1UMQA

Solution structure and dna binding of the effector domain from the global regulator prra(rega) from r. sphaeroides: insights into dna binding specificity
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
60
structure length
60
Chain Sequence
LAKGESLPPPPENPMSADRVRWEHIQRIYEMCDRNVSETARRLNMHRRTLQRILAKRSPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure and DNA Binding of the Effector Domain from the Global Regulator Prra(Rega) from Rhodobacter Sphaeroides: Insights Into DNA Binding Specificity
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Dna binding protein
molecule keywords PHOTOSYNTHETIC APPARATUS REGULATORY PROTEIN
total genus 15
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2003-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1umqA00
5DTDA 3HOWJ 2R5YB 3JR9A 3BG3A 1YRNB 3OOUA 4JX4A 4FISA 4JP0A 3MN2A 3G1OA 3QQAA 1Q1VA 3ZQFA 1MBHA 3GTGJ 1JT6A 2EZHA 1E3OC 1MBGA 2ECCA 2I10A 5IP7J 3FK7A 2EZLA 2X48A 4A3FJ 4FCYA 1B8IB 2DA3A 1BW6A 1MBEA 1MH3A 1CQTA 2G0EA 1DU0A 1ETKA 4NDLA 3GTJJ 4M3FA 2VPRA 3Q0VA 3HB9A 1B8IA 2JA5J 4DW6A 1A6IA 2WB1N 1RPWA 3UKGA 2JA8J 4UUSA 4A3MJ 4RBOA 4M3DA 4IHWA 2HOSA 3Q0WA 1TWFJ 2YU9J 1Z77A 1IUFA 2L7MP 5M5YJ 1JTYA 3BR0A 4UUSB 1ZQ3P 4M3EA 3A01A 2E2IJ 3JRFA 2LD5A 3B6CA 5EZHA 1I50J 2KT0A 2E2HJ 5EEAA 4G12A 2R93J 1ENHA 3S16J 2FJ1A 4XICA 1W0UA 1T56A 1IV6A 5M3MJ 2R5YA 1ETYA 4BBRJ 1RKTA 3HGYA 3ZOBA 1BA5A 1VF9A 1OCTC 2HXOA 3BTCA 3NAUA 4XRSG 3BQYA 5IP9J 3GBGA 4JX5A 5E3MA 4M3GA 1OFCX 1VI0A 1AKHB 1S7EA 4M6VA 1X58A 2Y9YA 3QPLA 1FIPA 4DYRA 1ZR4A 4M3BA 1NTCA 1JGGA 1ETVA 2VKEA 4I6ZA 3JRHA 1G2HA 3HBLA 5IOYA 1PUFB 1BJZA 4D7NA 1ZR2A 4D5CA 3O8HA 1ETXA 1ZKGA 1MSFC 4S0HB 2JK3A 3W6VA 2K9SA 2XB0X 5FKLA 1JUPA 1ETQA 4A3JJ 3JRAA 3M4OJ 2TCTA 2LP0A 2D5VA 2HDDA 2LVSA 1TWHJ 3K2AA 2NS7A 5EDNA 2ME0A 5F04A 3QPSA 2CQQA 2R7ZJ 5J3LA 2WAQN 4B4CA 2FD5A 3K7AJ 3ZQCA 4QTRA 1JUMA 1TWAJ 2LR8A 4FTHA 3VPRA 1I3QJ 3OSFA 3DEWA 3JRIA 4BY1J 3CQZJ 3F0CA 3WHBA 2DA2A 2XPUA 2AHQA 2JWTA 3GTQJ 3PM1A 2L9RA 4A69C 2FQ4A 2O9LA 1AHDP 1H89C 1RR7A 3IH2A 2HXIA 1U78A 3S1NJ 2YS9A 4C3HJ 4BY7J 2MGQA 2DMPA 4A3GJ 5DS9A 2K40A 1ZK8A 1LFUP 2P81A 4L5EA 3RZOJ 5E3OA 3HKZN 2ZB9A 1PUFA 3JREA 4JX6A 1NK3P 2CRGA 2Y0SN 5FKKA 2NS8A 3L1PA 2DA6A 2W48A 3SFIA 1JKPC 4A3BJ 3CDLA 1IG7A 4D7MA 3FIWA 1IGNA 1MSEC 2XGEA 5IP6A 2M2EA 3BR1A 5K7HA 5FKOA 3S1QJ 1APLC 1Z0XA 1RKWA 2FX0A 3ZQHA 5IYCJ 1TC3C 1QVTA 4QSHA 1UMQA 3FKIJ 3RZDJ 2JN6A 1B72A 1ZTRA 3Q0UA 2LTPA 4DYQA 2DN0A 3GTPJ 4V2FA 4MFEA 1FTTA 1QRYA 5IYBJ 2O8KA 5JLWA 3DCFA 2X6OA 1BW5A 2E2JJ 4IHYA 1RETA 3BR5A 1MNMC 4C2MJ 4W97A 2COBA 1JKRC 4Y7NJ 1QVUA 5FKNA 3S2HJ 2QCOA 5IYDJ 1Y1WJ 1OJLA 2DA5A 2DA4A 1XG1A 2LY9A 2H1KA 1ZGWA 3S15J 1SANA 3G1MA 2QF7A 2HI3A 4AC0A 1HF0A 4XK4A 4ABZA 5BNGA 3BR6A 3HOYJ 3M3YJ 2Y2ZA 1X2MA 2WV1A 2M34A 2DA1A 4HNVA 2NVTJ 4BKXA 5C44J 4X6AJ 3S1RJ 2L0KA 1JJ6C 2E1OA 2O7OA 3BTIA 3ZQLA 1A5JA 4RDUA 3D1NI 3LSGA 2DTZA 3NARA 2GBYA 1MBKA 4MFDA 3A03A 1I6HJ 2CU7A 1JUSA 5EF6A 3B6AA 2X9DA 4W1UA 5F1JA 5EYRA 4EEFG 1GV5A 1H8AC 2DJNA 1RESA 3BTLA 4MIMA 1JKOC 3PO2J 2RAEA 3IV5A 5EG0B 3GTOJ 5FLVA 4XRMA 1ORKA 3WHCA 1F36A 2GLOA 3BT9A 2DMTA 2HYJA 1B72B 4A3LJ 1XS9A 2K9NA 1O4XA 2LFBA 2CJJA 1R9TJ 2YUSA 4DYCA 2GM4A 5C4JJ 3SJMA 1IDZA 2IBDA 1Y1VJ 2HOTA 3A02A 1D5YA 3HOVJ 2CUEA 3S2DJ 1EF4A 3GTKJ 1LE8B 1XC5A 3RKQA 1NK2P 2NVQJ 2ECBA 1WH5A 1WH7A 2XB5A 3MKLA 2ELKA 1WGXA 4CYCA 5FKMA 3GTMJ 2AO9A 2M9HA 2Y31A 1AU7A 1W0TA 2MG4A 1LE8A 2H8RA 3LSRA 5K7FA 3OIOA 3HOUJ 2XRLA 1FIAA 4A3DJ 3JRBA 3CMYA 3E7LA 1BL0A 1HDDC 2CUFA 5F0FA 2M0CA 3JRCA 3H3VK 5EGOB 4C3JJ 1JT0A 1U9OA 1WI3A 3BR2A 2B63J 1P7IA 2HQ5A 5J1UA 4DZPA 5IPAA 1K83J 2R0QC 2XPVA 3BTJA 3SDGA 2EQRA 2NVYJ 2MW8A 4I76A 5E3NA 2DMNA 4V2GA 5J1YA 5F27A 5M3FJ 1QPIA 2ID3A 2LK2A 4MO7A 1WCMJ 3BG9A 3H0GJ 4IEJA 1FTZA 2XPWA 9ANTA 4DZJA 1IJWC 5K7ZA 1UG2A 1T33A 5C3EJ 1VFCA 2NOGA 1GT0C 4XIDA 3BR3A 2R5ZA 4XRSA 5FJ8J 2OF7A 1FJLA 3HM5A 4Y52J 3ZQIA 1TWGJ 2EZIA 3LNQA 2XGDA 1ETOA 3S1MJ 5C4XJ 3RQIA 4A3EJ 2K9QA 1SFOJ 4BXXJ 4GFBA 4J19A 1F43A 1IC8A 4A3IJ 5E3LA 3BG5A 2N8GA 5GPAA 3CCYA 3HOZJ 4AYBN 1AKHA 2TRTA 2DMQA 1POGA 4JYKA 1DU6A 1P7JA 3MVPA 5IOZA 1K61A 4QIWN 1IDYA 1H88C 2XSDC 2PMZN 5JLXA 1JTXA 1OCPA 3LSPA 1YRNA 2LLKA 5F08A 4B1RA 3GTLJ 3OSGA 4AUXA 2HOAA 5EG0A 3TP3A 1MH4A 1ETWA 1MBFA 3BQZA 2LKXA 3FISA 4UUTA 4BBSJ 3JRDA 2JA6J 2VI6A 3TW7A 5HODA 2Y9ZA 1TWCJ 3IH4A 1MBJA 4D5FA 3TEDA 3S17J 5F0CA 2JJ7A 1IRZA 1JJ8C 3G1LA 3LSJA 2R5ZB 5EZGA 1HDPA 2VUMJ 3C2BA 2MSYA 2R92J 2DA7A 4B3AA 1X2NA 1GV2A 3A01B 1U9NA 4A93J 3IH3A 3TW6A 3I4MJ 5F0HA 4MLOA 1WPKA 5GPCA 1GVDA 4X1EA 1UHSA 2XGCA 4LOCA 3O8GA 1GUUA 2JMWA 2ID6A 3FK6A 2OPTA 3HGGA 2E19A 5GP9A 5FLMJ 1GDTA 2NVXJ 3JRGA 1LFBA 1ITYA 4FE7A 1HCRA 3S14J 2CQXA 3LOCA 1VNDA 2Y30A 2DMUA 2EBIA 1FEXA 5J1RA 2JA7J 3HEFA 1JKQC 4A3KJ 4C3IJ 5EGOA 5M5WJ 3Q3SA 3HOXJ 5M5XJ 2L7ZA 1HLVA 2EZKA 3ZQGA 3PO3J 4A3CJ 3TP0A 4FE4A 2IAIA 3I4NJ 1HOMA 2L7FP 3HDDA 4IHVA 4CYCB 2IEKA 2KDZA 1U8BA 2ME6A 2VKVA 4IHXA 2EH3A 2M8GX
chains in the Genus database with same CATH superfamily
5DTDA 5GAEJ 2R5YB 1X3ZB 2KIMA 3FXLA 2NXNB 3OOUA 3GWZA 4FISA 2QSGX 3MN2A 2GA2A 1X1DA 2CW8A 2A5WA 4RLFA 1TNSA 1PP7U 2RKHA 2XRNA 3ABMH 2HEOA 5KAFC 3NWTA 2JPCA 3GTGJ 2ZBKA 2RREA 5IP7J 2EZLA 2R7QA 2X48A 1I1SA 3DKYA 5F64A 3SZGA 2PX9A 4OIQF 1BW6A 4EMSA 1OQYA 4IQ4A 2YR2A 3RPUA 3OS1A 4AVPA 1ETKA 3GTJJ 4L0YB 1R5HA 1YX3A 2Y0SA 3KEYA 2QBYA 3Q0VA 1B8IA 2L9SA 4A6EA 4HW0A 1A6IA 2LF7A 4XSZF 2WB1N 2R7SA 2CG4A 2HGCA 5J47A 2GIZA 3OYMA 3UKGA 4LIUA 4M72A 3F22A 2JA8J 4A3MJ 2E1NA 3E5UA 4KN4X 4RM2A 3E6CC 2FMLA 2DAOA 3LA2A 2KIUA 1G3WA 2HPIA 3CLQA 2YU9J 4MGRA 3R0AA 1EH7A 1H0MA 1T98A 2R7VA 1WJ5A 4DJAA 3ISPA 4KT6A 3JAMZ 3JRFA 2M3AA 3F9KA 3V8LA 4BXUA 4UVBA 2E2HJ 4RGRA 1ENHA 1FNNA 4NC6A 2GWRA 2FJ1A 2PEXA 4HA8A 4XICA 1W0UA 1S72I 2R5YA 5FRNA 4DBQA 1WQ2A 5JFRA 3ZOBA 1VF9A 2IA0A 4B44A 4HZFA 4DOZA 5K5QA 5IP9J 3GBGA 1B59A 5E3MA 1ZH5A 3WTZA 2QSHX 2P7VB 4QLCU 2XF5A 4I09A 5D8KB 1SFUA 2I5UA 4ANJA 5KHDA 1HSTA 4I6ZA 3JRHA 1G2HA 1GXPA 2WB1A 3FXUA 1BJZA 3LQRA 1ZR2A 3CUQC 3O8HA 3ZCOA 2IS2A 1ZKGA 4S0HB 2JK3A 3P9CA 1R00A 1MMSA 3TO6A 4BHCA 3K2ZA 4AIJA 2R7XA 3F6OA 2TCTA 2E60A 2D5VA 4ZYDA 2HDDA 3W2VA 1R4MB 3TOBA 1FZPB 2MLGA 2ME0A 5HLTA 4M9XA 3QPSA 4GCVA 1J2XA 3IAM2 2XAQA 4ON0A 2WC2A 5A2QK 2PN6A 4NB5A 2V9KA 4G6DA 1TQMA 2A6HF 3LWFA 2C6YA 3K7AJ 1BR4A 4HV6A 2LR8A 2ZMEC 4HOBA 2JVGA 1I3QJ 3EUHC 3M1CA 3JRIA 1N78A 1B9NA 4PSXA 2Y75A 3F0CA 1WWXA 3WHBA 2R7FA 3IP4B 3L2RA 4A69C 1FOWA 1XN7A 2LBFB 3K69A 4E6KG 1MW7A 3VYRB 4UV8A 1H89C 3S1NJ 4UUVA 3HRUA 2CV0A 4JBAA 3ZPLA 2DTRA 3ZQQA 2O6GE 4EGZA 2FQ3A 4B43A 2HOEA 3R0JA 3LAJA 4Q5SF 3RZOJ 5IT9Z 3GCMA 2ZB9A 2MD5A 2WA0A 4YFNF 3X2QH 1VQ5I 1HKSA 2VE8A 2NVUB 2OTJI 1MDMA 2MA3A 2NS8A 2DA6A 1I6XA 3WODF 1ZARA 2HNHA 3CDLA 1IG7A 1K7AA 4KUMA 1R4NB 5IP6A 1W5SA 4G7OF 1IXSB 2M87A 2VBWA 2QEXI 1VQ6I 3S1QJ 2H94A 2PQ8A 2QQ8A 3EQLF 3M8JA 5DCFA 3UNGC 4EJTA 5ICFA 1K78A 2HPMA 3G73A 3FKIJ 1XMKA 2OAZA 2JN6A 4C30A 4D9JA 1K4TA 1YJWI 2BV6A 3QYEA 3F8CA 2Z1DA 3JTGA 3WTUC 1ZTRA 4DYQA 2QENA 3L9FA 2Q2EB 3TOAA 2G7HA 3PL8A 3ONQA 3KZZA 2Z99A 2E2JJ 1RETA 2JQ7A 1MNMC 2F4OB 3NWSA 2CO5A 5BMZA 4Y17A 4U0VA 4W97A 2BE5F 3RPUD 2VOPA 3SEQA 4Y7NJ 2D2WA 1QVUA 1YW8A 5FRMA 5LHHA 1T0FA 5IYDJ 4RGXA 2ZO4A 1OPCA 3RKXA 3AAFA 2NNYA 2H1KA 1D1CA 3ZMDA 3K0LA 4NC7A 1SANA 5HNHA 2L9NA 2X0LA 3OIQA 1B1BA 2QUFA 3BPVA 4AC0A 1HF0A 1F9NA 3OS0A 4ENKA 4ABZA 4FX4A 5BNGA 3M3YJ 5JVGF 3EETA 2WV1A 3KZYA 2M34A 5F6FA 3I3LA 4I0BA 2NVTJ 4BKXA 1FPQA 5C44J 4QPQA 3S1RJ 4MTEA 2L3DA 2MH9A 1FP1D 2E1OA 1XDSA 2O7OA 3BTIA 3G3ZA 2KRHA 2FEZA 2PBIA 2G9WA 2RN7A 5FLXK 2DTZA 5DUIA 5HVQC 4MFDA 1MBKA 1MJ9A 3FKJA 4CUGA 1YFHA 2HKXA 5EF6A 2KKOA 4W1UA 2HKOA 5E1ZB 4BUPA 3GF2A 1RESA 2GXBA 5ICGA 4ZDLA 3TMOA 1A31A 1Z67A 1W36D 2RAEA 3V8KA 3IV5A 3CJNA 3GTOJ 5FLVA 4NQWA 1ORKA 2W4SA 5J8FA 3FMSA 5L3CA 4XLFA 5LBQA 1WI9A 2GLOA 2DMTA 1IRGA 4G94A 3DPUA 3CMMA 3PNYA 1K79A 1O4XA 2YUSA 4DYCA 1ODDA 4ESFA 2DFHA 4AIKA 3F6VA 2QA4I 3AG2H 3KFWX 3A02A 4ZH4F 5D5WB 1XC5A 3RKQA 1SFXA 3HYIA 1XSXA 4OOIA 2CYYA 2ELKA 2V9VA 3GTMJ 5FKMA 2X6WA 5E1XA 2AO9A 4N9HA 2M9HA 1S29A 1W0TA 1LE8A 3ZQ7A 2Z5UA 1R71A 1RZ4A 2DI3A 2XRLA 3HTSB 2FMYA 3G4SI 3WE3A 2W00A 2CUJA 2E7WA 3KE2A 3H35A 2HU9A 4BAYA 5LLQA 3E7LA 2KRCA 3EYYA 1YJ9I 3HKZA 1BL0A 1ZHFA 2F4IA 4HAMA 3PIOF 1HDDC 3M7GA 2M0CA 3DTKA 3H3VK 4C3JJ 3I0TA 1JT0A 2V4JC 3V7CA 1T2KA 4CYDA 5JR3A 1TBXA 5IPAA 3GFMA 3OYGA 4IRIA 2R0QC 4S04A 2EQRA 1RC9A 2F5CA 1QPIA 4BQAA 2BVMA 2VN2A 4G7HF 4DZJA 4GYGA 5JHFA 5BPDA 4U0YA 4E7JA 2ETHA 2BZTA 4OAYA 3A4CA 2HTJA 3J7YJ 1D1BA 1T38A 2GQQA 2OCEA 3CESA 5FO5A 1VFCA 3F72A 5K1YA 2R5ZA 3QP6A 1D0YA 3GZ6A 2CQKA 2EZIA 3LNQA 2XGDA 4V19K 2I8DA 6PAXA 2UUZA 4JQFA 1ETOA 1WJEA 5C4XJ 3RQIA 3QWLA 3ASNH 4A3EJ 3OMYA 