1UMHA

Structural basis of sugar-recognizing ubiquitin ligase
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
184
structure length
184
Chain Sequence
GSHFYFLSKRRRNLLRNPCGEEDLEGWSDVEHGGDGWKVEELPGDNGVEFTQDDSVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRTDAGSLYELTVRLLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of sugar-recognizing ubiquitin ligase
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords F-box only protein 2
total genus 38
structure length 184
sequence length 184
ec nomenclature ec 6.3.2.19: Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45.
pdb deposition date 2003-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04300 FBA F-box associated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1umhA00
5A1AA 2R7EB 1UYXA 2WABA 1OH4A 2KD7A 2WO1A 2LS6A 4KI5M 3CKHA 4L0PA 1O59A 4QX0A 3NJVA 3K4ZA 1W99A 3T08A 2W1SA 3PUIA 2BERA 3HJRA 3VD7A 5JMOA 2VM9A 1XNTA 4MOAA 2XONA 4BK5A 1GMMA 4BXSV 3OGRA 3FN9A 5EJZB 3WF0A 4JKKA 1TG7A 2C26A 2VMCA 3OG2A 5C71A 3LEGA 4Z2AA 4OUEA 5IYYA 2YC2A 2VOTA 4QX2A 2QQLA 3MV11 2Y6GA 4CU9A 1NKGA 2J1RA 3UNPA 4HG6B 3C7FA 3W5NA 1XC6A 3D3AA 1O8PA 4XUNA 2V72A 2QQMA 1US2A 2ZEYA 3ACIA 5EJ1B 4A41A 2W1UA 4W50A 4MO3M 4LKSA 4M4RA 2W46A 3PUHA 3I2KA 1JZ8A 4ARXA 4LPLA 5IJRA 4DXSA 2XQXA 2W94A 1XNAA 3K75B 3ACHA 1EUUA 3LPGA 4DEQA 4MGSA 2JE8A 2QQIA 1DLCA 4QDSA 3ACFA 3VD4A 2RV9A 1IQDC 3CZJA 3FHQA 4P02B 1H6YA 1W8NA 4QDQA 2W47A 3ZM8A 3T2QA 5LA0A 3MV01 1J84A 3NJXA 5JUVA 1UYYA 3GXUA 2VZTA 4ET7A 3BGAA 3VDBA 2DCKA 5EIYB 3CIHA 2RJ2A 2J1AA 2Y6LA 2ZXQA 3WSOA 3T09A 3A21A 2QQJA 3DYOA 1SDDB 4QDRA 1GOHA 3I3DA 1W9SA 1CX1A 1MPXA 1US3A 1UZ0A 4DEVA 5C7GA 3WF3A 5DMYA 2WO3A 1CIYA 2WYSA 3GM8A 1K45A 2VCAA 5LA2A 4XUQA 2WAOA 2JD9A 4XUTA 2Y64A 3EB7A 3SEEA 2BBAA 4W8JA 2J1TA 1XPWA 4P00B 3W5MA 3NRUA 1K3IA 5CYYA 4A4AA 3T0BA 2YB7A 3OBAA 5C70A 2VCBA 2EIBA 3WF4A 2W87A 3UESA 4P08A 2VZRA 2V5DA 1OD3A 3I2FA 5DQ0A 1JYNA 1UY4A 2J1VA 4AG4A 1JI6A 3K46A 1GU3A 2WUHA 3NNGA 2X10A 3LEKA 3A22A 4QAWA 3WNOA 2WQ8A 1UMHA 3WNLA 4ZZ8A 4DUXA 4ARYA 4MGQA 4LHSA 3SKVA 1W0NA 1GQPA 2YG0A 2W92A 1K12A 1RYYA 2W1QA 2WN3A 5B4XA 3THCA 3T0DA 2J22A 2VMDA 4BK4A 4LQRA 2VZVA 5F7UA 4JKLA 3VDCA 3BN6A 1I5PA 1PX3A 2WZ8A 3HNYM 3VD3A 1SG3A 2YFZA 3C8XA 1NUKA 1GOFA 4RN5A 1JZ6A 1CZVA 2Y6KA 4QB1A 3FHAA 4A42A 2E33A 4CU8A 3MO4A 2WZEA 1EUTA 4FI9A 5IFTA 3THDA 2OKXA 4XVHA 3JXSA 5G05L 3ECQA 2Y8KA 2W3JA 2J1UA 2C4XA 2VQTA 3WF1A 5CZKA 5IFPA 3OEAA 2ORXA 4UI9L 4XUPA 4UOJA 3WNNA 2Y6HA 3DYMA 2B4KA 4YPJA 1W8OA 5DPNA 2BGOA 2W95A 3WNMA 3LQCA 1UWWA 1LNSA 2VZQA 2QQOA 2HYXA 2DDUA 3T2PA 4PT6A 1JZ2A 3MBWA 1KEXA 3IAQA 2CDOA 2E32A 3SEPA 4ZY9A 3I2GA 4BDVB 2C9KA 3F2ZA 4PQQA 4QPWA 3T2OA 4QB6A 2J7MA 1ULPA 2W5FA 3UETA 4KMQA 1JZ3A 4DUWA 3ETPA 3C7EA 4W4ZA 2LW8A 1W9WA 2Y6JA 3HOBA 3CMGA 2X05A 2VZOA 2RVAA 5JXIA 3WEZA 3P6BA 3U37A 4CU6A 3HPNA 1JU3A 4ZXEA 2YC4A 1GNYA 5J1XA 5HXMA 1NX9A 3ACGA 4OYUA 4JKMA 1YQ2A 2WN2A 3AC0A 2ZEZA 3LEIA 4BJ0A 3DYPA 2WDBA 2VZUA 2W1WA 4E8DA 3WNKA 1O8SA 2ZEWA 1JYWA 4AAXA 3OGSA 4IUGA 5G04L 2BGPA 2JKXA 2VO5A 2ID4A 2XOMA 4TXWA 4DXTA 5IHRA 1UX7A 3C7GA 4CUCA 1JZ5A 4GZ9A 1WCQA 2VMFA 4A6OA 3A7QA 3DECA 3ABZA 4KWUA 4P5YA 4CU7A 4A44A 2ORZA 2WBKA 3C7HA 1OF3A 2VCCA 3WNPA 3IB3A 1P8JA 3I2HA 3IIIA 1ULOA 1UY3A 3HNBM 5JR2A 2VTFA 1UMIA 3HN3A 1JHJA 2VMEA 1UXXX 3NQHA 3MUZ1 3OEBA 4MADA 5LA1A 2E31A 3I2JA 3EYPA 4CUBA 1JZ7A 3C7OA 5I0DA 1JYVA 2Z4FA 3IDAA 2VZ1A 2VC9A 3K4AA 2DCJA 4E8CA 1L7QA 1OF4A 3SKJE 4ZZ5A 3OB8A 2BZDA 5DN2A 5FUIA 2B9VA 3MUY1 2X09A 4QB2A 1JU4A 1SHWB 2W91A 2L9LA 2XHNA 3T0AA 3WQBA 1DP0A 1JYXA 2YFUA 1CZSA 4CVUA 2PQSA 2QQNA 1CZTA 1J83A 2W9XA 1UY0A 1NAEA 4XZUG 3HEIA 4UAPA 3VDAA 2EICA 3CZUA 4JHZA 3VD5A 1UY2A 2VZPA 4RYDA 3I2IA 1DYOA 1T2XA 2VZSA 2JDAA 4JX0A 4QX1A 3WF2A 1GOGA 4OZOA 3I3EA 1UXZA 1D7PM 3P1IA 1PMJX 2EIDA 5JXHA 4DUVA 1OT5A 2QQKA 4A45A 1K42A 4QX3A 2EIEA 1GUIA 4XURA 5JXGA 3E1F1 1PMHX 3GGLA 1L7RA 2J1SA 4OMDA 2CDPA 1TVGA 2ZEXA 4A3ZA 3LPFA 4D0QA 1UYZA 3IAPA 3I97A 4CUAA 4M4PA 1WKYA 4GWIA 3J7HA 3HNMA 5HPOA 3A23A 1F4AA 1JZ4A 5LCWL 2VZ3A 1W9TA 2HLEA 2WAAA 2VR4A 3CDZB 2VJXA 3FL7A 2QBXA 3I3BA 4DXRA 5JXJA 1KGYA 2VL4A 1BHGA 3LE0A 2E26A 2VQUA 4GWJA 2WO2A 3CQOA 4D8MA 4TTGA 1PX4A 1R64A 1HN1A 3VD9A 4XUOA 3GDBA 4OMCA 1UY1A 1H6XA 1F4HA 3OGVA 5B4NA 3K4DA 3K77A 4PF1A 2V4VA 2J1EA
chains in the Genus database with same CATH superfamily
1Q8OA 3N9LA 1RUE1 2K0GA 4FT8A 3TEXA 1NLQA 5EWSA 4J1XA 4IEWA 1OH4A 4EE2A 2WO1A 4WVMA 1W6NB 1D4M2 5I0TA 2E7QA 3D0SA 2WS91 4KI5M 3RZJA 3ZFGA 1O59A 2HWC2 3H0OA 3K4ZA 4CCNA 2FCTA 4HKOA 3PUSA 4WM8B 5FFOC 3T08A 4WM7A 2ZGUA 2YC0A 2VM9A 5FZBA 1X36A 2A6ZA 3KV4A 1GR3A 1F15A 5FP9A 4AQSA 4BPZA 3DL3A 1MQTC 3TRSB 2HWE1 4BZ4A 2XJVA 2OVUA 4PIZA 3DGTA 2H6BA 4HKWA 1FMD1 5EFUA 5L7OC 1AR73 1UYPA 3AKQA 2MHFA 3QACA 1IZ3A 4QPIA 3ZDSA 2MPFA 5BNOA 4O61A 3P5BA 5A3OA 2R042 1XB9A 3ZIXA 3H7JA 4Z2AA 3A0NA 4OUEA 3BODA 4AFCA 4HN0A 2VOTA 5I8YA 5FP8A 3KCXA 1HB1A 1UZZA 4CU9A 2J1RA 4PI2A 4HG6B 2RS12 1VAKA 5JOWA 1SLCA 2IVJA 3AB0A 3D0JA 3KM5A 4XUNA 5A32B 2QQMA 3L2YA 5DG2A 4CP2A 4DZGA 4HVQA 2CNAA 2A70A 2UWBA 1E5IA 1UCXA 4A41A 3MZHA 1ZREA 1A8MA 1C8M3 1V9U3 1NXD1 3M7AA 4LKSA 3N7MA 1XE7A 1Y4WA 4LUMA 4XBNA 4XIKA 4YGDA 4E4HA 1VR3A 2W46A 3PTRB 3I2KA 3HMYA 4L9BA 1HV1A 1MR5A 1VB4A 3OYWB 4CDWC 4DXSA 1QIQA 1IPKA 1XSRA 1GNHA 4LBQA 3VBFC 3UT0A 4D7SA 2GZWA 1XNAA 2JDZA 4HZFA 4XJZA 5GLWA 5IVYA 4Z8BA 1JUHA 3K75B 2JE9A 3OY8A 1PZ7A 3LPGA 1W90A 4K1YA 3FBMA 2XL9A 1LOEA 2J42A 5HXVA 2JE8A 1J1TA 3BU7A 4BQYA 3K51A 2ZABA 2D3SA 3P3NA 4X6QB 3FHQA 4P02B 4F3JA 1AUYA 1LJ7A 4LBJA 5DZGA 3WHUA 3O1OA 5IK5A 1RUH2 5LK5A 1SEFA 4OZXA 2XJTA 2JG8B 1WD4A 4ZHNA 1OA3A 1J84A 2ZMNA 4LLOA 4XMIA 1JXNA 1S0JA 3TYJA 1DDLA 1NLRA 1WBLA 4MSVA 5DABA 4DINB 1YO8A 1VMFA 2GMPA 2JX9A 5A3LA 3V0BB 1O3SA 2OX0A 3M2MA 3UGHA 3FUOA 2RR12 4XOGA 2UY9A 1AL0G 3WSOA 4DRRA 5FJKA 3AZVA 3S0MA 2QQJA 4OHZA 1OVSA 3DYOA 1V6LA 5KXEA 1MEC2 1W9SA 2LALA 3KLSA 4Z1VA 3HIFA 4FPKA 1MPXA 1K5JA 2VBPA 4LK7A 5DMYA 1Z78A 4X8NA 1SBFA 1W6OA 4P9XA 5K0UC 1C8M2 1V9U2 2VCAA 4MXVA 3NSTA 4YGEA 4COZA 4P9JA 4ZU4A 1G86A 5FY1A 2K9ZA 1MS0A 3SEEA 3WV6A 3SXWA 1V6NA 1XPWA 3V0AB 2R041 5FYTA 3VBOC 1ENXA 2HWF1 2RMU1 1G9CA 2WNUC 5CU1A 2MEV1 4N53A 1QJY1 2VXJA 2VW2A 4V2WA 1GZTA 4DIQA 2ZTNA 3T0BA 4QPYA 2RMU3 2YB7A 2Q4SA 2VH9A 1WW5A 2ZA9A 2H6CA 3OBAA 1I3HA 4YFZA 5C70A 4LO6B 4MH0E 5JR7B 4COUA 1UOFA 2G9FA 4EZHA 3WDXA 4I2OA 1S0DA 4EN8B 1QJX1 5EPAA 1ZA7A 2Q5TA 4NOTA 1KD7A 5F5AA 4GB31 4P08A 4BLJA 4H7LA 2VZRA 4TSVA 5FZ9A 2P6CA 5D8AA 3H3LA 1JYNA 4HANA 2ERFA 1D0GA 2RR13 2ZS6B 1AJOA 3E5UA 3NNGA 2X10A 2BBVA 1REFA 3LEKA 5FCCA 2C1FA 2A3YA 2RMU2 5GKAC 5AC91 2WQ8A 1UMHA 2VECA 2JIGA 2ZHKA 2PLV3 4ZZ8A 5JWPA 1ULFA 1HXS1 3MF6A 4QHOA 3TBDA 1UQXA 1ENSA 1UO9A 3B7MA 3SKVA 4Y5SA 1RMU3 4MGYE 2IFWA 2W92A 2ZCWA 4Y3OA 1YFXA 5CKNA 1O7FA 2Y38A 3CL1A 5BUVA 2VMDA 4JC1A 4BK4A 1OC1A 1XU1A 2VZVA 4LQRA 4QKBA 4NIIA 4JKLA 1CD3G 5FUPA 5FPVA 2DUPA 4BU2A 1GSLA 1RUC3 1W6PB 2RE9A 5DDJ3 1FMD3 1GOFA 4RN5A 3KB5A 4LTAA 4M0NA 4XTMA 2Y6KA 4LBKA 3GF6A 1N47A 3GZAA 3MLLA 3ROUA 3FLRA 2FCUA 2WZEA 1EUTA 3MO4A 5FYUA 5JSOA 3T1MA 1IHMA 1IOAA 2WNVB 3NAPA 2JE7A 4H2AA 2G1MA 3WVJA 3VB9A 3ZN6A 4QMAA 4FXKB 4JTNA 2AZ5A 2H0BA 2BNMA 3ECQA 3RS6A 1G8WA 2BVVA 5FPUA 2XG3A 2XJRA 4YLZA 3ZSMA 2PA7A 1I6XA 2BFUL 3AYDA 1LHWA 2XBO3 3OEAA 4UI9L 1O5UA 1ZA4A 2QZ2A 4ZONA 2V4AA 1W0PA 3POSA 4HK9A 4Q4Y2 4UOJA 4AFDA 3TAYA 1SPPA 2R043 4DXZA 2EF6A 3I59A 2Z42A 5HCBA 1ZVFA 1C5IA 1LU1A 3JUUA 1BEV3 3OTFA 5HV4A 3H8XA 1R093 1KJRA 2WIIB 2W95A 4NRMA 4JGZB 3DUIA 3RZLA 3PMSA 2VZQA 3ZSKA 4AVAA 1LTEA 4B8EA 3POWA 3MI8A 4YNIA 4FPCA 5J98B 4AI1A 4YVSB 4PT6A 5H9PA 4XILA 1JZ2A 3VDDC 5FJHA 4D3WA 2VCMA 4YARA 3MBWA 2FCVA 4BLIA 1YFYA 1WCUA 2QQVA 4ZU5A 2ZGOA 2ETEA 2LUWA 3TNPB 4AVSA 1HN0A 1S2BA 2QJVA 4Q4Y3 1RITA 1N1YA 1GICA 5ABJB 4CCJA 4MHUA 2F17A 4BDVB 4PQQA 1X7NA 1S0EA 1AR91 1VBE1 3HR9A 1VBB2 3POEA 1F2NA 2W5FA 5CISA 4HK8A 4W6YA 3UETA 4AI9A 2YGLA 1QJU3 4D7TA 1JZ3A 1MZEA 1MVQA 4DUWA 3O0XA 3M3OA 1KDKA 4UFJA 2P1BA 4PIXA 4AI2A 4EN7B 1A8DA 4KNCA 2AYHA 4NMIA 4FOVA 3I54A 4DNYA 2GALA 2WS93 3HOBA 4YGCA 5A3WA 3THTA 2VZOA 2RVAA 1QOOA 1H1IA 1W8UA 3WEZA 3P6BA 3TB0A 3TN93 4CU6A 4Z07A 3HVDA 1LEDA 1JU3A 4UFMA 3I7DA 4ZXEA 3WP3A 4QHZA 5FP4A 2R0FA 5L9RA 5IAXA 1W2OA 5T5OA 4AL9A 2OQ7A 5HXMA 4KG0A 2VW0A 2XLFA 2D6OX 4LBQB 3RYRA 3WZ1A 4JAAA 4XF3A 3ZMNA 3OBZA 4OYUA 1IPJA 3E6BA 4PLMA 2FD8A 5FZLA 2IXJA 5EP9A 3AC0A 2NMNA 5T5PA 4AGGA 1KITA 2DFCA 3DYPA 3JB8A 4RQPB 2FDGA 1OQ1A 4Y1XA 1AL23 3PIGA 4QU2A 1W8ZA 5A6YA 2JDNA 4NWVA 5FMOL 4CDQA 4IUGA 1HRI2 4OHXA 1WGPA 5IK8A 2P3JA 2ZOEB 2JKXA 2WNEA 2D6PA 4F8AA 1H8TA 1S0FA 5FZKA 2ID4A 2XOMA 3RDIA 4TXWA 1GZWA 4DXTA 4NPMA 2JDHA 1RXFA 1AR62 3CJXA 3J8F3 4FXGB 3IMMA 4TN7A 1OH3A 1GQHA 1JZ5A 3VZOA 2JICA 3H7YA 3FFZA 1PMIA 1VRH2 2GP3A 3ES1A 3WW2A 5FDBA 3THPA 1FT9A 1VB2A 2HWE2 3MIBA 3SH4A 3ZN4A 1AXYA 1QJEA 3DPRA 3RMXA 2DVGA 2VMFA 3DV8A 4IEXA 3VKOA 3DECA 3ABZA 5FYZA 4KWUA 1CR7A 4CU7A 4A44A 2ORZA 2HWC1 4CEWC 2HWB1 2DUOA 1QJX2 2WS92 1W05A 2WKKA 5CFCB 5LEKA 3E6CC 4OHYA 2PYTA 2A7AA 2N7GA 5LATA 4CCEA 2GNTA 1YIFA 5KC5A 2V09A 1YYNA 1ZBA3 4DS0A 3IIIA 2Y34A 4XZPA 1NA1B 4S2FA 1RUI3 4G3YC 3NO8A 4R8HA 1GWMA 1QH6A 5CBLA 5IVBA 1OFNA 2Y26A 4RR3C 1QJY2 3OEBA 2UY8A 3S5AA 4Y4YA 1JYCA 2A6WA 2HWD1 4YW3A 4XJUA 2ZZJA 2X53S 2R1BA 3IDAA 3ZYBA 1POV0 3K4AA 3LF7A 5IT6A 1LOCA 1JW6A 2BRTA 1SBEA 2XVKA 2CGNA 4ZZ5A 2BZDA 1DGWX 1Q56A 5F3IA 5CB7A 3Q8BA 3IBMA 3SCGA 3U4XA 5FUIA 2FDIA 2A75A 2VU9A 1PK6B 1RUF1 4KWJA 3U75A 1CJDA 4RHV1 5F3EA 4FPGA 5GLUA 3WQ7A 2GC1A 4QQLA 1ND3B 1CIWA 1GKBA 3B93A 4EN0A 1SHWB 2XHNA 3ZXKA 2NP0A 3DKQA 1AR63 2R0HA 1DP0A 1JYXA 1BZWA 2Q1FA 4S2DA 3VBRC 1CZSA 2QKDA 4RFRB 1J58A 5AVAA 3W20A 2FBEA 2OQ6A 4IV1C 2C5DA 5IVFA 3VBRA 1CZTA 1OA4A 1CQ9A 1Y43B 3AJZA 4LEJA 2Y33A 2W9XA 2AREA 5C33A 4H55A 1NAEA 2OZJA 2CL2A 1YLLA 4AOCA 3CEWA 4AVCA 3JB4C 1HB4A 4MUVA 4QKFA 1J3RA 2VG9A 3JBG2 4I3GA 1V6OA 2EICA 5IWFA 3BKZA 4LR4A 1CAXA 4D69A 5C8CA 5LY1A 1Y3TA 3CZUA 4JHZA 4RYDA 3I2IA 2QCSB 2OYZA 3MFCA 2LM3A 2VZSA 3ZSEA 4FSJA 5FZEA 2BQPA 2NN8A 4RHV2 4QX1A 1GOGA 1MVEA 1RUF2 4I30A 3RYPA 1PVXA 4IEPA 1QHDA 2VOWA 5SV8A 5FZIA 1EP0A 1QH7A 3P1IA 3MFAA 3VKFC 5A1FA 1VMJA 5CIRA 4B4PA 1OPOA 1BEV1 1PM4A 2QQKA 2VULA 3MHZA 4Q26A 4JGZA 3UKVA 5I91A 2EIEA 1GUIA 1QGLA 5F3CA 1L7RA 2BPA2 4R4XA 5K9YA 3IN9A 3B9IA 1HDKA 2GNDA 1TMF2 5L19A 2P17A 4QXHA 1R083 3LPFA 1YQCA 4CP0A 3D8CA 1POV3 1UKRA 3I49A 4CUAA 1FI2A 1UW8A 4SBVA 1OOPC 2C24A 2K46A 1VMHA 3HQRA 2XB6C 4LKEA 5FY5A 3WLUA 4D6SA 5HPOA 1F4AA 5C5TA 2VUCA 3LWCA 2A1XA 3DPRC 1C5HA 2VZ3A 1HQNA 3AMQA 