  1RUJ 2;  2K9Z A;  4YVW A;  2WQ8 A;  5F7U A;  5IVF A;  1D2S A;  3FBM A;  4IL7 A;  1CX4 A;  3NRU A;  1I9R A;  2P2K A;  3VKN A;  3WG2 A;  2Y60 A;  4W8J A;  4UF0 A;  1TVG A;  2Y64 A;  3IZO A;  5FPV A;  3J7M A;  3VBO B;  4CCM A;  1COV 3;  3NNF A;  1ASJ 1;  1U12 A;  4I09 A;  1REF A;  3RZG A;  1QEX A;  1JU3 A;  2FCV A;  2VJX A;  3DYP A;  4H7M A;  5IVY A;  1HDK A;  1OHF A;  1W04 A;  3KV9 A;  3ECQ A;  4N53 B;  5APA A;  2R07 3;  4AAP A;  4XDO A;  5HCH A;  3H3L A;  4CCD A;  5A3T A;  4O9E A;  5C9A A;  2QTW B;  3LOB A;  1NA1 A;  5DUU A;  3VBF B;  4LO5 B;  3AM2 A;  4HBN A;  1W6M A;  3WW4 A;  3FN9 A;  2ARB A;  3LWC A;  1NLQ A;  3RMY A;  5IVB A;  2AEN A;  3VN4 A;  3IMM A;  2GN7 A;  4WM7 A;  1VMF A;  3A23 A;  1EV1 3;  1WLT A;  1X9P A;  3KV5 A;  3NNL A;  5IT6 A;  5FXW A;  2ZKN A;  5CAZ A;  2OQ7 A;  3C7O A;  2IWG B;  1RL3 A;  3DKQ A;  1MQT C;  1O5U A;  4JQR A;  1X9T A;  1OD5 A;  1SDD B;  1OA2 A;  2XVG A;  3ORJ A;  2CU5 A;  4FPC A;  4LHS A;  3ZIX A;  1LEN A;  2B42 B;  2UWC A;  2FZ2 A;  4QT6 A;  4Y20 B;  3POI A;  1W3V A;  4IGQ A;  4LIT A;  1QU0 A;  1W2A X;  4B4Q A;  1COV 1;  3JXS A;  2CHH A;  5T52 A;  2VO5 A;  5A6Z A;  1UOB A;  4GMP 0;  3RYK A;  3SNM A;  5FY5 A;  4QQO A;  4KGQ A;  2G9Z A;  4L2N A;  5FMB A;  5FMD A;  5LRR A;  3BGA A;  2PMW B;  5FYV A;  2WRA A;  3VDD C;  1AX2 A;  1UKG A;  1O8P A;  3OF1 A;  3P3P A;  2I2S A;  4AQS A;  2OZJ A;  3A0K A;  1CX1 A;  1W8Z A;  4ZU5 A;  2B9V A;  1PO1 3;  4DPN A;  1QJY 1;  2GDF A;  5FYC A;  1F31 A;  2OPW A;  2Z4F A;  3LFM A;  1BBT 1;  4CCE A;  3E1F 1;  4F83 A;  5JMC A;  4BLJ A;  5KWR A;  1HB4 A;  1J3Q A;  5SV8 A;  1O4Y A;  5T5P A;  4NUB A;  1VBA 1;  3TAY A;  1DU3 D;  4ES8 A;  2GMM A;  5HCB A;  1H6X A;  1R1A 3;  4EZH A;  1YCI A;  1PVC 2;  5D1I A;  4WZC A;  5LB6 A;  5FY0 A;  4BPZ A;  2JD9 A;  4LBQ B;  2W39 A;  4YWA A;  4CYD A;  2VXJ A;  3OB8 A;  3MDP A;  1PGL 1;  1AX0 A;  5FRA A;  3O1P A;  4FSJ A;  5FYT A;  1UQX A;  1B09 A;  3I2F A;  4CUB A;  2VVD A;  4QXB A;  5SV5 A;  1LNS A;  5J98 B;  4NO4 A;  3BTX A;  1AXK A;  5A33 B;  5A33 A;  1W06 A;  4ATF A;  4KH9 A;  4P9L A;  1AR6 1;  3FBY A;  4Y1Z A;  1J59 A;  2PAE A;  2XVK A;  5IJR A;  4A7Y A;  2VZ3 A;  1V00 A;  1QJU 1;  2D97 A;  5FDB A;  2XQX A;  2HWD 1;  2RR1 3;  1HQW A;  1UY1 A;  2QQL A;  4X8P A;  1Q8Q A;  2FQP A;  1FOD 3;  5BNO C;  1DBN A;  3KT4 A;  4LBQ A;  4HON A;  2RM2 1;  5FWJ A;  1Q8P A;  2WN2 A;  4UT5 A;  4CP0 A;  5HXM A;  3M3C A;  5HBA A;  4N43 B;  1JYT A;  4GB3 2;  3B9C A;  1I3H A;  5FMO S;  1V6J A;  2W08 A;  2FDJ A;  2ZXQ A;  2VVE A;  4QPI B;  1RVF 1;  4GWN A;  1S55 A;  3P5B A;  1K5M A;  2ZGR A;  3RI9 A;  2VEC A;  3H0O A;  1RUJ 1;  2W87 A;  3URF A;  5LEK A;  1XE8 A;  4P5Y A;  1PK6 A;  2Z69 A;  3I3B A;  2DCT A;  1QJZ A;  4HKL A;  1NZC A;  3TN9 3;  5FZB A;  3FMG A;  5FZE A;  3IWZ A;  4S2G A;  3RDI A;  2IVJ A;  1VBE 1;  4UFJ A;  1NCQ C;  3V64 A;  2WZ8 A;  1AYM 2;  3K3O A;  5D8A C;  4BIO A;  3J7L A;  3O1T A;  2QFE A;  1H30 A;  3CDZ B;  2VNG A;  1PGW 2;  4RS5 C;  3TYJ A;  2B46 X;  5DQ0 A;  1DGR N;  1PO2 3;  1EAH 1;  4E2Q A;  1DGR A;  3W21 A;  5GZF A;  2BWC A;  1FXZ A;  2Y6G A;  4LUM A;  1OFS A;  3RG0 A;  4XXA A;  3BTZ A;  3RPQ A;  2YXS A;  1QJY 3;  4IEX A;  4IW3 A;  4XTM A;  4XAA A;  2Q8O A;  4AFA A;  1HN1 A;  1GBG A;  2CL2 A;  3GZA A;  3RRD A;  2VBP A;  4U2A A;  1O91 A;  4O9G A;  1S0C A;  5GZG A;  1ASJ 2;  1XYP A;  5JZG A;  3H7J A;  1WKY A;  1W0N A;  1W9W A;  3PUQ A;  1RUH 3;  1R09 3;  4R9A A;  1CZT A;  2JG9 C;  1LOB A;  4XFF A;  1Q8O A;  3ZX7 A;  1FPN 3;  2P6C A;  4QKN A;  2XWJ B;  5LBB A;  5BNO B;  5DXD A;  4OI0 A;  2E33 A;  1SQ4 A;  1ZA7 A;  1ODN A;  5JCT A;  1SHW B;  2YBS A;  3K4Z A;  3IPV B;  4AQ6 A;  3I59 A;  2JB4 A;  3PLQ A;  3TEY A;  2PHX A;  2Z79 A;  3VKF C;  3E97 A;  5LBE A;  1WZX A;  1HQL A;  2RM2 2;  4QX1 A;  4DO0 A;  4Y33 A;  4FPK A;  3PIG A;  2WFF 1;  2F4P A;  2A3Y A;  1XPW A;  1FV2 A;  4KQ7 A;  1ENR A;  1PZ9 A;  4MZU A;  3S7E A;  2F17 A;  1VBD 3;  5IAX A;  2ATF A;  2ZGU A;  2B5H A;  3WNN A;  4CU7 A;  4LA3 A;  1H8T A;  2O8O A;  2ZEX A;  4DUX A;  1J1T A;  1Z7S 2;  1ZZC A;  2G1M A;  4LBM A;  5I0T A;  2WSU A;  5FP3 A;  4AVC A;  1QQP 1;  4ZXE A;  3LIG A;  1ST8 A;  3S57 A;  2P3K A;  3AXD A;  4AFD A;  3AL6 