4Y13A 4CO8A 4PK4A 2GXAA 1F43A 5E3LA 2BHZA 2NNNA 4RA2A 2N8GA 3CC7I 3FHNA 3IAS2 1KQ8A 1L0OC 4L5IA 3K6GA 4AIDA 3WTXC 3K4CA 4JYKA 2DOFA 3OYHA 1P7JA 4KN7X 4KJZA 2EFPA 4XKBA 4OWRB 3QOPA 5ILUA 4F52A 3BPXA 2OD5A 2PMZN 2K86A 3E97A 3K4BA 2BW3A 3LSPA 1YLFA 4PUSA 3S8PA 5KCMA 3M8FA 4AUXA 2HOAA 5AIPA 2F2EA 5BOXA 2LKXA 2K5CA 5ICEA 1R36A 2VI6A 2WWYA 1OLTA 1CF7B 1WRJA 2HYFA 4MQ9F 4OU0A 1TWCJ 2YX4A 2JUGA 3U9GA 4A2UA 4IL6C 3MKZA 4D5FA 5BPIA 4RS8A 1PYVA 2JJ7A 1IRZA 3CF2A 5HS7A 3FHZA 3G1LA 3LSJA 2LY1A 2R5ZB 1GVJA 5EZGA 1HDPA 1BOBA 1SVMA 2VASA 1YHQI 2EINH 3C2BA 2MSYA 4AIHA 3CF5F 3T8RA 3A01B 4P9UA 1YYVA 4A93J 2MBFA 3TW6A 2IS4A 2FRHA 4HEA2 4ZDOA 1KA8A 3FK6A 4HDUA 2E19A 1GDTA 2BGCA 1RUOA 3F3XA 3HJEA 3ZMVA 2EA2A 3CCEI 1QBJA 2EBIA 4AVZA 4G7ZF 4BACA 4E70A 4BE0A 3E6DA 3OY9A 1XGMA 5BS6A 3HC7A 1JKQC 3PSIA 5EGOA 1SFKA 3FBIB 2DDBA 4OIOF 2A61A 2MYSA 3WGHA 1U6GA 5A2QZ 2L7ZA 4HX7A 2NOJB 2ELHA 1HLVA 1SAXA 3IL2A 2M7BA 1VQOI 4KIBA 4XOTA 1YW7A 4AYBA 3E0JB 3GZ5A 2HFHA 2BY2A 3WGGA 3MFKA 3FXKA 4IX7A 2IAIA 1HOMA 2L7FP 2XHKA 2ME6A 5DDGA 2AQEA 3R6SA 2M8GX 2F5DA 3JR9A 2HYGD 4XLHA 2IJLA 3Q9SA 4LLLA 1Z6TA 3FXOA 4JP0A 1BOAA 3G1OA 3PQKA 3JAMK 2KFDA 4BYYA 1X1BA 1DQUA 4HX4A 2I10A 4RAYA 4LLGF 3OYLA 3L2CA 2VLAA 1XSVA 4FCYA 3MD2A 4F55A 2BBYA 2DA3A 2DJIA 3I56I 2CS3A 1CQTA 3CLOA 3MZHA 1LQ1A 2A6EF 4M3FA 3H9JA 1ON2A 2M0MA 2VPRA 3DP7A 3LA7A 3PNTA 4DW6A 2M30A 4DBRA 1RPWA 4OIRF 3HSFA 1SVLA 4O5VA 3F23A 4EM0B 3BJAA 3OYKA 3CJQB 4CCKA 4F92B 4M3DA 4IHWA 2DOEA 3Q0WA 4U0WA 2LC2A 2NS0A 4GXOA 3BZ6A 2IGKA 1LKXA 1O3TA 4HSTA 5CVVA 1T0FC 4UUSB 1QNTA 1C0WA 4M3EA 4MHGA 3J7AO 1V4RA 3E3VA 2L5QA 3GZNB 1X3UA 2VBYA 1BIBA 4CXFA 4G12A 2R93J 2VQCA 1FSHA 3RSNA 3G2BA 4HV5A 2FNPA 1IV6A 3FWEA 3FBNB 2EV6A 5M3MJ 5J6XA 1RKTA 1B9MA 3G6EI 4KYWA 3CUQB 1BA5A 1OCTC 2OUMA 3EUHA 2DPUA 3KP2A 2RC4A 3BTCA 4XRSG 2LKSA 1ZAOA 1MJAA 4HX8A 1IUYA 1KU7A 1M1EB 3I59A 4F91B 1OFCX 1UB9A 3V7SA 1AKHB 1S7EA 2M45A 2LREA 3FXRA 4IVNA 3QPLA 4P1WA 4LITA 4QWQA 1NTCA 1G3SA 2LMDA 1X3WB 4N4NB 3OL4A 3HBLA 5K5RA 5B1AH 5IOYA 3CMAI 3KX2A 3TGNA 4D5CA 3ULQB 1P92A 3OR1C 3HZJA 3W6VA 1Y56A 3LQQA 2K9SA 1FLIA 2L2OA 2XUBA 2LP0A 2KDOA 4PZJA 1F4KA 2M5WA 3EUKL 4NBQA 1BR1A 3FXMA 1EV7A 2FXAA 2NS7A 3BG7A 1VQMI 1MMDA 1U3EM 3GLXA 3CO6C 3WTWC 4CHUA 4O3MA 1X1PA 1DPUA 4IQJA 2WADA 2R4GA 4RLQA 1SMYF 2F5EA 2WBMA 3K1MA 3QPHA 3ZQCA 1ULYA 3WTYC 1JUMA 2MH2A 1MMNA 3VPRA 4XMYA 3DEWA 4D0PA 4BY1J 3CQZJ 3FZVA 2K4JA 1FBSA 1QGPA 3MMYB 2XPUA 2AHQA 2JWTA 3GTQJ 1Y0NA 3I55I 1J9IA 2XF7A 1R49A 1AA7A 1ZELA 5B3SH 2A3SA 2Q1ZB 1H9TA 1AHDP 1RR7A 3IH2A 2AXTC 5BQTA 5IT3A 1REPC 4B48A 1XCVA 4BY7J 4F93B 5E18F 1BM9A 1EA3A 2G7UA 2K40A 1ZK8A 1LFUP 4L5EA 1LUJB 3KZIC 1NK3P 3DEUA 2OC6A 1QHHD 1X19A 1ZGJA 4XQFA 4XR6A 4ZYAA 4ESJA 2LDUA 1DP3A 3A0HC 1LDKB 2F5VA 1FSEA 4RMNA 4I7HA 3FIWA 1IGNA 3CD6I 2HZDA 2XGEA 1VQ4I 2VXZA 4HRIA 1LFPA 1YJNI 1HW1A 3DQVC 4ZTJA 4Y3OA 3ZR8X 3CMEI 3SZTA 2AS5F 2ZKZA 1QVTA 1YQAA 3ABLH 3PQJA 1UMQA 2VB6A 3MAJA 4B3XA 3RZDJ 4HQEA 1Z7UA 4CICA 1Z1DA 4KICA 2RQQA 2L9VA 2DN0A 3SXYA 4ENJA 3GXOA 5IYBJ 3GFIA 3PJRA 2HR3A 4EJUA 1STZA 5FFXA 1VZ0A 1P2FA 3BR5A 2M1BA 2LG4A 4ZZLA 4C2MJ 3K70C 3ABKH 2CMPA 4BJ5C 1YTYA 2COBA 5L3FA 4I2OA 3HRSA 3DPLC 1IRXA 3ABTA 2Z3YA 3LSTA 2FU4A 1S3JA 2V26A 3GUDA 1Y1WJ 1IN7A 2DA4A 1XG1A 4RB1A 3S15J 1YW9A 1E0EA 3ABUA 1V54H 3S3OA 3GW2A 2VOOA 3HG9A 2HI3A 5CVUA 1R5GA 1HXDA 4PJLA 3ECHA 1X4PA 3BR6A 3HOYJ 3D5RC 1F5TA 2RNGA 2Y2ZA 2P5VA 3UR3C 1XB4A 1XGNA 3OWTA 5FFZA 1WZ2A 3ZP5A 1IRFA 4XL9A 4HF1A 2L0KA 1DP7P 3GVAA 4KA4A 2ICWG 4RDUA 3D1NI 4CSWA 4C9YA 2EA4A 4O6JA 3N97A 2FNAA 2GBYA 2EIMH 2JPBA 4XN0A 3BOQA 3DWLE 2X9DA 3ECOA 2PG4A 3LFKA 3WTSC 2OU2A 5LHIA 5D6FA 4BS9A 4EEFG 1H8AC 2DJNA 2LRDA 3RTRA 3PFIA 4II3A 2YX7A 5DYMA 1G4DA 3PO2J 2XAUA 2TDXA 4Q4ZF 2IRFG 1HA8A 1WJFA 4XRMA 1F36A 3VSKA 3BT9A 2HYJA 4FHTA 3VYSB 4A3LJ 4D1QA 3IUOA 2LFBA 3BCBA 2CJJA 1JXSA 5DM6F 5D4RA 2HDWA 3OYAA 1SD6A 2GM4A 4XLCA 5C4JJ 2XC7A 2X6XA 2X1CA 1Y1VJ 4YRVA 2HOTA 2QGUA 3WU0A 3MCZA 4A5NA 4IO9F 2IS1A 5CKTA 1MKMA 3S2DJ 3GTKJ 3V8JA 2JSPA 2KMUA 2ECBA 2L01A 3QOEA 1WH5A 5K5OA 2JTVA 1SD5A 3MKLA 1FMWA 1KYZA 1WGXA 4CYCA 3IHUA 5CLSA 4N4OB 5LD2C 2WAEA 3TDUC 2FBIA 1BN5A 3WU1B 4WK8F 2HVSA 3OIOA 2XF6A 1NG6A 2BVLA 5HS8A 3QAHA 3TQNA 1P6RA 3JRBA 4IOCF 5J8CA 4II2A 1P9QC 1D0ZA 3BLYA 3KYLA 4KNYA 2XKPA 3IWZA 5ED4A 5D5VB 3F8MA 4DIQA 2NYXA 1U9OA 2Z9OA 4OMZA 3OYFA 4N0BA 1XCBA 2VC0A 2RDPA 2XAFA 1P7IA 1RI7A 2P4WA 1K83J 2A05A 2NVYJ 4LG0B 4I76A 3CDIA 1P4AA 2ID3A 4MO7A 2K85A 1TQPA 2ADUA 3K70D 2XV4S 4RAGA 3A0BC 4ENNA 9ANTA 1IJWC 2QWWA 5K7ZA 5LEJA 4P96A 4EATA 1UG2A 5L3EA 1ZRDA 3KP3A 1OCZH 1LJ9A 2OQGA 1GT0C 4XIDA 2KL4A 2IS6A 4UHTA 3FM3A 3HUGB 1O57A 1FWZA 5FJ8J 4Y52J 1FJLA 4RAFA 1E3HA 3ZQIA 2GAUA 3CCMI 1S7AA 5KK1A 3VSLA 4XN3A 4YEJA 3DFGA 3S1MJ 3HIFA 4CCNA 5DD4A 3CC2I 2HQAA 4LK0F 1SFOJ 4GFBA 2VODA 5HNFA 3RI4A 4KDPA 1FYKA 5FLXZ 4WXHA 3CP8A 2FOKA 4KT5C 3T0YA 1O7LA 4GRIA 1ZG3A 1E3PA 1AKHA 4PSWA 3CJRB 2IXSA 5FD6A 1Y8RB 1XDUA 4QIWN 5IOZA 4FETA 1K61A 4AM3A 2KQRA 2XSDC 3HOTA 5LFAA 1XPXA 3FMQA 3BCAA 2K3PA 2RNJA 1N77A 1FYMA 2BXYA 3W2WA 4LIVA 4FASD 4IOAF 4PJNA 1HW2A 1JHFA 1QU3A 2JVHA 5E79C 2OV7A 4U88A 3TP3A 1MBFA 3BQZA 3PNVA 3L2VA 4UUTA 3DF8A 2E5NA 2DK5A 2OJED 2KIQA 4NC8A 2D1VA 3H9QA 4KIGA 3VB2A 4P5OA 4HLYA 4BEHA 2HZTA 3PUBA 5B5EC 2DW4A 2H09A 2X4HA 3M07A 3U2RA 5E8IA 3ZMTA 3BDDA 1SVOA 3JTHA 2DA7A 2EB7A 5KNLA 3V42A 2ZJPF 2R92J 5GTIC 1U9NA 4UV9A 3I4MJ 3AG1H 3WTVC 2VKDA 1G3YA 1K6YA 2EJRA 2XGCA 2XAJA 2LF8A 2JMWA 4LOCA 3VOEA 2OPTA 3HGGA 3HPGA 4LG3A 1ONVA 4FE7A 1HCRA 3JSPA 1SFEA 2CV2A 2W82A 5J4YA 2Y30A 2ACJA 5EJCA 4HLXA 3AKZA 4LB6B 5J1RA 3S2WA 1W4MA 2J5PA 4ETSA 3HEFA 3FXJA 2KZVA 2GXGA 3VODA 4C3IJ 1YX5A 3ML6A 2A68F 2CFOA 3I71A 3HOXJ 2STWA 5M5XJ 1ZRCA 1W36C 5LGTA 2EZKA 1NG7A 2OQRA 4YELA 5IT9K 3PO3J 1V5GA 1R22A 2KHMA 3P9KA 3OL3A 4WXDA 3TP0A 3OS2A 2Z2SB 5ERIA 4YFXF 4UB6C 4XM3A 4ZC3A 1MGTA 2VKVA 1YO5C 4IHXA 1SD7A 1U5TA 2EH3A 4DYRA 2BOLA 3HXLA 4YFKF 3SFZA 1JGSA 2VJIA 2VL8A 2A69F 2FBKA 3H5NA 3CO7C 1MBHA 4EJOA 1JT6A 1U5TC 4G6TB 2RGVA 4WWCA 4A12A 4L0ZB 2DDAA 3FK7A 4A3FJ 4XLAA 1B8IB 3J81Z 1R23A 3WGIA 3MKYB 1MH3A 2M4KA 1FOYA 1TT5B 1DU0A 4YIIA 2W84A 4LGWA 2CUZA 4NDLA 3OYDA 1HSJA 1I5ZA 4ESBA 2JA5J 1BC7C 5LRRA 2XGXA 3ESWB 4Q48A 2LSOA 2PMHA 3I54A 2JUCA 5TISC 4RBOA 1FMVA 3L7WA 2XKOA 1B4AA 2BW3B 2WV0A 2DQLA 3E5XA 1IUFA 2QM3A 3E5QA 2B7EA 1OMIA 1JTYA 3BR0A 3GO5A 4OIPF 2DYSH 2STTA 1L3LA 2VKHA 2L54A 2KT0A 4U87A 1FBQA 1BI0A 1FC3A 5EEAA 5HLGA 3S16J 2IGOA 5CPRB 3OYJA 1BR2A 1Y0UA 2CGPA 3RIRA 4BBRJ 3HGYA 3JW4A 2J5OA 1LEBA 1R5ID 4B09A 1S9HA 2VJ5A 5HLIA 3H92A 3NAUA 2ZXIA 4I99C 4JX5A 2CQ7A 1HW5A 1AWCA 4M3GA 1T08B 4M6VA 1X58A 3ZMZA 2VQGA 1A6QA 3Q5FA 5HOOA 2FF4A 4M3BA 1ETVA 2VKEA 3DBRB 2X51A 2MC3A 3RYRA 4KMFA 1UZCA 4D7NA 2K27A 2VT2A 4BJ6C 2Y69H 2UZKA 1KQ9A 4XLPF 1ETXA 2W7NA 2DU9A 3BZKA 3MKWB 3KEQA 1USTA 1JHHA 5FKLA 2DT6A 1ETQA 4A3JJ 4YIRX 3TO7A 3ROUA 1ACIA 4AU7A 3WU2C 1O7FA 3I4PA 2OA4A 1OYYA 4XLNF 1R1TA 4R79A 2LVSA 1TWHJ 2ZXJA 3C2HA 3K2AA 3SEZA 5EDNA 1XGSA 3J80K 4ZJZA 3D5LA 3J7AY 2VQLA 4BJTA 2R7ZJ 5J3LA 3ZGKA 4NHJA 5HDGA 3AFHA 1OCRH 2WAQN 3KP5A 1WVRA 5H20A 1ZLKA 3W2AA 1Z9CA 1Z3YA 2LH9A 2Q8KA 1Z3XA 4QTRA 1KONA 1VQ7I 3OSFA 3LSKA 3JCUC 1MIJA 1BI2A 2VT3A 4HF0A 2KLOA 2VBXA 2L9RA 3EYIA 2O8XA 1TW2A 1G59A 1IV8A 1DGWY 1XX5A 2QVOA 3H0DA 2HXIA 4C3HJ 3GLLA 4P9FA 4LMYA 4XBFA 3PUFA 2DMPA 3L2WA 1P4WA 2A6TA 3HKZN 3U21A 3CC4I 2Y0SN 3IKVA 3RKWA 1MNDA 3CP2A 4B8XA 3CCSI 2GA1A 4PCQA 2M8EA 4A3BJ 1D3YA 4D7MA 5TGTA 3OYCA 4AWXB 1MSEC 2M2EA 2R7DA 3VYTB 3BR1A 5K7HA 3CDHA 4WCGA 1APLC 2E34A 1Z0XA 5D5XB 2EIJH 3KPHA 1TQIA 3LA3A 5IYCJ 1LB2A 2QZ8A 3DTEA 4XRFA 1TC3C 4DQ2A 4QSHA 4EVIA 1LEAA 3DU6A 3C7JA 2VONA 1ERDA 1OR7A 1QPMA 1KU9A 3PIPF 1U8RA 3O6BB 4F7ZA 1QRYA 2O8KA 5JHUA 4LLNA 1D8KA 2X1EA 2IT0A 2HWVA 3LAPA 2R7OA 4CZZA 1KQ0A 2ZNZA 3F21A 4E7HA 1WFXA 2ESHA 1Z91A 3LFUA 3B02A 3N4MA 1JKRC 1RR8C 3KETA 2HQRA 1JE8A 1ZYRF 1FYLA 1TW3A 3LSHA 3S2HJ 2QCOA 4Y4RA 2F4MB 2UV1A 2LY9A 4IPAA 1I3AA 1DGRM 3T1BA 3G1MA 3K1NA 4Z6YA 4Z2YA 3SHFA 3M8EA 1SAUA 2KZGA 1QZYA 1EH8A 5TRDA 3P5JA 3KP7A 1Y8QB 1RUNA 5D8LB 4L5JA 2BEOA 1X4OA 3GX4X 2DA1A 4HNVA 2E36A 2BY0A 4A6DA 1UAAA 2QKMB 4LB5A 2UXNA 3MQ0A 4XORA 5LHGA 2E7XA 1NHAA 5AIQA 1JJ6C 3K4NA 5L3DA 4C2TA 5IY5H 1J5YA 5JI6A 1A5JA 4IKFA 3J80Z 2WAQA 2Y0MA 2PI0A 2V1UA 2NAZA 3A03A 4M74A 4RB0A 2CU7A 1R1UA 2DBBA 2V79A 2AXLA 2ZJQF 1ZGAA 5F1JA 2ZJRF 1QZEA 1W7PA 3J7ZI 1SMTA 5EYRA 3C1DA 1GV5A 1K78B 4RGUA 3TO9A 2K7LA 2IVMA 3BTLA 4I01A 4MIMA 1JKOC 1DPRA 3CZ6A 5GAGJ 4KITB 1WKMA 4RB2C 1CGPA 3WHCA 4FT8A 5H6RA 2ESNA 3R61A 4CA0A 3F8NA 1J59A 1W7PD 4EM1A 1B72B 2V6CA 1XS9A 4ZYEA 3L09A 1R9TJ 3AL0C 5LRSA 3P9IA 4BQQA 3SJMA 4GDFA 1IDZA 3LSMA 2IBDA 3A2KA 2XVCA 2L02A 4NUBA 1LDDA 3HL2A 4E7LA 1D5YA 1W5CC 1MJBA 5FB2A 2PMUA 1NK2P 2UXXA 4P55A 1V3FA 2NVQJ 1WH7A 2Y48A 3I53A 3AG4H 3B73A 4CDGA 1XMXA 2X1DA 4S05A 2DPDA 2MG4A 3LSRA 2GOXB 5KAIC 5K7FA 4H0EA 3HOUJ 1YIOA 2ZSIB 1J09A 2JRMA 1FIAA 3CCVI 2W57A 3CMYA 1YS7A 3ZMUA 4AD9A 5H2FC 2IGMA 3K9TA 4A5MA 2VE9A 2CUFA 3JRCA 1I39A 2P7CB 2MFZA 2XAHA 4OINF 4L18B 1NH3A 2RQPA 1FOKA 2HTSA 4DZPA 2HQ5A 3OYEA 1HKQA 2O3FA 3SDGA 2MW8A 4FQGA 4Y33A 5E3NA 2DMNA 4V2GA 1F1ZA 5F27A 1G8XA 4H4KC 2XROA 3ASOH 3H0GJ 3BJOA 4IEJA 1FTZA 2XPWA 2F48A 3BROA 4BL0B 3G71I 2OCCH 4XONA 3TDZC 3GYHX 3O3KA 4G6QA 1VQ9I 4FX0A 2GZWA 2W1OA 4KIFA 2PFBA 4EGYA 5C3EJ 4BU2A 2KJCA 2R3SA 3HHGA 3BR3A 2OZ6A 1UHMA 4XRSA 3VDXA 2OF7A 2XSJC 3HM5A 4HDVA 1GHCA 1TWGJ 1IN8A 4G9YA 4WXCA 5DV5A 1KU2A 3H5RA 5HS9A 3QYBA 4HYEA 1R1VA 1XMAA 2MLKA 2OBPA 1I1GA 3ELKA 4IHTA 2K9QA 3RQ4A 4LFUA 1KGSA 1MDMB 4L9TA 1G3TA 2V6EA 2R7TA 4OMYA 2WAFA 3BG5A 5E17F 5GPAA 4RAZA 2DMQA 1POGA 3I59B 5ILVA 5DM7F 1GXQA 4BHPA 5B66C 1DU6A 3MVPA 4DGWB 4A0YA 1ON1A 3CCJI 5GADJ 3H36A 1VQKI 5JLXA 3WG7H 2LLKA 4ASNA 2QKLB 4K2EA 4MNUA 3KEOA 3GTLJ 1Q1HA 2P0WA 1AOYA 1MH4A 1XTAA 4M6XA 2EK5A 4XLEA 1H9GA 3TW7A 3CCUI 3IWFA 2JT1A 2OTLI 2Y9ZA 2E71A 3D5SC 3S17J 5E1WA 5F0CA 3AL0B 1BJAA 1SD4A 1K6OA 3M1EA 1JJ8C 2K9MA 5DEQA 1LPQA 2WTEA 2JRTA 2MABA 1BIAA 2FE3A 2YSRA 4MQVA 4RGSA 1E17A 1GV2A 2ISYA 3DBHB 4XKWA 1J7KA 4MLOA 1WPKA 4A0XA 5GPCA 1IXRC 3F8BA 3ZN0A 4E7SA 1ZREA 4X1EA 1UHSA 3O8GA 1GUUA 3GMEA 2NVXJ 1IAWA 1EKEA 1LFBA 2FSWA 3JRGA 2JZYA 1OISA 1ITYA 2DFIA 1VQPI 1MZBA 1R6RA 2CQXA 5CVRA 3W3CA 5L3BA 2CV1A 1VNDA 2DMUA 2VIXA 1OCOH 4KFCA 4N9IA 1Z7LA 1IN4A 3T8TA 3CTAA 4M73A 1FEXA 2IP2A 2JA7J 3K4JA 1WJAA 4A3KJ 1YOVB 3E6BA 5M5WJ 1G6NA 1S6LA 4BE1A 4EM2A 5F1RA 1DDNA 2DXIA 1BI3A 3I64A 3K1PA 5DUKA 5JVTA 2D45A 3ZQGA 1JI8A 2RVCA 5B1BH 3R60A 1HC8A 3GFLA 2XAGA 3TBIA 3D0SA 3SZPA 3BZCA 3HDDA 3KLNA 2IEKA 1X1CA 4XKCA 2DT5A 4E7ZA 2KDZA 1N75A 1U8BA 5FROA 4CGZA 5GTHC 3HOWJ 3OR2C 3BG3A 1YRNB 1OR7C 4JX4A 4R1HA 2K02A 2DOAA 3QQAA 1Q1VA 2CW7A 4GGGA 2BY3A 4MEXF 3ZQFA 2IA1A 1N25A 1UFMA 1ZG5A 1J0RA 2EZHA 1E3OC 1MBGA 4Q47A 2ECCA 4BDYA 2O0YA 3F8FA 1E2XA 1S8NA 2P8TA 3I58A 2QBYB 1MBEA 3S32A 3QU3A 2G0EA 4IRHA 2H27A 2LOOA 1V5FA 1MMAA 3P7NA 1P4XA 4A0ZA 3FX3A 1QZZA 1GLNA 2QQBA 2X85A 3BG6A 3HB9A 1DUXC 3AG3H 1Y39A 1EH6A 5D4SA 3OIPA 4NNJA 4UUSA 4BHBA 4XSXF 2HS5A 2HOSA 1TWFJ 2R7WA 1Z77A 1BC8C 5J40A 3K4LA 2HQNA 2EILH 1T95A 2HVRA 2A5YB 2L7MP 3GFJA 3H9GA 5M5YJ 1ZQ3P 3A01A 4BQNA 1T6SA 2BXZA 2LD5A 2E2IJ 2VBZA 2KRFA 3B6CA 3OYNA 1Y6IA 3S3NA 3KCCA 1I50J 4HBLA 2IGNA 5EZHA 4RB3C 2CSOA 2BY1A 4ZYHA 1UCRA 1T56A 3U1DA 1S5LC 4WX9A 1ETYA 1Z21A 2B0LA 2FA5A 3NQOA 3WE2A 1TNTA 2F6CA 2HXOA 2H6BA 3KYCB 3HRMA 1W1WE 4BNCA 3BQYA 4ENMA 3BY6A 3A1YA 5LGNA 1PUEE 1SC7A 1VI0A 1YIJI 1T39A 4BE2A 2XIGA 3H3UA 2EIKH 2L4MA 2Y9YA 4HG2A 2R7UA 4MEYF 1FIPA 1ZR4A 3DPTA 1JGGA 1QQIA 1RNLA 2EPFA 3NRVA 2R7RA 3COAC 5HDKA 1ZN2A 4CCOA 1EJ9A 1PUFB 2M7AA 3C2GA 1MSFC 1D0XA 4YG2F 2LKPA 2XB0X 4XOPA 2P6SA 3QYFA 3REOA 1JUPA 2K9LA 4PGHA 4KISA 3JRAA 3M4OJ 2PJRB 4F3QA 1USSA 2BHYA 2ZFUA 2BYVE 3QU6A 2E1MB 5F04A 3V4GA 4L9JA 2CQQA 2QSFX 3S93A 3DU5A 3MZYA 1TTYA 4CH7A 2EFQA 4UB8C 3K4KA 4B4CA 4MTDA 2FD5A 4L9VA 1LVKA 1TWAJ 5E20A 4UVCA 4FTHA 3HOSA 3ERMA 1ZG1A 2IPQX 1PJRA 2DA2A 2VXDA 3O2PE 2MC4A 2K3FA 3RKYA 1ZLJA 3L00A 3PM1A 4GYIA 3Q9VA 2DQRA 2FQ4A 1KU3A 2O9LA 4I98B 5E8GA 3DTIA 2VQHA 4Y15A 1U78A 2DODA 2YS9A 3I9V2 3PSFA 2MGQA 3R4KA 1VQNI 3CCLI 1BBYA 4U7DA 4A3GJ 5DS9A 4M71A 2P81A 1FP2A 5E3OA 1D8JA 2OZUA 1PUFA 3JREA 1QO0D 4JX6A 1UG0A 1O3SA 2CRGA 2P6TA 5CYVA 5FKKA 3L1PA 3DXJF 4HNUA 1VTNC 3QODA 2W48A 3SFIA 2ZXHA 1JKPC 4ZTFA 3HTUA 3QRFF 3OYBA 2WY8Q 5FKOA 4U7BA 3DV8A 3JSOA 1RKWA 1TT0A 3HUGA 4UNOA 1UJ8A 3W6KB 2FX0A 2K4BA 2KISA 4ZDPA 3ZQHA 4IZZA 1ZRFA 1YG2A 5CQGA 1OCCH 4XNFA 4IRGA 2EFOA 1B72A 1YI2I 2Z16A 2JA2A 5CQEA 3FMRA 3Q0UA 2LTPA 1IZ1A 2E5ZA 3FM5A 2HDCA 3GTPJ 4V2FA 4MFEA 1FTTA 4J01A 1FT9A 3E1SA 5JLWA 3RJPA 4HQMA 3DCFA 1MNEA 1RIOH 3N05A 3DKXA 4WF2A 4CZCA 2X6OA 1B6AA 3V7RA 1BW5A 4CCLA 4IHYA 4HSRA 1LVAA 2KJBA 1U5TB 1WHUA 4BQOA 5KVRA 3EPZA 3KP6A 3U1KA 5L3GA 5GAHJ 4PJMA 1IN5A 5FKNA 3SDBA 5ICCA 1OJLA 2DA5A 1T8IA 2PMZA 4BH9A 1WJCA 1ZGWA 4E4HA 3FF5A 2CW0F 2QF7A 2CQNA 1WJDA 4BEHB 2X6YA 3CUOA 3I5UA 2DFEA 3H5AA 4XK4A 1VQ8I 2QYOA 2KP6A 2KPMA 2FBHA 1A35A 1FOXA 1X2MA 2WY7Q 2ZSHB 3RPQA 3OV8A 3DEEA 5LGUA 4NQWB 1XD7A 4X6AJ 1U0JA 1WJBA 2LNBA 3OYIA 4I0AA 3ZQLA 3QPTA 4ZZDA 2EV0A 4LG0A 4EV0A 2VC1A 3LSGA 5DCMA 2Q2EA 5EEGA 1FBUA 1OYWA 3MWMA 4M6YA 3NARA 5LEKA 3LL7A 1LDJA 1IF1A 1I6HJ 1JUSA 3B6AA 3SQNA 3PFYA 4YIFA 1V55H 2W85A 1QHGA 3VEPA 2V7FA 3RYPA 5EG0B 4B47A 3TL4X 3HRTA 3W6JB 4BXFA 4X0GA 1TP4A 2AQFA 2COMA 2FUG2 2K9NA 2XASA 3ZMSA 2IW5A 3CUQA 2EFNA 1BI1A 4LD5A 2VJJA 3VFZA 1R7JA 4CCMA 4IHSA 2V1NA 2DO7A 2E35A 1MD0A 2V1DA 3TKYA 5H6QA 5EEHA 2ZMEA 5CVIA 3HOVJ 2CUEA 3DKWA 1EF4A 1PP8F 4EQQA 1LE8B 2UWMA 4HNTA 3VYUB 2XB5A 4UY8I 4G8XA 2W24A 4PJ0C 1Z05A 4JK1X 2Y31A 2ZFWA 4IJAA 1AU7A 1A36A 2W25A 2H8RA 3C18A 1IO2A 2VPLA 2RV8A 1PVEA 2EV5A 2CH0A 2VJ4A 3SYTA 3ZRGA 4ITVA 4A3DJ 3C3WA 2ZC2A 2YU3A 2L4AA 4HPQA 3GEZA 5F0FA 2H6CA 3BC8A 3T5XA 5EGOB 4EJVA 3BJ6A 1WI3A 3BR2A 3K4MA 5FD5A 2B63J 5ILSA 2O61A 5J1UA 2Z33A 2XPVA 3BTJA 2LY2A 2CWEA 4GO1A 3IKTA 2O5RA 2KIFA 3IC7A 5J1YA 2D1HA 1KYWA 5M3FJ 2PJRA 2LK2A 2XDVA 1WCMJ 3BG9A 2YPRA 4ZYGA 3FDYA 1TLHB 1U2WA 4UXNA 5CJ9A 5D5UB 4R8HA 1T33A 2A07F 2O03A 4IXAA 4KMUX 2ZMEB 4PFPA 4L9NA 1TL8A 2FOWA 2NOGA 1LNWA 3HHHA 4BDZA 2QQ9A 3CJTB 1UELB 2QLZA 5CVJA 3BWGA 1FY7A 2P5KA 1FX7A 1W7PB 4PDKA 1WSUA 1O3RA 2LBFA 4BXXJ 1OYIA 4M9ZA 1PDNC 3DLLF 4J19A 1IC8A 4A3IJ 3ERED 3ZN1A 5DCMB 2PLYA 2M4GA 3CCYA 3HPHA 4OAZA 1KZHA 2ZCWA 3HOZJ 4AYBN 2TRTA 3HSEA 2GIVA 3KIOA 1OKRA 2QQAA 4QPOA 1IN6A 1IDYA 3RDIA 4HF2A 3RCOA 3MEXA 1H88C 1X1AA 3H1CA 1TZLA 2DT7B 1JTXA 1OCPA 3DLAA 2P5LC 2DCEA 3KYDB 3NEUA 3L2QA 3QP5A 1J75A 1YRNA 2ELJA 2EWNA 5F08A 4B1RA 2NRAC 3WG9A 2ZNYA 3OSGA 4JOMA 5EG0A 2DK8A 4RM3A 5TJJA 1ETWA 3IRQA 3FISA 2L7KA 4BBSJ 1W5TA 4DNCA 1HBXG 2DLLA 3JRDA 3CCQI 2JA6J 3FXQA 4PJJA 3K10A 1RRJA 2H1LA 2E1CA 1MMGA 5HODA 1Z6RA 3IH4A 1YE9A 3LMMA 1VQLI 1MBJA 2JSCA 3J81K 4C2UA 1QA6A 1YS6A 3LSIA 5HLHA 3TEDA 1HKTA 1S7OA 1R58A 4E7IA 3HSRA 5AONA 4LJZF 2VUMJ 5DD8A 2E1MC 1UHWA 2V9PA 3MZ8A 4B3AA 1X2NA 2HVQA 4EJWA 3WTTC 4BGDA 4J00A 2B9SA 2V1XA 3IH3A 3CCRI 5F0HA 2EFWA 2ISZA 5J4VA 1GVDA 1D1AA 3EDPA 3E6MA 2LYCA 4XKVA 5GP9A 2ID6A 5FLMJ 3IRRA 4IF4A 4TV7A 1SEUA 3S14J 1IXCA 3M9AA 3LOCA 5FGMA 4I02A 2ZXWH 3DBLB 3OOPA 1D5VA 2ZJ2A 2DYRH 3KLOA 3H3ZA 2PJPA 1A04A 4PGGA 4PFOA 3KP4A 1XGOA 1HQCA 1I27A 2Q0OA 3Q3SA 1O3QA 4E7KA 3EUAA 1V5EA 2DFFA 1CF7A 5HDNA 4CCJA 4LK1F 4A3CJ 2CFXA 1K4SA 2H8WA 4FE4A 2GOMA 3S3MA 2IA2A 1XSDA 3I4NJ 1IW7F 1YITI 3L2UA 3VWBA 2MD0A 3BP8A 4CYCB 4IHVA 4UVAA 3ZXSA 5D6EA 2F5FA 4M9SA
chains in the Genus database with same CATH topology
5DTDA 3HOWJ 2R5YB 3JR9A 3BG3A 1YRNB 3OOUA 4JX4A 4FISA 4JP0A 3MN2A 3G1OA 3QQAA 1Q1VA 3ZQFA 1MBHA 3GTGJ 1JT6A 2EZHA 1E3OC 1MBGA 2ECCA 2I10A 5IP7J 3FK7A 2EZLA 2X48A 4A3FJ 4FCYA 1B8IB 2DA3A 1BW6A 1MBEA 1MH3A 1CQTA 2G0EA 1DU0A 1ETKA 4NDLA 3GTJJ 4M3FA 2VPRA 3Q0VA 3HB9A 1B8IA 2JA5J 4DW6A 1A6IA 2WB1N 1RPWA 3UKGA 2JA8J 4UUSA 4A3MJ 4RBOA 4M3DA 4IHWA 2HOSA 3Q0WA 1TWFJ 2YU9J 1Z77A 1IUFA 2L7MP 5M5YJ 1JTYA 3BR0A 4UUSB 1ZQ3P 4M3EA 3A01A 2E2IJ 3JRFA 2LD5A 3B6CA 5EZHA 1I50J 2KT0A 2E2HJ 5EEAA 4G12A 2R93J 1ENHA 3S16J 2FJ1A 4XICA 1W0UA 1T56A 1IV6A 5M3MJ 2R5YA 1ETYA 4BBRJ 1RKTA 3HGYA 3ZOBA 1BA5A 1VF9A 1OCTC 2HXOA 3BTCA 3NAUA 4XRSG 3BQYA 5IP9J 3GBGA 4JX5A 5E3MA 4M3GA 1OFCX 1VI0A 1AKHB 1S7EA 4M6VA 1X58A 2Y9YA 3QPLA 1FIPA 4DYRA 1ZR4A 4M3BA 1NTCA 1JGGA 1ETVA 2VKEA 4I6ZA 3JRHA 1G2HA 3HBLA 5IOYA 1PUFB 1BJZA 4D7NA 1ZR2A 4D5CA 3O8HA 1ETXA 1ZKGA 1MSFC 4S0HB 2JK3A 3W6VA 2K9SA 2XB0X 5FKLA 1JUPA 1ETQA 4A3JJ 3JRAA 3M4OJ 2TCTA 2LP0A 2D5VA 2HDDA 2LVSA 1TWHJ 3K2AA 2NS7A 5EDNA 2ME0A 5F04A 3QPSA 2CQQA 2R7ZJ 5J3LA 2WAQN 4B4CA 2FD5A 3K7AJ 3ZQCA 4QTRA 1JUMA 1TWAJ 2LR8A 4FTHA 3VPRA 1I3QJ 3OSFA 3DEWA 3JRIA 4BY1J 3CQZJ 3F0CA 3WHBA 2DA2A 2XPUA 2AHQA 2JWTA 3GTQJ 3PM1A 2L9RA 4A69C 2FQ4A 2O9LA 1AHDP 1H89C 1RR7A 3IH2A 2HXIA 1U78A 3S1NJ 2YS9A 4C3HJ 4BY7J 2MGQA 2DMPA 4A3GJ 5DS9A 2K40A 1ZK8A 1LFUP 2P81A 4L5EA 3RZOJ 5E3OA 3HKZN 2ZB9A 1PUFA 3JREA 4JX6A 1NK3P 2CRGA 2Y0SN 5FKKA 2NS8A 3L1PA 2DA6A 2W48A 3SFIA 1JKPC 4A3BJ 3CDLA 1IG7A 4D7MA 3FIWA 1IGNA 1MSEC 2XGEA 5IP6A 2M2EA 3BR1A 5K7HA 5FKOA 3S1QJ 1APLC 1Z0XA 1RKWA 2FX0A 3ZQHA 5IYCJ 1TC3C 1QVTA 4QSHA 1UMQA 3FKIJ 3RZDJ 2JN6A 1B72A 1ZTRA 3Q0UA 2LTPA 4DYQA 2DN0A 3GTPJ 4V2FA 4MFEA 1FTTA 1QRYA 5IYBJ 2O8KA 5JLWA 3DCFA 2X6OA 1BW5A 2E2JJ 4IHYA 1RETA 3BR5A 1MNMC 4C2MJ 4W97A 2COBA 1JKRC 4Y7NJ 1QVUA 5FKNA 3S2HJ 2QCOA 5IYDJ 1Y1WJ 1OJLA 2DA5A 2DA4A 1XG1A 2LY9A 2H1KA 1ZGWA 3S15J 1SANA 3G1MA 2QF7A 2HI3A 4AC0A 1HF0A 