1OXCA 2WAAA 4COWA 1XYPA 3IZOA 2P5BA 3ZKUA 4FP2A 3U4SA 1ZZ6A 4DXRA 3BTXA 4PDWA 1X82A 4XAAA 4EV0A 3M8LA 3R0RA 1ZYBA 3ON7A 4YZ4A 2WRAA 2ZGRA 3KZ4C 1ENRA 5FZAA 1HQWA 2IUWA 3Q8FA 1YJKA 3JBG3 1COV3 5D2AA 1NCQC 3ZFEB 3CQOA 3PLQA 2QVSB 1OVPA 3APBA 4UBHA 4JRLA 1R64A 2RS53 2P2KA 4OMCA 1LB2A 1SFPA 4FFGA 5E89A 5JOZA 2B46X 2PMWB 3OGVA 4MV2A 1J3QA 4KH9A 5B4NA 3K77A 4L99A 5FQ0B 1W8HA 1LOAA 4NIHA 2VMGA 3AM2A 5JSRA 1YIPA 1AJKA 4WVMB 4Y5Z0 5A1AA 1HLCA 1NY72 3HD8B 2CAVA 5F6KA 1RUE2 2NPIA 2KD7A 2EAKA 2DCYA 2WL1A 1XXNA 2DVFA 4YG6A 4GH4B 2YHJA 4IETA 4L97A 4L0PA 5I8TA 1O3TA 5EXOA 1BK0A 1NCRA 3GBWA 3NJVA 4K40A 4AQ6A 4CDXB 2BERA 1AL22 4QKNA 3VD7A 4EN9B 3CO2A 5HI0A 5JZGA 1JOBA 2DBIA 4LLFA 3N9QA 4BXSV 2DCTA 3UJQA 3H3UA 2RDSA 3MEPA 5FPLA 3FWEA 4AI3A 4I02A 1LHUA 2XVLA 4NROA 3K3OA 2VW1A 4JKKA 1QXPA 3PURA 2VMCA 3OG2A 4XFBA 3OGGA 5F37A 2BOJA 1OLME 2YZ4A 3T1LA 4LITA 1SLIA 5ANNA 4JZRA 1RVF3 2WWUA 2YC2A 5JCTA 1WW7A 1RUD3 2A6VA 2QQLA 1Q8PA 1V6IA 2Y6GA 4LMFA 1O5LA 2WSVA 3N36A 1C28A 2ZHNA 2HBUA 4IGQA 1IQAA 2IXCA 3N7LA 1VBB1 5FYSA 3KCYA 2TUNA 3A4UA 3W5NA 4RFT0 2YY1A 1O8PA 4YW4A 1R1A3 2RS52 3ENRA 3ACIA 5EJ1B 5FYMA 2FZ1A 4HMZA 3AXEA 2IXIA 1HB3A 4M3CA 1UZYA 1RUI1 1NZIA 4GJZA 2GP5A 4MYEA 4QPGB 2HWC3 4XACA 5FZOB 3RI9A 4M4RA 3WDVA 4B3NA 1KS4A 1QJU1 2JDUA 1JZ8A 1PVC1 2OZ6A 4LPLA 2A3XA 2A6XA 1U5XA 4LBQD 3CJIA 4ASMB 2XHKA 4IE0A 5IJRA 1ALYA 4OULA 4QGNA 2QTWB 1W6QB 2RDRA 3POIA 1JTZX 2JECA 2WNOA 5L9VA 5HCHA 1EUUA 4DB5A 2W68A 5C8CB 3J7NA 1QJZA 5KHIA 5L73A 4EWDA 1ND2A 5DG1A 2QQIA 4QDSA 1JUIA 5FIXA 3BTZA 4Q4Y1 2VTXJ 1IQDC 4RSUA 2Q8OA 5CA6A 3LEMA 3CZJA 2YBPA 3MLKA 4ZXKA 1CESA 5IUQA 5CFCC 2WFF2 1W6OB 5CADA 2W47A 4XDQA 3VKMA 2GNMA 3T2QA 1CAVA 1MS4A 1DGRN 2DV9A 2NLRA 1MQTA 2PLV1 4IE5A 4WV8A 4A6SA 1LAJA 3WQ0A 2BDRA 3MYXA 2QQWA 1UOJA 4MGKE 2ZGMA 3BGAA 4ET7A 5FOJB 2DCKA 4WVWA 3G7DA 3R4SA 3VLBB 2ZHMA 5GZCA 4A3XA 2ENRA 2K2SA 2ZXQA 1H2LA 3DF0A 4OUSA 4U2AA 1D4M1 2GMEA 1UL9A 3A21A 4LXLA 4XW3A 2PAMA 4ZS3A 2P37A 4XF0A 2UWCA 5LBFA 3I3DA 5FZHA 4LK6A 3MGUA 1D4M3 3POBA 2YU1A 4LO5B 3S7EA 1FX5A 3KT7A 3WF3A 2C9AA 4B1MA 2WO3A 4QX8A 4X6RB 2AR6A 1PNFA 3X29B 5A3PA 3AMHA 3V0AA 4RD7A 3D5OA 3JCIA 3WDTA 2JD9A 1R081 2Y64A 3EB7A 3ITQA 4Q2FA 1ODNA 3UKNA 2C0ZA 3TEWA 2MEV3 2P6HA 2A5ZA 2JD4A 2DU1A 1GZWB 4P00B 4HETA 3N9NA 1VIWB 3NRUA 3W5MA 3O1VA 3VBRB 4YW2A 1AX2A 1W0OA 1AXKA 3FBYA 3ILNA 1W2UA 4A4AA 1W3XA 1AHSA 3KSCA 5I0UA 3HWJA 3VBHB 4AQTA 5FMDA 4UW3A 1RHI2 5A70A 2BWAA 1PM7A 4FO9A 2YGMA 2PHTA 2R072 4DOUA 1G9BA 2D97A 2XVGA 4Q4X2 4GMP3 3T2TA 3M3CA 3UESA 3Q9OA 1RUNA 1PIV3 3BTAA 3MIFA 1QDCA 3LDRA 5FZMA 4QM9A 1QU0A 2HEYF 3H8OA 2DYCA 3I2FA 5L9BA 2ZX1A 4YVWA 1UY4A 1LULA 2XWBB 1S0CA 1GBGA 3ZO0B 4AG4A 1AR92 1JI6A 1OUSA 1VBE2 2WUHA 2X8KA 3NNFA 1LOFC 4QQ2A 2DTWA 2WQ4A 3AP7A 1CAUB 3A22A 4QAWA 1NLSA 3QH6A 1DYPA 1Q3EA 5F2WA 3WNOA 3B5LB 4K8FA 3OBTA 2YPDA 4FAHA 4MGQA 1Z7S1 1EAH2 4Y1VA 1V70A 4QPIB 1XSQA 5CFDC 5JVVA 4PF5A 1HB2A 3RZHA 5A7WA 4YW5A 4NRQA 2O1QA 2ZAAA 4YVSC 4CEWB 2BOIA 1RYYA 4AF9A 1C8M1 1V9U1 4IL7A 2WNUA 3U07A 4K3UA 2J22A 4Y26A 5CNAA 3BI3A 5F5IA 5FXZA 2ZGTA 3VBOB 1EY2A 3FUQA 5DUUA 5F7UA 4IEZA 5FOBB 3BN6A 1NCRB 3HNYM 4O9EA 2WO7A 2YFZA 3ZXFA 1T6GC 1NUKA 1YI9A 1ZBE2 1CPNA 3ZXLA 4JDMA 1RUOA 2IXLA 5A32A 2ATFA 5FZ1A 4C8DA 4XPVA 5CG9A 2VQ0A 4B4RA 4QQOA 4QB1A 3N7JA 5K0UA 5FZ3A 2BYVE 5FYYA 3ZYPA 1V6KA 5JZGC 2IXHA 3VZLA 4C91A 4CU8A 3OSDA 3BUCA 1HIXA 1MS1A 3H9AA 4LHNA 1G7YA 3ZYIB 5BNPA 2D40A 5IW0A 2OKXA 3H1MA 3GZUC 2EAAA 5G05L 1MS8A 2Y8KA 2CAUA 3SHRA 3GJBA 1YUDA 3KQ4B 5IFPA 4BQ3A 1KQRA 3FLTA 3PUQA 3EJKA 4NHXA 5ABJA 5LW9A 3O5SA 4N8MA 4AWDA 3SH5A 4NVPA 1KRIA 2UWAA 2R6QA 5CFDA 2W39A 1ZZ7A 2B4KA 4W6XA 3VBFA 5DPNA 1YQ5A 1UU4A 2VVEA 4Q27A 2BGOA 3H1WA 3WNMA 1RHI1 2R063 3B02A 3LQCA 5FZ4A 5FXWA 5FZOA 4XHBA 3KMHA 2QQOA 4GA9A 4AEDC 2HYXA 5FPBA 4M3CB 3T2PA 3JD71 1YEWA 1DF0A 3NJZA 4LO8A 1HW5A 2H0VA 1S1AA 4XJ9A 1XNDA 4XDOA 3ZYFA 3RWKX 2E32A 4LBMA 4XF1A 4BQ1A 2D43A 1BVVA 2XXZA 1Y7BA 4NO4A 3SEPA 3GNEA 5AC92 1OHFA 1ZZCA 2PHLA 4WVVA 2Q1MA 2B39A 3EXUA 3OUJA 1NQDA 3GHNA 4QPWA 4AI0A 2CV6A 1G9DA 3WG1A 1ULPA 2HWD3 3RZGA 4QPGC 1ZBA1 1RINA 4YM0A 3SH3A 5FPXA 3ETPA 4Q0UA 4AYUA 4AFMA 3C7EA 3U11A 3M4FA 3KCCA 4LBOA 1KXGA 1SACA 5T3NA 4I01A 1W6NA 4I0WB 5FREA 2EXJA 5DUXA 5FAXA 2FMYA 5J7MA 3ELNA 1NT0A 1VPHA 2DCZA 4AI8A 1VBD1 2Q0AA 4GMP1 4TYSA 1H9PA 4FCAA 3WDUA 4AGRA 3QBQA 4B4QA 5DXDA 4FBFA 2ZHLA 1QXJA 4NPRA 1YXWA 4R52A 4I0BA 2EIGA 3AK0A 1LHNA 3ZIWA 4AEDA 5K7PA 4KL1A 4LE3A 3T3YA 3C3VA 1S0IA 5D1IA 4HOOA 3HAGA 2ZEZA 2OPKA 2WDBA 1IS6A 2G4IA 2WZR1 4IGPA 3WNKA 4UBGA 1MACA 4AAXA 3R05A 1DFQA 5AVPA 3OGSA 5G04L 3GZEA 3NL1A 3ETQA 4D94A 4EZ4A 1PNGA 4OFGA 3AZZA 4XBLA 1RVF1 1UD1A 4LOTA 3S30A 2GAUA 5ERLA 5B2GB 1UX7A 5F1RA 2DWRA 4HN1A 1X33A 5A7QA 3ZX7A 2A6YA 2ZGSA 1VBA2 2VBBA 1CAUA 3MLJA 2VOVA 1XNKA 3I4IA 3NWKA 5GALA 5CKMA 3VZNA 1MS9A 3VBUC 5BV6A 1WCQA 1CAXB 1IS4A 2VQAA 2GSYA 4CYDA 1ULDA 3SLIA 1BEV2 4LT5A 5C9AB 4FQZA 2XQRA 1RUH1 3ZYJB 5GZGA 1IS5A 3I59B 3C7HA 1OKOA 1C57A 1OF3A 2VCCA 4H3WA 1ZZBA 4E2GA 5DUVA 4YM1A 3IB3A 4GH4A 3WG2A 1TEIA 2BGCA 2B42B 4ASKA 1M06G 2OW4A 4NR1A 1UU6A 5F2SA 1S2KA 1O91A 4L11A 1ZRDA 1PIV2 2X5IA 4I09A 1UY3A 3CU7A 1JHJA 4N53B 2VMEA 3MUZ1 4MADA 2E31A 5FK7A 5FR3A 3BTYA 5F3GA 4MG2A 2XBO2 3EYPA 1FOD3 3C7OA 2UURA 3FHIB 3IPVA 3U10A 1LOFA 2VZ1A 4WZFA 1MZ5A 2XLAA 5FWEA 4QXCA 1WZXA 5FYCA 1JS9A 1FOD1 2P34A 1L7QA 1VRH3 3SKJE 3BU0A 3OB8A 1R092 2HEVF 1XE8A 3B01A 2ET1A 3AKTA 3PVEA 4KG8A 3PNAA 2OIIA 3POFA 1ASJ2 2DFBA 4WBBA 3MUY1 2X09A 3NKTA 4LKDA 4CCOA 5CEHA 4K9SA 1JU4A 3T0AA 2L9LA 4NIDA 1XU2A 3MW3A 1HJFA 3D6EA 5EQUA 4CDWA 1V6JA 1X8EA 4D6QA 1PO21 2Z5WA 1JYTA 2MNGA 2DU0A 1VBA3 3D4KA 3RPQA 4ES9A 3GJAA 2AH2A 1H4HA 1V6MA 1WA6X 1BK1A 2JG8C 4JRAA 1RC6A 5FBJA 3BVCA 5A7OA 5J3UA 5K8SA 1J83A 3AZWA 4COVA 1Z7S2 4XCBA 4FFIA 4QPIC 3I3MA 1XQNA 3WG3A 3HEIA 1JH5A 3AP4A 4QD2A 2ZJCA 1VBB3 2UYBA 1SFNA 1QJY3 4K20A 4CE8A 3NNLA 1K5MB 3IWZA 5AFEA 3M1HA 1LOBA 3OY8B 1UY2A 1JOPA 1QNYA 1LHOA 1CGPA 4YG3A 1DYOA 1NA1C 2D6MA 2G9GA 1DQ5A 2C6SA 3GHMA 3WF2A 2FDKA 4WZCA 2ZGQA 1C4RA 1K5MC 4KGQA 5ACA1 3VBFB 3BYWA 1PGL2 4YM3A 4AEMA 1LGNA 2SLIA 4OI4A 2UU8A 1OOPB 4P9YA 2WLPA 2PAKA 4H14A 5FXVA 1OT5A 1NCQA 1K42A 2WT2A 2R071 4GJYA 4QX3A 3OPZA 4XJAA 1H2MA 1PGW2 1CPMA 1WCKA 4XURA 4BQ5A 4CTEA 3E1F1 4CXYA 4BXFA 4PI0A 5C3RA 4GIQA 2YXSA 4OMDA 1IG0A 4AVBA 4Q4W2 3KHBA 1DZTA 4IESA 1T6BX 1JYIA 1UYZA 4S2GA 5EV7A 3PJYA 2D3RA 4J25A 1BMV1 4YW7A 3RZMA 1WKYA 3E97A 1U5ZA 4AFBA 1ND2B 3KF3A 1L7LA 5LCWL 4HLTA 5ISLA 1ZBA2 1W9TA 2GN7A 2HJIA 2D5HA 2HLEA 3KS7A 2VR4A 5KHHA 1GNZA 3CDZB 5AC93 2JEMA 3PDQA 3I3BA 2BEOA 5JI7A 1OMIA 4LE4A 5JXJA 4CZSA 1KGYA 4CEYA 1RUF3 3W59A 2VL4A 4N43B 2PAEA 4Y22A 4QGMA 5GLVA 3AFKA 3LE0A 4UFKA 3IDEA 5C4WC 1YRZA 2WO2A 2CHHA 4UFHA 5A6QA 4AHXA 1CVNA 1PX4A 3RWNA 1WWYA 1HN1A 1QXRA 4RL7A 1U5IA 4Y20A 2BW8A 4XUOA 1SCSA 3GDBA 3WP5A 3ZXDA 4AEDB 1GP5A 1ENQA 3RJ2X 4XAEA 4XHXA 1TZOA 2PLV2 4PF1A 2DF7A 5C9AC 2RG4A 1HRV1 3H50A 1TME2 2QZ3A 5FMBA 3I2DA 3DEMA 1C8NA 1STMA 2J1EA 1MS5A 2R7EB 1D2SA 1UYXA 4XABA 4IEVA 4OCTA 3H42B 1TE1B 4E27A 4G9SB 1OURA 4GD4A 2ZMKA 4MHRA 4PBOA 3CKHA 4BYYA 2F4PA 1XYNA 4QX0A 5DAXA 4YVWB 3WD5A 2OPWA 2RJLA 2W1SA 3B00A 3HJRA 4ASLA 1XNTA 4CDWB 5T55A 1RUC2 4BK5A 1GMMA 3J4UH 1W2NA 1IGOA 3OGRA 3PMEA 4AAPA 5FZDA 5C3SA 2KM2A 3FN9A 3M3IA 1VP6A 2WZR3 1ULCA 3NV1A 1PVC2 2JENA 3FC0A 3EHKA 5EJZB 1BJQA 4PHZA 4QU1A 3WW4A 1WLWA 1TME3 4GXLA 3J8F1 5GZDA 1TG7A 3OUHA 2C26A 2A3WA 5J37A 2WT1A 2FDHA 3IDCB 3O7OA 5JLVA 4FFFA 3Q8AA 1LEMA 1XJAA 4K8RB 5FV3A 5FUNA 4RGAA 4Z82A 1NCRC 1DBNA 1O4TA 1SFYA 1YI7A 2RS11 1A6CA 3NAPC 5CAZA 5CG8A 1ZRCA 2HWB2 1NKGA 4HONA 4XFIA 4XQ4A 4FTSA 3PVOA 4DPNA 2XMLA 1AXZA 3UNPA 4LKFA 3OD0A 3ZXAC 2TEPA 3D3AA 4IV3B 1U5YA 3VL8A 5T50A 2V72A 3N3HA 1PVC3 1RUJ2 4ONUA 1NCQB 2O0OA 2BP6A 4QXBA 1BXHA 5FKBA 4W50A 5LBEA 4MO3M 3ZFEC 5BNNA 3R4UA 3F95A 5T54A 2CGOA 5A80A 4ARXA 4XEZA 2VE1A 2Q30A 2E53A 1COV1 5FY7A 5H9RA 1JMUB 3VBHA 2WNVC 2XQXA 4Q0QA 4KWKA 4FOWA 1NG0A 2W94A 4RHV3 3TN92 3VN4A 4BH9A 1OD5A 3ACHA 3VBSA 3KHCA 3NKGA 3DPRB 3FX3A 5FYVA 1IPSA 1D0HA 3WDWA 4CPBA 3OOXA 4DEQA 5C3PA 4QM8A 3KVAA 3RGBA 3VD4A 3ACFA 2RV9A 4ORFA 1N1TA 1NE4A 2NM1A 1Q43A 1V0AA 1H6YA 4NHKA 4QDQA 3ZM8A 2HBTA 2R32A 3TN91 1O4YA 1WUVA 2JXAA 1L3JA 3E5XA 3VDBA 1DCSA 1W03A 3PHMA 4LHKA 1F8VA 4Y20B 5A7SA 1ZZ8A 1RMU1 1LENA 2J1AA 2RJ2A 5LBBA 4E4ZA 2JG9B 4NIAA 4KQ7A 1A34A 1PHMA 1LOGA 5FZGA 1H1MA 1YFWA 3T09A 1AR82 2G19A 1BBT1 3AMMA 1FNYA 3Q8CA 4HSJA 2VUAA 1AR71 4QDRA 4CCCA 4N53C 1CX1A 4QHBA 3U1XA 1US3A 5T5LA 2WT0A 3G6JB 3I8TA 1UZ0A 3WX5A 1YFUA 4DEVA 3VUOA 5EJ3A 1UNBA 2FDFA 1PK6A 1YHFA 2GDFA 4C0HA 1CIYA 2WYSA 5KR7A 1GZ9A 4GMP0 1K45A 2IFRA 2PHRA 5FY9A 4XUQA 3AP6A 3VV1A 4UFIA 4IDZA 5J36A 3CLPA 2EALA 3E6DA 4XC9A 5JIAA 1CN1A 4AEKA 1U12A 4W8JA 1H4GA 2J1TA 3AJYA 2ET7A 1SQ4A 4XFHA 4C1XA 3MICA 2P3YA 3PU8A 5HCAA 4ISRA 4IQPA 2X5IC 3BPSA 3AL6A 4IE6A 1ZRRA 4CA9A 1TMF1 3QOPA 5A3NA 4YM2A 5LK7B 3AXDA 4UW6A 3AYEA 3MPBA 5D21A 4FPJA 1HX6A 2E9QA 3KV9A 4HPKA 1D4VB 3DKWA 5JOXA 3ZYRA 4L92A 3GALA 4W6WA 2VNOA 1ZNPA 3FJSA 4Q4W3 5GJ6A 2AUYA 1GP6A 3UV9A 2WA3A 4O9GA 1H8VA 1H1AA 1PO22 3WF4A 4AHYA 5ACA3 2W52A 2WC2A 4A7YA 3T30A 5GM0A 3N9OA 3S5QA 1QMJA 1IKPA 1OD3A 3N9MA 2ZAHA 4LUKA 2E51A 3ME2A 1ASJ1 1PGSA 5EYYA 2J1VA 5HV0A 3T4HB 1X9PA 3NW4A 3O1MA 1GU3A 5D8AB 4W65A 3WCSA 3WUCA 4EQVA 4ES8A 1EAH1 4CDUB 1RUI2 3WNLA 3LDKA 4JVAA 4D6RA 1A78A 1YJLA 3UGFA 3EMRA 3UYJA 2RS51 2LROA 3ZSLA 3VHOA 1UX6A 2AACA 1W0NA 4F7ZA 1GQPA 3LA2A 4Z92B 1X8MA 1EV13 1K12A 1S0BA 4A2UA 4AR2A 2QDRA 2WNUB 3QLQA 1CAWA 3THCA 1KFUL 4P9WA 4XMAA 5C9AA 1UPSA 4FPYA 2BWCA 3U0ZA 3JQWA 2D98A 4UF0B 2VVDA 3VDCA 3QD6A 1I5PA 1QNWA 1PX3A 2WZ8A 3ALQA 3M3QA 4YZ3A 5FYIA 1N3QA 1O3RA 1PK6C 1SG3A 3C8XA 1ZRIA 2TBVA 2Y0OA 4JGYC 4UFLA 4YZ5A 2ZMLA 1CZVA 3GYDA 3O14A 4IERA 4L8QA 5IK4A 4Y1ZA 4YVSA 3FHAA 4QX7A 4FFHA 5DUWA 2BU9A 3WCRA 3ZN6B 4A42A 4ZU7A 2E33A 4OI1A 3RNSA 5FK8A 4B7KA 4FI9A 5IFTA 1RUG1 2I2SA 4NPLA 5T5JA 4ZS2A 2VTXA 1EV12 4LBLA 3THDA 4MGIE 3IM0A 4XVHA 5IVEA 1UIJA 2ZKNA 4P5HA 3SISA 3WF1A 3WT3A 3CJIB 2W0XA 3KWVA 5CZKA 3N4MA 1TMF3 2WZR2 2KA3A 2UYAA 2ORXA 3DCQA 1R082 3ES4A 4RQPA 2BUKA 5C3QA 3B9CA 2TNFA 2Q8EA 2YYOA 1WD3A 4YPJA 1E5RA 1HKDA 2AC1A 1OUXA 4WM7C 4XDPA 1TNRA 2KR2A 2NZ9A 2ZGLA 4WM7B 4FTEA 1WLTA 2CWMA 2I74A 3AKRA 1IG3A 3BB6A 3FFQA 3LFMA 2XWJB 3ZYHA 3N7KA 2OS2A 4BIOA 2DDUA 5FLJA 5JIUA 3VBSC 1C1FA 1VBD2 2R1DA 4O7XA 4AE2A 1RHI3 2R061 4O65A 2GN3A 3IAQA 5BNOC 5I0SA 2CDOA 3W58A 1RUJ3 3PVBB 1MZ6A 1W2TA 2E7TA 1E57A 1NZCA 5F32A 5FKCA 2P3IA 3V64A 1AVBA 5BNQA 3BALA 4K6BA 4HT1T 4ZY9A 4TLFA 2C9KA 4PDWC 2RS13 