A;  4CU6 A;  1JYC A;  1ND3 A;  3ZFG B;  3WG3 A;  1YIP A;  1GNY A;  1WMF A;  1DG6 A;  2WYF A;  4FXK B;  3KT7 A;  1RGS A;  2D6L X;  1PIV 3;  3CJI B;  4MHR A;  4FPH A;  4NRQ A;  4QGN A;  5FZM A;  4GQ7 A;  1DQ4 A;  1KQR A;  3L2Y A;  2BRT A;  2D6P A;  2DVA A;  1AR7 3;  1NUK A;  2ET1 A;  1MAC A;  2PYT A;  2HWB 3;  3HQX A;  4YYO A;  2VMF A;  3NJV A;  2WFF 3;  1LRH A;  4PLO A;  2HEW F;  2J42 A;  3R4S A;  4BE3 A;  1RUE 2;  1SLB A;  1Y3T A;  2VZV A;  3VDB A;  2W68 A;  1JUI A;  1LTE A;  1R08 2;  1W8H A;  5FXV A;  2ZGM A;  4IET A;  4LA2 A;  4MH0 E;  3NJX A;  1SZB A;  3IT8 A;  2EXH A;  2ZHM A;  4FPF A;  1T6G C;  1OF3 A;  2YY1 A;  3P1I A;  1A8M A;  3SHR A;  3AKT A;  3SH4 A;  5C8C B;  4P14 A;  2BP6 A;  2QQW A;  2VNR A;  1WW4 A;  1WUV A;  4GMP 3;  4KWL A;  3POG A;  1UF2 C;  4IUG A;  1WCK A;  4S2F A;  5FPZ A;  5FY1 A;  4WV8 A;  2EIE A;  1BHG A;  5C70 A;  1NA1 B;  5A7Q A;  1SCR A;  4CP1 A;  4IEU A;  3O12 A;  2DU0 A;  1TME 2;  1WBL A;  4M3C E;  3VBS A;  1RXF A;  4PIX A;  3THT A;  2ZX4 A;  2BPA 2;  1QJE A;  3R6S A;  2WZR 1;  2WFP A;  1GNZ A;  2C6S A;  1A78 A;  2EIC A;  4DFS A;  4BQ5 A;  3O1V A;  5E16 A;  3DF0 A;  4CDX A;  1RUC 2;  4A7K A;  4Q4V 2;  3VBH A;  4DOU A;  5C8C A;  3CQO A;  1VR3 A;  2RVA A;  3X29 B;  1BVP 1;  2R6Q A;  5J09 A;  2A1X A;  1WGP A;  2R16 A;  3OTF A;  3OEB A;  1Q5O A;  5FOB B;  3IMN A;  3OUH A;  3VDA A;  1TMF 2;  4RHV 1;  4BU2 A;  4NID A;  2ZMN A;  5DZF A;  5EHD A;  2V73 A;  5EYX A;  3ZFF C;  2EIB A;  3HNB M;  3TOJ A;  5L19 A;  3M7A A;  1JMU B;  3HPN A;  2HYX A;  5GJ6 A;  1GAN A;  4XUN A;  4XF3 A;  1SG3 A;  4RGK A;  1ZRD A;  4CA9 A;  1J1L A;  3AYC A;  2VPV A;  1W6P A;  3KCC A;  3JU9 A;  5A7O A;  2AAC A;  4HAN A;  3NV3 A;  4YGD A;  3EO6 A;  3POY A;  5TSW A;  3M3E A;  1G9F A;  1VAL A;  2JG9 B;  3LQC A;  4CSW A;  1W8F A;  4ZY9 A;  5FY8 A;  1NCR C;  2PTM A;  4YGE A;  2TUN A;  5L9V A;  2OX0 A;  3I3Q A;  2HWE 3;  4Q4V 1;  3VBU B;  3U4S A;  4FFF A;  4AXO A;  4X6R B;  4IXL A;  1OPO A;  3MLL A;  4K21 A;  4J1W A;  3EQE A;  3ZSM A;  3C3V A;  4A45 A;  4E2S A;  5A7W B;  2WDB A;  1NCQ B;  3FFZ A;  5ACA 3;  1QJF A;  4ISR A;  3ZFF B;  4BQW A;  3I2J A;  1R64 A;  2E7A A;  3RZH A;  1ENS A;  2Q1M A;  4YVS A;  5FZ4 A;  3K46 A;  2DUR A;  2XL7 A;  3J8F 2;  4Y4R A;  1LGC A;  1DQ1 A;  3C7F A;  3C7H A;  3RNS A;  1OI6 A;  2OXB A;  2OII A;  1K3I A;  2VH9 A;  3DPR A;  5F8P A;  5IVE A;  4MV2 A;  4N7U A;  2V4A A;  1HB2 A;  1VBB 3;  2QJV A;  2TNF A;  5A7N A;  1AYN 3;  4DXZ A;  5CG9 A;  4OMC A;  2E9Q A;  4HFS A;  5JAX A;  3UNP A;  3AMM A;  1WW5 A;  3BOD A;  1VBA 3;  2XJQ A;  3BIW E;  3LAG A;  3ZXJ A;  2DVB A;  4P9G A;  5FK8 A;  2R7E B;  2WJS A;  4MAD A;  3RMX A;  1QQP 3;  3PJQ A;  3BYW A;  1S0B A;  1RIT A;  1RUD 1;  5HXV A;  1YWK A;  1BJQ A;  1YLL A;  2UYB A;  4XZP A;  4YM3 A;  1AZD A;  1VBD 1;  1XRU A;  4YG0 A;  5C3Q A;  5JI9 A;  4MGS A;  2C1F A;  3H1M A;  3CHX A;  4Q0Q A;  2VUD A;  2RS3 2;  4IEP A;  2QQV A;  3WG1 A;  1AJK A;  1VBC 1;  3ZSL A;  3N36 A;  4HXC A;  2XR4 A;  4NE9 A;  3ZDV A;  1X8E A;  3PNA A;  1TNR A;  4CXY A;  1RUN A;  4FO9 A;  4LUK A;  5DPN A;  2WWJ A;  4GKY A;  1S0G A;  3KWV A;  3AP6 A;  4M4R A;  4AFC A;  3OSD A;  5I0D A;  2JG8 A;  4I30 A;  5GLU A;  4LBQ D;  4AHX A;  1VAK A;  5I0S A;  1W9S A;  4LOR A;  1MVQ A;  1BK1 A;  3I8T A;  2WR9 A;  2YU1 A;  3Q8E A;  4LLO A;  1H1A A;  4PDW C;  5CIR A;  2WZP P;  1CES A;  2ES3 A;  2Z5W A;  1RB8 G;  1SLI A;  2D3R A;  1FI2 A;  1TG7 A;  3MW3 A;  4LTA A;  1OOP A;  4YZ4 A;  4C1X A;  5CKN A;  1XND A;  4UW6 A;  1JHN A;  3INA A;  4AFM A;  1NYW A;  2K46 A;  4JVA A;  3MV0 1;  4Q8K A;  2QCS B;  3WEZ A;  2IXC A;  4BIF A;  1DYK A;  1LGB A;  2DDU A;  4QQH A;  3WDW A;  4GXL A;  5I8T A;  1RUO A;  1BXH A;  1POV 0;  3RGB A;  1VB4 A;  4FTE A;  2R04 2;  4Y5Z 0;  3WCR A;  4CCN A;  5B2G B;  1EAH 3;  5JOY A;  1D0G A;  4FOV A;  4XET A;  4LKE A;  1PGS A;  2RDQ A;  3ILF A;  2DFC A;  2JKB A;  3DYO A;  3R05 A;  1HXS 3;  4Q4W 2;  4ORF A;  1OLM E;  2X5I B;  3VBR A;  3IM0 A;  1PVX A;  4IV1 C;  4LHN A;  3ZYI B;  4BK4 A;  2YPJ A;  4AR2 A;  1AR9 3;  1Y9G A;  3LA7 A;  4IEW A;  4R4X A;  5F3I A;  3V0A A;  1IG0 A;  4LBJ A;  2XJP A;  1Z7S 1;  2JWP A;  3HEI A;  4ZS3 A;  3ROU A;  4TTG A;  1XQN A;  1UIJ A;  1QKQ A;  2ZGO A;  3D4K A;  3O0W A;  4JV4 A;  1UL9 A;  4Z1V A;  4ZHN A;  3AJZ A;  1CJD A;  4Q29 A;  4BXF A;  4ES9 A;  5LA0 A;  2RDS A;  1HX6 A;  4DY5 A;  3WP6 A;  3VD4 A;  1OUR A;  5GLT A;  3GZE A;  1OD3 A;  5FZ9 A;  4DZG A;  3BUC A;  4XDP A;  3I3M A;  1LOA A;  2MEV 2;  3F95 A;  3UL2 A;  1H9P A;  1US3 A;  1POV 1;  3FHI B;  4WM8 B;  2VCB A;  3ZFG C;  1MEC 1;  1SLT A;  2VMI A;  3ZIW A;  2RJL A;  5F37 A;  3SLI A;  4M3C B;  1VE0 A;  3KS7 A;  5C5T A;  4NPM A;  3PUH A;  4LO6 B;  1OF4 A;  3HBZ A;  2W0X A;  1S0I A;  5C3O A;  5T54 A;  2GAU A;  4RR3 B;  3DYM A;  5FLH A;  4OHZ A;  5A6Q A;  4OQ9 A;  4OUM A;  4PI0 A;  4ZZ5 A;  3FLR A;  4XW3 A;  5EPA A;  3RZK A;  5E8A A;  3SIT A;  1XU1 A;  4XJA A;  3H1Y A;  2BGP A;  3M4F A;  3PVN A;  4Q26 A;  2OYZ A;  3THD A;  4FAH A;  1DDL A;  2JD4 A;  5JSP A;  4X6Q B;  2ZHL A;  3MPP G;  2P4E A;  3POJ A;  2VQA A;  4YVS B;  3FZ3 A;  5IAT A;  5EJZ B;  4AHY A;  2RS5 1;  2W92 A;  2JKX A;  3N9P A;  4LOT A;  5F39 A;  3MO4 A;  1JN2 P;  2VD7 A;  4HG6 B;  4JTO A;  4WM8 C;  1C8M 3;  3E6B A;  2A6X A;  1C1L A;  1LKN A;  1NE4 A;  1R1A 2;  2X5I C;  5FZ0 A;  5A6Y A;  4D6S A;  1JS9 A;  1VMJ A;  1NCR B;  2QQK A;  4E27 A;  3AZZ A;  4M4P A;  4D0Q A;  3W59 A;  1D4V B;  1UPS A;  2JIJ A;  3IKW A;  2HYK A;  1SLL A;  2Y6H A;  4N43 C;  5LZ6 A;  1RUI 3;  2DCJ A;  1GSL A;  1DQ5 A;  1LOF C;  2R32 A;  1UYY A;  3ON7 A;  4Q5O A;  3LEI A;  3EBR A;  3JBG 3;  5GKA C;  1YC6 1;  2YG0 A;  3HR9 A;  1NXD 1;  3WP4 A;  5FFO C;  4BME A;  4AZZ A;  1P8J A;  2JDH A;  3AL5 A;  5GZE A;  4R9C A;  4EWE A;  1OKO A;  3Q8A A;  3AX4 A;  2CGP A;  4HVQ A;  5BV6 A;  1QH6 A;  3NKT A;  3GGL A;  1UZZ A;  2GNM A;  1XYO A;  5F32 A;  3GAL A;  2A6V A;  3KCY A;  4WVM B;  1M06 G;  5J1X A;  5K0U C;  4XFC A;  1ULO A;  3DXT A;  2LTN A;  1W8O A;  2WWU A;  4WZF A;  4AQ2 A;  2VQT A;  5L7O C;  1MR5 A;  2DTY A;  4XUT A;  5LA1 A;  3WW2 A;  3C2U A;  3HT2 A;  2XKP A;  5FBZ A;  5FPX A;  5IK7 A;  4IEV A;  2A73 B;  4CDQ A;  4TYS A;  3WQB A;  5J37 A;  1AR6 2;  2VBB A;  5K7P A;  5FYY A;  5EZW A;  5JXI A;  1F4H A;  4UWD A;  2WNU C;  3N9Q A;  1GP5 A;  3USS A;  3VZL A;  3U14 A;  4AVS A;  1TZO A;  4CZS A;  3BPZ A;  4D7T A;  3IDE A;  3VZO A;  5I91 A;  2LRP A;  1UO9 A;  1YI9 A;  1LGN A;  1PGL 2;  1TMF 1;  4TZD A;  4JCK A;  1AYM 3;  1A8D A;  4XFB A;  4TXW A;  2JE8 A;  2W9X A;  3IDA A;  2VU9 A;  2Y26 A;  1FMD 3;  1UYX A;  4NMI A;  4RYD A;  4QB2 A;  1URX A;  4QU2 A;  2UWB A;  4W6Y A;  2WT0 A;  3U07 A;  4CDQ B;  1YQ2 A;  3N9N A;  1GFF 2;  3PDQ A;  1OA4 A;  1SFP A;  2WSV A;  3RYR A;  3WY6 A;  3WUD A;  5KC5 A;  4QPG C;  1CIY A;  2W94 A;  4RQP A;  4PDW B;  1UMI A;  1X36 A;  2BGO A;  4RHV 3;  2DYC A;  4Y1Y A;  4OI4 A;  5A7P A;  4CVU A;  5IFT A;  1GOG A;  1UOJ A;  4A2U A;  4HK8 A;  2ZKL A;  1HRV 1;  3W5M A;  1CJP A;  3MID A;  4UW5 A;  2WNU B;  3OCP A;  3DUI A;  2QE3 A;  4QXK A;  4NHM A;  1BK0 A;  1UU5 A;  1Z0H A;  1YYN A;  3BN6 A;  3D6E A;  1QNY A;  3I3E A;  4M01 A;  4MXW A;  4V2W A;  4FP2 A;  3UT0 A;  5DDJ 3;  3AMQ A;  1IGO A;  2A3X A;  3AFK A;  3LPG A;  5HCA A;  1SPP B;  3FLT A;  4HL0 A;  4NVP A;  4CEY A;  5FYS A;  3U37 A;  2VY0 A;  3E6C C;  2JX9 A;  2YC4 A;  5BPX A;  5KHI A;  3VBO C;  3ZXE A;  2Y6L A;  1NG0 A;  1UY2 A;  1H8T B;  1W9F A;  3MUZ 1;  1OUS A;  4GMP 1;  4KG8 A;  2B9U A;  5CVR A;  2EAL A;  2D6O X;  2E53 A;  4LO7 A;  4Q4Y 2;  5DDJ 1;  1YQC A;  2H0B A;  3IPV A;  4UBG A;  4N53 C;  3UES A;  2VM9 A;  2HWF 3;  5C4W A;  3QOP A;  2ZBJ A;  3RWK X;  2C5D A;  4IGP A;  5KHG A;  1UOF A;  3T08 A;  4OUS A;  3VBH B;  4JRA A;  4PHZ A;  5C5U A;  2X29 A;  4QGL A;  4GJY A;  3Q9O A;  1CON A;  5EYY A;  1CAU B;  1WCU A;  2VZR A;  3NNG A;  4YVW B;  3RJ2 X;  3ETQ A;  3V0A B;  4OCT A;  3HMY A;  1H8V A;  2P6H A;  1ZA4 A;  5J36 A;  2ZEY A;  1NKG A;  1PIV 2;  1ZBE 2;  2R0F A;  4YZ3 A;  1ZBE 1;  1CAV B;  3VL8 A;  1O8S A;  3MIG A;  5FYM A;  1V6N A;  2ZHN A;  3LSD A;  2YGL A;  2VR4 A;  4JGY A;  4RFT 0;  2OZ6 A;  3HVD A;  2DVG A;  1PNF A;  1A3K A;  4M0H A;  4LMF A;  1XNC A;  1K5J A;  3PU3 A;  2JIC A;  4BK5 A;  4EWD A;  4QKD A;  4XOG A;  5C7G A;  3O1U A;  5FPA A;  5ABJ C;  4ZXK A;  4AHW A;  2CTV A;  2DBN A;  3S30 A;  5L36 A;  1YFX A;  2EXK A;  2SLI A;  4GWJ A;  3C8X A;  1AR8 