4XK4A 4ABZA 5BNGA 3BR6A 3HOYJ 3M3YJ 2Y2ZA 1X2MA 2WV1A 2M34A 2DA1A 4HNVA 2NVTJ 4BKXA 5C44J 4X6AJ 3S1RJ 2L0KA 1JJ6C 2E1OA 2O7OA 3BTIA 3ZQLA 1A5JA 4RDUA 3D1NI 3LSGA 2DTZA 3NARA 2GBYA 1MBKA 4MFDA 3A03A 1I6HJ 2CU7A 1JUSA 5EF6A 3B6AA 2X9DA 4W1UA 5F1JA 5EYRA 4EEFG 1GV5A 1H8AC 2DJNA 1RESA 3BTLA 4MIMA 1JKOC 3PO2J 2RAEA 3IV5A 5EG0B 3GTOJ 5FLVA 4XRMA 1ORKA 3WHCA 1F36A 2GLOA 3BT9A 2DMTA 2HYJA 1B72B 4A3LJ 1XS9A 2K9NA 1O4XA 2LFBA 2CJJA 1R9TJ 2YUSA 4DYCA 2GM4A 5C4JJ 3SJMA 1IDZA 2IBDA 1Y1VJ 2HOTA 3A02A 1D5YA 3HOVJ 2CUEA 3S2DJ 1EF4A 3GTKJ 1LE8B 1XC5A 3RKQA 1NK2P 2NVQJ 2ECBA 1WH5A 1WH7A 2XB5A 3MKLA 2ELKA 1WGXA 4CYCA 5FKMA 3GTMJ 2AO9A 2M9HA 2Y31A 1AU7A 1W0TA 2MG4A 1LE8A 2H8RA 3LSRA 5K7FA 3OIOA 3HOUJ 2XRLA 1FIAA 4A3DJ 3JRBA 3CMYA 3E7LA 1BL0A 1HDDC 2CUFA 5F0FA 2M0CA 3JRCA 3H3VK 5EGOB 4C3JJ 1JT0A 1U9OA 1WI3A 3BR2A 2B63J 1P7IA 2HQ5A 5J1UA 4DZPA 5IPAA 1K83J 2R0QC 2XPVA 3BTJA 3SDGA 2EQRA 2NVYJ 2MW8A 4I76A 5E3NA 2DMNA 4V2GA 5J1YA 5F27A 5M3FJ 1QPIA 2ID3A 2LK2A 4MO7A 1WCMJ 3BG9A 3H0GJ 4IEJA 1FTZA 2XPWA 9ANTA 4DZJA 1IJWC 5K7ZA 1UG2A 1T33A 5C3EJ 1VFCA 2NOGA 1GT0C 4XIDA 3BR3A 2R5ZA 4XRSA 5FJ8J 2OF7A 1FJLA 3HM5A 4Y52J 3ZQIA 1TWGJ 2EZIA 3LNQA 2XGDA 1ETOA 3S1MJ 5C4XJ 3RQIA 4A3EJ 2K9QA 1SFOJ 4BXXJ 4GFBA 4J19A 1F43A 1IC8A 4A3IJ 5E3LA 3BG5A 2N8GA 5GPAA 3CCYA 3HOZJ 4AYBN 1AKHA 2TRTA 2DMQA 1POGA 4JYKA 1DU6A 1P7JA 3MVPA 5IOZA 1K61A 4QIWN 1IDYA 1H88C 2XSDC 2PMZN 5JLXA 1JTXA 1OCPA 3LSPA 1YRNA 2LLKA 5F08A 4B1RA 3GTLJ 3OSGA 4AUXA 2HOAA 5EG0A 3TP3A 1MH4A 1ETWA 1MBFA 3BQZA 2LKXA 3FISA 4UUTA 4BBSJ 3JRDA 2JA6J 2VI6A 3TW7A 5HODA 2Y9ZA 1TWCJ 3IH4A 1MBJA 4D5FA 3TEDA 3S17J 5F0CA 2JJ7A 1IRZA 1JJ8C 3G1LA 3LSJA 2R5ZB 5EZGA 1HDPA 2VUMJ 3C2BA 2MSYA 2R92J 2DA7A 4B3AA 1X2NA 1GV2A 3A01B 1U9NA 4A93J 3IH3A 3TW6A 3I4MJ 5F0HA 4MLOA 1WPKA 5GPCA 1GVDA 4X1EA 1UHSA 2XGCA 4LOCA 3O8GA 1GUUA 2JMWA 2ID6A 3FK6A 2OPTA 3HGGA 2E19A 5GP9A 5FLMJ 1GDTA 2NVXJ 3JRGA 1LFBA 1ITYA 4FE7A 1HCRA 3S14J 2CQXA 3LOCA 1VNDA 2Y30A 2DMUA 2EBIA 1FEXA 5J1RA 2JA7J 3HEFA 1JKQC 4A3KJ 4C3IJ 5EGOA 5M5WJ 3Q3SA 3HOXJ 5M5XJ 2L7ZA 1HLVA 2EZKA 3ZQGA 3PO3J 4A3CJ 3TP0A 4FE4A 2IAIA 3I4NJ 1HOMA 2L7FP 3HDDA 4IHVA 4CYCB 2IEKA 2KDZA 1U8BA 2ME6A 2VKVA 4IHXA 2EH3A 2M8GX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DTD A;  3HOW J;  2R5Y B;  3JR9 A;  3BG3 A;  1YRN B;  3OOU A;  4JX4 A;  4FIS A;  4JP0 A;  3MN2 A;  3G1O A;  3QQA A;  1Q1V A;  3ZQF A;  1MBH A;  3GTG J;  1JT6 A;  2EZH A;  1E3O C;  1MBG A;  2ECC A;  2I10 A;  5IP7 J;  3FK7 A;  2EZL A;  2X48 A;  4A3F J;  4FCY A;  1B8I B;  2DA3 A;  1BW6 A;  1MBE A;  1MH3 A;  1CQT A;  2G0E A;  1DU0 A;  1ETK A;  4NDL A;  3GTJ J;  4M3F A;  2VPR A;  3Q0V A;  3HB9 A;  1B8I A;  2JA5 J;  4DW6 A;  1A6I A;  2WB1 N;  1RPW A;  3UKG A;  2JA8 J;  4UUS A;  4A3M J;  4RBO A;  4M3D A;  4IHW A;  2HOS A;  3Q0W A;  1TWF J;  2YU9 J;  1Z77 A;  1IUF A;  2L7M P;  5M5Y J;  1JTY A;  3BR0 A;  4UUS B;  1ZQ3 P;  4M3E A;  3A01 A;  2E2I J;  3JRF A;  2LD5 A;  3B6C A;  5EZH A;  1I50 J;  2KT0 A;  2E2H J;  5EEA A;  4G12 A;  2R93 J;  1ENH A;  3S16 J;  2FJ1 A;  4XIC A;  1W0U A;  1T56 A;  1IV6 A;  5M3M J;  2R5Y A;  1ETY A;  4BBR J;  1RKT A;  3HGY A;  3ZOB A;  1BA5 A;  1VF9 A;  1OCT C;  2HXO A;  3BTC A;  3NAU A;  4XRS G;  3BQY A;  5IP9 J;  3GBG A;  4JX5 A;  5E3M A;  4M3G A;  1OFC X;  1VI0 A;  1AKH B;  1S7E A;  4M6V A;  1X58 A;  2Y9Y A;  3QPL A;  1FIP A;  4DYR A;  1ZR4 A;  4M3B A;  1NTC A;  1JGG A;  1ETV A;  2VKE A;  4I6Z A;  3JRH A;  1G2H A;  3HBL A;  5IOY A;  1PUF B;  1BJZ A;  4D7N A;  1ZR2 A;  4D5C A;  3O8H A;  1ETX A;  1ZKG A;  1MSF C;  4S0H B;  2JK3 A;  3W6V A;  2K9S A;  2XB0 X;  5FKL A;  1JUP A;  1ETQ A;  4A3J J;  3JRA A;  3M4O J;  2TCT A;  2LP0 A;  2D5V A;  2HDD A;  2LVS A;  1TWH J;  3K2A A;  2NS7 A;  5EDN A;  2ME0 A;  5F04 A;  3QPS A;  2CQQ A;  2R7Z J;  5J3L A;  2WAQ N;  4B4C A;  2FD5 A;  3K7A J;  3ZQC A;  4QTR A;  1JUM A;  1TWA J;  2LR8 A;  4FTH A;  3VPR A;  1I3Q J;  3OSF A;  3DEW A;  3JRI A;  4BY1 J;  3CQZ J;  3F0C A;  3WHB A;  2DA2 A;  2XPU A;  2AHQ A;  2JWT A;  3GTQ J;  3PM1 A;  2L9R A;  4A69 C;  2FQ4 A;  2O9L A;  1AHD P;  1H89 C;  1RR7 A;  3IH2 A;  2HXI A;  1U78 A;  3S1N J;  2YS9 A;  4C3H J;  4BY7 J;  2MGQ A;  2DMP A;  4A3G J;  5DS9 A;  2K40 A;  1ZK8 A;  1LFU P;  2P81 A;  4L5E A;  3RZO J;  5E3O A;  3HKZ N;  2ZB9 A;  1PUF A;  3JRE A;  4JX6 A;  1NK3 P;  2CRG A;  2Y0S N;  5FKK A;  2NS8 A;  3L1P A;  2DA6 A;  2W48 A;  3SFI A;  1JKP C;  4A3B J;  3CDL A;  1IG7 A;  4D7M A;  3FIW A;  1IGN A;  1MSE C;  2XGE A;  5IP6 A;  2M2E A;  3BR1 A;  5K7H A;  5FKO A;  3S1Q J;  1APL C;  1Z0X A;  1RKW A;  2FX0 A;  3ZQH A;  5IYC J;  1TC3 C;  1QVT A;  4QSH A;  1UMQ A;  3FKI J;  3RZD J;  2JN6 A;  1B72 A;  1ZTR A;  3Q0U A;  2LTP A;  4DYQ A;  2DN0 A;  3GTP J;  4V2F A;  4MFE A;  1FTT A;  1QRY A;  5IYB J;  2O8K A;  5JLW A;  3DCF A;  2X6O A;  1BW5 A;  2E2J J;  4IHY A;  1RET A;  3BR5 A;  1MNM C;  4C2M J;  4W97 A;  2COB A;  1JKR C;  4Y7N J;  1QVU A;  5FKN A;  3S2H J;  2QCO A;  5IYD J;  1Y1W J;  1OJL A;  2DA5 A;  2DA4 A;  1XG1 A;  2LY9 A;  2H1K A;  1ZGW A;  3S15 J;  1SAN A;  3G1M A;  2QF7 A;  2HI3 A;  4AC0 A;  1HF0 A;  4XK4 A;  4ABZ A;  5BNG A;  3BR6 A;  3HOY J;  3M3Y J;  2Y2Z A;  1X2M A;  2WV1 A;  2M34 A;  2DA1 A;  4HNV A;  2NVT J;  4BKX A;  5C44 J;  4X6A J;  3S1R J;  2L0K A;  1JJ6 C;  2E1O A;  2O7O A;  3BTI A;  3ZQL A;  1A5J A;  4RDU A;  3D1N I;  3LSG A;  2DTZ A;  3NAR A;  2GBY A;  1MBK A;  4MFD A;  3A03 A;  1I6H J;  2CU7 A;  1JUS A;  5EF6 A;  3B6A A;  2X9D A;  4W1U A;  5F1J A;  5EYR A;  4EEF G;  1GV5 A;  1H8A C;  2DJN A;  1RES A;  3BTL A;  4MIM A;  1JKO C;  3PO2 J;  2RAE A;  3IV5 A;  5EG0 B;  3GTO J;  5FLV A;  4XRM A;  1ORK A;  3WHC A;  1F36 A;  2GLO A;  3BT9 A;  2DMT A;  2HYJ A;  1B72 B;  4A3L J;  1XS9 A;  2K9N A;  1O4X A;  2LFB A;  2CJJ A;  1R9T J;  2YUS A;  4DYC A;  2GM4 A;  5C4J J;  3SJM A;  1IDZ A;  2IBD A;  1Y1V J;  2HOT A;  3A02 A;  1D5Y A;  3HOV J;  2CUE A;  3S2D J;  1EF4 A;  3GTK J;  1LE8 B;  1XC5 A;  3RKQ A;  1NK2 P;  2NVQ J;  2ECB A;  1WH5 A;  1WH7 A;  2XB5 A;  3MKL A;  2ELK A;  1WGX A;  4CYC A;  5FKM A;  3GTM J;  2AO9 A;  2M9H A;  2Y31 A;  1AU7 A;  1W0T A;  2MG4 A;  1LE8 A;  2H8R A;  3LSR A;  5K7F A;  3OIO A;  3HOU J;  2XRL A;  1FIA A;  4A3D J;  3JRB A;  3CMY A;  3E7L A;  1BL0 A;  1HDD C;  2CUF A;  5F0F A;  2M0C A;  3JRC A;  3H3V K;  5EGO B;  4C3J J;  1JT0 A;  1U9O A;  1WI3 A;  3BR2 A;  2B63 J;  1P7I A;  2HQ5 A;  5J1U A;  4DZP A;  5IPA A;  1K83 J;  2R0Q C;  2XPV A;  3BTJ A;  3SDG A;  2EQR A;  2NVY J;  2MW8 A;  4I76 A;  5E3N A;  2DMN A;  4V2G A;  5J1Y A;  5F27 A;  5M3F J;  1QPI A;  2ID3 A;  2LK2 A;  4MO7 A;  1WCM J;  3BG9 A;  3H0G J;  4IEJ A;  1FTZ A;  2XPW A;  9ANT A;  4DZJ A;  1IJW C;  5K7Z A;  1UG2 A;  1T33 A;  5C3E J;  1VFC A;  2NOG A;  1GT0 C;  4XID A;  3BR3 A;  2R5Z A;  4XRS A;  5FJ8 J;  2OF7 A;  1FJL A;  3HM5 A;  4Y52 J;  3ZQI A;  1TWG J;  2EZI A;  3LNQ A;  2XGD A;  1ETO A;  3S1M J;  5C4X J;  3RQI A;  4A3E J;  2K9Q A;  1SFO J;  4BXX J;  4GFB A;  4J19 A;  1F43 A;  1IC8 A;  4A3I J;  5E3L A;  3BG5 A;  2N8G A;  5GPA A;  3CCY A;  3HOZ J;  4AYB N;  1AKH A;  2TRT A;  2DMQ A;  1POG A;  4JYK A;  1DU6 A;  1P7J A;  3MVP A;  5IOZ A;  1K61 A;  4QIW N;  1IDY A;  1H88 C;  2XSD C;  2PMZ N;  5JLX A;  1JTX A;  1OCP A;  3LSP A;  1YRN A;  2LLK A;  5F08 A;  4B1R A;  3GTL J;  3OSG A;  4AUX A;  2HOA A;  5EG0 A;  3TP3 A;  1MH4 A;  1ETW A;  1MBF A;  3BQZ A;  2LKX A;  3FIS A;  4UUT A;  4BBS J;  3JRD A;  2JA6 J;  2VI6 A;  3TW7 A;  5HOD A;  2Y9Z A;  1TWC J;  3IH4 A;  1MBJ A;  4D5F A;  3TED A;  3S17 J;  5F0C A;  2JJ7 A;  1IRZ A;  1JJ8 C;  3G1L A;  3LSJ A;  2R5Z B;  5EZG A;  1HDP A;  2VUM J;  3C2B A;  2MSY A;  2R92 J;  2DA7 A;  4B3A A;  1X2N A;  1GV2 A;  3A01 B;  1U9N A;  4A93 J;  3IH3 A;  3TW6 A;  3I4M J;  5F0H A;  4MLO A;  1WPK A;  5GPC A;  1GVD A;  4X1E A;  1UHS A;  2XGC A;  4LOC A;  3O8G A;  1GUU A;  2JMW A;  2ID6 A;  3FK6 A;  2OPT A;  3HGG A;  2E19 A;  5GP9 A;  5FLM J;  1GDT A;  2NVX J;  3JRG A;  1LFB A;  1ITY A;  4FE7 A;  1HCR A;  3S14 J;  2CQX A;  3LOC A;  1VND A;  2Y30 A;  2DMU A;  2EBI A;  1FEX A;  5J1R A;  2JA7 J;  3HEF A;  1JKQ C;  4A3K J;  4C3I J;  5EGO A;  5M5W J;  3Q3S A;  3HOX J;  5M5X J;  2L7Z A;  1HLV A;  2EZK A;  3ZQG A;  3PO3 J;  4A3C J;  3TP0 A;  4FE4 A;  2IAI A;  3I4N J;  1HOM A;  2L7F P;  3HDD A;  4IHV A;  4CYC B;  2IEK A;  2KDZ A;  1U8B A;  2ME6 A;  2VKV A;  4IHX A;  2EH3 A;  2M8G X; 
#chains in the Genus database with same CATH topology