3MPPG 1F9KA 1QOSA 3M70A 1EYBA 2NYYA 3T2OA 4QB6A 4UYBA 2JB4A 4CUGA 2RJKA 2WFF1 4QT6A 1UZWA 4KMQA 4CP9A 5ABJC 5KHKA 1UOBA 4YW1A 4BWOA 1QKQA 3LGRA 4HFSA 3ZFFA 1AR93 1VBE3 2P3KA 4W4ZA 1MS3A 2LW8A 1OOPA 1ST8A 3CBNA 1REDA 1W9WA 2ZX3A 3OPWA 1UU5A 1VBD3 1TQ5A 2BNOA 2DVDA 2Y6JA 4SLIA 4XIOA 1GANA 5LBCA 1FPN2 2SBAA 5IAVA 2X05A 1XRUA 5FXXA 3ZVXA 2HKXA 3INAA 3JZVA 4GKXA 1NOVA 2ADDA 4J6GA 4CCMA 3U37A 1H8TB 4Y1YA 1UZVA 1NXMA 4JDNA 1FV2A 2YC4A 3A0KA 4RS5C 2QNKA 3PVNA 2IC1A 3VZMA 5LWBA 4OVEA 3ZYGA 5KHGA 1MEC3 3B94A 4R9AA 1NX9A 4XF4A 3ACGA 4JKMA 1EPZA 4XFAA 2D44A 1PO12 1S2EA 1QDOA 5DZFA 2VZUA 1PO11 4UF0A 4FTBA 5FO7B 2W1WA 4E8DA 4KBBA 2ZX2A 3AL5A 4PBPA 3OUIA 2YMZA 1W9FA 2EXIA 2ZEWA 2GU9A 2CY6A 3U14A 2XJUA 4PDWB 3V65A 4B7EA 2OA2A 4Z2WA 1XOYA 1FATA 2ZGPA 4ITCA 3ZLIA 3SCHA 3B69A 4CPBD 2XUEA 2JDYA 3ZFGB 1UKGA 1WMEA 4X8PA 2VO5A 1Q5OA 1UF2C 4UT5A 3WR0A 1S0GA 4CDXC 5E6HA 5IHRA 1DZRA 3K48A 4N90A 5HBAA 3C7GA 4GH4C 4OHWA 4RS5B 5FY0A 5FP7A 2BNNA 4XTPA 4BQWA 2GNBA 4TZDA 4E9KA 3OPTA 1OSGA 1GP4A 2NMOA 1HV0A 4RR3A 2XUMA 3A7QA 4A6OA 4LNVA 3PUAA 5E16A 5C6CA 4R9BA 3MDPA 3N35A 3ATGA 4P5YA 3TNQA 1R1ZA 3J26N 5SV5A 3USSA 1FPN3 5L36A 1W8FA 3AMPA 2ZGNA 3RI8A 4OUMA 3WNPA 4FVVA 3WW3A 3I2HA 4IEYA 5LASA 3R6SA 3S57A 1I5ZA 4JQRA 3VZKA 4G4FA 4BQXA 1DHKB 4Q4W1 3RJRA 2I45A 1HRV2 3PIJA 3HNBM 3EQEA 5IATA 4CDUC 3HN3A 5JR2A 1QQP1 4A7KA 4YZ1A 4AQ2A 5LA1A 5KXBA 2BJSA 2XKOA 3KT1A 4GB33 4QKDA 2FMDA 1R1A1 4CUBA 1JZ7A 3NV3A 1JYVA 4COYA 1JHNA 2VNVA 1QJFA 2Z4FA 2W08A 2VC9A 3SC7X 1F31A 2VVFA 1JODA 1DYKA 1YWKA 4C1WA 2XH6A 3E5QA 1OF4A 4E8CA 1DGWA 1VRBA 1VLNA 4N7UA 3AZXA 1YCIA 4FPLA 1IS3A 4IV3C 2VUDA 5DDJ2 2WFPA 1CWPA 4K21A 4OHVA 3LA3A 3UJOA 4Q4V3 3OF1A 5BXXA 1HRV3 4H7MA 1RUG3 2GMMA 5M0TA 2JWPA 1W8TA 4UW5A 5J48A 1CAVB 1JBCA 1EV11 1NA1A 1W2AX 2DURA 2P4EA 4WM8A 3KQRA 4XBQA 4E4DX 2WFF3 2E63A 1RMU2 1CONA 1UY0A 4BQ2A 4XZUG 4CDUA 2RHPA 3WP4A 2B7YA 4JGYA 4UAPA 5D8AC 2ADEA 2NQYA 3R4DB 5BYNA 2LTNA 4GQ7A 2OUJA 4RR3B 3W21A 3ZPYA 1VJ2A 1LODA 4XQWA 4Q0VA 4BA6A 3VD5A 5FQ0A 2D5FA 3WP6A 5A3TA 4URAA 1CX4A 2XGXA 2D93A 1REEA 2CWSA 1N3OA 1NQJA 4LORA 4P9LA 1VBC3 4JX0A 4KU7A 4R4ZA 4XF9A 1WMFA 4OZOA 1WBFA 4AXOA 4MGTA 3I3EA 4KU8A 1D7PM 5APAA 1SCRA 3CF6E 3CHXA 1B35A 4JGZC 3ZR5A 3DXUA 2GC2A 3NVCA 3S6PA 4CRQA 5JXHA 4DUVA 1DQ1A 3ZFFB 1ZX5A 4XCAA 4LO4B 2OXBA 4Q4X3 4C90A 4Q1PA 3ZPOA 5LEJA 2XBO1 2QE3A 4IV1B 3GGLA 1GWLA 3ZMOA 3TWIA 4EYUA 3AX4A 2F4LA 4YSFA 1Q8QA 4GKYA 3VBHC 5EYXA 2CDPA 1TVGA 1Q8VA 2MEV2 2ZEXA 2PHFA 4A3ZA 4M0HA 2ARXA 3LKJA 3ZXGA 5FTTC 1I9RA 1FAYA 1Z7S3 4CCKA 1OI6A 2VOXA 1N3PA 4M4PA 1E5HA 5FYHA 4FPFA 3HNMA 3VDDA 2QFEA 2B5HA 3MF9A 3UK9A 3A23A 3TOJA 1JZ4A 5LA9A 1YC61 3CJIC 1RL3A 2VJXA 4JDOA 2VNGA 4M3CF 4Q8LA 3FL7A 1ZZ9A 1VALA 1DG6A 3BOWA 4PJYA 5IK7A 1FNZA 2AGSA 5FWJA 4HKLA 1O3QA 5JZGB 2HEWF 5FY8A 1TNFA 2E26A 2VQUA 4GWJA 1FOD2 1NE6A 2WQZC 2WWJA 1WCSA 4JCKA 3VKLA 5BNNB 4TTGA 3O1UA 3VD9A 4P9IA 3ZOIA 3KF5A 3IT8A 1UY1A 2IVIB 3N9PA 4BB3A 4BOWA 3AMNA 1F4HA 1RUC1 1W3VA 1XE0A 1O6UA 1Y9GA 3AZYA 1QJU2 4Y24A 4EJRA 3IDBB 2JB8A 4URTA 3OD4A 3AP9A 3K4DA 1N1SA 1WLCA 2VAUA 4JV4A 1EAH3 4MXWA 5F39A 3RG0A 3CIHA 4NAMA 3LD8A 4Q8KA 4CXWA 5C4WA 2RM21 3UGGA 3NMBA 5C4WB 1UPIA 2WABA 4JTOA 4IGOA 5CFDB 4FAGA 5J09A 1BBT2 2ARAA 1RJ8A 4Q1RA 1AR81 2LS6A 1WCDJ 2CU5A 3BIWE 5FZCA 4LIVA 3ILFA 1JN2P 3RRDA 1W99A 3VZJA 3PUIA 5JMOA 2JIJA 5FMCA 3WG4A 2PQQA 3O1RA 3FLPA 1F35A 2XONA 4MOAA 1ZRFA 4GAZA 4EN6B 2ZGKA 1DQ2A 1ZBE3 2PTMA 4Y4RA 3WXPA 1YQ6A 4BCUA 3ZSJA 5EHDA 3JQXA 3GCXA 3WF0A 2CSGA 1BVP1 4MVTA 4J1WA 5F5CA 5BPXA 2JG9A 2Q8CA 3QH7A 5C71A 4PLNA 1ASJ3 4HL0A 3LEGA 4UW4A 4DY3A 3ILRA 3POJA 4XFFA 5JSPA 2V73A 2WINB 1POV1 5IYYA 4HVRA 4CSWA 1NY71 2WSUA 3HBZA 5F5QA 1AL21 4QX2A 3FE5A 3HN1A 3NV2A 1H30A 3MV11 3ORJA 5FZ6A 5DAWA 2PHXA 3B3QE 1RUH3 1QF3A 4DRVA 4NJ4A 1G9AA 4U36A 5JPNB 3C7FA 1KJLA 1XC6A 2EA7A 2AEYA 2D3PA 3LCPA 2JDKA 2X5IB 3MIEA 3SMHA 2Z79A 2PXJA 2ZEYA 1UN1A 1US2A 2VMHA 3AYAA 3JD73 4UXAA 1WW4A 3J7MA 2W1UA 3O1PA 5F6LB 4XJ8A 4LIUA 3ZFEA 2R062 1FMD2 3ST7A 3PUHA 1RUJ1 1W28A 4NHYA 2XDVA 5A33A 3ZFGC 2XPJA 4LA3A 1DLLA 2JDPA 4EROA 3I3QA 1OFSA 1WLDA 2OT7A 4Q29A 2A71A 4GB32 5I0RA 1POQA 3LAGA 4NIGA 4YGBA 2RDNA 4MGSA 1YNAA 5IVVA 5LRSA 1DLCA 1RGSA 3H8UA 1GLHA 5FMOS 1ND2C 1GFF2 2EXKA 4FQ4A 1GWKA 1DQ6A 1GQGA 1HJGA 1VAMA 1W6PA 4Q4V1 1W8NA 1ND3C 3MV01 5LA0A 2OUHA 3LOBA 3LSEA 5JUVA 3NJXA 1H2NA 1UYYA 4YYOA 3GXUA 2VZTA 4OLLA 1RUG2 2G9ZA 2YUEA 3OYWA 5EIYB 4IV1A 3AVRA 2Z2SB 3KD4A 4DFSA 1BQPA 2Y6LA 2JKBA 3POGA 4IEQA 1ZBE1 3AKPA 4N43C 3K2OA 4NHLA 3MIHA 4AGVA 2ARCA 1RIRA 1AYN1 1SDDB 2XKPA 1GOHA 4QWNA 1JOJA 5C8CC 4YRDA 2GH2A 2ARBA 1LECA 3RMYA 5JMCA 1MEC1 5C7GA 5ANQA 2V5YA 3RZKA 3GM8A 4P9GA 2WZPP 1NYWA 5LA2A 4MX3A 1SBDA 1DQ0A 1PZ8A 2VY0A 3AKSA 5CVRA 3ZXJA 1Q8SA 2WAOA 2XLGA 4AFAA 4NAOA 4XUTA 4CCLA 1VBC2 3RFRA 2BBAA 4MZUA 4XETA 4A7ZA 2DVAA 2JJ6A 4HBNA 4IE7A 3PJQA 3PL0A 5LRRA 4OQ8A 4L2NA 1K3IA 5KWRA 4JHTA 3I2OA 5CYYA 3LOIA 4ATEA 4HPKB 4AHZA 4KBZA 3VGIA 1S4CA 3VBUB 1VAVA 2BFUS 4K7JA 2BTVC 4YWAA 4AHWA 1OA2A 3IKWA 5A7WB 2VCBA 1VBC1 1FPN1 2EIBA 4NRPA 4QXKA 4AEJA 2B45X 2W87A 1OLMA 1ONAA 4CEYB 4S2HA 4BMBA 2IZWA 4NN0A 2V5DA 2YU2A 1OQEA 1WMDA 2BVBA 4GWNA 1ND3A 4XQDA 2VBDA 3FMGA 5DQ0A 2Y6FA 3D82A 4QGLA 1AYN2 3PU3A 1SLBA 3K46A 3WOGA 4CEYC 4EWAA 1HXS3 3SCFA 3T4VA 5GZFA 1G6NA 1AZDA 4DQAA 5KBFA 4XYXA 3RZZA 2D7FA 3VHRA 1BMV2 5A33B 5GLZA 4DUXA 5JAXA 5LB6A 3HQXA 2O14A 4MGZE 4ARYA 3RQ0A 4LHSA 4CEWA 5BNOB 5GLTA 2GH8A 2QDNA 3NJYA 2Y60A 3VBSB 1SMVA 1W04A 1QQP3 1AYM3 2YG0A 2W1QA 1IKQA 2WN3A 1LHVA 1CAWB 1UAIA 1XBFA 5FY4A 5B4XA 5KXDA 3T0DA 5DAQA 1PGW1 1DQ4A 1U0AA 4IEUA 5DDJ1 1AYM1 1Z0HA 4IE4A 5KC6A 4QQHA 1AYN3 3KGLA 4QX5A 3VD3A 4YZ2A 3OBRA 2Q1ZB 1S55A 5FO9B 1PO23 3RVHA 5ACA2 1PGL1 1H8TC 1VRH1 2A73B 1ZM1A 2EXHA 1UIKA 1JZ6A 1H9WA 4IV3A 5FLHA 5KXCA 1BBT3 2XJSA 5BNPB 1HRI3 1H0BA 2PELA 2ZACA 2PN5A 4LULA 3PTYA 3USUA 2E7AA 3BPZA 1QQP2 4E2QA 5A1LA 4CP1A 3NV4A 2YV8A 2FQPA 2IWGB 3WQ1A 5E88A 1HRI1 3UL2A 2HWF2 4OQ9A 3JXSA 4LBNA 2W3JA 2J1UA 2C4XA 2VQTA 4HXCA 2B8MA 4I0AA 2JG9C 1WMXA 4GWMA 4LA2A 1DGRA 2R49A 3AVSA 4XUPA 2ZKLA 3WNNA 2HWE3 1WW6A 1R091 2Y6HA 3HQUA 4RQPC 5JPMB 3DYMA 3VBOA 1RB8G 5FZ0A 5CFCA 2HYKA 2ZPXA 4M3CE 1AX1A 1W8OA 4CDQC 1UMZA 2RS32 1W6MB 3H1YA 3KGZA 5A7NA 3MW2A 3IIAA 2YBSA 2YBKA 2IXKA 3J7LA 2O8OA 2WR9A 1QJX3 3LIGA 4BQ4A 2DBNA 1UWWA 5E8AA 1LNSA 4HSLA 5LY2A 5FRAA 2B9UA 4BM8A 3JBG1 2Z69A 3DN7A 4PIYA 4Q0PA 5FPAA 1O4ZA 1KEXA 2QUOA 3O1SA 2RR11 4DMIA 1PZ9A 4Q0SA 1J3PA 5E1RA 3ZDVA 1V00A 4BE3A 3JD72 2VUJA 1RUD2 2WWSA 4D7YA 3KT4A 1X50A 2VMIA 1YQ8A 1J59A 3I2GA 3LFIA 1SDWA 3F2ZA 1DU3D 4N9HA 4CP9B 4R9DA 2FDJA 2J7MA 2RS33 4UWDA 3GCWA 4WVZA 5KHJA 4AVVA 2X29A 4QQPA 5IVJA 1BYHA 4PQ9A 3LSDA 3M3EA 3WNXA 5DAVA 2YDEA 3ZR6A 4PCRA 4RA0A 5F8PA 5TSWA 2PFWA 2RM22 3H3ZA 1B35B 2YROA 1E5SA 4YFWA 2CYFA 1LGCA 5LZ6A 5K4LA 4MLOA 3VL9A 3CMGA 3FZ3A 3J8F2 4KGGA 5JXIA 5I8SA 1M4WA 3IMNA 5EZWA 3MIGA 4GALA 1W9YA 3NAPB 2XL7A 3HPNA 1DZQA 4N7IA 1MZFA 3WY6A 4XE9A 1GNYA 5J1XA 1W6QA 1RXGA 1VE0A 4PLOA 1VBA1 3QCWA 3LDBA 4RS5A 4LHLA 2VD7A 3SNMA 1LU2A 5FO8B 1C1LA 1YQ2A 1KS5A 4BHPA 1SZBA 4META 2WN2A 3LEIA 1AX0A 2RM23 4V2VA 4BJ0A 2WA4A 1QEXA 2D6LX 2PHDA 1DGLA 3J9SA 3ZN5A 1ODMA 5IVCA 2PHWA 1BKZA 4LO7A 1F5FA 5HCFA 1O8SA 5DZEA 5L7OB 1FXZA 2VOKA 4YVWC 1TME1 1LKNA 1MQTB 3URFA 4BIFA 3ACLA 2BGPA 4INDA 3OCPA 4NE9A 5FBZA 1AR72 4FOYA 1J1LA 1ULGA 2ZX4A 4WM8C 1RUD1 2ZX0A 3UKTA 1Y9QA 5T52A 4JGYB 1I1EA 4CUCA 4XXAA 4BISA 1W39A 4HVOA 2R073 3WDYA 5FZFA 3AFGA 4B29A 4ZPIA 4GZ9A 4Y33A 4FPOB 4AW7A 1EPWA 3HBKA 2CTVA 2E6VA 1OQDA 3EO6A 5JDBA 1LGBA 4N9IA 3ZFFC 1F5JA 4AZZA 1APNA 2WBKA 2D6NA 3GBGA 1GYKA 5J96B 1GZCA 2XR4A 3ZXEA 4Q4X1 3RSJA 3SQOA 4DO0A 3ZKYA 2BV4A 3KV6A 1N1VA 4IXLA 2ZBJA 3U78A 1OLRA 1P8JA 2HH9A 2HWB3 1LR5A 1FV3A 5A3UA 1ULOA 4XXPA 4Q5OA 5A6ZA 3KVBA 2PHUA 1ULEA 2VTFA 4Y1UA 1UMIA 1JYWA 1UXXX 3NQHA 2WNVA 4EWEA 3I2JA 4QPGA 1COV2 3SITA 1GV9A 3JU9A 3USUB 4FOQA 1HXS2 3GBFA 1K5MA 3NNMA 5I0DA 4AK3A 1LESA 1SLTA 4XJWA 2VNRA 5FZ7A 2LRPA 3VDDB 4FP3A 4JQTA 3VHPA 4CXXA 3TEYA 2DCJA 4I3PA 1LRHA 2F6BA 1Y9MA 3K3NA 4TWTA 3O12A 5DN2A 4ISQA 1SLAA 2B9VA 2DUQA 2XJQA 4RGKA 1AYM2 4FPHA 5BY5A 1A3KA 1G9FA 2W91A 4QB2A 3WQBA 4NHMA 2EVXA 3AP5A 1QOTA 3MIDA 2WLQA 5JI9A 4LJHA 1B09A 4BMEA 1BCXA 3WHTA 1OPMA 5A3MA 5FPZA 2JG8A 1RUE3 1OBNA 2XJPA 2YFUA 3ASIA 3O0WA 4CDXA 4CVUA 2PQSA 2QQUA 2QQNA 2VXRA 4FPEA 5FLIA 5I93A 1UOGA 1XNBA 3DXTA 2GC0A 5A6XA 5K0UB 2FHRA 5C3OA 5GZEA 5BNNC 3V0BA 1KFXL 4XFGA 1R1A2 2GC3A 1AF9A 1D2QA 2DVBA 4NWWA 1OLQA 5DAPA 4YW6A 3AYCA 3VDAA 3MW4A 3GZTB 1FYUA 1PO13 2FZ2A 3H8RA 1LCLA 3IPVB 4Y5TA 4C0BA 1RJ7A 4P14A 1WA4A 2VZPA 4LOSA 1URXA 3O1TA 3C2UA 1OKQA 2ZZQA 3WUDA 1DIWA 1T2XA 4KWLA 5BNPC 1AR83 2JDAA 4TLGA 2HWF3 1SLLA 1HQLA 1W6MA 4YG0A 3HT1A 4IEOA 1SPPB 1UXZA 5CKQA 5JOYA 4K1ZA 2KXLA 3V56A 1PMJX 4B1LA 2EIDA 4E4SA 3LZZA 4M01A 1XNCA 3WW1A 4A45A 2DTYA 2JDMA 2R16A 2QQPA 3KV5A 4CDQB 5C5UA 2RDQA 4V1PA 1XYOA 4N43A 1PMHX 4Y22B 5FYBA 1X9TA 5JXGA 4XFCA 5A7PA 2J1SA 3L2HA 4OI2A 4F83A 2R30A 1RTVA 3CNAA 2WYFA 1W06A 4R9CA 1ACCA 3VHNA 1KDMA 4D0QA 1PIV1 1W8WA 3RYKA 3IAPA 3I97A 4DY5A 2I07B 5AFBA 4ATFA 4ZKTB 5C8WA 2AENA 1B35C 4GWIA 3J7HA 3BIEA 3LA7A 4M00A 4MXWB 4IW3A 4CCDA 5F9TA 3W9AA 2ILMA 2QBXA 2CGPA 3BCWA 5H9QA 3TEZA 3LIHA 3P3PA 1QWRA 2W2IA 2O8QA 1BHGA 2WJSA 3HT2A 4NUBA 4AVTA 5L7OA 1CJPA 2Y0IA 3O0VA 1H2KA 5H9SA 4GULA 4D8MA 1AR61 3WINE 3NNJA 3POYA 3OGJA 4E2SA 2YPJA 2VPVA 4RGGA 1BLZA 2D6KA 3VKNA 1RVF2 2ES3A 2HWD2 1H6XA 3VBUA 3L9JT 4OI0A 2VGDA 5FZ8A 3LB9A 3EBRA 3OJBA 2AEZA 1QY4A 2RS31 3S7IA 5FP3A 3BOPA 1C3HA 2V4VA 4Q4V2 3Q8EA 2Q8DA
chains in the Genus database with same CATH topology