1;  3JCI A;  3M1H A;  2P3J A;  2F6B A;  1UAI A;  2ZAB A;  4XHX A;  2GH2 A;  4OFG A;  5I93 A;  2OT7 A;  3NST A;  3H3U A;  4TSV A;  1BMV 1;  3LIH A;  4XHB A;  3ZXD A;  4B1M A;  4GUL A;  3WP5 A;  1CZS A;  4GWI A;  5A7S A;  2FD8 A;  2PHF A;  4R8H A;  3R4U A;  2EAA A;  3PUS A;  4AED C;  4ITC A;  5LW9 A;  5CA6 A;  2YBP A;  5JIA A;  2A70 A;  3WDY A;  3ZN5 A;  1UIK A;  1JXN A;  2GC2 A;  2TBV A;  2XUE A;  3QBQ A;  1RIN A;  1RUC 3;  4I2O A;  3POE A;  2MHF A;  1RC6 A;  1JYV A;  2D93 A;  5JPN B;  2JDM A;  2HBT A;  2BDR A;  4EQV A;  5A3W A;  4XQW A;  1ONA A;  3ZYR A;  1KS5 A;  1Y9Q A;  4Q4W 1;  2AGS A;  2YHJ A;  1W39 A;  4NRM A;  2J22 A;  4D7Y A;  3VKM A;  4PF5 A;  1GLH A;  1UY0 A;  4MYE A;  5KHK A;  4EN6 B;  3UJQ A;  1H1M A;  4AEJ A;  1QDO A;  4M0N A;  5LK7 B;  5DAB A;  1XC6 A;  4CDU B;  2WO2 A;  4Y24 A;  1EYB A;  2XJU A;  2KXL A;  4C0B A;  3MIE A;  1CAW B;  2DWR A;  4YG6 A;  3UGH A;  3T30 A;  1F5F A;  5ISL A;  3N7M A;  1YFU A;  2GP5 A;  2XJV A;  3V65 A;  2HWE 2;  5DAV A;  4FPJ A;  3LKJ A;  3WF2 A;  1ZRE A;  4ASL A;  2VCM A;  5LY2 A;  2NYY A;  3GZU C;  4LHL A;  2WA4 A;  2ZJC A;  3GCW A;  3PHM A;  3VD5 A;  3ACF A;  3E5X A;  2VAU A;  2BNO A;  1HRV 2;  4CDU A;  3VBU A;  2BW8 A;  3RS6 A;  5IVV A;  3UV9 A;  2CDO A;  2IZW A;  1MS4 A;  5BNP B;  2YUE A;  3VZN A;  4JC1 A;  4YW1 A;  1Q8S A;  2Q0A A;  1I6X A;  5FZ7 A;  5LRS A;  5IVJ A;  4HOO A;  1I5P A;  2W52 A;  2WAB A;  1OQE A;  4NHK A;  3TWI A;  1BEV 2;  1QIQ A;  4F7Z A;  1W8N A;  1SBE A;  4LKD A;  2Y33 A;  3WSO A;  5D8A B;  4IND A;  4K3U A;  4PLM A;  3ZMO A;  1O59 A;  4S2D A;  3KF5 A;  5K4L A;  1QXR A;  5K0U B;  2AH2 A;  1D4M 3;  2QNK A;  2JE7 A;  2XON A;  2YBK A;  3HN3 A;  4C0H A;  5GM0 A;  4RQP B;  1AR7 1;  1K45 A;  1YNA A;  4DY3 A;  3N4M A;  3NV2 A;  4H14 A;  4Q27 A;  1QJX 3;  4I01 A;  5C3P A;  2FMY A;  1IQD C;  2W3J A;  3AZX A;  1W2N A;  1WW6 A;  4LE4 A;  2PAM A;  4E2G A;  5BNP C;  1WMX A;  2OKX A;  1N1V A;  3OD4 A;  2WNV C;  4YM2 A;  2W46 A;  1BBT 3;  3TNQ A;  2C9K A;  1SMV A;  2ZX2 A;  4LOS A;  5FZH A;  1MS0 A;  1Y4W A;  3FLP A;  3T09 A;  1HRI 2;  4AK3 A;  3JD7 3;  2NN8 A;  4D94 A;  5A3M A;  2YC0 A;  1UYZ A;  4NJ4 A;  1OKQ A;  1U5Y A;  4MGK E;  3GDB A;  1JZ5 A;  4QM8 A;  3MEP A;  1V9U 3;  3VGI A;  4CEW A;  1WLC A;  2YB7 A;  2LRO A;  3UGF A;  3KD4 A;  4IV3 C;  2PHD A;  1G9B A;  4NIH A;  3VBF A;  2ZZJ A;  3H8R A;  3L9J T;  1V6O A;  5FK7 A;  5FQ0 B;  1EUT A;  5EJ3 A;  4WVV A;  1HKD A;  3HQU A;  4YGC A;  1CAX B;  3CMG A;  1W9T A;  3K3N A;  3V0B B;  4ZU7 A;  3PUA A;  4BMB A;  1LEM A;  5LEJ A;  2W95 A;  3ITQ A;  2V5D A;  5FXX A;  4A41 A;  4AEM A;  4LKF A;  3SKV A;  3VBR B;  3KGL A;  1VBC 3;  1VRB A;  4HVO A;  3WX5 A;  2R04 3;  3FC0 A;  4OUL A;  2OS2 A;  4KI5 M;  4MO3 M;  1A34 A;  3S6P A;  1MS1 A;  3CZU A;  1ACC A;  5EJ1 B;  3O1O A;  1HXS 2;  2QDR A;  1PIV 1;  4LKS A;  2V5Y A;  3NW4 A;  5JUV A;  1DQ6 A;  4DUW A;  4QPI C;  4R4Z A;  4DS0 A;  2LM3 A;  3ST7 A;  4EN7 B;  5FR3 A;  3ATG A;  3ILR A;  5AFB A;  2DV9 A;  1W3X A;  2ERF A;  4QDQ A;  5D2A A;  4AI8 A;  4Z2A A;  5LWB A;  1SBD A;  4MXV A;  1ZX5 A;  2Z42 A;  4XCB A;  2B7Y A;  3KV6 A;  3LZZ A;  2JDK A;  3QAC A;  4P9W A;  4YW5 A;  5HPO A;  2WZR 2;  3DGT A;  1VBB 1;  2JDN A;  1SEF A;  4DEV A;  1WBF A;  2MEV 3;  2XVL A;  3T2Q A;  3TN9 1;  4J6G A;  2Q5T A;  4HZF A;  2J1R A;  3KHC A;  2ZTN A;  5FO7 B;  1MEC 2;  3AZV A;  1OQD A;  4UFI A;  2XHK A;  3A22 A;  3I49 A;  2TEP A;  2R06 1;  1NA1 C;  2I74 A;  4H3W A;  4IV3 B;  5JVV A;  4DXR A;  2ADE A;  4QGM A;  4CU9 A;  2RMU 3;  4L8Q A;  5JPM B;  4FOY A;  2H0V A;  1ULE A;  1JZ8 A;  4A7Z A;  5C6C A;  1C5I A;  2CGO A;  3ZPY A;  3MZH A;  3FUO A;  1Q3E A;  1PMJ X;  3N7L A;  1V0A A;  3WVJ A;  5HV0 A;  1RUE 1;  3M3I A;  1JH5 A;  4BHP A;  1FOD 1;  1RMU 3;  1OT5 A;  3J7H A;  3AKQ A;  4B4R A;  2W47 A;  4IGO A;  5E88 A;  5C8W A;  2FHR A;  2R07 2;  1FNY A;  2XBO 1;  2BUK A;  3MFC A;  1VIW B;  4W6X A;  1XNB A;  4D69 A;  4QX8 A;  2W5F A;  3WW3 A;  3CZJ A;  4FAG A;  5JWP A;  4HSJ A;  2SBA A;  2Y6J A;  4XJ8 A;  5H9S A;  1IHM A;  3OEA A;  4AAX A;  1L7Q A;  1BZW A;  3ZXK A;  4XUQ A;  1RUD 2;  2AZ5 A;  1KFX L;  2YU2 A;  4R9B A;  1HJG A;  3U1X A;  3HAG A;  4CDW A;  2JEM A;  3ACG A;  5G04 