 5DTD A;  5GAE J;  2R5Y B;  1X3Z B;  2KIM A;  3FXL A;  2NXN B;  3OOU A;  3GWZ A;  4FIS A;  2QSG X;  3MN2 A;  2GA2 A;  1X1D A;  2CW8 A;  2A5W A;  4RLF A;  1TNS A;  1PP7 U;  2RKH A;  2XRN A;  3ABM H;  2HEO A;  5KAF C;  3NWT A;  2JPC A;  3GTG J;  2ZBK A;  2RRE A;  5IP7 J;  2EZL A;  2R7Q A;  2X48 A;  1I1S A;  3DKY A;  5F64 A;  3SZG A;  2PX9 A;  4OIQ F;  1BW6 A;  4EMS A;  1OQY A;  4IQ4 A;  2YR2 A;  3RPU A;  3OS1 A;  4AVP A;  1ETK A;  3GTJ J;  4L0Y B;  1R5H A;  1YX3 A;  2Y0S A;  3KEY A;  2QBY A;  3Q0V A;  1B8I A;  2L9S A;  4A6E A;  4HW0 A;  1A6I A;  2LF7 A;  4XSZ F;  2WB1 N;  2R7S A;  2CG4 A;  2HGC A;  5J47 A;  2GIZ A;  3OYM A;  3UKG A;  4LIU A;  4M72 A;  3F22 A;  2JA8 J;  4A3M J;  2E1N A;  3E5U A;  4KN4 X;  4RM2 A;  3E6C C;  2FML A;  2DAO A;  3LA2 A;  2KIU A;  1G3W A;  2HPI A;  3CLQ A;  2YU9 J;  4MGR A;  3R0A A;  1EH7 A;  1H0M A;  1T98 A;  2R7V A;  1WJ5 A;  4DJA A;  3ISP A;  4KT6 A;  3JAM Z;  3JRF A;  2M3A A;  3F9K A;  3V8L A;  4BXU A;  4UVB A;  2E2H J;  4RGR A;  1ENH A;  1FNN A;  4NC6 A;  2GWR A;  2FJ1 A;  2PEX A;  4HA8 A;  4XIC A;  1W0U A;  1S72 I;  2R5Y A;  5FRN A;  4DBQ A;  1WQ2 A;  5JFR A;  3ZOB A;  1VF9 A;  2IA0 A;  4B44 A;  4HZF A;  4DOZ A;  5K5Q A;  5IP9 J;  3GBG A;  1B59 A;  5E3M A;  1ZH5 A;  3WTZ A;  2QSH X;  2P7V B;  4QLC U;  2XF5 A;  4I09 A;  5D8K B;  1SFU A;  2I5U A;  4ANJ A;  5KHD A;  1HST A;  4I6Z A;  3JRH A;  1G2H A;  1GXP A;  2WB1 A;  3FXU A;  1BJZ A;  3LQR A;  1ZR2 A;  3CUQ C;  3O8H A;  3ZCO A;  2IS2 A;  1ZKG A;  4S0H B;  2JK3 A;  3P9C A;  1R00 A;  1MMS A;  3TO6 A;  4BHC A;  3K2Z A;  4AIJ A;  2R7X A;  3F6O A;  2TCT A;  2E60 A;  2D5V A;  4ZYD A;  2HDD A;  3W2V A;  1R4M B;  3TOB A;  1FZP B;  2MLG A;  2ME0 A;  5HLT A;  4M9X A;  3QPS A;  4GCV A;  1J2X A;  3IAM 2;  2XAQ A;  4ON0 A;  2WC2 A;  5A2Q K;  2PN6 A;  4NB5 A;  2V9K A;  4G6D A;  1TQM A;  2A6H F;  3LWF A;  2C6Y A;  3K7A J;  1BR4 A;  4HV6 A;  2LR8 A;  2ZME C;  4HOB A;  2JVG A;  1I3Q J;  3EUH C;  3M1C A;  3JRI A;  1N78 A;  1B9N A;  4PSX A;  2Y75 A;  3F0C A;  1WWX A;  3WHB A;  2R7F A;  3IP4 B;  3L2R A;  4A69 C;  1FOW A;  1XN7 A;  2LBF B;  3K69 A;  4E6K G;  1MW7 A;  3VYR B;  4UV8 A;  1H89 C;  3S1N J;  4UUV A;  3HRU A;  2CV0 A;  4JBA A;  3ZPL A;  2DTR A;  3ZQQ A;  2O6G E;  4EGZ A;  2FQ3 A;  4B43 A;  2HOE A;  3R0J A;  3LAJ A;  4Q5S F;  3RZO J;  5IT9 Z;  3GCM A;  2ZB9 A;  2MD5 A;  2WA0 A;  4YFN F;  3X2Q H;  1VQ5 I;  1HKS A;  2VE8 A;  2NVU B;  2OTJ I;  1MDM A;  2MA3 A;  2NS8 A;  2DA6 A;  1I6X A;  3WOD F;  1ZAR A;  2HNH A;  3CDL A;  1IG7 A;  1K7A A;  4KUM A;  1R4N B;  5IP6 A;  1W5S A;  4G7O F;  1IXS B;  2M87 A;  2VBW A;  2QEX I;  1VQ6 I;  3S1Q J;  2H94 A;  2PQ8 A;  2QQ8 A;  3EQL F;  3M8J A;  5DCF A;  3UNG C;  4EJT A;  5ICF A;  1K78 A;  2HPM A;  3G73 A;  3FKI J;  1XMK A;  2OAZ A;  2JN6 A;  4C30 A;  4D9J A;  1K4T A;  1YJW I;  2BV6 A;  3QYE A;  3F8C A;  2Z1D A;  3JTG A;  3WTU C;  1ZTR A;  4DYQ A;  2QEN A;  3L9F A;  2Q2E B;  3TOA A;  2G7H A;  3PL8 A;  3ONQ A;  3KZZ A;  2Z99 A;  2E2J J;  1RET A;  2JQ7 A;  1MNM C;  2F4O B;  3NWS A;  2CO5 A;  5BMZ A;  4Y17 A;  4U0V A;  4W97 A;  2BE5 F;  3RPU D;  2VOP A;  3SEQ A;  4Y7N J;  2D2W A;  1QVU A;  1YW8 A;  5FRM A;  5LHH A;  1T0F A;  5IYD J;  4RGX A;  2ZO4 A;  1OPC A;  3RKX A;  3AAF A;  2NNY A;  2H1K A;  1D1C A;  3ZMD A;  3K0L A;  4NC7 A;  1SAN A;  5HNH A;  2L9N A;  2X0L A;  3OIQ A;  1B1B A;  2QUF A;  3BPV A;  4AC0 A;  1HF0 A;  1F9N A;  3OS0 A;  4ENK A;  4ABZ A;  4FX4 A;  5BNG A;  3M3Y J;  5JVG F;  3EET A;  2WV1 A;  3KZY A;  2M34 A;  5F6F A;  3I3L A;  4I0B A;  2NVT J;  4BKX A;  1FPQ A;  5C44 J;  4QPQ A;  3S1R J;  4MTE A;  2L3D A;  2MH9 A;  1FP1 D;  2E1O A;  1XDS A;  2O7O A;  3BTI A;  3G3Z A;  2KRH A;  2FEZ A;  2PBI A;  2G9W A;  2RN7 A;  5FLX K;  2DTZ A;  5DUI A;  5HVQ C;  4MFD A;  1MBK A;  1MJ9 A;  3FKJ A;  4CUG A;  1YFH A;  2HKX A;  5EF6 A;  2KKO A;  4W1U A;  2HKO A;  5E1Z B;  4BUP A;  3GF2 A;  1RES A;  2GXB A;  5ICG A;  4ZDL A;  3TMO A;  1A31 A;  1Z67 A;  1W36 D;  2RAE A;  3V8K A;  3IV5 A;  3CJN A;  3GTO J;  5FLV A;  4NQW A;  1ORK A;  2W4S A;  5J8F A;  3FMS A;  5L3C A;  4XLF A;  5LBQ A;  1WI9 A;  2GLO A;  2DMT A;  1IRG A;  4G94 A;  3DPU A;  3CMM A;  3PNY A;  1K79 A;  1O4X A;  2YUS A;  4DYC A;  1ODD A;  4ESF A;  2DFH A;  4AIK A;  3F6V A;  2QA4 I;  3AG2 H;  3KFW X;  3A02 A;  4ZH4 F;  5D5W B;  1XC5 A;  3RKQ A;  1SFX A;  3HYI A;  1XSX A;  4OOI A;  2CYY A;  2ELK A;  2V9V A;  3GTM J;  5FKM A;  2X6W A;  5E1X A;  2AO9 A;  4N9H A;  2M9H A;  1S29 A;  1W0T A;  1LE8 A;  3ZQ7 A;  2Z5U A;  1R71 A;  1RZ4 A;  2DI3 A;  2XRL A;  3HTS B;  2FMY A;  3G4S I;  3WE3 A;  2W00 A;  2CUJ A;  2E7W A;  3KE2 A;  3H35 A;  2HU9 A;  4BAY A;  5LLQ A;  3E7L A;  2KRC A;  3EYY A;  1YJ9 I;  3HKZ A;  1BL0 A;  1ZHF A;  2F4I A;  4HAM A;  3PIO F;  1HDD C;  3M7G A;  2M0C A;  3DTK A;  3H3V K;  4C3J J;  3I0T A;  1JT0 A;  2V4J C;  3V7C A;  1T2K A;  4CYD A;  5JR3 A;  1TBX A;  5IPA A;  3GFM A;  3OYG A;  4IRI A;  2R0Q C;  4S04 A;  2EQR A;  1RC9 A;  2F5C A;  1QPI A;  4BQA A;  2BVM A;  2VN2 A;  4G7H F;  4DZJ A;  4GYG A;  5JHF A;  5BPD A;  4U0Y A;  4E7J A;  2ETH A;  2BZT A;  4OAY A;  3A4C A;  2HTJ A;  3J7Y J;  1D1B A;  1T38 A;  2GQQ A;  2OCE A;  3CES A;  5FO5 A;  1VFC A;  3F72 A;  5K1Y A;  2R5Z A;  3QP6 A;  1D0Y A;  3GZ6 A;  2CQK A;  2EZI A;  3LNQ A;  2XGD A;  4V19 K;  2I8D A;  6PAX A;  2UUZ A;  4JQF A;  1ETO A;  1WJE A;  5C4X J;  3RQI A;  3QWL A;  3ASN H;  4A3E J;  3OMY A;  4Y13 A;  4CO8 A;  4PK4 A;  2GXA A;  1F43 A;  5E3L A;  2BHZ A;  2NNN A;  4RA2 A;  2N8G A;  3CC7 I;  3FHN A;  3IAS 2;  1KQ8 A;  1L0O C;  4L5I A;  3K6G A;  4AID A;  3WTX C;  3K4C A;  4JYK A;  2DOF A;  3OYH A;  1P7J A;  4KN7 X;  4KJZ A;  2EFP A;  4XKB A;  4OWR B;  3QOP A;  5ILU A;  4F52 A;  3BPX A;  2OD5 A;  2PMZ N;  2K86 A;  3E97 A;  3K4B A;  2BW3 A;  3LSP A;  1YLF A;  4PUS A;  3S8P A;  5KCM A;  3M8F A;  4AUX A;  2HOA A;  5AIP A;  2F2E A;  5BOX A;  2LKX A;  2K5C A;  5ICE A;  1R36 A;  2VI6 A;  2WWY A;  1OLT A;  1CF7 B;  1WRJ A;  2HYF A;  4MQ9 F;  4OU0 A;  1TWC J;  2YX4 A;  2JUG A;  3U9G A;  4A2U A;  4IL6 C;  3MKZ A;  4D5F A;  5BPI A;  4RS8 A;  1PYV A;  2JJ7 A;  1IRZ A;  3CF2 A;  5HS7 A;  3FHZ A;  3G1L A;  3LSJ A;  2LY1 A;  2R5Z B;  1GVJ A;  5EZG A;  1HDP A;  1BOB A;  1SVM A;  2VAS A;  1YHQ I;  2EIN H;  3C2B A;  2MSY A;  4AIH A;  3CF5 F;  3T8R A;  3A01 B;  4P9U A;  1YYV A;  4A93 J;  2MBF A;  3TW6 A;  2IS4 A;  2FRH A;  4HEA 2;  4ZDO A;  1KA8 A;  3FK6 A;  4HDU A;  2E19 A;  1GDT A;  2BGC A;  1RUO A;  3F3X A;  3HJE A;  3ZMV A;  2EA2 A;  3CCE I;  1QBJ A;  2EBI A;  4AVZ A;  4G7Z F;  4BAC A;  4E70 A;  4BE0 A;  3E6D A;  3OY9 A;  1XGM A;  5BS6 A;  3HC7 A;  1JKQ C;  3PSI A;  5EGO A;  1SFK A;  3FBI B;  2DDB A;  4OIO F;  2A61 A;  2MYS A;  3WGH A;  1U6G A;  5A2Q Z;  2L7Z A;  4HX7 A;  2NOJ B;  2ELH A;  1HLV A;  1SAX A;  3IL2 A;  2M7B A;  1VQO I;  4KIB A;  4XOT A;  1YW7 A;  4AYB A;  3E0J B;  3GZ5 A;  2HFH A;  2BY2 A;  3WGG A;  3MFK A;  3FXK A;  4IX7 A;  2IAI A;  1HOM A;  2L7F P;  2XHK A;  2ME6 A;  5DDG A;  2AQE A;  3R6S A;  2M8G X;  2F5D A;  3JR9 A;  2HYG D;  4XLH A;  2IJL A;  3Q9S A;  4LLL A;  1Z6T A;  3FXO A;  4JP0 A;  1BOA A;  3G1O A;  3PQK A;  3JAM K;  2KFD A;  4BYY A;  1X1B A;  1DQU A;  4HX4 A;  2I10 A;  4RAY A;  4LLG F;  3OYL A;  3L2C A;  2VLA A;  1XSV A;  4FCY A;  3MD2 A;  4F55 A;  2BBY A;  2DA3 A;  2DJI A;  3I56 I;  2CS3 A;  1CQT A;  3CLO A;  3MZH A;  1LQ1 A;  2A6E F;  4M3F A;  3H9J A;  1ON2 A;  2M0M A;  2VPR A;  3DP7 A;  3LA7 A;  3PNT A;  4DW6 A;  2M30 A;  4DBR A;  1RPW A;  4OIR F;  3HSF A;  1SVL A;  4O5V A;  3F23 A;  4EM0 B;  3BJA A;  3OYK A;  3CJQ B;  4CCK A;  4F92 B;  4M3D A;  4IHW A;  2DOE A;  3Q0W A;  4U0W A;  2LC2 A;  2NS0 A;  4GXO A;  3BZ6 A;  2IGK A;  1LKX A;  1O3T A;  4HST A;  5CVV A;  1T0F C;  4UUS B;  1QNT A;  1C0W A;  4M3E A;  4MHG A;  3J7A O;  1V4R A;  3E3V A;  2L5Q A;  3GZN B;  1X3U A;  2VBY A;  1BIB A;  4CXF A;  4G12 A;  2R93 J;  2VQC A;  1FSH A;  3RSN A;  3G2B A;  4HV5 A;  2FNP A;  1IV6 A;  3FWE A;  3FBN B;  2EV6 A;  5M3M J;  5J6X A;  1RKT A;  1B9M A;  3G6E I;  4KYW A;  3CUQ B;  1BA5 A;  1OCT C;  2OUM A;  3EUH A;  2DPU A;  3KP2 A;  2RC4 A;  3BTC A;  4XRS G;  2LKS A;  1ZAO A;  1MJA A;  4HX8 A;  1IUY A;  1KU7 A;  1M1E B;  3I59 A;  4F91 B;  1OFC X;  1UB9 A;  3V7S A;  1AKH B;  1S7E A;  2M45 A;  2LRE A;  3FXR A;  4IVN A;  3QPL A;  4P1W A;  4LIT A;  4QWQ A;  1NTC A;  1G3S A;  2LMD A;  1X3W B;  4N4N B;  3OL4 A;  3HBL A;  5K5R A;  5B1A H;  5IOY A;  3CMA I;  3KX2 A;  3TGN A;  4D5C A;  3ULQ B;  1P92 A;  3OR1 C;  3HZJ A;  3W6V A;  1Y56 A;  3LQQ A;  2K9S A;  1FLI A;  2L2O A;  2XUB A;  2LP0 A;  2KDO A;  4PZJ A;  1F4K A;  2M5W A;  3EUK L;  4NBQ A;  1BR1 A;  3FXM A;  1EV7 A;  2FXA A;  2NS7 A;  3BG7 A;  1VQM I;  1MMD A;  