5A1AA 2R7EB 1UYXA 2WABA 1OH4A 2KD7A 2WO1A 2LS6A 4KI5M 3CKHA 4L0PA 1O59A 4QX0A 3NJVA 3K4ZA 1W99A 3T08A 2W1SA 3PUIA 2BERA 3HJRA 3VD7A 5JMOA 2VM9A 1XNTA 4MOAA 2XONA 4BK5A 1GMMA 4BXSV 3OGRA 3FN9A 5EJZB 3WF0A 4JKKA 1TG7A 2C26A 2VMCA 3OG2A 5C71A 3LEGA 4Z2AA 4OUEA 5IYYA 2YC2A 2VOTA 4QX2A 2QQLA 3MV11 2Y6GA 4CU9A 1NKGA 2J1RA 3UNPA 4HG6B 3C7FA 3W5NA 1XC6A 3D3AA 1O8PA 4XUNA 2V72A 2QQMA 1US2A 2ZEYA 3ACIA 5EJ1B 4A41A 2W1UA 4W50A 4MO3M 4LKSA 4M4RA 2W46A 3PUHA 3I2KA 1JZ8A 4ARXA 4LPLA 5IJRA 4DXSA 2XQXA 2W94A 1XNAA 3K75B 3ACHA 1EUUA 3LPGA 4DEQA 4MGSA 2JE8A 2QQIA 1DLCA 4QDSA 3ACFA 3VD4A 2RV9A 1IQDC 3CZJA 3FHQA 4P02B 1H6YA 1W8NA 4QDQA 2W47A 3ZM8A 3T2QA 5LA0A 3MV01 1J84A 3NJXA 5JUVA 1UYYA 3GXUA 2VZTA 4ET7A 3BGAA 3VDBA 2DCKA 5EIYB 3CIHA 2RJ2A 2J1AA 2Y6LA 2ZXQA 3WSOA 3T09A 3A21A 2QQJA 3DYOA 1SDDB 4QDRA 1GOHA 3I3DA 1W9SA 1CX1A 1MPXA 1US3A 1UZ0A 4DEVA 5C7GA 3WF3A 5DMYA 2WO3A 1CIYA 2WYSA 3GM8A 1K45A 2VCAA 5LA2A 4XUQA 2WAOA 2JD9A 4XUTA 2Y64A 3EB7A 3SEEA 2BBAA 4W8JA 2J1TA 1XPWA 4P00B 3W5MA 3NRUA 1K3IA 5CYYA 4A4AA 3T0BA 2YB7A 3OBAA 5C70A 2VCBA 2EIBA 3WF4A 2W87A 3UESA 4P08A 2VZRA 2V5DA 1OD3A 3I2FA 5DQ0A 1JYNA 1UY4A 2J1VA 4AG4A 1JI6A 3K46A 1GU3A 2WUHA 3NNGA 2X10A 3LEKA 3A22A 4QAWA 3WNOA 2WQ8A 1UMHA 3WNLA 4ZZ8A 4DUXA 4ARYA 4MGQA 4LHSA 3SKVA 1W0NA 1GQPA 2YG0A 2W92A 1K12A 1RYYA 2W1QA 2WN3A 5B4XA 3THCA 3T0DA 2J22A 2VMDA 4BK4A 4LQRA 2VZVA 5F7UA 4JKLA 3VDCA 3BN6A 1I5PA 1PX3A 2WZ8A 3HNYM 3VD3A 1SG3A 2YFZA 3C8XA 1NUKA 1GOFA 4RN5A 1JZ6A 1CZVA 2Y6KA 4QB1A 3FHAA 4A42A 2E33A 4CU8A 3MO4A 2WZEA 1EUTA 4FI9A 5IFTA 3THDA 2OKXA 4XVHA 3JXSA 5G05L 3ECQA 2Y8KA 2W3JA 2J1UA 2C4XA 2VQTA 3WF1A 5CZKA 5IFPA 3OEAA 2ORXA 4UI9L 4XUPA 4UOJA 3WNNA 2Y6HA 3DYMA 2B4KA 4YPJA 1W8OA 5DPNA 2BGOA 2W95A 3WNMA 3LQCA 1UWWA 1LNSA 2VZQA 2QQOA 2HYXA 2DDUA 3T2PA 4PT6A 1JZ2A 3MBWA 1KEXA 3IAQA 2CDOA 2E32A 3SEPA 4ZY9A 3I2GA 4BDVB 2C9KA 3F2ZA 4PQQA 4QPWA 3T2OA 4QB6A 2J7MA 1ULPA 2W5FA 3UETA 4KMQA 1JZ3A 4DUWA 3ETPA 3C7EA 4W4ZA 2LW8A 1W9WA 2Y6JA 3HOBA 3CMGA 2X05A 2VZOA 2RVAA 5JXIA 3WEZA 3P6BA 3U37A 4CU6A 3HPNA 1JU3A 4ZXEA 2YC4A 1GNYA 5J1XA 5HXMA 1NX9A 3ACGA 4OYUA 4JKMA 1YQ2A 2WN2A 3AC0A 2ZEZA 3LEIA 4BJ0A 3DYPA 2WDBA 2VZUA 2W1WA 4E8DA 3WNKA 1O8SA 2ZEWA 1JYWA 4AAXA 3OGSA 4IUGA 5G04L 2BGPA 2JKXA 2VO5A 2ID4A 2XOMA 4TXWA 4DXTA 5IHRA 1UX7A 3C7GA 4CUCA 1JZ5A 4GZ9A 1WCQA 2VMFA 4A6OA 3A7QA 3DECA 3ABZA 4KWUA 4P5YA 4CU7A 4A44A 2ORZA 2WBKA 3C7HA 1OF3A 2VCCA 3WNPA 3IB3A 1P8JA 3I2HA 3IIIA 1ULOA 1UY3A 3HNBM 5JR2A 2VTFA 1UMIA 3HN3A 1JHJA 2VMEA 1UXXX 3NQHA 3MUZ1 3OEBA 4MADA 5LA1A 2E31A 3I2JA 3EYPA 4CUBA 1JZ7A 3C7OA 5I0DA 1JYVA 2Z4FA 3IDAA 2VZ1A 2VC9A 3K4AA 2DCJA 4E8CA 1L7QA 1OF4A 3SKJE 4ZZ5A 3OB8A 2BZDA 5DN2A 5FUIA 2B9VA 3MUY1 2X09A 4QB2A 1JU4A 1SHWB 2W91A 2L9LA 2XHNA 3T0AA 3WQBA 1DP0A 1JYXA 2YFUA 1CZSA 4CVUA 2PQSA 2QQNA 1CZTA 1J83A 2W9XA 1UY0A 1NAEA 4XZUG 3HEIA 4UAPA 3VDAA 2EICA 3CZUA 4JHZA 3VD5A 1UY2A 2VZPA 4RYDA 3I2IA 1DYOA 1T2XA 2VZSA 2JDAA 4JX0A 4QX1A 3WF2A 1GOGA 4OZOA 3I3EA 1UXZA 1D7PM 3P1IA 1PMJX 2EIDA 5JXHA 4DUVA 1OT5A 2QQKA 4A45A 1K42A 4QX3A 2EIEA 1GUIA 4XURA 5JXGA 3E1F1 1PMHX 3GGLA 1L7RA 2J1SA 4OMDA 2CDPA 1TVGA 2ZEXA 4A3ZA 3LPFA 4D0QA 1UYZA 3IAPA 3I97A 4CUAA 4M4PA 1WKYA 4GWIA 3J7HA 3HNMA 5HPOA 3A23A 1F4AA 1JZ4A 5LCWL 2VZ3A 1W9TA 2HLEA 2WAAA 2VR4A 3CDZB 2VJXA 3FL7A 2QBXA 3I3BA 4DXRA 5JXJA 1KGYA 2VL4A 1BHGA 3LE0A 2E26A 2VQUA 4GWJA 2WO2A 3CQOA 4D8MA 4TTGA 1PX4A 1R64A 1HN1A 3VD9A 4XUOA 3GDBA 4OMCA 1UY1A 1H6XA 1F4HA 3OGVA 5B4NA 3K4DA 3K77A 4PF1A 2V4VA 2J1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A1A A;  2R7E B;  1UYX A;  2WAB A;  1OH4 A;  2KD7 A;  2WO1 A;  2LS6 A;  4KI5 M;  3CKH A;  4L0P A;  1O59 A;  4QX0 A;  3NJV A;  3K4Z A;  1W99 A;  3T08 A;  2W1S A;  3PUI A;  2BER A;  3HJR A;  3VD7 A;  5JMO A;  2VM9 A;  1XNT A;  4MOA A;  2XON A;  4BK5 A;  1GMM A;  4BXS V;  3OGR A;  3FN9 A;  5EJZ B;  3WF0 A;  4JKK A;  1TG7 A;  2C26 A;  2VMC A;  3OG2 A;  5C71 A;  3LEG A;  4Z2A A;  4OUE A;  5IYY A;  2YC2 A;  2VOT A;  4QX2 A;  2QQL A;  3MV1 1;  2Y6G A;  4CU9 A;  1NKG A;  2J1R A;  3UNP A;  4HG6 B;  3C7F A;  3W5N A;  1XC6 A;  3D3A A;  1O8P A;  4XUN A;  2V72 A;  2QQM A;  1US2 A;  2ZEY A;  3ACI A;  5EJ1 B;  4A41 A;  2W1U A;  4W50 A;  4MO3 M;  4LKS A;  4M4R A;  2W46 A;  3PUH A;  3I2K A;  1JZ8 A;  4ARX A;  4LPL A;  5IJR A;  4DXS A;  2XQX A;  2W94 A;  1XNA A;  3K75 B;  3ACH A;  1EUU A;  3LPG A;  4DEQ A;  4MGS A;  2JE8 A;  2QQI A;  1DLC A;  4QDS A;  3ACF A;  3VD4 A;  2RV9 A;  1IQD C;  3CZJ A;  3FHQ A;  4P02 B;  1H6Y A;  1W8N A;  4QDQ A;  2W47 A;  3ZM8 A;  3T2Q A;  5LA0 A;  3MV0 1;  1J84 A;  3NJX A;  5JUV A;  1UYY A;  3GXU A;  2VZT A;  4ET7 A;  3BGA A;  3VDB A;  2DCK A;  5EIY B;  3CIH A;  2RJ2 A;  2J1A A;  2Y6L A;  2ZXQ A;  3WSO A;  3T09 A;  3A21 A;  2QQJ A;  3DYO A;  1SDD B;  4QDR A;  1GOH A;  3I3D A;  1W9S A;  1CX1 A;  1MPX A;  1US3 A;  1UZ0 A;  4DEV A;  5C7G A;  3WF3 A;  5DMY A;  2WO3 A;  1CIY A;  2WYS A;  3GM8 A;  1K45 A;  2VCA A;  5LA2 A;  4XUQ A;  2WAO A;  2JD9 A;  4XUT A;  2Y64 A;  3EB7 A;  3SEE A;  2BBA A;  4W8J A;  2J1T A;  1XPW A;  4P00 B;  3W5M A;  3NRU A;  1K3I A;  5CYY A;  4A4A A;  3T0B A;  2YB7 A;  3OBA A;  5C70 A;  2VCB A;  2EIB A;  3WF4 A;  2W87 A;  3UES A;  4P08 A;  2VZR A;  2V5D A;  1OD3 A;  3I2F A;  5DQ0 A;  1JYN A;  1UY4 A;  2J1V A;  4AG4 A;  1JI6 A;  3K46 A;  1GU3 A;  2WUH A;  3NNG A;  2X10 A;  3LEK A;  3A22 A;  4QAW A;  3WNO A;  2WQ8 A;  1UMH A;  3WNL A;  4ZZ8 A;  4DUX A;  4ARY A;  4MGQ A;  4LHS A;  3SKV A;  1W0N A;  1GQP A;  2YG0 A;  2W92 A;  1K12 A;  1RYY A;  2W1Q A;  2WN3 A;  5B4X A;  3THC A;  3T0D A;  2J22 A;  2VMD A;  4BK4 A;  4LQR A;  2VZV A;  5F7U A;  4JKL A;  3VDC A;  3BN6 A;  1I5P A;  1PX3 A;  2WZ8 A;  3HNY M;  3VD3 A;  1SG3 A;  2YFZ A;  3C8X A;  1NUK A;  1GOF A;  4RN5 A;  1JZ6 A;  1CZV A;  2Y6K A;  4QB1 A;  3FHA A;  4A42 A;  2E33 A;  4CU8 A;  3MO4 A;  2WZE A;  1EUT A;  4FI9 A;  5IFT A;  3THD A;  2OKX A;  4XVH A;  3JXS A;  5G05 L;  3ECQ A;  2Y8K A;  2W3J A;  2J1U A;  2C4X A;  2VQT A;  3WF1 A;  5CZK A;  5IFP A;  3OEA A;  2ORX A;  4UI9 L;  4XUP A;  4UOJ A;  3WNN A;  2Y6H A;  3DYM A;  2B4K A;  4YPJ A;  1W8O A;  5DPN A;  2BGO A;  2W95 A;  3WNM A;  3LQC A;  1UWW A;  1LNS A;  2VZQ A;  2QQO A;  2HYX A;  2DDU A;  3T2P A;  4PT6 A;  1JZ2 A;  3MBW A;  1KEX A;  3IAQ A;  2CDO A;  2E32 A;  3SEP A;  4ZY9 A;  3I2G A;  4BDV B;  2C9K A;  3F2Z A;  4PQQ A;  4QPW A;  3T2O A;  4QB6 A;  2J7M A;  1ULP A;  2W5F A;  3UET A;  4KMQ A;  1JZ3 A;  4DUW A;  3ETP A;  3C7E A;  4W4Z A;  2LW8 A;  1W9W A;  2Y6J A;  3HOB A;  3CMG A;  2X05 A;  2VZO A;  2RVA A;  5JXI A;  3WEZ A;  3P6B A;  3U37 A;  4CU6 A;  3HPN A;  1JU3 A;  4ZXE A;  2YC4 A;  1GNY A;  5J1X A;  5HXM A;  1NX9 A;  3ACG A;  4OYU A;  4JKM A;  1YQ2 A;  2WN2 A;  3AC0 A;  2ZEZ A;  3LEI A;  4BJ0 A;  3DYP A;  2WDB A;  2VZU A;  2W1W A;  4E8D A;  3WNK A;  1O8S A;  2ZEW A;  1JYW A;  4AAX A;  3OGS A;  4IUG A;  5G04 L;  2BGP A;  2JKX A;  2VO5 A;  2ID4 A;  2XOM A;  4TXW A;  4DXT A;  5IHR A;  1UX7 A;  3C7G A;  4CUC A;  1JZ5 A;  4GZ9 A;  1WCQ A;  2VMF A;  4A6O A;  3A7Q A;  3DEC A;  3ABZ A;  4KWU A;  4P5Y A;  4CU7 A;  4A44 A;  2ORZ A;  2WBK A;  3C7H A;  1OF3 A;  2VCC A;  3WNP A;  3IB3 A;  1P8J A;  3I2H A;  3III A;  1ULO A;  1UY3 A;  3HNB M;  5JR2 A;  2VTF A;  1UMI A;  3HN3 A;  1JHJ A;  2VME A;  1UXX X;  3NQH A;  3MUZ 1;  3OEB A;  4MAD A;  5LA1 A;  2E31 A;  3I2J A;  3EYP A;  4CUB A;  1JZ7 A;  3C7O A;  5I0D A;  1JYV A;  2Z4F A;  3IDA A;  2VZ1 A;  2VC9 A;  3K4A A;  2DCJ A;  4E8C A;  1L7Q A;  1OF4 A;  3SKJ E;  4ZZ5 A;  3OB8 A;  2BZD A;  5DN2 A;  5FUI A;  2B9V A;  3MUY 1;  2X09 A;  4QB2 A;  1JU4 A;  1SHW B;  2W91 A;  2L9L A;  2XHN A;  3T0A A;  3WQB A;  1DP0 A;  1JYX A;  2YFU A;  1CZS A;  4CVU A;  2PQS A;  2QQN A;  1CZT A;  1J83 A;  2W9X A;  1UY0 A;  1NAE A;  4XZU G;  3HEI A;  4UAP A;  3VDA A;  2EIC A;  3CZU A;  4JHZ A;  3VD5 A;  1UY2 A;  2VZP A;  4RYD A;  3I2I A;  1DYO A;  1T2X A;  2VZS A;  2JDA A;  4JX0 A;  4QX1 A;  3WF2 A;  1GOG A;  4OZO A;  3I3E A;  1UXZ A;  1D7P M;  3P1I A;  1PMJ X;  2EID A;  5JXH A;  4DUV A;  1OT5 A;  2QQK A;  4A45 A;  1K42 A;  4QX3 A;  2EIE A;  1GUI A;  4XUR A;  5JXG A;  3E1F 1;  1PMH X;  3GGL A;  1L7R A;  2J1S A;  4OMD A;  2CDP A;  1TVG A;  2ZEX A;  4A3Z A;  3LPF A;  4D0Q A;  1UYZ A;  3IAP A;  3I97 A;  4CUA A;  4M4P A;  1WKY A;  4GWI A;  3J7H A;  3HNM A;  5HPO A;  3A23 A;  1F4A A;  1JZ4 A;  5LCW L;  2VZ3 A;  1W9T A;  2HLE A;  2WAA A;  2VR4 A;  3CDZ B;  2VJX A;  3FL7 A;  2QBX A;  3I3B A;  4DXR A;  5JXJ A;  1KGY A;  2VL4 A;  1BHG A;  3LE0 A;  2E26 A;  2VQU A;  4GWJ A;  2WO2 A;  3CQO A;  4D8M A;  4TTG A;  1PX4 A;  1R64 A;  1HN1 A;  3VD9 A;  4XUO A;  3GDB A;  4OMC A;  1UY1 A;  1H6X A;  1F4H A;  3OGV A;  5B4N A;  3K4D A;  3K77 A;  4PF1 A;  2V4V A;  2J1E A; 
#chains in the Genus database with same CATH topology
 1Q8O A;  3N9L A;  1RUE 1;  2K0G A;  4FT8 A;  3TEX A;  1NLQ A;  5EWS A;  4J1X A;  4IEW A;  1OH4 A;  4EE2 A;  2WO1 A;  4WVM A;  1W6N B;  1D4M 2;  5I0T A;  2E7Q A;  3D0S A;  2WS9 1;  4KI5 M;  3RZJ A;  3ZFG A;  1O59 A;  2HWC 2;  3H0O A;  3K4Z A;  4CCN A;  2FCT A;  4HKO A;  3PUS A;  4WM8 B;  5FFO C;  3T08 A;  4WM7 A;  2ZGU A;  2YC0 A;  2VM9 A;  5FZB A;  1X36 A;  2A6Z A;  3KV4 A;  1GR3 A;  1F15 A;  5FP9 A;  4AQS A;  4BPZ A;  3DL3 A;  1MQT C;  3TRS B;  2HWE 1;  4BZ4 A;  2XJV A;  2OVU A;  4PIZ A;  3DGT A;  2H6B A;  4HKW A;  1FMD 1;  5EFU A;  5L7O C;  1AR7 3;  1UYP A;  3AKQ A;  2MHF A;  3QAC A;  1IZ3 A;  4QPI A;  3ZDS A;  2MPF A;  5BNO A;  4O61 A;  3P5B A;  5A3O A;  2R04 2;  1XB9 A;  3ZIX A;  3H7J A;  4Z2A A;  3A0N A;  4OUE A;  3BOD A;  4AFC A;  4HN0 A;  2VOT A;  5I8Y A;  5FP8 A;  3KCX A;  1HB1 A;  1UZZ A;  4CU9 A;  2J1R A;  4PI2 A;  4HG6 B;  2RS1 2;  1VAK A;  5JOW A;  1SLC A;  2IVJ A;  3AB0 A;  3D0J A;  3KM5 A;  4XUN A;  5A32 B;  2QQM A;  3L2Y A;  5DG2 A;  4CP2 A;  4DZG A;  4HVQ A;  2CNA A;  2A70 A;  2UWB A;  1E5I A;  1UCX A;  4A41 A;  3MZH A;  1ZRE A;  1A8M A;  1C8M 3;  1V9U 3;  1NXD 1;  3M7A A;  4LKS A;  3N7M A;  1XE7 A;  1Y4W A;  4LUM A;  4XBN A;  4XIK A;  4YGD A;  4E4H A;  1VR3 A;  2W46 A;  3PTR B;  3I2K A;  3HMY A;  4L9B A;  1HV1 A;  1MR5 A;  1VB4 A;  3OYW B;  4CDW C;  4DXS A;  1QIQ A;  1IPK A;  1XSR A;  1GNH A;  4LBQ A;  3VBF C;  3UT0 A;  4D7S A;  2GZW A;  1XNA A;  2JDZ A;  4HZF A;  4XJZ A;  5GLW A;  5IVY A;  4Z8B A;  1JUH A;  3K75 B;  2JE9 A;  3OY8 A;  1PZ7 A;  3LPG A;  1W90 A;  4K1Y A;  3FBM A;  2XL9 A;  1LOE A;  2J42 A;  5HXV A;  2JE8 A;  1J1T A;  3BU7 A;  4BQY A;  3K51 A;  2ZAB A;  2D3S A;  3P3N A;  4X6Q B;  3FHQ A;  4P02 B;  4F3J A;  1AUY A;  1LJ7 A;  4LBJ A;  5DZG A;  3WHU A;  3O1O A;  5IK5 A;  1RUH 2;  5LK5 A;  1SEF A;  4OZX A;  2XJT A;  2JG8 B;  1WD4 A;  4ZHN A;  1OA3 A;  1J84 A;  2ZMN A;  4LLO A;  4XMI A;  1JXN A;  1S0J A;  3TYJ A;  1DDL A;  1NLR A;  1WBL A;  4MSV A;  5DAB A;  4DIN B;  1YO8 A;  1VMF A;  2GMP A;  2JX9 A;  5A3L A;  3V0B B;  1O3S A;  2OX0 A;  3M2M A;  3UGH A;  3FUO A;  2RR1 2;  4XOG A;  2UY9 A;  1AL0 G;  3WSO A;  4DRR A;  5FJK A;  3AZV A;  3S0M A;  2QQJ A;  4OHZ A;  1OVS A;  3DYO A;  1V6L A;  5KXE A;  1MEC 2;  1W9S A;  2LAL A;  3KLS A;  4Z1V A;  3HIF A;  4FPK A;  1MPX A;  1K5J A;  2VBP A;  4LK7 A;  5DMY A;  1Z78 A;  4X8N A;  1SBF A;  1W6O A;  4P9X A;  5K0U C;  1C8M 2;  1V9U 2;  2VCA A;  4MXV A;  3NST A;  4YGE A;  4COZ A;  4P9J A;  4ZU4 A;  1G86 A;  5FY1 A;  2K9Z A;  1MS0 A;  3SEE A;  