L;  1ND2 B;  1R1Z A;  4XUO A;  1VBE 3;  3H8X A;  3JBG 2;  3MIF A;  4YM1 A;  1CZV A;  4LE3 A;  5LAS A;  1ULP A;  3I54 A;  2DUO A;  1STM A;  2D6M A;  2WNE A;  4P08 A;  3VD9 A;  3NAP B;  2LUW A;  3I2O A;  1IOA A;  5BNN C;  4MX3 A;  1AR8 3;  1ZYB A;  2HLE A;  2RS1 3;  2NP0 A;  5F6K A;  3T4H B;  1G9D A;  4XAE A;  4LUL A;  2XQR A;  1I1E A;  1RUG 2;  3KB5 A;  1UYP A;  3PU8 A;  1KIT A;  1RED A;  3P3N A;  2KA3 A;  2BOI A;  1W9Y A;  2WS9 2;  3KHB A;  3WQ7 A;  1S0J A;  5CB7 A;  5M0T A;  1W2O A;  2D98 A;  1HW5 A;  2WA3 A;  2WZE A;  1B35 C;  1AVB A;  1YEW A;  3M3Q A;  4IE7 A;  1LU2 A;  4QAW A;  2VTX J;  3MF9 A;  3APB A;  4N90 A;  4A6S A;  1DZR A;  1ND2 C;  2QUO A;  1E5H A;  3E5U A;  1S2K A;  2PQQ A;  4DXT A;  3MYX A;  4QX2 A;  4DQA A;  3JQW A;  2ZGP A;  1PO1 2;  2XLF A;  2GC3 A;  1CAX A;  1V6I A;  2D44 A;  3GBW A;  3OD0 A;  2VZT A;  4QPY A;  4RD7 A;  2G9F A;  5A1F A;  4O61 A;  4OHX A;  3WUC A;  2V09 A;  3O7O A;  3NAP C;  2DTW A;  4NN0 A;  4L0P A;  5LCW L;  1HXS 1;  2QDN A;  3CF6 E;  4FQ4 A;  1NOV A;  5AVA A;  2HWB 1;  4XIL A;  1FMD 2;  2WT2 A;  3N9M A;  5JIU A;  4L97 A;  2HWF 1;  1EPZ A;  3I2H A;  2AC1 A;  1PVC 3;  1UMH A;  3K77 A;  1QOT A;  1R1A 1;  3CBN A;  4QX7 A;  1XYN A;  2VME A;  3WHT A;  4RS5 B;  5IYY A;  4XUP A;  3OOX A;  1Z78 A;  3RYP A;  2EA7 A;  2WAA A;  3UET A;  1S0F A;  4PQQ A;  2PEL A;  3BB6 A;  3WLU A;  3ZVX A;  5FZ6 A;  5CFC A;  3O5S A;  3Q8B A;  4I0A A;  5CFC B;  2VOT A;  3B01 A;  3N9L A;  3WF4 A;  5C33 A;  5JZG B;  1ZNP A;  1RVF 2;  3OY8 B;  2HEY F;  1H1I A;  2VOW A;  1D7P M;  5K8S A;  1XSQ A;  3Q8F A;  2DVD A;  2ENR A;  3VHR A;  1DQ0 A;  1Y7B A;  2VC9 A;  3DEC A;  4Y22 A;  4S2H A;  4A6O A;  4BQ1 A;  4K20 A;  4TWT A;  3EXU A;  4QQL A;  1NCQ A;  5FP8 A;  5JDB A;  2WBK A;  1MVE A;  4XBL A;  3EMR A;  4K8F A;  3OPT A;  2QQJ A;  3TBD A;  4QDS A;  2HWD 2;  3VHN A;  2OPK A;  3USU B;  2PHU A;  3WV6 A;  3AP9 A;  3EB7 A;  1RJ7 A;  3SH3 A;  3WNP A;  4LO8 A;  2E7T A;  2VTF A;  2F4L A;  1WMD A;  4Q4Y 3;  4O7X A;  3QLQ A;  4BDV B;  1V6L A;  3NWK A;  5EIY B;  2E63 A;  2VCA A;  4GKX A;  1GNH A;  5L9B A;  1GZ9 A;  2HBU A;  5LY1 A;  1FMD 1;  2PHR A;  4N9H A;  3U10 A;  1JHJ A;  2Z2S B;  5JZG C;  3CJI C;  3MBW A;  4PIZ A;  4LT5 A;  1WWY A;  1GV9 A;  1DCS A;  2ETE A;  2IFR A;  4JZR A;  1W90 A;  2JG9 A;  3ACL A;  4FOW A;  3KQR A;  4AF9 A;  4N9I A;  3UJO A;  3WNM A;  3RZZ A;  1SPP A;  2RE9 A;  2I45 A;  1J84 A;  3AFG A;  4JGZ B;  1QJX 1;  1BEV 1;  1QGL A;  3LEG A;  4QD2 A;  2YC2 A;  3B7M A;  3J26 N;  2FZ1 A;  3BTA A;  3NJY A;  1JI6 A;  1KD7 A;  4XUR A;  5LAT A;  3ZYP A;  5L7O B;  4BZ4 A;  1PO2 1;  1DGW X;  2OUH A;  3OGS A;  4UXA A;  3WDV A;  2J1E A;  1KFU L;  1QJY 2;  2W2I A;  3DXU A;  3N7K A;  4COZ A;  1JYI A;  5DG2 A;  4QHZ A;  4P9J A;  3D3A A;  1PMH X;  4YW3 A;  4AED B;  1WW7 A;  1PNG A;  4COU A;  1LEC A;  3B69 A;  1ODM A;  3GZT B;  4CCC A;  2QZ3 A;  1WCD J;  5AC9 2;  2P3Y A;  2ILM A;  2ZAC A;  4RGG A;  1J3R A;  4AG4 A;  4OZO A;  3USU A;  3EYP A;  1FPN 2;  2W1Q A;  4CDX B;  3TEZ A;  2DCK A;  4BQ2 A;  3HNM A;  1X82 A;  4URT A;  3LGR A;  2DCZ A;  2E31 A;  2D7F A;  2Y6K A;  1JYN A;  3NV1 A;  4RR3 C;  1H2L A;  4HLT A;  3O1S A;  1ZZ9 A;  3GBG A;  4Y1V A;  1VRH 3;  4DB5 A;  4R9D A;  3G7D A;  2RM2 3;  1N3O A;  3LDB A;  1GQH A;  5T5L A;  2VOV A;  4H55 A;  2NMN A;  1AL2 3;  4ASK A;  2RV9 A;  1ZZ8 A;  1U5X A;  1QHD A;  1YRZ A;  3IN9 A;  2RS3 1;  4UI9 L;  2D43 A;  5BYN A;  2G9G A;  3OGJ A;  4Q4X 1;  4QQP A;  1UNB A;  2B39 A;  5BNQ A;  2R1B A;  5I8S A;  4BOW A;  4MGQ A;  2H6C A;  2J1S A;  4NWW A;  2RJ2 A;  4QKF A;  3I2I A;  3T0D A;  3KZ4 C;  1O3R A;  2WYS A;  3LEK A;  2RS5 3;  4FFI A;  1RIR A;  3NVC A;  4MVT A;  3WHU A;  3ZKU A;  4AI2 A;  3K51 A;  1SAC A;  2AUY A;  4XFA A;  2WAO A;  2A71 A;  3DL3 A;  5I0R A;  3T0A A;  2UWA A;  5FYH A;  1UZV A;  3OPZ A;  4UF0 B;  3AZY A;  1WLW A;  1PX3 A;  1VAM A;  1JOD A;  4XF9 A;  3ZXF A;  2WN3 A;  4XMA A;  2DCY A;  2GNB A;  1V70 A;  3N9O A;  2WFF 2;  3U75 A;  4PIY A;  3VHP A;  1G8W A;  1YQ5 A;  2VCC A;  4TN7 A;  3VBS C;  5CBL A;  1E5S A;  2R06 2;  4LIV A;  3AKS A;  5FJH A;  1DP0 A;  3BPS A;  5C9A B;  3QH6 A;  2J1T A;  4LJH A;  4AVV A;  1IPJ A;  3WP3 A;  4CDX C;  2PHT A;  4NIG