1U3E M;  3GLX A;  3CO6 C;  3WTW C;  4CHU A;  4O3M A;  1X1P A;  1DPU A;  4IQJ A;  2WAD A;  2R4G A;  4RLQ A;  1SMY F;  2F5E A;  2WBM A;  3K1M A;  3QPH A;  3ZQC A;  1ULY A;  3WTY C;  1JUM A;  2MH2 A;  1MMN A;  3VPR A;  4XMY A;  3DEW A;  4D0P A;  4BY1 J;  3CQZ J;  3FZV A;  2K4J A;  1FBS A;  1QGP A;  3MMY B;  2XPU A;  2AHQ A;  2JWT A;  3GTQ J;  1Y0N A;  3I55 I;  1J9I A;  2XF7 A;  1R49 A;  1AA7 A;  1ZEL A;  5B3S H;  2A3S A;  2Q1Z B;  1H9T A;  1AHD P;  1RR7 A;  3IH2 A;  2AXT C;  5BQT A;  5IT3 A;  1REP C;  4B48 A;  1XCV A;  4BY7 J;  4F93 B;  5E18 F;  1BM9 A;  1EA3 A;  2G7U A;  2K40 A;  1ZK8 A;  1LFU P;  4L5E A;  1LUJ B;  3KZI C;  1NK3 P;  3DEU A;  2OC6 A;  1QHH D;  1X19 A;  1ZGJ A;  4XQF A;  4XR6 A;  4ZYA A;  4ESJ A;  2LDU A;  1DP3 A;  3A0H C;  1LDK B;  2F5V A;  1FSE A;  4RMN A;  4I7H A;  3FIW A;  1IGN A;  3CD6 I;  2HZD A;  2XGE A;  1VQ4 I;  2VXZ A;  4HRI A;  1LFP A;  1YJN I;  1HW1 A;  3DQV C;  4ZTJ A;  4Y3O A;  3ZR8 X;  3CME I;  3SZT A;  2AS5 F;  2ZKZ A;  1QVT A;  1YQA A;  3ABL H;  3PQJ A;  1UMQ A;  2VB6 A;  3MAJ A;  4B3X A;  3RZD J;  4HQE A;  1Z7U A;  4CIC A;  1Z1D A;  4KIC A;  2RQQ A;  2L9V A;  2DN0 A;  3SXY A;  4ENJ A;  3GXO A;  5IYB J;  3GFI A;  3PJR A;  2HR3 A;  4EJU A;  1STZ A;  5FFX A;  1VZ0 A;  1P2F A;  3BR5 A;  2M1B A;  2LG4 A;  4ZZL A;  4C2M J;  3K70 C;  3ABK H;  2CMP A;  4BJ5 C;  1YTY A;  2COB A;  5L3F A;  4I2O A;  3HRS A;  3DPL C;  1IRX A;  3ABT A;  2Z3Y A;  3LST A;  2FU4 A;  1S3J A;  2V26 A;  3GUD A;  1Y1W J;  1IN7 A;  2DA4 A;  1XG1 A;  4RB1 A;  3S15 J;  1YW9 A;  1E0E A;  3ABU A;  1V54 H;  3S3O A;  3GW2 A;  2VOO A;  3HG9 A;  2HI3 A;  5CVU A;  1R5G A;  1HXD A;  4PJL A;  3ECH A;  1X4P A;  3BR6 A;  3HOY J;  3D5R C;  1F5T A;  2RNG A;  2Y2Z A;  2P5V A;  3UR3 C;  1XB4 A;  1XGN A;  3OWT A;  5FFZ A;  1WZ2 A;  3ZP5 A;  1IRF A;  4XL9 A;  4HF1 A;  2L0K A;  1DP7 P;  3GVA A;  4KA4 A;  2ICW G;  4RDU A;  3D1N I;  4CSW A;  4C9Y A;  2EA4 A;  4O6J A;  3N97 A;  2FNA A;  2GBY A;  2EIM H;  2JPB A;  4XN0 A;  3BOQ A;  3DWL E;  2X9D A;  3ECO A;  2PG4 A;  3LFK A;  3WTS C;  2OU2 A;  5LHI A;  5D6F A;  4BS9 A;  4EEF G;  1H8A C;  2DJN A;  2LRD A;  3RTR A;  3PFI A;  4II3 A;  2YX7 A;  5DYM A;  1G4D A;  3PO2 J;  2XAU A;  2TDX A;  4Q4Z F;  2IRF G;  1HA8 A;  1WJF A;  4XRM A;  1F36 A;  3VSK A;  3BT9 A;  2HYJ A;  4FHT A;  3VYS B;  4A3L J;  4D1Q A;  3IUO A;  2LFB A;  3BCB A;  2CJJ A;  1JXS A;  5DM6 F;  5D4R A;  2HDW A;  3OYA A;  1SD6 A;  2GM4 A;  4XLC A;  5C4J J;  2XC7 A;  2X6X A;  2X1C A;  1Y1V J;  4YRV A;  2HOT A;  2QGU A;  3WU0 A;  3MCZ A;  4A5N A;  4IO9 F;  2IS1 A;  5CKT A;  1MKM A;  3S2D J;  3GTK J;  3V8J A;  2JSP A;  2KMU A;  2ECB A;  2L01 A;  3QOE A;  1WH5 A;  5K5O A;  2JTV A;  1SD5 A;  3MKL A;  1FMW A;  1KYZ A;  1WGX A;  4CYC A;  3IHU A;  5CLS A;  4N4O B;  5LD2 C;  2WAE A;  3TDU C;  2FBI A;  1BN5 A;  3WU1 B;  4WK8 F;  2HVS A;  3OIO A;  2XF6 A;  1NG6 A;  2BVL A;  5HS8 A;  3QAH A;  3TQN A;  1P6R A;  3JRB A;  4IOC F;  5J8C A;  4II2 A;  1P9Q C;  1D0Z A;  3BLY A;  3KYL A;  4KNY A;  2XKP A;  3IWZ A;  5ED4 A;  5D5V B;  3F8M A;  4DIQ A;  2NYX A;  1U9O A;  2Z9O A;  4OMZ A;  3OYF A;  4N0B A;  1XCB A;  2VC0 A;  2RDP A;  2XAF A;  1P7I A;  1RI7 A;  2P4W A;  1K83 J;  2A05 A;  2NVY J;  4LG0 B;  4I76 A;  3CDI A;  1P4A A;  2ID3 A;  4MO7 A;  2K85 A;  1TQP A;  2ADU A;  3K70 D;  2XV4 S;  4RAG A;  3A0B C;  4ENN A;  9ANT A;  1IJW C;  2QWW A;  5K7Z A;  5LEJ A;  4P96 A;  4EAT A;  1UG2 A;  5L3E A;  1ZRD A;  3KP3 A;  1OCZ H;  1LJ9 A;  2OQG A;  1GT0 C;  4XID A;  2KL4 A;  2IS6 A;  4UHT A;  3FM3 A;  3HUG B;  1O57 A;  1FWZ A;  5FJ8 J;  4Y52 J;  1FJL A;  4RAF A;  1E3H A;  3ZQI A;  2GAU A;  3CCM I;  1S7A A;  5KK1 A;  3VSL A;  4XN3 A;  4YEJ A;  3DFG A;  3S1M J;  3HIF A;  4CCN A;  5DD4 A;  3CC2 I;  2HQA A;  4LK0 F;  1SFO J;  4GFB A;  2VOD A;  5HNF A;  3RI4 A;  4KDP A;  1FYK A;  5FLX Z;  4WXH A;  3CP8 A;  2FOK A;  4KT5 C;  3T0Y A;  1O7L A;  4GRI A;  1ZG3 A;  1E3P A;  1AKH A;  4PSW A;  3CJR B;  2IXS A;  5FD6 A;  1Y8R B;  1XDU A;  4QIW N;  5IOZ A;  4FET A;  1K61 A;  4AM3 A;  2KQR A;  2XSD C;  3HOT A;  5LFA A;  1XPX A;  3FMQ A;  3BCA A;  2K3P A;  2RNJ A;  1N77 A;  1FYM A;  2BXY A;  3W2W A;  4LIV A;  4FAS D;  4IOA F;  4PJN A;  1HW2 A;  1JHF A;  1QU3 A;  2JVH A;  5E79 C;  2OV7 A;  4U88 A;  3TP3 A;  1MBF A;  3BQZ A;  3PNV A;  3L2V A;  4UUT A;  3DF8 A;  2E5N A;  2DK5 A;  2OJE D;  2KIQ A;  4NC8 A;  2D1V A;  3H9Q A;  4KIG A;  3VB2 A;  4P5O A;  4HLY A;  4BEH A;  2HZT A;  3PUB A;  5B5E C;  2DW4 A;  2H09 A;  2X4H A;  3M07 A;  3U2R A;  5E8I A;  3ZMT A;  3BDD A;  1SVO A;  3JTH A;  2DA7 A;  2EB7 A;  5KNL A;  3V42 A;  2ZJP F;  2R92 J;  5GTI C;  1U9N A;  4UV9 A;  3I4M J;  3AG1 H;  3WTV C;  2VKD A;  1G3Y A;  1K6Y A;  2EJR A;  2XGC A;  2XAJ A;  2LF8 A;  2JMW A;  4LOC A;  3VOE A;  2OPT A;  3HGG A;  3HPG A;  4LG3 A;  1ONV A;  4FE7 A;  1HCR A;  3JSP A;  1SFE A;  2CV2 A;  2W82 A;  5J4Y A;  2Y30 A;  2ACJ A;  5EJC A;  4HLX A;  3AKZ A;  4LB6 B;  5J1R A;  3S2W A;  1W4M A;  2J5P A;  4ETS A;  3HEF A;  3FXJ A;  2KZV A;  2GXG A;  3VOD A;  4C3I J;  1YX5 A;  3ML6 A;  2A68 F;  2CFO A;  3I71 A;  3HOX J;  2STW A;  5M5X J;  1ZRC A;  1W36 C;  5LGT A;  2EZK A;  1NG7 A;  2OQR A;  4YEL A;  5IT9 K;  3PO3 J;  1V5G A;  1R22 A;  2KHM A;  3P9K A;  3OL3 A;  4WXD A;  3TP0 A;  3OS2 A;  2Z2S B;  5ERI A;  4YFX F;  4UB6 C;  4XM3 A;  4ZC3 A;  1MGT A;  2VKV A;  1YO5 C;  4IHX A;  1SD7 A;  1U5T A;  2EH3 A;  4DYR A;  2BOL A;  3HXL A;  4YFK F;  3SFZ A;  1JGS A;  2VJI A;  2VL8 A;  2A69 F;  2FBK A;  3H5N A;  3CO7 C;  1MBH A;  4EJO A;  1JT6 A;  1U5T C;  4G6T B;  2RGV A;  4WWC A;  4A12 A;  4L0Z B;  2DDA A;  3FK7 A;  4A3F J;  4XLA A;  1B8I B;  3J81 Z;  1R23 A;  3WGI A;  3MKY B;  1MH3 A;  2M4K A;  1FOY A;  1TT5 B;  1DU0 A;  4YII A;  2W84 A;  4LGW A;  2CUZ A;  4NDL A;  3OYD A;  1HSJ A;  1I5Z A;  4ESB A;  2JA5 J;  1BC7 C;  5LRR A;  2XGX A;  3ESW B;  4Q48 A;  2LSO A;  2PMH A;  3I54 A;  2JUC A;  5TIS C;  4RBO A;  1FMV A;  3L7W A;  2XKO A;  1B4A A;  2BW3 B;  2WV0 A;  2DQL A;  3E5X A;  1IUF A;  2QM3 A;  3E5Q A;  2B7E A;  1OMI A;  1JTY A;  3BR0 A;  3GO5 A;  4OIP F;  2DYS H;  2STT A;  1L3L A;  2VKH A;  2L54 A;  2KT0 A;  4U87 A;  1FBQ A;  1BI0 A;  1FC3 A;  5EEA A;  5HLG A;  3S16 J;  2IGO A;  5CPR B;  3OYJ A;  1BR2 A;  1Y0U A;  2CGP A;  3RIR A;  4BBR J;  3HGY A;  3JW4 A;  2J5O A;  1LEB A;  1R5I D;  4B09 A;  1S9H A;  2VJ5 A;  5HLI A;  3H92 A;  3NAU A;  2ZXI A;  4I99 C;  4JX5 A;  2CQ7 A;  1HW5 A;  1AWC A;  4M3G A;  1T08 B;  4M6V A;  1X58 A;  3ZMZ A;  2VQG A;  1A6Q A;  3Q5F A;  5HOO A;  2FF4 A;  4M3B A;  1ETV A;  2VKE A;  3DBR B;  2X51 A;  2MC3 A;  3RYR A;  4KMF A;  1UZC A;  4D7N A;  2K27 A;  2VT2 A;  4BJ6 C;  2Y69 H;  2UZK A;  1KQ9 A;  4XLP F;  1ETX A;  2W7N A;  2DU9 A;  3BZK A;  3MKW B;  3KEQ A;  1UST A;  1JHH A;  5FKL A;  2DT6 A;  1ETQ A;  4A3J J;  4YIR X;  3TO7 A;  3ROU A;  1ACI A;  4AU7 A;  3WU2 C;  1O7F A;  3I4P A;  2OA4 A;  1OYY A;  4XLN F;  1R1T A;  4R79 A;  2LVS A;  1TWH J;  2ZXJ A;  3C2H A;  3K2A A;  3SEZ A;  5EDN A;  1XGS A;  3J80 K;  4ZJZ A;  3D5L A;  3J7A Y;  2VQL A;  4BJT A;  2R7Z J;  5J3L A;  3ZGK A;  4NHJ A;  5HDG A;  3AFH A;  1OCR H;  2WAQ N;  3KP5 A;  1WVR A;  5H20 A;  1ZLK A;  3W2A A;  1Z9C A;  1Z3Y A;  2LH9 A;  2Q8K A;  1Z3X A;  4QTR A;  1KON A;  1VQ7 I;  3OSF A;  3LSK A;  3JCU C;  1MIJ A;  1BI2 A;  2VT3 A;  4HF0 A;  2KLO A;  2VBX A;  2L9R A;  3EYI A;  2O8X A;  1TW2 A;  1G59 A;  1IV8 A;  1DGW Y;  1XX5 A;  2QVO A;  3H0D A;  2HXI A;  4C3H J;  3GLL A;  4P9F A;  4LMY A;  4XBF A;  3PUF A;  2DMP A;  3L2W A;  1P4W A;  2A6T A;  3HKZ N;  3U21 A;  3CC4 I;  2Y0S N;  3IKV A;  3RKW A;  1MND A;  3CP2 A;  4B8X A;  3CCS I;  2GA1 A;  4PCQ A;  2M8E A;  4A3B J;  1D3Y A;  4D7M A;  5TGT A;  3OYC A;  4AWX B;  1MSE C;  2M2E A;  2R7D A;  3VYT B;  3BR1 A;  5K7H A;  3CDH A;  4WCG A;  1APL C;  2E34 A;  1Z0X A;  5D5X B;  2EIJ H;  3KPH A;  1TQI A;  3LA3 A;  5IYC J;  1LB2 A;  2QZ8 A;  3DTE A;  4XRF A;  1TC3 C;  4DQ2 A;  4QSH A;  4EVI A;  1LEA A;  3DU6 A;  3C7J A;  2VON A;  1ERD A;  1OR7 A;  1QPM A;  1KU9 A;  3PIP F;  1U8R A;  3O6B B;  4F7Z A;  1QRY A;  2O8K A;  5JHU A;  4LLN A;  1D8K A;  2X1E A;  2IT0 A;  2HWV A;  3LAP A;  2R7O A;  4CZZ A;  1KQ0 A;  2ZNZ A;  3F21 A;  4E7H A;  1WFX A;  2ESH A;  1Z91 A;  3LFU A;  3B02 A;  3N4M A;  1JKR C;  1RR8 C;  3KET A;  2HQR A;  1JE8 A;  1ZYR F;  1FYL A;  1TW3 A;  3LSH A;  3S2H J;  2QCO A;  4Y4R A;  2F4M B;  2UV1 A;  2LY9 A;  4IPA A;  1I3A A;  1DGR M;  3T1B A;  3G1M A;  3K1N A;  4Z6Y A;  4Z2Y A;  3SHF A;  3M8E A;  1SAU A;  2KZG A;  1QZY A;  1EH8 A;  5TRD A;  3P5J A;  3KP7 A;  1Y8Q