3WV6 A;  3SXW A;  1V6N A;  1XPW A;  3V0A B;  2R04 1;  5FYT A;  3VBO C;  1ENX A;  2HWF 1;  2RMU 1;  1G9C A;  2WNU C;  5CU1 A;  2MEV 1;  4N53 A;  1QJY 1;  2VXJ A;  2VW2 A;  4V2W A;  1GZT A;  4DIQ A;  2ZTN A;  3T0B A;  4QPY A;  2RMU 3;  2YB7 A;  2Q4S A;  2VH9 A;  1WW5 A;  2ZA9 A;  2H6C A;  3OBA A;  1I3H A;  4YFZ A;  5C70 A;  4LO6 B;  4MH0 E;  5JR7 B;  4COU A;  1UOF A;  2G9F A;  4EZH A;  3WDX A;  4I2O A;  1S0D A;  4EN8 B;  1QJX 1;  5EPA A;  1ZA7 A;  2Q5T A;  4NOT A;  1KD7 A;  5F5A A;  4GB3 1;  4P08 A;  4BLJ A;  4H7L A;  2VZR A;  4TSV A;  5FZ9 A;  2P6C A;  5D8A A;  3H3L A;  1JYN A;  4HAN A;  2ERF A;  1D0G A;  2RR1 3;  2ZS6 B;  1AJO A;  3E5U A;  3NNG A;  2X10 A;  2BBV A;  1REF A;  3LEK A;  5FCC A;  2C1F A;  2A3Y A;  2RMU 2;  5GKA C;  5AC9 1;  2WQ8 A;  1UMH A;  2VEC A;  2JIG A;  2ZHK A;  2PLV 3;  4ZZ8 A;  5JWP A;  1ULF A;  1HXS 1;  3MF6 A;  4QHO A;  3TBD A;  1UQX A;  1ENS A;  1UO9 A;  3B7M A;  3SKV A;  4Y5S A;  1RMU 3;  4MGY E;  2IFW A;  2W92 A;  2ZCW A;  4Y3O A;  1YFX A;  5CKN A;  1O7F A;  2Y38 A;  3CL1 A;  5BUV A;  2VMD A;  4JC1 A;  4BK4 A;  1OC1 A;  1XU1 A;  2VZV A;  4LQR A;  4QKB A;  4NII A;  4JKL A;  1CD3 G;  5FUP A;  5FPV A;  2DUP A;  4BU2 A;  1GSL A;  1RUC 3;  1W6P B;  2RE9 A;  5DDJ 3;  1FMD 3;  1GOF A;  4RN5 A;  3KB5 A;  4LTA A;  4M0N A;  4XTM A;  2Y6K A;  4LBK A;  3GF6 A;  1N47 A;  3GZA A;  3MLL A;  3ROU A;  3FLR A;  2FCU A;  2WZE A;  1EUT A;  3MO4 A;  5FYU A;  5JSO A;  3T1M A;  1IHM A;  1IOA A;  2WNV B;  3NAP A;  2JE7 A;  4H2A A;  2G1M A;  3WVJ A;  3VB9 A;  3ZN6 A;  4QMA A;  4FXK B;  4JTN A;  2AZ5 A;  2H0B A;  2BNM A;  3ECQ A;  3RS6 A;  1G8W A;  2BVV A;  5FPU A;  2XG3 A;  2XJR A;  4YLZ A;  3ZSM A;  2PA7 A;  1I6X A;  2BFU L;  3AYD A;  1LHW A;  2XBO 3;  3OEA A;  4UI9 L;  1O5U A;  1ZA4 A;  2QZ2 A;  4ZON A;  2V4A A;  1W0P A;  3POS A;  4HK9 A;  4Q4Y 2;  4UOJ A;  4AFD A;  3TAY A;  1SPP A;  2R04 3;  4DXZ A;  2EF6 A;  3I59 A;  2Z42 A;  5HCB A;  1ZVF A;  1C5I A;  1LU1 A;  3JUU A;  1BEV 3;  3OTF A;  5HV4 A;  3H8X A;  1R09 3;  1KJR A;  2WII B;  2W95 A;  4NRM A;  4JGZ B;  3DUI A;  3RZL A;  3PMS A;  2VZQ A;  3ZSK A;  4AVA A;  1LTE A;  4B8E A;  3POW A;  3MI8 A;  4YNI A;  4FPC A;  5J98 B;  4AI1 A;  4YVS B;  4PT6 A;  5H9P A;  4XIL A;  1JZ2 A;  3VDD C;  5FJH A;  4D3W A;  2VCM A;  4YAR A;  3MBW A;  2FCV A;  4BLI A;  1YFY A;  1WCU A;  2QQV A;  4ZU5 A;  2ZGO A;  2ETE A;  2LUW A;  3TNP B;  4AVS A;  1HN0 A;  1S2B A;  2QJV A;  4Q4Y 3;  1RIT A;  1N1Y A;  1GIC A;  5ABJ B;  4CCJ A;  4MHU A;  2F17 A;  4BDV B;  4PQQ A;  1X7N A;  1S0E A;  1AR9 1;  1VBE 1;  3HR9 A;  1VBB 2;  3POE A;  1F2N A;  2W5F A;  5CIS A;  4HK8 A;  4W6Y A;  3UET A;  4AI9 A;  2YGL A;  1QJU 3;  4D7T A;  1JZ3 A;  1MZE A;  1MVQ A;  4DUW A;  3O0X A;  3M3O A;  1KDK A;  4UFJ A;  2P1B A;  4PIX A;  4AI2 A;  4EN7 B;  1A8D A;  4KNC A;  2AYH A;  4NMI A;  4FOV A;  3I54 A;  4DNY A;  2GAL A;  2WS9 3;  3HOB A;  4YGC A;  5A3W A;  3THT A;  2VZO A;  2RVA A;  1QOO A;  1H1I A;  1W8U A;  3WEZ A;  3P6B A;  3TB0 A;  3TN9 3;  4CU6 A;  4Z07 A;  3HVD A;  1LED A;  1JU3 A;  4UFM A;  3I7D A;  4ZXE A;  3WP3 A;  4QHZ A;  5FP4 A;  2R0F A;  5L9R A;  5IAX A;  1W2O A;  5T5O A;  4AL9 A;  2OQ7 A;  5HXM A;  4KG0 A;  2VW0 A;  2XLF A;  2D6O X;  4LBQ B;  3RYR A;  3WZ1 A;  4JAA A;  4XF3 A;  3ZMN A;  3OBZ A;  4OYU A;  1IPJ A;  3E6B A;  4PLM A;  2FD8 A;  5FZL A;  2IXJ A;  5EP9 A;  3AC0 A;  2NMN A;  5T5P A;  4AGG A;  1KIT A;  2DFC A;  3DYP A;  3JB8 A;  4RQP B;  2FDG A;  1OQ1 A;  4Y1X A;  1AL2 3;  3PIG A;  4QU2 A;  1W8Z A;  5A6Y A;  2JDN A;  4NWV A;  5FMO L;  4CDQ A;  4IUG A;  1HRI 2;  4OHX A;  1WGP A;  5IK8 A;  2P3J A;  2ZOE B;  2JKX A;  2WNE A;  2D6P A;  4F8A A;  1H8T A;  1S0F A;  5FZK A;  2ID4 A;  2XOM A;  3RDI A;  4TXW A;  1GZW A;  4DXT A;  4NPM A;  2JDH A;  1RXF A;  1AR6 2;  3CJX A;  3J8F 3;  4FXG B;  3IMM A;  4TN7 A;  1OH3 A;  1GQH A;  1JZ5 A;  3VZO A;  2JIC A;  3H7Y A;  3FFZ A;  1PMI A;  1VRH 2;  2GP3 A;  3ES1 A;  3WW2 A;  5FDB A;  3THP A;  1FT9 A;  1VB2 A;  2HWE 2;  3MIB A;  3SH4 A;  3ZN4 A;  1AXY A;  1QJE A;  3DPR A;  3RMX A;  2DVG A;  2VMF A;  3DV8 A;  4IEX A;  3VKO A;  3DEC A;  3ABZ A;  5FYZ A;  4KWU A;  1CR7 A;  4CU7 A;  4A44 A;  2ORZ A;  2HWC 1;  4CEW C;  2HWB 1;  2DUO A;  1QJX 2;  2WS9 2;  1W05 A;  2WKK A;  5CFC B;  5LEK A;  3E6C C;  4OHY A;  2PYT A;  2A7A A;  2N7G A;  5LAT A;  4CCE A;  2GNT A;  1YIF A;  5KC5 A;  2V09 A;  1YYN A;  1ZBA 3;  4DS0 A;  3III A;  2Y34 A;  4XZP A;  1NA1 B;  4S2F A;  1RUI 3;  4G3Y C;  3NO8 A;  4R8H A;  1GWM A;  1QH6 A;  5CBL A;  5IVB A;  1OFN A;  2Y26 A;  4RR3 C;  1QJY 2;  3OEB A;  2UY8 A;  3S5A A;  4Y4Y A;  1JYC A;  2A6W A;  2HWD 1;  4YW3 A;  4XJU A;  2ZZJ A;  2X53 S;  2R1B A;  3IDA A;  3ZYB A;  1POV 0;  3K4A A;  3LF7 A;  5IT6 A;  1LOC A;  1JW6 A;  2BRT A;  1SBE A;  2XVK A;  2CGN A;  4ZZ5 A;  2BZD A;  1DGW X;  1Q56 A;  5F3I A;  5CB7 A;  3Q8B A;  3IBM A;  3SCG A;  3U4X A;  5FUI A;  2FDI A;  2A75 A;  2VU9 A;  1PK6 B;  1RUF 1;  4KWJ A;  3U75 A;  1CJD A;  4RHV 1;  5F3E A;  4FPG A;  5GLU A;  3WQ7 A;  2GC1 A;  4QQL A;  1ND3 B;  1CIW A;  1GKB A;  3B93 A;  4EN0 A;  1SHW B;  2XHN A;  3ZXK A;  2NP0 A;  3DKQ A;  1AR6 3;  2R0H A;  1DP0 A;  1JYX A;  1BZW A;  2Q1F A;  4S2D A;  3VBR C;  1CZS A;  2QKD A;  4RFR B;  1J58 A;  5AVA A;  3W20 A;  2FBE A;  2OQ6 A;  4IV1 C;  2C5D A;  5IVF A;  3VBR A;  1CZT A;  1OA4 A;  1CQ9 A;  1Y43 B;  3AJZ A;  4LEJ A;  2Y33 A;  2W9X A;  2ARE A;  5C33 A;  4H55 A;  1NAE A;  2OZJ A;  2CL2 A;  1YLL A;  4AOC A;  3CEW A;  4AVC A;  3JB4 C;  1HB4 A;  4MUV A;  4QKF A;  1J3R A;  2VG9 A;  3JBG 2;  4I3G A;  1V6O A;  2EIC A;  5IWF A;  3BKZ A;  4LR4 A;  1CAX A;  4D69 A;  5C8C A;  5LY1 A;  1Y3T A;  3CZU A;  4JHZ A;  4RYD A;  3I2I A;  2QCS B;  2OYZ A;  3MFC A;  2LM3 A;  2VZS A;  3ZSE A;  4FSJ A;  5FZE A;  2BQP A;  2NN8 A;  4RHV 2;  4QX1 A;  1GOG A;  1MVE A;  1RUF 2;  4I30 A;  3RYP A;  1PVX A;  4IEP A;  1QHD A;  2VOW A;  5SV8 A;  5FZI A;  1EP0 A;  1QH7 A;  3P1I A;  3MFA A;  3VKF C;  5A1F A;  1VMJ A;  5CIR A;  4B4P A;  1OPO A;  1BEV 1;  1PM4 A;  2QQK A;  2VUL A;  3MHZ A;  4Q26 A;  4JGZ A;  3UKV A;  5I91 A;  2EIE A;  1GUI A;  1QGL A;  5F3C A;  1L7R A;  2BPA 2;  4R4X A;  5K9Y A;  3IN9 A;  3B9I A;  1HDK A;  2GND A;  1TMF 2;  5L19 A;  2P17 A;  4QXH A;  1R08 3;  3LPF A;  1YQC A;  4CP0 A;  3D8C A;  1POV 3;  1UKR A;  3I49 A;  4CUA A;  1FI2 A;  1UW8 A;  4SBV A;  1OOP C;  2C24 A;  2K46 A;  1VMH A;  3HQR A;  2XB6 C;  4LKE A;  5FY5 A;  3WLU A;  4D6S A;  5HPO A;  1F4A A;  5C5T A;  2VUC A;  3LWC A;  2A1X A;  3DPR C;  1C5H A;  2VZ3 A;  1HQN A;  3AMQ A;  1OXC A;  2WAA A;  4COW A;  1XYP A;  3IZO A;  2P5B A;  3ZKU A;  4FP2 A;  3U4S A;  1ZZ6 A;  4DXR A;  3BTX A;  4PDW A;  1X82 A;  4XAA A;  4EV0 A;  3M8L A;  3R0R A;  1ZYB A;  3ON7 A;  4YZ4 A;  2WRA A;  2ZGR A;  3KZ4 C;  1ENR A;  5FZA A;  1HQW A;  2IUW A;  3Q8F A;  1YJK A;  3JBG 3;  1COV 3;  5D2A A;  1NCQ C;  3ZFE B;  3CQO A;  3PLQ A;  2QVS B;  1OVP A;  3APB A;  4UBH A;  4JRL A;  1R64 A;  2RS5 3;  2P2K A;  4OMC A;  1LB2 A;  1SFP A;  4FFG A;  5E89 A;  5JOZ A;  2B46 X;  2PMW B;  3OGV A;  4MV2 A;  1J3Q A;  4KH9 A;  5B4N A;  3K77 A;  4L99 A;  5FQ0 B;  1W8H A;  1LOA A;  4NIH A;  2VMG A;  3AM2 A;  5JSR A;  1YIP A;  1AJK A;  4WVM B;  4Y5Z 0;  5A1A A;  1HLC A;  1NY7 2;  3HD8 B;  2CAV A;  5F6K A;  1RUE 2;  2NPI A;  2KD7 A;  2EAK A;  2DCY A;  2WL1 A;  1XXN A;  2DVF A;  4YG6 A;  4GH4 B;  2YHJ A;  4IET A;  4L97 A;  4L0P A;  5I8T A;  1O3T A;  5EXO A;  1BK0 A;  1NCR A;  3GBW A;  3NJV A;  4K40 A;  4AQ6 A;  4CDX B;  2BER A;  1AL2 2;  4QKN A;  3VD7 A;  4EN9 B;  3CO2 A;  5HI0 A;  5JZG A;  1JOB A;  2DBI A;  4LLF A;  3N9Q A;  4BXS V;  2DCT A;  3UJQ A;  3H3U A;  2RDS A;  3MEP A;  5FPL A;  3FWE A;  4AI3 A;  4I02 A;  1LHU A;  2XVL A;  4NRO A;  3K3O A;  2VW1 A;  4JKK A;  1QXP A;  3PUR A;  2VMC A;  3OG2 A;  4XFB A;  3OGG A;  5F37 A;  2BOJ A;  1OLM E;  2YZ4 A;  3T1L A;  4LIT A;  1SLI A;  5ANN A;  4JZR A;  1RVF 3;  2WWU A;  2YC2 A;  5JCT A;  1WW7 A;  1RUD 3;  2A6V A;  2QQL A;  1Q8P A;  1V6I A;  2Y6G A;  4LMF A;  1O5L A;  2WSV A;  3N36 A;  1C28 A;  2ZHN A;  2HBU A;  4IGQ A;  1IQA A;  2IXC A;  3N7L A;  1VBB 1;  5FYS A;  3KCY A;  2TUN A;  3A4U A;  3W5N A;  4RFT 0;  2YY1 A;  1O8P A;  4YW4 A;  1R1A 3;  2RS5 2;  3ENR A;  3ACI A;  5EJ1 B;  5FYM A;  2FZ1 A;  4HMZ A;  3AXE A;  2IXI A;  1HB3 A;  4M3C A;  1UZY A;  1RUI 1;  1NZI A;  4GJZ A;  2GP5 A;  4MYE A;  4QPG B;  2HWC 3;  4XAC A;  5FZO B;  3RI9 A;  4M4R A;  3WDV A;  4B3N A;  1KS4 A;  1QJU 1;  2JDU A;  1JZ8 A;  1PVC 1;  2OZ6 A;  4LPL A;  2A3X A;  2A6X A;  1U5X A;  4LBQ D;  3CJI A;  4ASM B;  2XHK A;  4IE0 A;  5IJR A;  1ALY A;  4OUL A;  4QGN A;  2QTW B;  1W6Q B;  2RDR A;  3POI A;  1JTZ X;  2JEC A;  2WNO A;  5L9V A;  5HCH A;  1EUU A;  4DB5 A;  2W68 A;  5C8C B;  3J7N A;  1QJZ A;  5KHI A;  5L73 A;  4EWD A;  1ND2 A;  5DG1 A;  2QQI A;  4QDS A;  1JUI A;  5FIX A;  3BTZ A;  4Q4Y 1;  2VTX J;  1IQD C;  4RSU A;  2Q8O A;  5CA6 A;  3LEM A;  3CZJ A;  2YBP A;  3MLK A;  4ZXK A;  1CES A;  5IUQ A;  5CFC C;  2WFF 2;  1W6O B;  5CAD A;  2W47 A;  4XDQ A;  3VKM A;  2GNM A;  3T2Q A;  1CAV A;  1MS4 A;  1DGR N;  2DV9 A;  2NLR A;  1MQT A;  2PLV 1;  4IE5 A;  4WV8 A;  4A6S A;  1LAJ A;  3WQ0 A;  2BDR A;  3MYX A;  2QQW A;  1UOJ A;  4MGK E;  2ZGM A;  3BGA A;  4ET7 A;  5FOJ B;  2DCK A;  4WVW A;  3G7D A;  3R4S A;  3VLB B;  2ZHM A;  5GZC A;  4A3X A;  2ENR A;  2K2S A;  2ZXQ A;  1H2L A;  3DF0 A;  4OUS A;  4U2A A;  1D4M 1;  2GME A;  1UL9 A;  3A21 A;  4LXL A;  4XW3 A;  2PAM A;  4ZS3 A;  2P37 A;  4XF0 A;  2UWC A;  5LBF A;  3I3D A;  5FZH A;  4LK6 A;  3MGU A;  1D4M 3;  3POB A;  2YU1 A;  4LO5 B;  3S7E A;  1FX5 A;  3KT7 A;  3WF3 A;  2C9A A;  4B1M A;  2WO3 A;  4QX8 A;  4X6R B;  2AR6 A;  1PNF A;  3X29 B;  5A3P A;  3AMH A;  3V0A A;  4RD7 A;  3D5O A;  3JCI A;  3WDT A;  2JD9 A;  1R08 1;  2Y64 A;  3EB7 A;  3ITQ A;  4Q2F A;  1ODN A;  3UKN A;  2C0Z A;  3TEW A;  2MEV 3;  2P6H A;  2A5Z A;  2JD4 A;  2DU1 A;  1GZW B;  4P00 B;  4HET A;  3N9N A;  1VIW B;  3NRU A;  3W5M A;  3O1V A;  3VBR B;  4YW2 A;  1AX2 A;  1W0O A;  1AXK A;  3FBY A;  3ILN A;  1W2U A;  4A4A A;  1W3X A;  1AHS A;  3KSC A;  5I0U A;  3HWJ A;  3VBH B;  4AQT A;  5FMD A;  4UW3 A;  1RHI 2;  5A70 A;  2BWA A;  1PM7 A;  4FO9 A;  2YGM A;  2PHT A;  2R07 2;  4DOU A;  1G9B A;  2D97 A;  2XVG A;  4Q4X 2;  4GMP 3;  3T2T A;  3M3C A;  3UES A;  3Q9O A;  1RUN A;  1PIV 3;  3BTA A;  3MIF A;  1QDC A;  3LDR A;  