A;  1OSG A;  5KC6 A;  3SXW A;  3VBH C;  2IFW A;  1SFN A;  5B4X A;  1VMH A;  5T55 A;  2GC0 A;  1C57 A;  1CAW A;  5IUQ A;  4YLZ A;  4FFH A;  3N7J A;  2QVS B;  3PTY A;  4IEZ A;  2WIN B;  1HRV 3;  4IEQ A;  4AVB A;  1S1A A;  5ANN A;  1F15 A;  5L73 A;  3W58 A;  4JKL A;  1JW6 A;  2UYA A;  4TLG A;  1HRI 1;  3OG2 A;  3I2G A;  1QWR A;  1WCQ A;  4YAR A;  5LA9 A;  1LCL A;  5C4W B;  3QCW A;  4IQP A;  1NZI A;  4AFB A;  2K2S A;  3ZXA C;  2BER A;  1JZ6 A;  3NQH A;  2ZGS A;  2VUC A;  3OY8 A;  1UWW A;  4IES A;  5AC9 1;  1O5L A;  4WVM A;  1ZZ7 A;  2W1U A;  2ID4 A;  3GJB A;  4QQ2 A;  4OMD A;  2GH8 A;  4EYU A;  5HCF A;  3R4D B;  1LOE A;  1D4M 2;  4JGZ C;  4Z82 A;  1CIW A;  4XIO A;  4AEK A;  4BB3 A;  1TMF 3;  3B94 A;  2B8M A;  3TB0 A;  2VUJ A;  3ZFE B;  1E57 A;  2WUH A;  2ORX A;  3MF6 A;  4F3J A;  1I5Z A;  1NT0 A;  4LBL A;  2VE1 A;  1UZW A;  2A5Z A;  1QF3 A;  3WQ1 A;  4AI0 A;  1CPM A;  1RXG A;  3LD8 A;  2DUP A;  4RL7 A;  4I3G A;  5FMC A;  2ET7 A;  5L9R A;  3T1M A;  1IS3 A;  2EIG A;  3GXU A;  1W0P A;  4YVS C;  4LPL A;  3NO8 A;  2YZ4 A;  4YRD A;  1BBT 2;  1J83 A;  2XML A;  5FLJ A;  5FMO L;  3VUO A;  5FV3 A;  1OLQ A;  1RUF 2;  5KXD A;  3DV8 A;  3DPR C;  4LQR A;  5LK5 A;  4B8E A;  1K42 A;  4XZU G;  1ZBA 3;  3K4D A;  5FY7 A;  1E5I A;  4M3C F;  3POW A;  5F2W A;  5CFD C;  1AUY A;  2J7M A;  5T3N A;  4OI1 A;  3HJR A;  1PK6 B;  2CDP A;  1XXN A;  3AP7 A;  4GH4 A;  2B4K A;  5KXE A;  1M4W A;  2XGX A;  3ME2 A;  3I4I A;  3ZFE C;  3KLS A;  4BQ4 A;  1COV 2;  2VZQ A;  3LSE A;  2PFW A;  1QXJ A;  4JKK A;  5FZO B;  3S5Q A;  3WW1 A;  5EQU A;  2E6V A;  1W03 A;  2FCT A;  2RDN A;  1F9K A;  1MS9 A;  2EXI A;  3JD7 1;  4WVW A;  5FOJ B;  3J8F 3;  3ZSK A;  5FLI A;  1CPN A;  4K6B A;  1OQ1 A;  4IV1 B;  1QOO A;  3B00 A;  4K1Y A;  5JLV A;  1AYN 2;  4GJZ A;  2D3P A;  2QBX A;  2ZAA A;  3GHN A;  1W2U A;  4XFH A;  4YVW C;  4AGG A;  1VBA 2;  4J25 A;  4OI2 A;  3ZLI A;  2VZP A;  2JG8 C;  3FWE A;  4I3P A;  4P00 B;  5J96 B;  1JOJ A;  2MPF A;  5FBJ A;  1DZT A;  4CXW A;  4GA9 A;  5GAL A;  3K4A A;  4XFG A;  4FCA A;  2FMD A;  2W1W A;  3UGG A;  4DRV A;  4YFZ A;  4R52 A;  1JOP A;  3BCW A;  4ZPI A;  4BYY A;  4M00 A;  1DYO A;  5DZE A;  1IS6 A;  4PI2 A;  5FY9 A;  4KWU A;  5C9A C;  1UX6 A;  1XBF A;  3V0B A;  4NPR A;  3VD7 A;  3POF A;  1YHF A;  4JHZ A;  3LB9 A;  1LOD A;  2Q1Z B;  3A4U A;  3OPW A;  1IQA A;  1VLN A;  4A44 A;  5F3C A;  5CIS A;  1GWL A;  4OLL A;  1JTZ X;  3T2T A;  2W91 A;  1UXZ A;  4QXC A;  2QQN A;  1WCS A;  2WLQ A;  3MHZ A;  4G3Y C;  3ZXG A;  4WM7 C;  1UW8 A;  4CEW B;  4Q0U A;  2JG8 B;  5A3N A;  1IS5 A;  5H9Q A;  1W99 A;  1MQT A;  1WLD A;  2BFU S;  3VZK A;  4Z2W A;  2WS9 1;  5BY5 A;  1MZ6 A;  3GHM A;  4ISQ A;  5FTT C;  2UUR A;  1F5J A;  1NY7 2;  1RMU 2;  2BZD A;  3THC A;  3M8L A;  2C4X A;  2ZEW A;  1IZ3 A;  3OBT A;  4CCJ A;  1H6Y A;  4AE2 A;  4BQY A;  1FNZ A;  2NM1 A;  2IUW A;  1CGP A;  2V4V A;  1XSR A;  3GCX A;  2VW1 A;  2YFU A;  4DMI A;  3M3O A;  1G9A A;  1N1Y A;  3BTY A;  2CAU A;  4KBB A;  4W6W A;  4YW6 A;  4AVA A;  2JDA A;  2VZ1 A;  4Z8B A;  3PTR B;  5ANQ A;  2XG3 A;  3AB0 A;  3ZFG A;  2PAK A;  1AR9 2;  2AEZ A;  2BVV A;  1DF0 A;  2V72 A;  1PGW 1;  2VNO A;  4UW4 A;  3NKG A;  1G7Y A;  3VDD A;  4V2V A;  1PO1 1;  4MGI E;  5JOZ A;  4UFL A;  5JOX A;  2D6N A;  3SCH A;  3CIH A;  3A7Q A;  1VBE 2;  5H9R A;  3ALQ A;  3LDR A;  1AJO A;  3NJZ A;  5DAX A;  2LS6 A;  1YJL A;  5JR7 B;  4CU8 A;  1ULD A;  4JQT A;  4BQ3 A;  1U5I A;  1JOB A;  2X8K A;  3PVB B;  4MSV A;  5JXG A;  4Q4Y 1;  3ABZ A;  3WF0 A;  4BH9 A;  1SBF A;  1XE0 A;  4G4F A;  4PF1 A;  4HPK B;  1DGL A;  1KDM A;  1LJ7 A;  1TEI A;  1UD1 A;  2YGM A;  3O14 A;  2JDP A;  1FAY A;  2VUL A;  1ZBA 1;  3ZOI A;  1RUG 3;  2IC1 A;  3WR0 A;  1LHW A;  4B29 A;  4ZKT B;  4SLI A;  4GB3 3;  4EE2 A;  1LHO A;  1YI7 A;  2YYO A;  4KWJ A;  3KVA A;  2X5I A;  2IXL A;  5FQ0 A;  2KM2 A;  1LU1 A;  3B9I A;  3ACH A;  4NAO A;  5KR7 A;  1YIF A;  4NHX A;  1R09 1;  2Y38 A;  2A6W A;  2EAK A;  2VXR A;  3ZYF A;  5F3E A;  4QMA A;  2VQ0 A;  4LEJ A;  3OBA A;  3IBM A;  5T50 A;  4B7E A;  1LOF A;  4RA0 A;  1GKB A;  1UY4 A;  3AYD A;  3TN9 2;  5CYY A;  3MW4 A;  2LAL A;  3ZXL A;  2GND A;  5BNO A;  1LUL A;  4RFR B;  2CGN A;  2BWA A;  2IVI B;  1NLS