B;  1RUN A;  5D8L B;  4L5J A;  2BEO A;  1X4O A;  3GX4 X;  2DA1 A;  4HNV A;  2E36 A;  2BY0 A;  4A6D A;  1UAA A;  2QKM B;  4LB5 A;  2UXN A;  3MQ0 A;  4XOR A;  5LHG A;  2E7X A;  1NHA A;  5AIQ A;  1JJ6 C;  3K4N A;  5L3D A;  4C2T A;  5IY5 H;  1J5Y A;  5JI6 A;  1A5J A;  4IKF A;  3J80 Z;  2WAQ A;  2Y0M A;  2PI0 A;  2V1U A;  2NAZ A;  3A03 A;  4M74 A;  4RB0 A;  2CU7 A;  1R1U A;  2DBB A;  2V79 A;  2AXL A;  2ZJQ F;  1ZGA A;  5F1J A;  2ZJR F;  1QZE A;  1W7P A;  3J7Z I;  1SMT A;  5EYR A;  3C1D A;  1GV5 A;  1K78 B;  4RGU A;  3TO9 A;  2K7L A;  2IVM A;  3BTL A;  4I01 A;  4MIM A;  1JKO C;  1DPR A;  3CZ6 A;  5GAG J;  4KIT B;  1WKM A;  4RB2 C;  1CGP A;  3WHC A;  4FT8 A;  5H6R A;  2ESN A;  3R61 A;  4CA0 A;  3F8N A;  1J59 A;  1W7P D;  4EM1 A;  1B72 B;  2V6C A;  1XS9 A;  4ZYE A;  3L09 A;  1R9T J;  3AL0 C;  5LRS A;  3P9I A;  4BQQ A;  3SJM A;  4GDF A;  1IDZ A;  3LSM A;  2IBD A;  3A2K A;  2XVC A;  2L02 A;  4NUB A;  1LDD A;  3HL2 A;  4E7L A;  1D5Y A;  1W5C C;  1MJB A;  5FB2 A;  2PMU A;  1NK2 P;  2UXX A;  4P55 A;  1V3F A;  2NVQ J;  1WH7 A;  2Y48 A;  3I53 A;  3AG4 H;  3B73 A;  4CDG A;  1XMX A;  2X1D A;  4S05 A;  2DPD A;  2MG4 A;  3LSR A;  2GOX B;  5KAI C;  5K7F A;  4H0E A;  3HOU J;  1YIO A;  2ZSI B;  1J09 A;  2JRM A;  1FIA A;  3CCV I;  2W57 A;  3CMY A;  1YS7 A;  3ZMU A;  4AD9 A;  5H2F C;  2IGM A;  3K9T A;  4A5M A;  2VE9 A;  2CUF A;  3JRC A;  1I39 A;  2P7C B;  2MFZ A;  2XAH A;  4OIN F;  4L18 B;  1NH3 A;  2RQP A;  1FOK A;  2HTS A;  4DZP A;  2HQ5 A;  3OYE A;  1HKQ A;  2O3F A;  3SDG A;  2MW8 A;  4FQG A;  4Y33 A;  5E3N A;  2DMN A;  4V2G A;  1F1Z A;  5F27 A;  1G8X A;  4H4K C;  2XRO A;  3ASO H;  3H0G J;  3BJO A;  4IEJ A;  1FTZ A;  2XPW A;  2F48 A;  3BRO A;  4BL0 B;  3G71 I;  2OCC H;  4XON A;  3TDZ C;  3GYH X;  3O3K A;  4G6Q A;  1VQ9 I;  4FX0 A;  2GZW A;  2W1O A;  4KIF A;  2PFB A;  4EGY A;  5C3E J;  4BU2 A;  2KJC A;  2R3S A;  3HHG A;  3BR3 A;  2OZ6 A;  1UHM A;  4XRS A;  3VDX A;  2OF7 A;  2XSJ C;  3HM5 A;  4HDV A;  1GHC A;  1TWG J;  1IN8 A;  4G9Y A;  4WXC A;  5DV5 A;  1KU2 A;  3H5R A;  5HS9 A;  3QYB A;  4HYE A;  1R1V A;  1XMA A;  2MLK A;  2OBP A;  1I1G A;  3ELK A;  4IHT A;  2K9Q A;  3RQ4 A;  4LFU A;  1KGS A;  1MDM B;  4L9T A;  1G3T A;  2V6E A;  2R7T A;  4OMY A;  2WAF A;  3BG5 A;  5E17 F;  5GPA A;  4RAZ A;  2DMQ A;  1POG A;  3I59 B;  5ILV A;  5DM7 F;  1GXQ A;  4BHP A;  5B66 C;  1DU6 A;  3MVP A;  4DGW B;  4A0Y A;  1ON1 A;  3CCJ I;  5GAD J;  3H36 A;  1VQK I;  5JLX A;  3WG7 H;  2LLK A;  4ASN A;  2QKL B;  4K2E A;  4MNU A;  3KEO A;  3GTL J;  1Q1H A;  2P0W A;  1AOY A;  1MH4 A;  1XTA A;  4M6X A;  2EK5 A;  4XLE A;  1H9G A;  3TW7 A;  3CCU I;  3IWF A;  2JT1 A;  2OTL I;  2Y9Z A;  2E71 A;  3D5S C;  3S17 J;  5E1W A;  5F0C A;  3AL0 B;  1BJA A;  1SD4 A;  1K6O A;  3M1E A;  1JJ8 C;  2K9M A;  5DEQ A;  1LPQ A;  2WTE A;  2JRT A;  2MAB A;  1BIA A;  2FE3 A;  2YSR A;  4MQV A;  4RGS A;  1E17 A;  1GV2 A;  2ISY A;  3DBH B;  4XKW A;  1J7K A;  4MLO A;  1WPK A;  4A0X A;  5GPC A;  1IXR C;  3F8B A;  3ZN0 A;  4E7S A;  1ZRE A;  4X1E A;  1UHS A;  3O8G A;  1GUU A;  3GME A;  2NVX J;  1IAW A;  1EKE A;  1LFB A;  2FSW A;  3JRG A;  2JZY A;  1OIS A;  1ITY A;  2DFI A;  1VQP I;  1MZB A;  1R6R A;  2CQX A;  5CVR A;  3W3C A;  5L3B A;  2CV1 A;  1VND A;  2DMU A;  2VIX A;  1OCO H;  4KFC A;  4N9I A;  1Z7L A;  1IN4 A;  3T8T A;  3CTA A;  4M73 A;  1FEX A;  2IP2 A;  2JA7 J;  3K4J A;  1WJA A;  4A3K J;  1YOV B;  3E6B A;  5M5W J;  1G6N A;  1S6L A;  4BE1 A;  4EM2 A;  5F1R A;  1DDN A;  2DXI A;  1BI3 A;  3I64 A;  3K1P A;  5DUK A;  5JVT A;  2D45 A;  3ZQG A;  1JI8 A;  2RVC A;  5B1B H;  3R60 A;  1HC8 A;  3GFL A;  2XAG A;  3TBI A;  3D0S A;  3SZP A;  3BZC A;  3HDD A;  3KLN A;  2IEK A;  1X1C A;  4XKC A;  2DT5 A;  4E7Z A;  2KDZ A;  1N75 A;  1U8B A;  5FRO A;  4CGZ A;  5GTH C;  3HOW J;  3OR2 C;  3BG3 A;  1YRN B;  1OR7 C;  4JX4 A;  4R1H A;  2K02 A;  2DOA A;  3QQA A;  1Q1V A;  2CW7 A;  4GGG A;  2BY3 A;  4MEX F;  3ZQF A;  2IA1 A;  1N25 A;  1UFM A;  1ZG5 A;  1J0R A;  2EZH A;  1E3O C;  1MBG A;  4Q47 A;  2ECC A;  4BDY A;  2O0Y A;  3F8F A;  1E2X A;  1S8N A;  2P8T A;  3I58 A;  2QBY B;  1MBE A;  3S32 A;  3QU3 A;  2G0E A;  4IRH A;  2H27 A;  2LOO A;  1V5F A;  1MMA A;  3P7N A;  1P4X A;  4A0Z A;  3FX3 A;  1QZZ A;  1GLN A;  2QQB A;  2X85 A;  3BG6 A;  3HB9 A;  1DUX C;  3AG3 H;  1Y39 A;  1EH6 A;  5D4S A;  3OIP A;  4NNJ A;  4UUS A;  4BHB A;  4XSX F;  2HS5 A;  2HOS A;  1TWF J;  2R7W A;  1Z77 A;  1BC8 C;  5J40 A;  3K4L A;  2HQN A;  2EIL H;  1T95 A;  2HVR A;  2A5Y B;  2L7M P;  3GFJ A;  3H9G A;  5M5Y J;  1ZQ3 P;  3A01 A;  4BQN A;  1T6S A;  2BXZ A;  2LD5 A;  2E2I J;  2VBZ A;  2KRF A;  3B6C A;  3OYN A;  1Y6I A;  3S3N A;  3KCC A;  1I50 J;  4HBL A;  2IGN A;  5EZH A;  4RB3 C;  2CSO A;  2BY1 A;  4ZYH A;  1UCR A;  1T56 A;  3U1D A;  1S5L C;  4WX9 A;  1ETY A;  1Z21 A;  2B0L A;  2FA5 A;  3NQO A;  3WE2 A;  1TNT A;  2F6C A;  2HXO A;  2H6B A;  3KYC B;  3HRM A;  1W1W E;  4BNC A;  3BQY A;  4ENM A;  3BY6 A;  3A1Y A;  5LGN A;  1PUE E;  1SC7 A;  1VI0 A;  1YIJ I;  1T39 A;  4BE2 A;  2XIG A;  3H3U A;  2EIK H;  2L4M A;  2Y9Y A;  4HG2 A;  2R7U A;  4MEY F;  1FIP A;  1ZR4 A;  3DPT A;  1JGG A;  1QQI A;  1RNL A;  2EPF A;  3NRV A;  2R7R A;  3COA C;  5HDK A;  1ZN2 A;  4CCO A;  1EJ9 A;  1PUF B;  2M7A A;  3C2G A;  1MSF C;  1D0X A;  4YG2 F;  2LKP A;  2XB0 X;  4XOP A;  2P6S A;  3QYF A;  3REO A;  1JUP A;  2K9L A;  4PGH A;  4KIS A;  3JRA A;  3M4O J;  2PJR B;  4F3Q A;  1USS A;  2BHY A;  2ZFU A;  2BYV E;  3QU6 A;  2E1M B;  5F04 A;  3V4G A;  4L9J A;  2CQQ A;  2QSF X;  3S93 A;  3DU5 A;  3MZY A;  1TTY A;  4CH7 A;  2EFQ A;  4UB8 C;  3K4K A;  4B4C A;  4MTD A;  2FD5 A;  4L9V A;  1LVK A;  1TWA J;  5E20 A;  4UVC A;  4FTH A;  3HOS A;  3ERM A;  1ZG1 A;  2IPQ X;  1PJR A;  2DA2 A;  2VXD A;  3O2P E;  2MC4 A;  2K3F A;  3RKY A;  1ZLJ A;  3L00 A;  3PM1 A;  4GYI A;  3Q9V A;  2DQR A;  2FQ4 A;  1KU3 A;  2O9L A;  4I98 B;  5E8G A;  3DTI A;  2VQH A;  4Y15 A;  1U78 A;  2DOD A;  2YS9 A;  3I9V 2;  3PSF A;  2MGQ A;  3R4K A;  1VQN I;  3CCL I;  1BBY A;  4U7D A;  4A3G J;  5DS9 A;  4M71 A;  2P81 A;  1FP2 A;  5E3O A;  1D8J A;  2OZU A;  1PUF A;  3JRE A;  1QO0 D;  4JX6 A;  1UG0 A;  1O3S A;  2CRG A;  2P6T A;  5CYV A;  5FKK A;  3L1P A;  3DXJ F;  4HNU A;  1VTN C;  3QOD A;  2W48 A;  3SFI A;  2ZXH A;  1JKP C;  4ZTF A;  3HTU A;  3QRF F;  3OYB A;  2WY8 Q;  5FKO A;  4U7B A;  3DV8 A;  3JSO A;  1RKW A;  1TT0 A;  3HUG A;  4UNO A;  1UJ8 A;  3W6K B;  2FX0 A;  2K4B A;  2KIS A;  4ZDP A;  3ZQH A;  4IZZ A;  1ZRF A;  1YG2 A;  5CQG A;  1OCC H;  4XNF A;  4IRG A;  2EFO A;  1B72 A;  1YI2 I;  2Z16 A;  2JA2 A;  5CQE A;  3FMR A;  3Q0U A;  2LTP A;  1IZ1 A;  2E5Z A;  3FM5 A;  2HDC A;  3GTP J;  4V2F A;  4MFE A;  1FTT A;  4J01 A;  1FT9 A;  3E1S A;  5JLW A;  3RJP A;  4HQM A;  3DCF A;  1MNE A;  1RIO H;  3N05 A;  3DKX A;  4WF2 A;  4CZC A;  2X6O A;  1B6A A;  3V7R A;  1BW5 A;  4CCL A;  4IHY A;  4HSR A;  1LVA A;  2KJB A;  1U5T B;  1WHU A;  4BQO A;  5KVR A;  3EPZ A;  3KP6 A;  3U1K A;  5L3G A;  5GAH J;  4PJM A;  1IN5 A;  5FKN A;  3SDB A;  5ICC A;  1OJL A;  2DA5 A;  1T8I A;  2PMZ A;  4BH9 A;  1WJC A;  1ZGW A;  4E4H A;  3FF5 A;  2CW0 F;  2QF7 A;  2CQN A;  1WJD A;  4BEH B;  2X6Y A;  3CUO A;  3I5U A;  2DFE A;  3H5A A;  4XK4 A;  1VQ8 I;  2QYO A;  2KP6 A;  2KPM A;  2FBH A;  1A35 A;  1FOX A;  1X2M A;  2WY7 Q;  2ZSH B;  3RPQ A;  3OV8 A;  3DEE A;  5LGU A;  4NQW B;  1XD7 A;  4X6A J;  1U0J A;  1WJB A;  2LNB A;  3OYI A;  4I0A A;  3ZQL A;  3QPT A;  4ZZD A;  2EV0 A;  4LG0 A;  4EV0 A;  2VC1 A;  3LSG A;  5DCM A;  2Q2E A;  5EEG A;  1FBU A;  1OYW A;  3MWM A;  4M6Y A;  3NAR A;  5LEK A;  3LL7 A;  1LDJ A;  1IF1 A;  1I6H J;  1JUS A;  3B6A A;  3SQN A;  3PFY A;  4YIF A;  1V55 H;  2W85 A;  1QHG A;  3VEP A;  2V7F A;  3RYP A;  5EG0 B;  4B47 A;  3TL4 X;  3HRT A;  3W6J B;  4BXF A;  4X0G A;  1TP4 A;  2AQF A;  2COM A;  2FUG 2;  2K9N A;  2XAS A;  3ZMS A;  2IW5 A;  3CUQ A;  2EFN A;  1BI1 A;  4LD5 A;  2VJJ A;  3VFZ A;  1R7J A;  4CCM A;  4IHS A;  2V1N A;  2DO7 A;  2E35 A;  1MD0 A;  2V1D A;  3TKY A;  5H6Q A;  5EEH A;  2ZME A;  5CVI A;  3HOV J;  2CUE A;  3DKW A;  1EF4 A;  1PP8 F;  4EQQ A;  1LE8 B;  2UWM A;  4HNT A;  3VYU B;  2XB5 A;  4UY8 I;  4G8X A;  2W24 A;  4PJ0 C;  1Z05 A;  4JK1 X;  2Y31 A;  2ZFW A;  4IJA A;  1AU7 A;  1A36 A;  2W25 A;  2H8R A;  3C18 A;  1IO2 A;  2VPL A;  2RV8 A;  1PVE A;  2EV5 A;  2CH0 A;  2VJ4 A;  3SYT A;  3ZRG A;  4ITV A;  4A3D J;  3C3W A;  2ZC2 A;  2YU3 A;  2L4A A;  4HPQ A;  3GEZ A;  5F0F A;  2H6C A;  3BC8 A;  3T5X A;  5EGO B;  4EJV A;  3BJ6 A;  1WI3 A;  3BR2 A;  3K4M A;  5FD5 A;  2B63 J;  5ILS A;  2O61 A;  5J1U