5FZM A;  4QM9 A;  1QU0 A;  2HEY F;  3H8O A;  2DYC A;  3I2F A;  5L9B A;  2ZX1 A;  4YVW A;  1UY4 A;  1LUL A;  2XWB B;  1S0C A;  1GBG A;  3ZO0 B;  4AG4 A;  1AR9 2;  1JI6 A;  1OUS A;  1VBE 2;  2WUH A;  2X8K A;  3NNF A;  1LOF C;  4QQ2 A;  2DTW A;  2WQ4 A;  3AP7 A;  1CAU B;  3A22 A;  4QAW A;  1NLS A;  3QH6 A;  1DYP A;  1Q3E A;  5F2W A;  3WNO A;  3B5L B;  4K8F A;  3OBT A;  2YPD A;  4FAH A;  4MGQ A;  1Z7S 1;  1EAH 2;  4Y1V A;  1V70 A;  4QPI B;  1XSQ A;  5CFD C;  5JVV A;  4PF5 A;  1HB2 A;  3RZH A;  5A7W A;  4YW5 A;  4NRQ A;  2O1Q A;  2ZAA A;  4YVS C;  4CEW B;  2BOI A;  1RYY A;  4AF9 A;  1C8M 1;  1V9U 1;  4IL7 A;  2WNU A;  3U07 A;  4K3U A;  2J22 A;  4Y26 A;  5CNA A;  3BI3 A;  5F5I A;  5FXZ A;  2ZGT A;  3VBO B;  1EY2 A;  3FUQ A;  5DUU A;  5F7U A;  4IEZ A;  5FOB B;  3BN6 A;  1NCR B;  3HNY M;  4O9E A;  2WO7 A;  2YFZ A;  3ZXF A;  1T6G C;  1NUK A;  1YI9 A;  1ZBE 2;  1CPN A;  3ZXL A;  4JDM A;  1RUO A;  2IXL A;  5A32 A;  2ATF A;  5FZ1 A;  4C8D A;  4XPV A;  5CG9 A;  2VQ0 A;  4B4R A;  4QQO A;  4QB1 A;  3N7J A;  5K0U A;  5FZ3 A;  2BYV E;  5FYY A;  3ZYP A;  1V6K A;  5JZG C;  2IXH A;  3VZL A;  4C91 A;  4CU8 A;  3OSD A;  3BUC A;  1HIX A;  1MS1 A;  3H9A A;  4LHN A;  1G7Y A;  3ZYI B;  5BNP A;  2D40 A;  5IW0 A;  2OKX A;  3H1M A;  3GZU C;  2EAA A;  5G05 L;  1MS8 A;  2Y8K A;  2CAU A;  3SHR A;  3GJB A;  1YUD A;  3KQ4 B;  5IFP A;  4BQ3 A;  1KQR A;  3FLT A;  3PUQ A;  3EJK A;  4NHX A;  5ABJ A;  5LW9 A;  3O5S A;  4N8M A;  4AWD A;  3SH5 A;  4NVP A;  1KRI A;  2UWA A;  2R6Q A;  5CFD A;  2W39 A;  1ZZ7 A;  2B4K A;  4W6X A;  3VBF A;  5DPN A;  1YQ5 A;  1UU4 A;  2VVE A;  4Q27 A;  2BGO A;  3H1W A;  3WNM A;  1RHI 1;  2R06 3;  3B02 A;  3LQC A;  5FZ4 A;  5FXW A;  5FZO A;  4XHB A;  3KMH A;  2QQO A;  4GA9 A;  4AED C;  2HYX A;  5FPB A;  4M3C B;  3T2P A;  3JD7 1;  1YEW A;  1DF0 A;  3NJZ A;  4LO8 A;  1HW5 A;  2H0V A;  1S1A A;  4XJ9 A;  1XND A;  4XDO A;  3ZYF A;  3RWK X;  2E32 A;  4LBM A;  4XF1 A;  4BQ1 A;  2D43 A;  1BVV A;  2XXZ A;  1Y7B A;  4NO4 A;  3SEP A;  3GNE A;  5AC9 2;  1OHF A;  1ZZC A;  2PHL A;  4WVV A;  2Q1M A;  2B39 A;  3EXU A;  3OUJ A;  1NQD A;  3GHN A;  4QPW A;  4AI0 A;  2CV6 A;  1G9D A;  3WG1 A;  1ULP A;  2HWD 3;  3RZG A;  4QPG C;  1ZBA 1;  1RIN A;  4YM0 A;  3SH3 A;  5FPX A;  3ETP A;  4Q0U A;  4AYU A;  4AFM A;  3C7E A;  3U11 A;  3M4F A;  3KCC A;  4LBO A;  1KXG A;  1SAC A;  5T3N A;  4I01 A;  1W6N A;  4I0W B;  5FRE A;  2EXJ A;  5DUX A;  5FAX A;  2FMY A;  5J7M A;  3ELN A;  1NT0 A;  1VPH A;  2DCZ A;  4AI8 A;  1VBD 1;  2Q0A A;  4GMP 1;  4TYS A;  1H9P A;  4FCA A;  3WDU A;  4AGR A;  3QBQ A;  4B4Q A;  5DXD A;  4FBF A;  2ZHL A;  1QXJ A;  4NPR A;  1YXW A;  4R52 A;  4I0B A;  2EIG A;  3AK0 A;  1LHN A;  3ZIW A;  4AED A;  5K7P A;  4KL1 A;  4LE3 A;  3T3Y A;  3C3V A;  1S0I A;  5D1I A;  4HOO A;  3HAG A;  2ZEZ A;  2OPK A;  2WDB A;  1IS6 A;  2G4I A;  2WZR 1;  4IGP A;  3WNK A;  4UBG A;  1MAC A;  4AAX A;  3R05 A;  1DFQ A;  5AVP A;  3OGS A;  5G04 L;  3GZE A;  3NL1 A;  3ETQ A;  4D94 A;  4EZ4 A;  1PNG A;  4OFG A;  3AZZ A;  4XBL A;  1RVF 1;  1UD1 A;  4LOT A;  3S30 A;  2GAU A;  5ERL A;  5B2G B;  1UX7 A;  5F1R A;  2DWR A;  4HN1 A;  1X33 A;  5A7Q A;  3ZX7 A;  2A6Y A;  2ZGS A;  1VBA 2;  2VBB A;  1CAU A;  3MLJ A;  2VOV A;  1XNK A;  3I4I A;  3NWK A;  5GAL A;  5CKM A;  3VZN A;  1MS9 A;  3VBU C;  5BV6 A;  1WCQ A;  1CAX B;  1IS4 A;  2VQA A;  2GSY A;  4CYD A;  1ULD A;  3SLI A;  1BEV 2;  4LT5 A;  5C9A B;  4FQZ A;  2XQR A;  1RUH 1;  3ZYJ B;  5GZG A;  1IS5 A;  3I59 B;  3C7H A;  1OKO A;  1C57 A;  1OF3 A;  2VCC A;  4H3W A;  1ZZB A;  4E2G A;  5DUV A;  4YM1 A;  3IB3 A;  4GH4 A;  3WG2 A;  1TEI A;  2BGC A;  2B42 B;  4ASK A;  1M06 G;  2OW4 A;  4NR1 A;  1UU6 A;  5F2S A;  1S2K A;  1O91 A;  4L11 A;  1ZRD A;  1PIV 2;  2X5I A;  4I09 A;  1UY3 A;  3CU7 A;  1JHJ A;  4N53 B;  2VME A;  3MUZ 1;  4MAD A;  2E31 A;  5FK7 A;  5FR3 A;  3BTY A;  5F3G A;  4MG2 A;  2XBO 2;  3EYP A;  1FOD 3;  3C7O A;  2UUR A;  3FHI B;  3IPV A;  3U10 A;  1LOF A;  2VZ1 A;  4WZF A;  1MZ5 A;  2XLA A;  5FWE A;  4QXC A;  1WZX A;  5FYC A;  1JS9 A;  1FOD 1;  2P34 A;  1L7Q A;  1VRH 3;  3SKJ E;  3BU0 A;  3OB8 A;  1R09 2;  2HEV F;  1XE8 A;  3B01 A;  2ET1 A;  3AKT A;  3PVE A;  4KG8 A;  3PNA A;  2OII A;  3POF A;  1ASJ 2;  2DFB A;  4WBB A;  3MUY 1;  2X09 A;  3NKT A;  4LKD A;  4CCO A;  5CEH A;  4K9S A;  1JU4 A;  3T0A A;  2L9L A;  4NID A;  1XU2 A;  3MW3 A;  1HJF A;  3D6E A;  5EQU A;  4CDW A;  1V6J A;  1X8E A;  4D6Q A;  1PO2 1;  2Z5W A;  1JYT A;  2MNG A;  2DU0 A;  1VBA 3;  3D4K A;  3RPQ A;  4ES9 A;  3GJA A;  2AH2 A;  1H4H A;  1V6M A;  1WA6 X;  1BK1 A;  2JG8 C;  4JRA A;  1RC6 A;  5FBJ A;  3BVC A;  5A7O A;  5J3U A;  5K8S A;  1J83 A;  3AZW A;  4COV A;  1Z7S 2;  4XCB A;  4FFI A;  4QPI C;  3I3M A;  1XQN A;  3WG3 A;  3HEI A;  1JH5 A;  3AP4 A;  4QD2 A;  2ZJC A;  1VBB 3;  2UYB A;  1SFN A;  1QJY 3;  4K20 A;  4CE8 A;  3NNL A;  1K5M B;  3IWZ A;  5AFE A;  3M1H A;  1LOB A;  3OY8 B;  1UY2 A;  1JOP A;  1QNY A;  1LHO A;  1CGP A;  4YG3 A;  1DYO A;  1NA1 C;  2D6M A;  2G9G A;  1DQ5 A;  2C6S A;  3GHM A;  3WF2 A;  2FDK A;  4WZC A;  2ZGQ A;  1C4R A;  1K5M C;  4KGQ A;  5ACA 1;  3VBF B;  3BYW A;  1PGL 2;  4YM3 A;  4AEM A;  1LGN A;  2SLI A;  4OI4 A;  2UU8 A;  1OOP B;  4P9Y A;  2WLP A;  2PAK A;  4H14 A;  5FXV A;  1OT5 A;  1NCQ A;  1K42 A;  2WT2 A;  2R07 1;  4GJY A;  4QX3 A;  3OPZ A;  4XJA A;  1H2M A;  1PGW 2;  1CPM A;  1WCK A;  4XUR A;  4BQ5 A;  4CTE A;  3E1F 1;  4CXY A;  4BXF A;  4PI0 A;  5C3R A;  4GIQ A;  2YXS A;  4OMD A;  1IG0 A;  4AVB A;  4Q4W 2;  3KHB A;  1DZT A;  4IES A;  1T6B X;  1JYI A;  1UYZ A;  4S2G A;  5EV7 A;  3PJY A;  2D3R A;  4J25 A;  1BMV 1;  4YW7 A;  3RZM A;  1WKY A;  3E97 A;  1U5Z A;  4AFB A;  1ND2 B;  3KF3 A;  1L7L A;  5LCW L;  4HLT A;  5ISL A;  1ZBA 2;  1W9T A;  2GN7 A;  2HJI A;  2D5H A;  2HLE A;  3KS7 A;  2VR4 A;  5KHH A;  1GNZ A;  3CDZ B;  5AC9 3;  2JEM A;  3PDQ A;  3I3B A;  2BEO A;  5JI7 A;  1OMI A;  4LE4 A;  5JXJ A;  4CZS A;  1KGY A;  4CEY A;  1RUF 3;  3W59 A;  2VL4 A;  4N43 B;  2PAE A;  4Y22 A;  4QGM A;  5GLV A;  3AFK A;  3LE0 A;  4UFK A;  3IDE A;  5C4W C;  1YRZ A;  2WO2 A;  2CHH A;  4UFH A;  5A6Q A;  4AHX A;  1CVN A;  1PX4 A;  3RWN A;  1WWY A;  1HN1 A;  1QXR A;  4RL7 A;  1U5I A;  4Y20 A;  2BW8 A;  4XUO A;  1SCS A;  3GDB A;  3WP5 A;  3ZXD A;  4AED B;  1GP5 A;  1ENQ A;  3RJ2 X;  4XAE A;  4XHX A;  1TZO A;  2PLV 2;  4PF1 A;  2DF7 A;  5C9A C;  2RG4 A;  1HRV 1;  3H50 A;  1TME 2;  2QZ3 A;  5FMB A;  3I2D A;  3DEM A;  1C8N A;  1STM A;  2J1E A;  1MS5 A;  2R7E B;  1D2S A;  1UYX A;  4XAB A;  4IEV A;  4OCT A;  3H42 B;  1TE1 B;  4E27 A;  4G9S B;  1OUR A;  4GD4 A;  2ZMK A;  4MHR A;  4PBO A;  3CKH A;  4BYY A;  2F4P A;  1XYN A;  4QX0 A;  5DAX A;  4YVW B;  3WD5 A;  2OPW A;  2RJL A;  2W1S A;  3B00 A;  3HJR A;  4ASL A;  1XNT A;  4CDW B;  5T55 A;  1RUC 2;  4BK5 A;  1GMM A;  3J4U H;  1W2N A;  1IGO A;  3OGR A;  3PME A;  4AAP A;  5FZD A;  5C3S A;  2KM2 A;  3FN9 A;  3M3I A;  1VP6 A;  2WZR 3;  1ULC A;  3NV1 A;  1PVC 2;  2JEN A;  3FC0 A;  3EHK A;  5EJZ B;  1BJQ A;  4PHZ A;  4QU1 A;  3WW4 A;  1WLW A;  1TME 3;  4GXL A;  3J8F 1;  5GZD A;  1TG7 A;  3OUH A;  2C26 A;  2A3W A;  5J37 A;  2WT1 A;  2FDH A;  3IDC B;  3O7O A;  5JLV A;  4FFF A;  3Q8A A;  1LEM A;  1XJA A;  4K8R B;  5FV3 A;  5FUN A;  4RGA A;  4Z82 A;  1NCR C;  1DBN A;  1O4T A;  1SFY A;  1YI7 A;  2RS1 1;  1A6C A;  3NAP C;  5CAZ A;  5CG8 A;  1ZRC A;  2HWB 2;  1NKG A;  4HON A;  4XFI A;  4XQ4 A;  4FTS A;  3PVO A;  4DPN A;  2XML A;  1AXZ A;  3UNP A;  4LKF A;  3OD0 A;  3ZXA C;  2TEP A;  3D3A A;  4IV3 B;  1U5Y A;  3VL8 A;  5T50 A;  2V72 A;  3N3H A;  1PVC 3;  1RUJ 2;  4ONU A;  1NCQ B;  2O0O A;  2BP6 A;  4QXB A;  1BXH A;  5FKB A;  4W50 A;  5LBE A;  4MO3 M;  3ZFE C;  5BNN A;  3R4U A;  3F95 A;  5T54 A;  2CGO A;  5A80 A;  4ARX A;  4XEZ A;  2VE1 A;  2Q30 A;  2E53 A;  1COV 1;  5FY7 A;  5H9R A;  1JMU B;  3VBH A;  2WNV C;  2XQX A;  4Q0Q A;  4KWK A;  4FOW A;  1NG0 A;  2W94 A;  4RHV 3;  3TN9 2;  3VN4 A;  4BH9 A;  1OD5 A;  3ACH A;  3VBS A;  3KHC A;  3NKG A;  3DPR B;  3FX3 A;  5FYV A;  1IPS A;  1D0H A;  3WDW A;  4CPB A;  3OOX A;  4DEQ A;  5C3P A;  4QM8 A;  3KVA A;  3RGB A;  3VD4 A;  3ACF A;  2RV9 A;  4ORF A;  1N1T A;  1NE4 A;  2NM1 A;  1Q43 A;  1V0A A;  1H6Y A;  4NHK A;  4QDQ A;  3ZM8 A;  2HBT A;  2R32 A;  3TN9 1;  1O4Y A;  1WUV A;  2JXA A;  1L3J A;  3E5X A;  3VDB A;  1DCS A;  1W03 A;  3PHM A;  4LHK A;  1F8V A;  4Y20 B;  5A7S A;  1ZZ8 A;  1RMU 1;  1LEN A;  2J1A A;  2RJ2 A;  5LBB A;  4E4Z A;  2JG9 B;  4NIA A;  4KQ7 A;  1A34 A;  1PHM A;  1LOG A;  5FZG A;  1H1M A;  1YFW A;  3T09 A;  1AR8 2;  2G19 A;  1BBT 1;  3AMM A;  1FNY A;  3Q8C A;  4HSJ A;  2VUA A;  1AR7 1;  4QDR A;  4CCC A;  4N53 C;  1CX1 A;  4QHB A;  3U1X A;  1US3 A;  5T5L A;  2WT0 A;  3G6J B;  3I8T A;  1UZ0 A;  3WX5 A;  1YFU A;  4DEV A;  3VUO A;  5EJ3 A;  1UNB A;  2FDF A;  1PK6 A;  1YHF A;  2GDF A;  4C0H A;  1CIY A;  2WYS A;  5KR7 A;  1GZ9 A;  4GMP 0;  1K45 A;  2IFR A;  2PHR A;  5FY9 A;  4XUQ A;  3AP6 A;  3VV1 A;  4UFI A;  4IDZ A;  5J36 A;  3CLP A;  2EAL A;  3E6D A;  4XC9 A;  5JIA A;  1CN1 A;  4AEK A;  1U12 A;  4W8J A;  1H4G A;  2J1T A;  3AJY A;  2ET7 A;  1SQ4 A;  4XFH A;  4C1X A;  3MIC A;  2P3Y A;  3PU8 A;  5HCA A;  4ISR A;  4IQP A;  2X5I C;  3BPS A;  3AL6 A;  4IE6 A;  1ZRR A;  4CA9 A;  1TMF 1;  3QOP A;  5A3N A;  4YM2 A;  5LK7 B;  3AXD A;  4UW6 A;  3AYE A;  3MPB A;  5D21 A;  4FPJ A;  1HX6 A;  2E9Q A;  3KV9 A;  4HPK A;  1D4V B;  3DKW A;  5JOX A;  3ZYR A;  4L92 A;  3GAL A;  4W6W A;  2VNO A;  1ZNP A;  3FJS A;  4Q4W 3;  5GJ6 A;  2AUY A;  1GP6 A;  3UV9 A;  2WA3 A;  4O9G A;  1H8V A;  1H1A A;  1PO2 2;  3WF4 A;  4AHY A;  5ACA 3;  2W52 A;  2WC2 A;  4A7Y A;  3T30 A;  5GM0 A;  3N9O A;  3S5Q A;  1QMJ A;  1IKP A;  1OD3 A;  3N9M A;  2ZAH A;  4LUK A;  2E51 A;  3ME2 A;  1ASJ 1;  1PGS A;  5EYY A;  2J1V A;  5HV0 A;  3T4H B;  1X9P A;  3NW4 A;  3O1M A;  1GU3 A;  5D8A B;  4W65 A;  3WCS A;  3WUC A;  4EQV A;  4ES8 A;  1EAH 1;  4CDU B;  1RUI 2;  3WNL A;  3LDK A;  4JVA A;  4D6R A;  1A78 A;  1YJL A;  3UGF A;  3EMR A;  3UYJ A;  2RS5 1;  2LRO A;  3ZSL A;  3VHO A;  1UX6 A;  2AAC A;  1W0N A;  4F7Z A;  1GQP A;  3LA2 A;  4Z92 B;  1X8M A;  1EV1 3;  1K12 A;  1S0B A;  4A2U A;  4AR2 A;  2QDR A;  2WNU B;  3QLQ A;  1CAW A;  3THC A;  1KFU L;  4P9W A;  4XMA A;  5C9A A;  1UPS A;  4FPY A;  2BWC A;  3U0Z A;  3JQW A;  2D98 A;  4UF0 B;  2VVD A;  3VDC A;  3QD6 A;  1I5P A;  1QNW A;  1PX3 A;  