A;  2D6K A;  4LK6 A;  3S5A A;  2J1V A;  3I59 B;  4Y1X A;  1PO2 2;  1KRI A;  1UPI A;  5A80 A;  1BQP A;  1JBC A;  4AGV A;  1K5M C;  4ZON A;  3MI8 A;  1CVN A;  1XB9 A;  4NRP A;  1H2N A;  3LA3 A;  2KR2 A;  3D0J A;  2OW4 A;  1EUU A;  4C90 A;  3RZL A;  2X53 S;  1PK6 C;  4Q1R A;  3I7D A;  4CDW B;  2ZX0 A;  2E51 A;  1F35 A;  5FUI A;  4JAA A;  1ASJ 3;  4CDQ C;  5FUP A;  2XB6 C;  3WOG A;  1EY2 A;  3V56 A;  1RUH 2;  4HVR A;  5D8A A;  3DCQ A;  1VAV A;  4ERO A;  5ACA 1;  3POB A;  1RVF 3;  3HT1 A;  3IB3 A;  4FPG A;  4UAP A;  1WD4 A;  1H2K A;  1OPM A;  2W1S A;  1W8U A;  1TQ5 A;  3JB4 C;  4L11 A;  4RS5 A;  2UY8 A;  4QDR A;  1HB3 A;  4AVT A;  1KJL A;  4D3W A;  1ZRF A;  1C3H A;  2C0Z A;  2RG4 A;  1HJF A;  2BBA A;  2L9L A;  2XL9 A;  3JZV A;  2X10 A;  4GH4 B;  4MLO A;  4N8M A;  5ERL A;  3VZM A;  1QOS A;  1C8N A;  1EP0 A;  2VMH A;  4EV0 A;  2BTV C;  2RS1 1;  4UYB A;  5KXB A;  2GMP A;  2P1B A;  2ZX3 A;  3OUI A;  3NNJ A;  4JDM A;  2RR1 1;  3VKO A;  1UX7 A;  2CY6 A;  2HWD 3;  3ZYG A;  4AYU A;  4EN0 A;  2HWC 3;  3U4X A;  2MNG A;  2PHW A;  1ALY A;  5FZL A;  1WD3 A;  1AR6 3;  5IFP A;  2XLG A;  3ES4 A;  2Q4S A;  5FZD A;  3SKJ E;  2K0G A;  3D8C A;  3F2Z A;  3RI8 A;  4Q0P A;  4RQP C;  1A6C A;  1BCX A;  2RHP A;  1VBD 2;  4MOA A;  2JDY A;  4FPL A;  2VZS A;  1IPS A;  2VMG A;  1QXP A;  1KS4 A;  3H42 B;  1Q8V A;  1FYU A;  2PN5 A;  3K2O A;  4IER A;  4JGY B;  4O65 A;  5FZ1 A;  4BCU A;  1QDC A;  5FZC A;  2BU9 A;  5CG8 A;  4DUV A;  2A75 A;  4GWM A;  4XBN A;  2Y0I A;  5AFE A;  3B02 A;  2PLV 3;  2NQY A;  4Q4X 3;  3SC7 X;  3RZM A;  2Y6F A;  3FE5 A;  3PL0 A;  3IDC B;  3KSC A;  4CEY C;  4Q0S A;  5ABJ B;  1AR7 2;  5A32 A;  1LED A;  3AYA A;  3KM5 A;  5DUV A;  1BVV A;  1JYX A;  5IWF A;  3UK9 A;  3P6B A;  4RHV 2;  3VBO A;  4C8D A;  4C91 A;  2ZGK A;  1PM7 A;  1RUE 3;  1H8T C;  2XJT A;  3B3Q E;  3OUJ A;  4Q0V A;  2XH6 A;  4KBZ A;  1R08 3;  5JI7 A;  1LOG A;  3PUR A;  1VRH 1;  5FKB A;  5BXX A;  5FZO A;  2VBD A;  2P5B A;  3ZYH A;  2XLA A;  4ASM B;  1ENX A;  4BIS A;  1T2X A;  1O3T A;  1PX4 A;  2ZGT A;  4AHZ A;  4AWD A;  4QB1 A;  4D7S A;  3H8U A;  3ES1 A;  1GWK A;  1ND3 C;  1OOP B;  1XOY A;  2RMU 1;  4WBB A;  3WT3 A;  1IS4 A;  1PM4 A;  3BU7 A;  1KGY A;  1Y43 B;  3AK0 A;  1QJU 3;  1HLC A;  1S0D A;  3IAP A;  3KCX A;  5C71 A;  2P37 A;  1JU4 A;  1TME 1;  4Y20 A;  5AVP A;  2UY9 A;  1ULC A;  3AJY A;  4YFW A;  1W6P B;  4AI9 A;  1TME 3;  1KXG A;  2LW8 A;  2QKD A;  3BVC A;  4XAC A;  3NNM A;  1OH3 A;  2ZGQ A;  2D3S A;  4ONU A;  1ZZB A;  5GLW A;  3HQR A;  4EWA A;  4ARX A;  1W8W A;  3O1M A;  2MEV 1;  3AKR A;  5FZA A;  1W2T A;  2O1Q A;  4DXS A;  5FAX A;  5CAD A;  2GZW A;  3EJK A;  4JGY C;  3VV1 A;  3NL1 A;  1REE A;  1W6O B;  2HWE 1;  4Q4V 3;  2HWF 2;  4DRR A;  2ZZQ A;  3ZSJ A;  5FZ3 A;  4FBF A;  4AI3 A;  3HNY M;  4F8A A;  4CCL A;  3S7I A;  1POQ A;  3QH7 A;  1AX1 A;  3RQ0 A;  1NQD A;  3ZN4 A;  4NR1 A;  2RS5 2;  3SIS A;  5DZG A;  3LCP A;  3WDT A;  4PCR A;  2DU1 A;  4FTB A;  3ELN A;  1BYH A;  1DLC A;  4CEY B;  1FX5 A;  2QQO A;  2WII B;  3GF6 A;  4GAL A;  1ZBE 3;  3KVB A;  1N3P A;  1IPK A;  1OLR A;  2R0H A;  3VB9 A;  1PZ7 A;  5JSO A;  2FDH A; 
#chains in the Genus database with same CATH homology
 2VC9 A;  3DEC A;  3LE0 A;  3T2O A;  2BGP A;  3THD A;  1XNT A;  2WBK A;  2QQJ A;  4CUA A;  3I3D A;  5EJZ B;  4QDS A;  2W92 A;  2JKX A;  1OH4 A;  4E8C A;  3MO4 A;  4YPJ A;  5JXJ A;  3EB7 A;  3WNP A;  1UXX X;  4HG6 B;  2VTF A;  1GUI A;  1NAE A;  3AC0 A;  4BDV B;  2QQK A;  4E8D A;  4M4P A;  4D0Q A;  5EIY B;  2VCA A;  3WNK A;  2Y6H A;  1JHJ A;  3MBW A;  2DCJ A;  3WNL A;  1UYY A;  3WNM A;  2X09 A;  3LEI A;  3C7E A;  3I97 A;  1J84 A;  2WQ8 A;  2YG0 A;  5F7U A;  3LEG A;  1UY3 A;  1P8J A;  2J1U A;  2YC2 A;  3NRU A;  3ZM8 A;  4KMQ A;  1JI6 A;  4XUR A;  4UOJ A;  4W8J A;  1TVG A;  2Y64 A;  3GGL A;  3OGS A;  1KEX A;  2J1E A;  3D3A A;  1PMH X;  5J1X A;  1JU3 A;  1ULO A;  1W8O A;  2VJX A;  2VQT A;  3DYP A;  4XUT A;  5LA1 A;  1RYY A;  4QPW A;  4DEQ A;  3ECQ A;  4AG4 A;  4OZO A;  3WQB A;  3EYP A;  2W1Q A;  3HOB A;  4ET7 A;  2DCK A;  5JXI A;  3HNM A;  1F4H A;  3LPF A;  2E31 A;  2Y6K A;  3FN9 A;  1JYN A;  4D8M A;  3A23 A;  4OYU A;  1GQP A;  4GZ9 A;  2VZU A;  4TXW A;  2JE8 A;  2W9X