A;  2Z33 A;  2XPV A;  3BTJ A;  2LY2 A;  2CWE A;  4GO1 A;  3IKT A;  2O5R A;  2KIF A;  3IC7 A;  5J1Y A;  2D1H A;  1KYW A;  5M3F J;  2PJR A;  2LK2 A;  2XDV A;  1WCM J;  3BG9 A;  2YPR A;  4ZYG A;  3FDY A;  1TLH B;  1U2W A;  4UXN A;  5CJ9 A;  5D5U B;  4R8H A;  1T33 A;  2A07 F;  2O03 A;  4IXA A;  4KMU X;  2ZME B;  4PFP A;  4L9N A;  1TL8 A;  2FOW A;  2NOG A;  1LNW A;  3HHH A;  4BDZ A;  2QQ9 A;  3CJT B;  1UEL B;  2QLZ A;  5CVJ A;  3BWG A;  1FY7 A;  2P5K A;  1FX7 A;  1W7P B;  4PDK A;  1WSU A;  1O3R A;  2LBF A;  4BXX J;  1OYI A;  4M9Z A;  1PDN C;  3DLL F;  4J19 A;  1IC8 A;  4A3I J;  3ERE D;  3ZN1 A;  5DCM B;  2PLY A;  2M4G A;  3CCY A;  3HPH A;  4OAZ A;  1KZH A;  2ZCW A;  3HOZ J;  4AYB N;  2TRT A;  3HSE A;  2GIV A;  3KIO A;  1OKR A;  2QQA A;  4QPO A;  1IN6 A;  1IDY A;  3RDI A;  4HF2 A;  3RCO A;  3MEX A;  1H88 C;  1X1A A;  3H1C A;  1TZL A;  2DT7 B;  1JTX A;  1OCP A;  3DLA A;  2P5L C;  2DCE A;  3KYD B;  3NEU A;  3L2Q A;  3QP5 A;  1J75 A;  1YRN A;  2ELJ A;  2EWN A;  5F08 A;  4B1R A;  2NRA C;  3WG9 A;  2ZNY A;  3OSG A;  4JOM A;  5EG0 A;  2DK8 A;  4RM3 A;  5TJJ A;  1ETW A;  3IRQ A;  3FIS A;  2L7K A;  4BBS J;  1W5T A;  4DNC A;  1HBX G;  2DLL A;  3JRD A;  3CCQ I;  2JA6 J;  3FXQ A;  4PJJ A;  3K10 A;  1RRJ A;  2H1L A;  2E1C A;  1MMG A;  5HOD A;  1Z6R A;  3IH4 A;  1YE9 A;  3LMM A;  1VQL I;  1MBJ A;  2JSC A;  3J81 K;  4C2U A;  1QA6 A;  1YS6 A;  3LSI A;  5HLH A;  3TED A;  1HKT A;  1S7O A;  1R58 A;  4E7I A;  3HSR A;  5AON A;  4LJZ F;  2VUM J;  5DD8 A;  2E1M C;  1UHW A;  2V9P A;  3MZ8 A;  4B3A A;  1X2N A;  2HVQ A;  4EJW A;  3WTT C;  4BGD A;  4J00 A;  2B9S A;  2V1X A;  3IH3 A;  3CCR I;  5F0H A;  2EFW A;  2ISZ A;  5J4V A;  1GVD A;  1D1A A;  3EDP A;  3E6M A;  2LYC A;  4XKV A;  5GP9 A;  2ID6 A;  5FLM J;  3IRR A;  4IF4 A;  4TV7 A;  1SEU A;  3S14 J;  1IXC A;  3M9A A;  3LOC A;  5FGM A;  4I02 A;  2ZXW H;  3DBL B;  3OOP A;  1D5V A;  2ZJ2 A;  2DYR H;  3KLO A;  3H3Z A;  2PJP A;  1A04 A;  4PGG A;  4PFO A;  3KP4 A;  1XGO A;  1HQC A;  1I27 A;  2Q0O A;  3Q3S A;  1O3Q A;  4E7K A;  3EUA A;  1V5E A;  2DFF A;  1CF7 A;  5HDN A;  4CCJ A;  4LK1 F;  4A3C J;  2CFX A;  1K4S A;  2H8W A;  4FE4 A;  2GOM A;  3S3M A;  2IA2 A;  1XSD A;  3I4N J;  1IW7 F;  1YIT I;  3L2U A;  3VWB A;  2MD0 A;  3BP8 A;  4CYC B;  4IHV A;  4UVA A;  3ZXS A;  5D6E A;  2F5F A;  4M9S A; 
#chains in the Genus database with same CATH homology
 5DTD A;  3HOW J;  2R5Y B;  3JR9 A;  3BG3 A;  1YRN B;  3OOU A;  4JX4 A;  4FIS A;  4JP0 A;  3MN2 A;  3G1O A;  3QQA A;  1Q1V A;  3ZQF A;  1MBH A;  3GTG J;  1JT6 A;  2EZH A;  1E3O C;  1MBG A;  2ECC A;  2I10 A;  5IP7 J;  3FK7 A;  2EZL A;  2X48 A;  4A3F J;  4FCY A;  1B8I B;  2DA3 A;  1BW6 A;  1MBE A;  1MH3 A;  1CQT A;  2G0E A;  1DU0 A;  1ETK A;  4NDL A;  3GTJ J;  4M3F A;  2VPR A;  3Q0V A;  3HB9 A;  1B8I A;  2JA5 J;  4DW6 A;  1A6I A;  2WB1 N;  1RPW A;  3UKG A;  2JA8 J;  4UUS A;  4A3M J;  4RBO A;  4M3D A;  4IHW A;  2HOS A;  3Q0W A;  1TWF J;  2YU9 J;  1Z77 A;  1IUF A;  2L7M P;  5M5Y J;  1JTY A;  3BR0 A;  4UUS B;  1ZQ3 P;  4M3E A;  3A01 A;  2E2I J;  3JRF A;  2LD5 A;  3B6C A;  5EZH A;  1I50 J;  2KT0 A;  2E2H J;  5EEA A;  4G12 A;  2R93 J;  1ENH A;  3S16 J;  2FJ1 A;  4XIC A;  1W0U A;  1T56 A;  1IV6 A;  5M3M J;  2R5Y A;  1ETY A;  4BBR J;  1RKT A;  3HGY A;  3ZOB A;  1BA5 A;  1VF9 A;  1OCT C;  2HXO A;  3BTC A;  3NAU A;  4XRS G;  3BQY A;  5IP9 J;  3GBG A;  4JX5 A;  5E3M A;  4M3G A;  1OFC X;  1VI0 A;  1AKH B;  1S7E A;  4M6V A;  1X58 A;  2Y9Y A;  3QPL A;  1FIP A;  4DYR A;  1ZR4 A;  4M3B A;  1NTC A;  1JGG A;  1ETV A;  2VKE A;  4I6Z A;  3JRH A;  1G2H A;  3HBL A;  5IOY A;  1PUF B;  1BJZ A;  4D7N A;  1ZR2 A;  4D5C A;  3O8H A;  1ETX A;  1ZKG A;  1MSF C;  4S0H B;  2JK3 A;  3W6V A;  2K9S A;  2XB0 X;  5FKL A;  1JUP A;  1ETQ A;  4A3J J;  3JRA A;  3M4O J;  2TCT A;  2LP0 A;  2D5V A;  2HDD A;  2LVS A;  1TWH J;  3K2A A;  2NS7 A;  5EDN A;  2ME0 A;  5F04 A;  3QPS A;  2CQQ A;  2R7Z J;  5J3L A;  2WAQ N;  4B4C A;  2FD5 A;  3K7A J;  3ZQC A;  4QTR A;  1JUM A;  1TWA J;  2LR8 A;  4FTH A;  3VPR A;  1I3Q J;  3OSF A;  3DEW A;  3JRI A;  4BY1 J;  3CQZ J;  3F0C A;  3WHB A;  2DA2 A;  2XPU A;  2AHQ A;  2JWT A;  3GTQ J;  3PM1 A;  2L9R A;  4A69 C;  2FQ4 A;  2O9L A;  1AHD P;  1H89 C;  1RR7 A;  3IH2 A;  2HXI A;  1U78 A;  3S1N J;  2YS9 A;  4C3H J;  4BY7 J;  2MGQ A;  2DMP A;  4A3G J;  5DS9 A;  2K40 A;  1ZK8 A;  1LFU P;  2P81 A;  4L5E A;  3RZO J;  5E3O A;  3HKZ N;  2ZB9 A;  1PUF A;  3JRE A;  4JX6 A;  1NK3 P;  2CRG A;  2Y0S N;  5FKK A;  2NS8 A;  3L1P A;  2DA6 A;  2W48 A;  3SFI A;  1JKP C;  4A3B J;  3CDL A;  1IG7 A;  4D7M A;  3FIW A;  1IGN A;  1MSE C;  2XGE A;  5IP6 A;  2M2E A;  3BR1 A;  5K7H A;  5FKO A;  3S1Q J;  1APL C;  1Z0X A;  1RKW A;  2FX0 A;  3ZQH A;  5IYC J;  1TC3 C;  1QVT A;  4QSH A;  1UMQ A;  3FKI J;  3RZD J;  2JN6 A;  1B72 A;  1ZTR A;  3Q0U A;  2LTP A;  4DYQ A;  2DN0 A;  3GTP J;  4V2F A;  4MFE A;  1FTT A;  1QRY A;  5IYB J;  2O8K A;  5JLW A;  3DCF A;  2X6O A;  1BW5 A;  2E2J J;  4IHY A;  1RET A;  3BR5 A;  1MNM C;  4C2M J;  4W97 A;  2COB A;  1JKR C;  4Y7N J;  1QVU A;  5FKN A;  3S2H J;  2QCO A;  5IYD J;  1Y1W J;  1OJL A;  2DA5 A;  2DA4 A;  1XG1 A;  2LY9 A;  2H1K A;  1ZGW A;  3S15 J;  1SAN A;  3G1M A;  2QF7 A;  2HI3 A;  4AC0 A;  1HF0 A;  4XK4 A;  4ABZ A;  5BNG A;  3BR6 A;  3HOY J;  3M3Y J;  2Y2Z A;  1X2M A;  2WV1 A;  2M34 A;  2DA1 A;  4HNV A;  2NVT J;  4BKX A;  5C44 J;  4X6A J;  3S1R J;  2L0K A;  1JJ6 C;  2E1O A;  2O7O A;  3BTI A;  3ZQL A;  1A5J A;  4RDU A;  3D1N I;  3LSG A;  2DTZ A;  3NAR A;  2GBY A;  1MBK A;  4MFD A;  3A03 A;  1I6H J;  2CU7 A;  1JUS A;  5EF6 A;  3B6A A;  2X9D A;  4W1U A;  5F1J A;  5EYR A;  4EEF G;  1GV5 A;  1H8A C;  2DJN A;  1RES A;  3BTL A;  4MIM A;  1JKO C;  3PO2 J;  2RAE A;  3IV5 A;  5EG0 B;  3GTO J;  5FLV A;  4XRM A;  1ORK A;  3WHC A;  1F36 A;  2GLO A;  3BT9 A;  2DMT A;  2HYJ A;  1B72 B;  4A3L J;  1XS9 A;  2K9N A;  1O4X A;  2LFB A;  2CJJ A;  1R9T J;  2YUS A;  4DYC A;  2GM4 A;  5C4J J;  3SJM A;  1IDZ A;  2IBD A;  1Y1V J;  2HOT A;  3A02 A;  1D5Y A;  3HOV J;  2CUE A;  3S2D J;  1EF4 A;  3GTK J;  1LE8 B;  1XC5 A;  3RKQ A;  1NK2 P;  2NVQ J;  2ECB A;  1WH5 A;  1WH7 A;  2XB5 A;  3MKL A;  2ELK A;  1WGX A;  4CYC A;  5FKM A;  3GTM J;  2AO9 A;  2M9H A;  2Y31 A;  1AU7 A;  1W0T A;  2MG4 A;  1LE8 A;  2H8R A;  3LSR A;  5K7F A;  3OIO A;  3HOU J;  2XRL A;  1FIA A;  4A3D J;  3JRB A;  3CMY A;  3E7L A;  1BL0 A;  1HDD C;  2CUF A;  5F0F A;  2M0C A;  3JRC A;  3H3V K;  5EGO B;  4C3J J;  1JT0 A;  1U9O A;  1WI3 A;  3BR2 A;  2B63 J;  1P7I A;  2HQ5 A;  5J1U A;  4DZP A;  5IPA A;  1K83 J;  2R0Q C;  2XPV A;  3BTJ A;  3SDG A;  2EQR A;  2NVY J;  2MW8 A;  4I76 A;  5E3N A;  2DMN A;  4V2G A;  5J1Y A;  5F27 A;  5M3F J;  1QPI A;  2ID3 A;  2LK2 A;  4MO7 A;  1WCM J;  3BG9 A;  3H0G J;  4IEJ A;  1FTZ A;  2XPW A;  9ANT A;  4DZJ A;  1IJW C;  5K7Z A;  1UG2 A;  1T33 A;  5C3E J;  1VFC A;  2NOG A;  1GT0 C;  4XID A;  3BR3 A;  2R5Z A;  4XRS A;  5FJ8 J;  2OF7 A;  1FJL A;  3HM5 A;  4Y52 J;  3ZQI A;  1TWG J;  2EZI A;  3LNQ A;  2XGD A;  1ETO A;  3S1M J;  5C4X J;  3RQI A;  4A3E J;  2K9Q A;  1SFO J;  4BXX J;  4GFB A;  4J19 A;  1F43 A;  1IC8 A;  4A3I J;  5E3L A;  3BG5 A;  2N8G A;  5GPA A;  3CCY A;  3HOZ J;  4AYB N;  1AKH A;  2TRT A;  2DMQ A;  1POG A;  4JYK A;  1DU6 A;  1P7J A;  3MVP A;  5IOZ A;  1K61 A;  4QIW N;  1IDY A;  1H88 C;  2XSD C;  2PMZ N;  5JLX A;  1JTX A;  1OCP A;  3LSP A;  1YRN A;  2LLK A;  5F08 A;  4B1R A;  3GTL J;  3OSG A;  4AUX A;  2HOA A;  5EG0 A;  3TP3 A;  1MH4 A;  1ETW A;  1MBF A;  3BQZ A;  2LKX A;  3FIS A;  4UUT A;  4BBS J;  3JRD A;  2JA6 J;  2VI6 A;  3TW7 A;  5HOD A;  2Y9Z A;  1TWC J;  3IH4 A;  1MBJ A;  4D5F A;  3TED A;  3S17 J;  5F0C A;  2JJ7 A;  1IRZ A;  1JJ8 C;  3G1L A;  3LSJ A;  2R5Z B;  5EZG A;  1HDP A;  2VUM J;  3C2B A;  2MSY A;  2R92 J;  2DA7 A;  4B3A A;  1X2N A;  1GV2 A;  3A01 B;  1U9N A;  4A93 J;  3IH3 A;  3TW6 A;  3I4M J;  5F0H A;  4MLO A;  1WPK A;  5GPC A;  1GVD A;  4X1E A;  1UHS A;  2XGC A;  4LOC A;  3O8G A;  1GUU A;  2JMW A;  2ID6 A;  3FK6 A;  2OPT A;  3HGG A;  2E19 A;  5GP9 A;  5FLM J;  1GDT A;  2NVX J;  3JRG A;  1LFB A;  1ITY A;  4FE7 A;  1HCR A;  3S14 J;  2CQX A;  3LOC A;  1VND A;  2Y30 A;  2DMU A;  2EBI A;  1FEX A;  5J1R A;  2JA7 J;  3HEF A;  1JKQ C;  4A3K J;  4C3I J;  5EGO A;  5M5W J;  3Q3S A;  3HOX J;  5M5X J;  2L7Z A;  1HLV A;  2EZK A;  3ZQG A;  3PO3 J;  4A3C J;  3TP0 A;  4FE4 A;  2IAI A;  3I4N J;  1HOM A;  2L7F P;  3HDD A;  4IHV A;  4CYC B;  2IEK A;  2KDZ A;  1U8B A;  2ME6 A;  2VKV A;  4IHX A;  2EH3 A;  2M8G X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...