2WZ8 A;  3ALQ A;  3M3Q A;  4YZ3 A;  5FYI A;  1N3Q A;  1O3R A;  1PK6 C;  1SG3 A;  3C8X A;  1ZRI A;  2TBV A;  2Y0O A;  4JGY C;  4UFL A;  4YZ5 A;  2ZML A;  1CZV A;  3GYD A;  3O14 A;  4IER A;  4L8Q A;  5IK4 A;  4Y1Z A;  4YVS A;  3FHA A;  4QX7 A;  4FFH A;  5DUW A;  2BU9 A;  3WCR A;  3ZN6 B;  4A42 A;  4ZU7 A;  2E33 A;  4OI1 A;  3RNS A;  5FK8 A;  4B7K A;  4FI9 A;  5IFT A;  1RUG 1;  2I2S A;  4NPL A;  5T5J A;  4ZS2 A;  2VTX A;  1EV1 2;  4LBL A;  3THD A;  4MGI E;  3IM0 A;  4XVH A;  5IVE A;  1UIJ A;  2ZKN A;  4P5H A;  3SIS A;  3WF1 A;  3WT3 A;  3CJI B;  2W0X A;  3KWV A;  5CZK A;  3N4M A;  1TMF 3;  2WZR 2;  2KA3 A;  2UYA A;  2ORX A;  3DCQ A;  1R08 2;  3ES4 A;  4RQP A;  2BUK A;  5C3Q A;  3B9C A;  2TNF A;  2Q8E A;  2YYO A;  1WD3 A;  4YPJ A;  1E5R A;  1HKD A;  2AC1 A;  1OUX A;  4WM7 C;  4XDP A;  1TNR A;  2KR2 A;  2NZ9 A;  2ZGL A;  4WM7 B;  4FTE A;  1WLT A;  2CWM A;  2I74 A;  3AKR A;  1IG3 A;  3BB6 A;  3FFQ A;  3LFM A;  2XWJ B;  3ZYH A;  3N7K A;  2OS2 A;  4BIO A;  2DDU A;  5FLJ A;  5JIU A;  3VBS C;  1C1F A;  1VBD 2;  2R1D A;  4O7X A;  4AE2 A;  1RHI 3;  2R06 1;  4O65 A;  2GN3 A;  3IAQ A;  5BNO C;  5I0S A;  2CDO A;  3W58 A;  1RUJ 3;  3PVB B;  1MZ6 A;  1W2T A;  2E7T A;  1E57 A;  1NZC A;  5F32 A;  5FKC A;  2P3I A;  3V64 A;  1AVB A;  5BNQ A;  3BAL A;  4K6B A;  4HT1 T;  4ZY9 A;  4TLF A;  2C9K A;  4PDW C;  2RS1 3;  3MPP G;  1F9K A;  1QOS A;  3M70 A;  1EYB A;  2NYY A;  3T2O A;  4QB6 A;  4UYB A;  2JB4 A;  4CUG A;  2RJK A;  2WFF 1;  4QT6 A;  1UZW A;  4KMQ A;  4CP9 A;  5ABJ C;  5KHK A;  1UOB A;  4YW1 A;  4BWO A;  1QKQ A;  3LGR A;  4HFS A;  3ZFF A;  1AR9 3;  1VBE 3;  2P3K A;  4W4Z A;  1MS3 A;  2LW8 A;  1OOP A;  1ST8 A;  3CBN A;  1RED A;  1W9W A;  2ZX3 A;  3OPW A;  1UU5 A;  1VBD 3;  1TQ5 A;  2BNO A;  2DVD A;  2Y6J A;  4SLI A;  4XIO A;  1GAN A;  5LBC A;  1FPN 2;  2SBA A;  5IAV A;  2X05 A;  1XRU A;  5FXX A;  3ZVX A;  2HKX A;  3INA A;  3JZV A;  4GKX A;  1NOV A;  2ADD A;  4J6G A;  4CCM A;  3U37 A;  1H8T B;  4Y1Y A;  1UZV A;  1NXM A;  4JDN A;  1FV2 A;  2YC4 A;  3A0K A;  4RS5 C;  2QNK A;  3PVN A;  2IC1 A;  3VZM A;  5LWB A;  4OVE A;  3ZYG A;  5KHG A;  1MEC 3;  3B94 A;  4R9A A;  1NX9 A;  4XF4 A;  3ACG A;  4JKM A;  1EPZ A;  4XFA A;  2D44 A;  1PO1 2;  1S2E A;  1QDO A;  5DZF A;  2VZU A;  1PO1 1;  4UF0 A;  4FTB A;  5FO7 B;  2W1W A;  4E8D A;  4KBB A;  2ZX2 A;  3AL5 A;  4PBP A;  3OUI A;  2YMZ A;  1W9F A;  2EXI A;  2ZEW A;  2GU9 A;  2CY6 A;  3U14 A;  2XJU A;  4PDW B;  3V65 A;  4B7E A;  2OA2 A;  4Z2W A;  1XOY A;  1FAT A;  2ZGP A;  4ITC A;  3ZLI A;  3SCH A;  3B69 A;  4CPB D;  2XUE A;  2JDY A;  3ZFG B;  1UKG A;  1WME A;  4X8P A;  2VO5 A;  1Q5O A;  1UF2 C;  4UT5 A;  3WR0 A;  1S0G A;  4CDX C;  5E6H A;  5IHR A;  1DZR A;  3K48 A;  4N90 A;  5HBA A;  3C7G A;  4GH4 C;  4OHW A;  4RS5 B;  5FY0 A;  5FP7 A;  2BNN A;  4XTP A;  4BQW A;  2GNB A;  4TZD A;  4E9K A;  3OPT A;  1OSG A;  1GP4 A;  2NMO A;  1HV0 A;  4RR3 A;  2XUM A;  3A7Q A;  4A6O A;  4LNV A;  3PUA A;  5E16 A;  5C6C A;  4R9B A;  3MDP A;  3N35 A;  3ATG A;  4P5Y A;  3TNQ A;  1R1Z A;  3J26 N;  5SV5 A;  3USS A;  1FPN 3;  5L36 A;  1W8F A;  3AMP A;  2ZGN A;  3RI8 A;  4OUM A;  3WNP A;  4FVV A;  3WW3 A;  3I2H A;  4IEY A;  5LAS A;  3R6S A;  3S57 A;  1I5Z A;  4JQR A;  3VZK A;  4G4F A;  4BQX A;  1DHK B;  4Q4W 1;  3RJR A;  2I45 A;  1HRV 2;  3PIJ A;  3HNB M;  3EQE A;  5IAT A;  4CDU C;  3HN3 A;  5JR2 A;  1QQP 1;  4A7K A;  4YZ1 A;  4AQ2 A;  5LA1 A;  5KXB A;  2BJS A;  2XKO A;  3KT1 A;  4GB3 3;  4QKD A;  2FMD A;  1R1A 1;  4CUB A;  1JZ7 A;  3NV3 A;  1JYV A;  4COY A;  1JHN A;  2VNV A;  1QJF A;  2Z4F A;  2W08 A;  2VC9 A;  3SC7 X;  1F31 A;  2VVF A;  1JOD A;  1DYK A;  1YWK A;  4C1W A;  2XH6 A;  3E5Q A;  1OF4 A;  4E8C A;  1DGW A;  1VRB A;  1VLN A;  4N7U A;  3AZX A;  1YCI A;  4FPL A;  1IS3 A;  4IV3 C;  2VUD A;  5DDJ 2;  2WFP A;  1CWP A;  4K21 A;  4OHV A;  3LA3 A;  3UJO A;  4Q4V 3;  3OF1 A;  5BXX A;  1HRV 3;  4H7M A;  1RUG 3;  2GMM A;  5M0T A;  2JWP A;  1W8T A;  4UW5 A;  5J48 A;  1CAV B;  1JBC A;  1EV1 1;  1NA1 A;  1W2A X;  2DUR A;  2P4E A;  4WM8 A;  3KQR A;  4XBQ A;  4E4D X;  2WFF 3;  2E63 A;  1RMU 2;  1CON A;  1UY0 A;  4BQ2 A;  4XZU G;  4CDU A;  2RHP A;  3WP4 A;  2B7Y A;  4JGY A;  4UAP A;  5D8A C;  2ADE A;  2NQY A;  3R4D B;  5BYN A;  2LTN A;  4GQ7 A;  2OUJ A;  4RR3 B;  3W21 A;  3ZPY A;  1VJ2 A;  1LOD A;  4XQW A;  4Q0V A;  4BA6 A;  3VD5 A;  5FQ0 A;  2D5F A;  3WP6 A;  5A3T A;  4URA A;  1CX4 A;  2XGX A;  2D93 A;  1REE A;  2CWS A;  1N3O A;  1NQJ A;  4LOR A;  4P9L A;  1VBC 3;  4JX0 A;  4KU7 A;  4R4Z A;  4XF9 A;  1WMF A;  4OZO A;  1WBF A;  4AXO A;  4MGT A;  3I3E A;  4KU8 A;  1D7P M;  5APA A;  1SCR A;  3CF6 E;  3CHX A;  1B35 A;  4JGZ C;  3ZR5 A;  3DXU A;  2GC2 A;  3NVC A;  3S6P A;  4CRQ A;  5JXH A;  4DUV A;  1DQ1 A;  3ZFF B;  1ZX5 A;  4XCA A;  4LO4 B;  2OXB A;  4Q4X 3;  4C90 A;  4Q1P A;  3ZPO A;  5LEJ A;  2XBO 1;  2QE3 A;  4IV1 B;  3GGL A;  1GWL A;  3ZMO A;  3TWI A;  4EYU A;  3AX4 A;  2F4L A;  4YSF A;  1Q8Q A;  4GKY A;  3VBH C;  5EYX A;  2CDP A;  1TVG A;  1Q8V A;  2MEV 2;  2ZEX A;  2PHF A;  4A3Z A;  4M0H A;  2ARX A;  3LKJ A;  3ZXG A;  5FTT C;  1I9R A;  1FAY A;  1Z7S 3;  4CCK A;  1OI6 A;  2VOX A;  1N3P A;  4M4P A;  1E5H A;  5FYH A;  4FPF A;  3HNM A;  3VDD A;  2QFE A;  2B5H A;  3MF9 A;  3UK9 A;  3A23 A;  3TOJ A;  1JZ4 A;  5LA9 A;  1YC6 1;  3CJI C;  1RL3 A;  2VJX A;  4JDO A;  2VNG A;  4M3C F;  4Q8L A;  3FL7 A;  1ZZ9 A;  1VAL A;  1DG6 A;  3BOW A;  4PJY A;  5IK7 A;  1FNZ A;  2AGS A;  5FWJ A;  4HKL A;  1O3Q A;  5JZG B;  2HEW F;  5FY8 A;  1TNF A;  2E26 A;  2VQU A;  4GWJ A;  1FOD 2;  1NE6 A;  2WQZ C;  2WWJ A;  1WCS A;  4JCK A;  3VKL A;  5BNN B;  4TTG A;  3O1U A;  3VD9 A;  4P9I A;  3ZOI A;  3KF5 A;  3IT8 A;  1UY1 A;  2IVI B;  3N9P A;  4BB3 A;  4BOW A;  3AMN A;  1F4H A;  1RUC 1;  1W3V A;  1XE0 A;  1O6U A;  1Y9G A;  3AZY A;  1QJU 2;  4Y24 A;  4EJR A;  3IDB B;  2JB8 A;  4URT A;  3OD4 A;  3AP9 A;  3K4D A;  1N1S A;  1WLC A;  2VAU A;  4JV4 A;  1EAH 3;  4MXW A;  5F39 A;  3RG0 A;  3CIH A;  4NAM A;  3LD8 A;  4Q8K A;  4CXW A;  5C4W A;  2RM2 1;  3UGG A;  3NMB A;  5C4W B;  1UPI A;  2WAB A;  4JTO A;  4IGO A;  5CFD B;  4FAG A;  5J09 A;  1BBT 2;  2ARA A;  1RJ8 A;  4Q1R A;  1AR8 1;  2LS6 A;  1WCD J;  2CU5 A;  3BIW E;  5FZC A;  4LIV A;  3ILF A;  1JN2 P;  3RRD A;  1W99 A;  3VZJ A;  3PUI A;  5JMO A;  2JIJ A;  5FMC A;  3WG4 A;  2PQQ A;  3O1R A;  3FLP A;  1F35 A;  2XON A;  4MOA A;  1ZRF A;  4GAZ A;  4EN6 B;  2ZGK A;  1DQ2 A;  1ZBE 3;  2PTM A;  4Y4R A;  3WXP A;  1YQ6 A;  4BCU A;  3ZSJ A;  5EHD A;  3JQX A;  3GCX A;  3WF0 A;  2CSG A;  1BVP 1;  4MVT A;  4J1W A;  5F5C A;  5BPX A;  2JG9 A;  2Q8C A;  3QH7 A;  5C71 A;  4PLN A;  1ASJ 3;  4HL0 A;  3LEG A;  4UW4 A;  4DY3 A;  3ILR A;  3POJ A;  4XFF A;  5JSP A;  2V73 A;  2WIN B;  1POV 1;  5IYY A;  4HVR A;  4CSW A;  1NY7 1;  2WSU A;  3HBZ A;  5F5Q A;  1AL2 1;  4QX2 A;  3FE5 A;  3HN1 A;  3NV2 A;  1H30 A;  3MV1 1;  3ORJ A;  5FZ6 A;  5DAW A;  2PHX A;  3B3Q E;  1RUH 3;  1QF3 A;  4DRV A;  4NJ4 A;  1G9A A;  4U36 A;  5JPN B;  3C7F A;  1KJL A;  1XC6 A;  2EA7 A;  2AEY A;  2D3P A;  3LCP A;  2JDK A;  2X5I B;  3MIE A;  3SMH A;  2Z79 A;  2PXJ A;  2ZEY A;  1UN1 A;  1US2 A;  2VMH A;  3AYA A;  3JD7 3;  4UXA A;  1WW4 A;  3J7M A;  2W1U A;  3O1P A;  5F6L B;  4XJ8 A;  4LIU A;  3ZFE A;  2R06 2;  1FMD 2;  3ST7 A;  3PUH A;  1RUJ 1;  1W28 A;  4NHY A;  2XDV A;  5A33 A;  3ZFG C;  2XPJ A;  4LA3 A;  1DLL A;  2JDP A;  4ERO A;  3I3Q A;  1OFS A;  1WLD A;  2OT7 A;  4Q29 A;  2A71 A;  4GB3 2;  5I0R A;  1POQ A;  3LAG A;  4NIG A;  4YGB A;  2RDN A;  4MGS A;  1YNA A;  5IVV A;  5LRS A;  1DLC A;  1RGS A;  3H8U A;  1GLH A;  5FMO S;  1ND2 C;  1GFF 2;  2EXK A;  4FQ4 A;  1GWK A;  1DQ6 A;  1GQG A;  1HJG A;  1VAM A;  1W6P A;  4Q4V 1;  1W8N A;  1ND3 C;  3MV0 1;  5LA0 A;  2OUH A;  3LOB A;  3LSE A;  5JUV A;  3NJX A;  1H2N A;  1UYY A;  4YYO A;  3GXU A;  2VZT A;  4OLL A;  1RUG 2;  2G9Z A;  2YUE A;  3OYW A;  5EIY B;  4IV1 A;  3AVR A;  2Z2S B;  3KD4 A;  4DFS A;  1BQP A;  2Y6L A;  2JKB A;  3POG A;  4IEQ A;  1ZBE 1;  3AKP A;  4N43 C;  3K2O A;  4NHL A;  3MIH A;  4AGV A;  2ARC A;  1RIR A;  1AYN 1;  1SDD B;  2XKP A;  1GOH A;  4QWN A;  1JOJ A;  5C8C C;  4YRD A;  2GH2 A;  2ARB A;  1LEC A;  3RMY A;  5JMC A;  1MEC 1;  5C7G A;  5ANQ A;  2V5Y A;  3RZK A;  3GM8 A;  4P9G A;  2WZP P;  1NYW A;  5LA2 A;  4MX3 A;  1SBD A;  1DQ0 A;  1PZ8 A;  2VY0 A;  3AKS A;  5CVR A;  3ZXJ A;  1Q8S A;  2WAO A;  2XLG A;  4AFA A;  4NAO A;  4XUT A;  4CCL A;  1VBC 2;  3RFR A;  2BBA A;  4MZU A;  4XET A;  4A7Z A;  2DVA A;  2JJ6 A;  4HBN A;  4IE7 A;  3PJQ A;  3PL0 A;  5LRR A;  4OQ8 A;  4L2N A;  1K3I A;  5KWR A;  4JHT A;  3I2O A;  5CYY A;  3LOI A;  4ATE A;  4HPK B;  4AHZ A;  4KBZ A;  3VGI A;  1S4C A;  3VBU B;  1VAV A;  2BFU S;  4K7J A;  2BTV C;  4YWA A;  4AHW A;  1OA2 A;  3IKW A;  5A7W B;  2VCB A;  1VBC 1;  1FPN 1;  2EIB A;  4NRP A;  4QXK A;  4AEJ A;  2B45 X;  2W87 A;  1OLM A;  1ONA A;  4CEY B;  4S2H A;  4BMB A;  2IZW A;  4NN0 A;  2V5D A;  2YU2 A;  1OQE A;  1WMD A;  2BVB A;  4GWN A;  1ND3 A;  4XQD A;  2VBD A;  3FMG A;  5DQ0 A;  2Y6F A;  3D82 A;  4QGL A;  1AYN 2;  3PU3 A;  1SLB A;  3K46 A;  3WOG A;  4CEY C;  4EWA A;  1HXS 3;  3SCF A;  3T4V A;  5GZF A;  1G6N A;  1AZD A;  4DQA A;  5KBF A;  4XYX A;  3RZZ A;  2D7F A;  3VHR A;  1BMV 2;  5A33 B;  5GLZ A;  4DUX A;  5JAX A;  5LB6 A;  3HQX A;  2O14 A;  4MGZ E;  4ARY A;  3RQ0 A;  4LHS A;  4CEW A;  5BNO B;  5GLT A;  2GH8 A;  2QDN A;  3NJY A;  2Y60 A;  3VBS B;  1SMV A;  1W04 A;  1QQP 3;  1AYM 3;  2YG0 A;  2W1Q A;  1IKQ A;  2WN3 A;  1LHV A;  1CAW B;  1UAI A;  1XBF A;  5FY4 A;  5B4X A;  5KXD A;  3T0D A;  5DAQ A;  1PGW 1;  1DQ4 A;  1U0A A;  4IEU A;  5DDJ 1;  1AYM 1;  1Z0H A;  4IE4 A;  5KC6 A;  4QQH A;  1AYN 3;  3KGL A;  4QX5 A;  3VD3 A;  4YZ2 A;  3OBR A;  2Q1Z B;  1S55 A;  5FO9 B;  1PO2 3;  3RVH A;  5ACA 2;  1PGL 1;  1H8T C;  1VRH 1;  2A73 B;  1ZM1 A;  2EXH A;  1UIK A;  1JZ6 A;  1H9W A;  4IV3 A;  5FLH A;  5KXC A;  1BBT 3;  2XJS A;  5BNP B;  1HRI 3;  1H0B A;  2PEL A;  2ZAC A;  2PN5 A;  4LUL A;  3PTY A;  3USU A;  2E7A A;  3BPZ A;  1QQP 2;  4E2Q A;  5A1L A;  4CP1 A;  3NV4 A;  2YV8 A;  2FQP A;  2IWG B;  3WQ1 A;  5E88 A;  1HRI 1;  3UL2 A;  2HWF 2;  4OQ9 A;  3JXS A;  4LBN A;  2W3J A;  2J1U A;  2C4X A;  2VQT A;  4HXC A;  2B8M A;  4I0A A;  2JG9 C;  1WMX A;  4GWM A;  4LA2 A;  1DGR A;  2R49 A;  3AVS A;  4XUP A;  2ZKL A;  3WNN A;  2HWE 3;  1WW6 A;  1R09 1;  2Y6H A;  3HQU