A;  3IDA A;  3C7O A;  4RYD A;  1UYX A;  2RV9 A;  1MPX A;  4QB2 A;  1SDD B;  2YFZ A;  4UI9 L;  4A42 A;  1US2 A;  1YQ2 A;  4LHS A;  4MGQ A;  2J1S A;  1CIY A;  2W94 A;  2RJ2 A;  1UMI A;  2BGO A;  3I2I A;  3T0D A;  5IFT A;  1GOG A;  2WYS A;  3LEK A;  3FHA A;  4PT6 A;  3JXS A;  3W5M A;  3PUI A;  2WAO A;  2VO5 A;  3T0A A;  4ARY A;  1PX3 A;  3BN6 A;  3I3E A;  3CKH A;  2WN3 A;  3BGA A;  3T0B A;  3SEP A;  1O8P A;  3LPG A;  4JKM A;  1CX1 A;  2VCC A;  2QQI A;  2B9V A;  4RN5 A;  3U37 A;  2YC4 A;  1DP0 A;  2Z4F A;  2J1T A;  3E1F 1;  2Y6L A;  1UY2 A;  3MUZ 1;  2X05 A;  5B4X A;  1H6X A;  3UES A;  2VM9 A;  2JD9 A;  3T2P A;  3OB8 A;  3T08 A;  4CUB A;  3I2F A;  2VZR A;  3NNG A;  4JKL A;  3OG2 A;  3I2G A;  1L7R A;  1LNS A;  1WCQ A;  2BER A;  1JZ6 A;  5IJR A;  3NQH A;  2ZEY A;  1NKG A;  2VZ3 A;  1O8S A;  1UWW A;  2XQX A;  2W1U A;  2ID4 A;  1UY1 A;  2QQL A;  5CZK A;  4OMD A;  5JMO A;  1JZ2 A;  2VR4 A;  5HXM A;  4BK5 A;  2WN2 A;  5C7G A;  2WUH A;  2ORX A;  2ZXQ A;  4GWJ A;  3C8X A;  2W87 A;  4P5Y A;  3GXU A;  3I3B A;  4LPL A;  3III A;  2KD7 A;  1J83 A;  1CZS A;  4LQR A;  1K42 A;  4GWI A;  2WZ8 A;  3K4D A;  4XZU G;  2XHN A;  5LA2 A;  4A4A A;  2E26 A;  3CDZ B;  2J7M A;  5DQ0 A;  3HJR A;  2CDP A;  2B4K A;  1JYV A;  3FL7 A;  3ACI A;  2Y6G A;  2VZQ A;  2VMC A;  4JKK A;  1HN1 A;  2J22 A;  3I2K A;  1UZ0 A;  1W0N A;  1WKY A;  1JZ3 A;  1W9W A;  1UY0 A;  1CZT A;  5DN2 A;  2QBX A;  2E33 A;  1XC6 A;  2WO2 A;  1SHW B;  2VZP A;  3K4Z A;  4P00 B;  4QX1 A;  3K4A A;  1XPW A;  2W1W A;  4QX0 A;  3WF2 A;  4P02 B;  1DYO A;  4KWU A;  1K12 A;  4CU7 A;  3WNN A;  3VD5 A;  3VD7 A;  2ZEX A;  4JHZ A;  4DUX A;  3ACF A;  2QQM A;  4A44 A;  4ZXE A;  2CDO A;  2W91 A;  4CU6 A;  1UXZ A;  5JXH A;  2QQN A;  1GMM A;  1GNY A;  1I5P A;  2WAB A;  1W8N A;  3WSO A;  1W99 A;  1NUK A;  1O59 A;  2VMD A;  2VMF A;  3NJV A;  3OGR A;  2WO3 A;  2VZV A;  3VDB A;  2XON A;  3HN3 A;  2BZD A;  3THC A;  2C4X A;  2ZEW A;  1H6Y A;  3NJX A;  1K45 A;  5A1A A;  1OF3 A;  2V4V A;  3P1I A;  4CUC A;  2YFU A;  1IQD C;  2W3J A;  4XVH A;  1F4A A;  2JDA A;  2VZ1 A;  2OKX A;  4IUG A;  2Y8K A;  2W46 A;  2J1A A;  2EIE A;  1BHG A;  2C9K A;  2V72 A;  5C70 A;  2C26 A;  3T09 A;  3CIH A;  3A7Q A;  1UYZ A;  3GDB A;  2LS6 A;  3MUY 1;  2EIC A;  1JZ5 A;  3K75 B;  4CU8 A;  2YB7 A;  4QX3 A;  4FI9 A;  3WF1 A;  5JXG A;  3CQO A;  3ABZ A;  3WF0 A;  2RVA A;  4PF1 A;  1EUT A;  3W5N A;  1GOH A;  3CMG A;  3OEB A;  1W9T A;  3VDA A;  2W95 A;  2V5D A;  2EIB A;  4A41 A;  3SKV A;  3HNB M;  3HPN A;  2HYX A;  4XUN A;  3ACH A;  1SG3 A;  1NX9 A;  3MV1 1;  4KI5 M;  4MO3 M;  4ZZ8 A;  3CZU A;  3OBA A;  5EJ1 B;  4LKS A;  5JUV A;  1UY4 A;  3FHQ A;  3LQC A;  4DUW A;  5CYY A;  4ZY9 A;  3C7G A;  4Z2A A;  4QDQ A;  2J1V A;  2ZEZ A;  2XOM A;  4A45 A;  5HPO A;  2WDB A;  2VQU A;  4DEV A;  3I2J A;  1R64 A;  2EID A;  3T2Q A;  5JR2 A;  1EUU A;  2J1R A;  3K46 A;  1GOF A;  5FUI A;  3C7F A;  3C7H A;  3A22 A;  1K3I A;  4DXR A;  2PQS A;  4CU9 A;  2ORZ A;  1JZ8 A;  3IB3 A;  4UAP A;  4OMC A;  2VZO A;  2W1S A;  4W4Z A;  3UNP A;  4QDR A;  1JYW A;  1PMJ X;  5IHR A;  5G05 L;  2BBA A;  2L9L A;  2R7E B;  2X10 A;  4MAD A;  1OT5 A;  3J7H A;  2W47 A;  4BXS V;  5B4N A;  1UX7 A;  4MGS A;  5IFP A;  2W5F A;  3SKJ E;  3CZJ A;  2Y6J A;  3F2Z A;  4MOA A;  3OEA A;  4AAX A;  1L7Q A;  2VZS A;  4XUQ A;  5DPN A;  4M4R A;  3ACG A;  5G04 L;  5I0D A;  4DUV A;  1JZ4 A;  3A21 A;  4QB6 A;  4XUO A;  1W9S A;  1CZV A;  1ULP A;  4W50 A;  4P08 A;  3WNO A;  3VD9 A;  1TG7 A;  1JYX A;  2HLE A;  3P6B A;  3SEE A;  3MV0 1;  3WEZ A;  2WO1 A;  2DDU A;  3IAQ A;  1T2X A;  1PX4 A;  2WZE A;  3GM8 A;  3VDC A;  4QB1 A;  4JX0 A;  4QAW A;  4OUE A;  4A3Z A;  1GU3 A;  1KGY A;  3DYO A;  5C71 A;  3IAP A;  4DXT A;  4BK4 A;  1JU4 A;  4QX2 A;  5DMY A;  4CVU A;  2VZT A;  3HEI A;  1XNA A;  4TTG A;  4L0P A;  2LW8 A;  5LCW L;  1JZ7 A;  4ARX A;  5LA0 A;  3VD4 A;  4DXS A;  3I2H A;  1OD3 A;  3ETP A;  1UMH A;  3K77 A;  3HNY M;  2VME A;  1US3 A;  5IYY A;  4XUP A;  2E32 A;  2VCB A;  3VD3 A;  4BJ0 A;  2WAA A;  3UET A;  4PQQ A;  2VL4 A;  3PUH A;  1OF4 A;  1DLC A;  2VOT A;  3OGV A;  2QQO A;  3WF4 A;  3DYM A;  4ZZ5 A;  1D7P M;  3WF3 A;  4A6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...