A;  4RQP C;  5JPM B;  3DYM A;  3VBO A;  1RB8 G;  5FZ0 A;  5CFC A;  2HYK A;  2ZPX A;  4M3C E;  1AX1 A;  1W8O A;  4CDQ C;  1UMZ A;  2RS3 2;  1W6M B;  3H1Y A;  3KGZ A;  5A7N A;  3MW2 A;  3IIA A;  2YBS A;  2YBK A;  2IXK A;  3J7L A;  2O8O A;  2WR9 A;  1QJX 3;  3LIG A;  4BQ4 A;  2DBN A;  1UWW A;  5E8A A;  1LNS A;  4HSL A;  5LY2 A;  5FRA A;  2B9U A;  4BM8 A;  3JBG 1;  2Z69 A;  3DN7 A;  4PIY A;  4Q0P A;  5FPA A;  1O4Z A;  1KEX A;  2QUO A;  3O1S A;  2RR1 1;  4DMI A;  1PZ9 A;  4Q0S A;  1J3P A;  5E1R A;  3ZDV A;  1V00 A;  4BE3 A;  3JD7 2;  2VUJ A;  1RUD 2;  2WWS A;  4D7Y A;  3KT4 A;  1X50 A;  2VMI A;  1YQ8 A;  1J59 A;  3I2G A;  3LFI A;  1SDW A;  3F2Z A;  1DU3 D;  4N9H A;  4CP9 B;  4R9D A;  2FDJ A;  2J7M A;  2RS3 3;  4UWD A;  3GCW A;  4WVZ A;  5KHJ A;  4AVV A;  2X29 A;  4QQP A;  5IVJ A;  1BYH A;  4PQ9 A;  3LSD A;  3M3E A;  3WNX A;  5DAV A;  2YDE A;  3ZR6 A;  4PCR A;  4RA0 A;  5F8P A;  5TSW A;  2PFW A;  2RM2 2;  3H3Z A;  1B35 B;  2YRO A;  1E5S A;  4YFW A;  2CYF A;  1LGC A;  5LZ6 A;  5K4L A;  4MLO A;  3VL9 A;  3CMG A;  3FZ3 A;  3J8F 2;  4KGG A;  5JXI A;  5I8S A;  1M4W A;  3IMN A;  5EZW A;  3MIG A;  4GAL A;  1W9Y A;  3NAP B;  2XL7 A;  3HPN A;  1DZQ A;  4N7I A;  1MZF A;  3WY6 A;  4XE9 A;  1GNY A;  5J1X A;  1W6Q A;  1RXG A;  1VE0 A;  4PLO A;  1VBA 1;  3QCW A;  3LDB A;  4RS5 A;  4LHL A;  2VD7 A;  3SNM A;  1LU2 A;  5FO8 B;  1C1L A;  1YQ2 A;  1KS5 A;  4BHP A;  1SZB A;  4MET A;  2WN2 A;  3LEI A;  1AX0 A;  2RM2 3;  4V2V A;  4BJ0 A;  2WA4 A;  1QEX A;  2D6L X;  2PHD A;  1DGL A;  3J9S A;  3ZN5 A;  1ODM A;  5IVC A;  2PHW A;  1BKZ A;  4LO7 A;  1F5F A;  5HCF A;  1O8S A;  5DZE A;  5L7O B;  1FXZ A;  2VOK A;  4YVW C;  1TME 1;  1LKN A;  1MQT B;  3URF A;  4BIF A;  3ACL A;  2BGP A;  4IND A;  3OCP A;  4NE9 A;  5FBZ A;  1AR7 2;  4FOY A;  1J1L A;  1ULG A;  2ZX4 A;  4WM8 C;  1RUD 1;  2ZX0 A;  3UKT A;  1Y9Q A;  5T52 A;  4JGY B;  1I1E A;  4CUC A;  4XXA A;  4BIS A;  1W39 A;  4HVO A;  2R07 3;  3WDY A;  5FZF A;  3AFG A;  4B29 A;  4ZPI A;  4GZ9 A;  4Y33 A;  4FPO B;  4AW7 A;  1EPW A;  3HBK A;  2CTV A;  2E6V A;  1OQD A;  3EO6 A;  5JDB A;  1LGB A;  4N9I A;  3ZFF C;  1F5J A;  4AZZ A;  1APN A;  2WBK A;  2D6N A;  3GBG A;  1GYK A;  5J96 B;  1GZC A;  2XR4 A;  3ZXE A;  4Q4X 1;  3RSJ A;  3SQO A;  4DO0 A;  3ZKY A;  2BV4 A;  3KV6 A;  1N1V A;  4IXL A;  2ZBJ A;  3U78 A;  1OLR A;  1P8J A;  2HH9 A;  2HWB 3;  1LR5 A;  1FV3 A;  5A3U A;  1ULO A;  4XXP A;  4Q5O A;  5A6Z A;  3KVB A;  2PHU A;  1ULE A;  2VTF A;  4Y1U A;  1UMI A;  1JYW A;  1UXX X;  3NQH A;  2WNV A;  4EWE A;  3I2J A;  4QPG A;  1COV 2;  3SIT A;  1GV9 A;  3JU9 A;  3USU B;  4FOQ A;  1HXS 2;  3GBF A;  1K5M A;  3NNM A;  5I0D A;  4AK3 A;  1LES A;  1SLT A;  4XJW A;  2VNR A;  5FZ7 A;  2LRP A;  3VDD B;  4FP3 A;  4JQT A;  3VHP A;  4CXX A;  3TEY A;  2DCJ A;  4I3P A;  1LRH A;  2F6B A;  1Y9M A;  3K3N A;  4TWT A;  3O12 A;  5DN2 A;  4ISQ A;  1SLA A;  2B9V A;  2DUQ A;  2XJQ A;  4RGK A;  1AYM 2;  4FPH A;  5BY5 A;  1A3K A;  1G9F A;  2W91 A;  4QB2 A;  3WQB A;  4NHM A;  2EVX A;  3AP5 A;  1QOT A;  3MID A;  2WLQ A;  5JI9 A;  4LJH A;  1B09 A;  4BME A;  1BCX A;  3WHT A;  1OPM A;  5A3M A;  5FPZ A;  2JG8 A;  1RUE 3;  1OBN A;  2XJP A;  2YFU A;  3ASI A;  3O0W A;  4CDX A;  4CVU A;  2PQS A;  2QQU A;  2QQN A;  2VXR A;  4FPE A;  5FLI A;  5I93 A;  1UOG A;  1XNB A;  3DXT A;  2GC0 A;  5A6X A;  5K0U B;  2FHR A;  5C3O A;  5GZE A;  5BNN C;  3V0B A;  1KFX L;  4XFG A;  1R1A 2;  2GC3 A;  1AF9 A;  1D2Q A;  2DVB A;  4NWW A;  1OLQ A;  5DAP A;  4YW6 A;  3AYC A;  3VDA A;  3MW4 A;  3GZT B;  1FYU A;  1PO1 3;  2FZ2 A;  3H8R A;  1LCL A;  3IPV B;  4Y5T A;  4C0B A;  1RJ7 A;  4P14 A;  1WA4 A;  2VZP A;  4LOS A;  1URX A;  3O1T A;  3C2U A;  1OKQ A;  2ZZQ A;  3WUD A;  1DIW A;  1T2X A;  4KWL A;  5BNP C;  1AR8 3;  2JDA A;  4TLG A;  2HWF 3;  1SLL A;  1HQL A;  1W6M A;  4YG0 A;  3HT1 A;  4IEO A;  1SPP B;  1UXZ A;  5CKQ A;  5JOY A;  4K1Z A;  2KXL A;  3V56 A;  1PMJ X;  4B1L A;  2EID A;  4E4S A;  3LZZ A;  4M01 A;  1XNC A;  3WW1 A;  4A45 A;  2DTY A;  2JDM A;  2R16 A;  2QQP A;  3KV5 A;  4CDQ B;  5C5U A;  2RDQ A;  4V1P A;  1XYO A;  4N43 A;  1PMH X;  4Y22 B;  5FYB A;  1X9T A;  5JXG A;  4XFC A;  5A7P A;  2J1S A;  3L2H A;  4OI2 A;  4F83 A;  2R30 A;  1RTV A;  3CNA A;  2WYF A;  1W06 A;  4R9C A;  1ACC A;  3VHN A;  1KDM A;  4D0Q A;  1PIV 1;  1W8W A;  3RYK A;  3IAP A;  3I97 A;  4DY5 A;  2I07 B;  5AFB A;  4ATF A;  4ZKT B;  5C8W A;  2AEN A;  1B35 C;  4GWI A;  3J7H A;  3BIE A;  3LA7 A;  4M00 A;  4MXW B;  4IW3 A;  4CCD A;  5F9T A;  3W9A A;  2ILM A;  2QBX A;  2CGP A;  3BCW A;  5H9Q A;  3TEZ A;  3LIH A;  3P3P A;  1QWR A;  2W2I A;  2O8Q A;  1BHG A;  2WJS A;  3HT2 A;  4NUB A;  4AVT A;  5L7O A;  1CJP A;  2Y0I A;  3O0V A;  1H2K A;  5H9S A;  4GUL A;  4D8M A;  1AR6 1;  3WIN E;  3NNJ A;  3POY A;  3OGJ A;  4E2S A;  2YPJ A;  2VPV A;  4RGG A;  1BLZ A;  2D6K A;  3VKN A;  1RVF 2;  2ES3 A;  2HWD 2;  1H6X A;  3VBU A;  3L9J T;  4OI0 A;  2VGD A;  5FZ8 A;  3LB9 A;  3EBR A;  3OJB A;  2AEZ A;  1QY4 A;  2RS3 1;  3S7I A;  5FP3 A;  3BOP A;  1C3H A;  2V4V A;  4Q4V 2;  3Q8E A;  2Q8D A; 
#chains in the Genus database with same CATH homology
 5A1A A;  2R7E B;  1UYX A;  2WAB A;  1OH4 A;  2KD7 A;  2WO1 A;  2LS6 A;  4KI5 M;  3CKH A;  4L0P A;  1O59 A;  4QX0 A;  3NJV A;  3K4Z A;  1W99 A;  3T08 A;  2W1S A;  3PUI A;  2BER A;  3HJR A;  3VD7 A;  5JMO A;  2VM9 A;  1XNT A;  4MOA A;  2XON A;  4BK5 A;  1GMM A;  4BXS V;  3OGR A;  3FN9 A;  5EJZ B;  3WF0 A;  4JKK A;  1TG7 A;  2C26 A;  2VMC A;  3OG2 A;  5C71 A;  3LEG A;  4Z2A A;  4OUE A;  5IYY A;  2YC2 A;  2VOT A;  4QX2 A;  2QQL A;  3MV1 1;  2Y6G A;  4CU9 A;  1NKG A;  2J1R A;  3UNP A;  4HG6 B;  3C7F A;  3W5N A;  1XC6 A;  3D3A A;  1O8P A;  4XUN A;  2V72 A;  2QQM A;  1US2 A;  2ZEY A;  3ACI A;  5EJ1 B;  4A41 A;  2W1U A;  4W50 A;  4MO3 M;  4LKS A;  4M4R A;  2W46 A;  3PUH A;  3I2K A;  1JZ8 A;  4ARX A;  4LPL A;  5IJR A;  4DXS A;  2XQX A;  2W94 A;  1XNA A;  3K75 B;  3ACH A;  1EUU A;  3LPG A;  4DEQ A;  4MGS A;  2JE8 A;  2QQI A;  1DLC A;  4QDS A;  3ACF A;  3VD4 A;  2RV9 A;  1IQD C;  3CZJ A;  3FHQ A;  4P02 B;  1H6Y A;  1W8N A;  4QDQ A;  2W47 A;  3ZM8 A;  3T2Q A;  5LA0 A;  3MV0 1;  1J84 A;  3NJX A;  5JUV A;  1UYY A;  3GXU A;  2VZT A;  4ET7 A;  3BGA A;  3VDB A;  2DCK A;  5EIY B;  3CIH A;  2RJ2 A;  2J1A A;  2Y6L A;  2ZXQ A;  3WSO A;  3T09 A;  3A21 A;  2QQJ A;  3DYO A;  1SDD B;  4QDR A;  1GOH A;  3I3D A;  1W9S A;  1CX1 A;  1MPX A;  1US3 A;  1UZ0 A;  4DEV A;  5C7G A;  3WF3 A;  5DMY A;  2WO3 A;  1CIY A;  2WYS A;  3GM8 A;  1K45 A;  2VCA A;  5LA2 A;  4XUQ A;  2WAO A;  2JD9 A;  4XUT A;  2Y64 A;  3EB7 A;  3SEE A;  2BBA A;  4W8J A;  2J1T A;  1XPW A;  4P00 B;  3W5M A;  3NRU A;  1K3I A;  5CYY A;  4A4A A;  3T0B A;  2YB7 A;  3OBA A;  5C70 A;  2VCB A;  2EIB A;  3WF4 A;  2W87 A;  3UES A;  4P08 A;  2VZR A;  2V5D A;  1OD3 A;  3I2F A;  5DQ0 A;  1JYN A;  1UY4 A;  2J1V A;  4AG4 A;  1JI6 A;  3K46 A;  1GU3 A;  2WUH A;  3NNG A;  2X10 A;  3LEK A;  3A22 A;  4QAW A;  3WNO A;  2WQ8 A;  1UMH A;  3WNL A;  4ZZ8 A;  4DUX A;  4ARY A;  4MGQ A;  4LHS A;  3SKV A;  1W0N A;  1GQP A;  2YG0 A;  2W92 A;  1K12 A;  1RYY A;  2W1Q A;  2WN3 A;  5B4X A;  3THC A;  3T0D A;  2J22 A;  2VMD A;  4BK4 A;  4LQR A;  2VZV A;  5F7U A;  4JKL A;  3VDC A;  3BN6 A;  1I5P A;  1PX3 A;  2WZ8 A;  3HNY M;  3VD3 A;  1SG3 A;  2YFZ A;  3C8X A;  1NUK A;  1GOF A;  4RN5 A;  1JZ6 A;  1CZV A;  2Y6K A;  4QB1 A;  3FHA A;  4A42 A;  2E33 A;  4CU8 A;  3MO4 A;  2WZE A;  1EUT A;  4FI9 A;  5IFT A;  3THD A;  2OKX A;  4XVH A;  3JXS A;  5G05 L;  3ECQ A;  2Y8K A;  2W3J A;  2J1U A;  2C4X A;  2VQT A;  3WF1 A;  5CZK A;  5IFP A;  3OEA A;  2ORX A;  4UI9 L;  4XUP A;  4UOJ A;  3WNN A;  2Y6H A;  3DYM A;  2B4K A;  4YPJ A;  1W8O A;  5DPN A;  2BGO A;  2W95 A;  3WNM A;  3LQC A;  1UWW A;  1LNS A;  2VZQ A;  2QQO A;  2HYX A;  2DDU A;  3T2P A;  4PT6 A;  1JZ2 A;  3MBW A;  1KEX A;  3IAQ A;  2CDO A;  2E32 A;  3SEP A;  4ZY9 A;  3I2G A;  4BDV B;  2C9K A;  3F2Z A;  4PQQ A;  4QPW A;  3T2O A;  4QB6 A;  2J7M A;  1ULP A;  2W5F A;  3UET A;  4KMQ A;  1JZ3 A;  4DUW A;  3ETP A;  3C7E A;  4W4Z A;  2LW8 A;  1W9W A;  2Y6J A;  3HOB A;  3CMG A;  2X05 A;  2VZO A;  2RVA A;  5JXI A;  3WEZ A;  3P6B A;  3U37 A;  4CU6 A;  3HPN A;  1JU3 A;  4ZXE A;  2YC4 A;  1GNY A;  5J1X A;  5HXM A;  1NX9 A;  3ACG A;  4OYU A;  4JKM A;  1YQ2 A;  2WN2 A;  3AC0 A;  2ZEZ A;  3LEI A;  4BJ0 A;  3DYP A;  2WDB A;  2VZU A;  2W1W A;  4E8D A;  3WNK A;  1O8S A;  2ZEW A;  1JYW A;  4AAX A;  3OGS A;  4IUG A;  5G04 L;  2BGP A;  2JKX A;  2VO5 A;  2ID4 A;  2XOM A;  4TXW A;  4DXT A;  5IHR A;  1UX7 A;  3C7G A;  4CUC A;  1JZ5 A;  4GZ9 A;  1WCQ A;  2VMF A;  4A6O A;  3A7Q A;  3DEC A;  3ABZ A;  4KWU A;  4P5Y A;  4CU7 A;  4A44 A;  2ORZ A;  2WBK A;  3C7H A;  1OF3 A;  2VCC A;  3WNP A;  3IB3 A;  1P8J A;  3I2H A;  3III A;  1ULO A;  1UY3 A;  3HNB M;  5JR2 A;  2VTF A;  1UMI A;  3HN3 A;  1JHJ A;  2VME A;  1UXX X;  3NQH A;  3MUZ 1;  3OEB A;  4MAD A;  5LA1 A;  2E31 A;  3I2J A;  3EYP A;  4CUB A;  1JZ7 A;  3C7O A;  5I0D A;  1JYV A;  2Z4F A;  3IDA A;  2VZ1 A;  2VC9 A;  3K4A A;  2DCJ A;  4E8C A;  1L7Q A;  1OF4 A;  3SKJ E;  4ZZ5 A;  3OB8 A;  2BZD A;  5DN2 A;  5FUI A;  2B9V A;  3MUY 1;  2X09 A;  4QB2 A;  1JU4 A;  1SHW B;  2W91 A;  2L9L A;  2XHN A;  3T0A A;  3WQB A;  1DP0 A;  1JYX A;  2YFU A;  1CZS A;  4CVU A;  2PQS A;  2QQN A;  1CZT A;  1J83 A;  2W9X A;  1UY0 A;  1NAE A;  4XZU G;  3HEI A;  4UAP A;  3VDA A;  2EIC A;  3CZU A;  4JHZ A;  3VD5 A;  1UY2 A;  2VZP A;  4RYD A;  3I2I A;  1DYO A;  1T2X A;  2VZS A;  2JDA A;  4JX0 A;  4QX1 A;  3WF2 A;  1GOG A;  4OZO A;  3I3E A;  1UXZ A;  1D7P M;  3P1I A;  1PMJ X;  2EID A;  5JXH A;  4DUV A;  1OT5 A;  2QQK A;  4A45 A;  1K42 A;  4QX3 A;  2EIE A;  1GUI A;  4XUR A;  5JXG A;  3E1F 1;  1PMH X;  3GGL A;  1L7R A;  2J1S A;  4OMD A;  2CDP A;  1TVG A;  2ZEX A;  4A3Z A;  3LPF A;  4D0Q A;  1UYZ A;  3IAP A;  3I97 A;  4CUA A;  4M4P A;  1WKY A;  4GWI A;  3J7H A;  3HNM A;  5HPO A;  3A23 A;  1F4A A;  1JZ4 A;  5LCW L;  2VZ3 A;  1W9T A;  2HLE A;  2WAA A;  2VR4 A;  3CDZ B;  2VJX A;  3FL7 A;  2QBX A;  3I3B A;  4DXR A;  5JXJ A;  1KGY A;  2VL4 A;  1BHG A;  3LE0 A;  2E26 A;  2VQU A;  4GWJ A;  2WO2 A;  3CQO A;  4D8M A;  4TTG A;  1PX4 A;  1R64 A;  1HN1 A;  3VD9 A;  4XUO A;  3GDB A;  4OMC A;  1UY1 A;  1H6X A;  1F4H A;  3OGV A;  5B4N A;  3K4D A;  3K77 A;  4PF1 A;  2V4V A;  2J1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...