1UMSA

Stromelysin-1 catalytic domain with hydrophobic inhibitor bound, ph 7.0, 32oc, 20 mm cacl2, 15% acetonitrile; nmr ensemble of 20 structures
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
166
structure length
166
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STROMELYSIN-1
publication title Solution structure of the catalytic domain of human stromelysin complexed with a hydrophobic inhibitor.
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 31
structure length 166
sequence length 166
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1995-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1umsA00
2OW0A 3K7LA 1MNCA 1USNA 3G42A 3UVCA 5L7FA 1JIWP 1OM6A 1SATA 1HY7A 2SRTA 2RJQA 3HDAP 5I2ZA 3TT4A 3F16A 4GUYA 1MMPA 1PWWA 1HFSA 2L0RA 5L79A 5I12A 4WK7A 1DMTA 1JH1A 4H76A 2E2DA 3EDHA 1JIZA 2WO9A 3KECA 5B5PA 3HY7A 2E3XA 1KUIA 4IN9A 1JAQA 3TVCA 1D7XA 3LUNA 4WKEA 1RM8A 1YCMA 3HYGA 1GXDA 1G9KA 3KEKA 4L63A 2CKIA 3WV1A 3LMCA 3F19A 3LUMA 2X3AA 4DPEA 1Y0VA 3ELMA 4AIGA 2DW1A 3KMCA 1S4BP 1OMJA 4H2EA 1GO7P 4WZVA 4ON1A 2EROA 2OXWA 3CKIA 3DPEA 1MMQA 1BKCA 2OY2A 3I7GA 4G9LA 1ROSA 3Q2HA 2Y6CA 2JT5A 2N8RA 3USNA 1CGEA 1K7GA 3KMEA 3TSKA 1BZSA 3LIKA 3E8RA 3O2XA 5B5OA 1BIWA 1MMRA 3AIGA 4DF9A 2DW0A 1XUCA 5JMYA 1IAGA 5I3MA 2OW2A 4JIJA 1ZP5A 4HMAA 5BOYA 1R55A 1AKLA 1PWQA 1G05A 1CAQA 3EWJA 4GR8A 2J0TA 1OO9A 1XFXA 3HB2P 3KRYA 2OZRA 1JJ9A 1G4KA 1BKCE 2DDFA 2POJA 2Z2DA 2K2GA 4AUOA 3DNGA 1IAEA 1OM8A 3DPFA 1UMSA 2OI0A 4GF1A 4PKTA 2J83A 3RTTA 2W14A 4GR3A 4JP4A 4AYKA 1BM6A 5D7WA 1UEAA 3N2VA 1CGLA 1I1IP 1KBCA 2TCLA 1FLSA 3KWVC 1I73A 3LQBA 4FU4A 1O0QA 1RMZA 3MA2A 5CZMA 2RJPA 3LE9A 4XM7A 1CIZA 2X3BA 1EAKA 4H84A 1FM1A 3BA0A 1EB6A 3EDGA 456CA 2JIHA 2QPJA 2YIGA 1YOUA 2V4BA 1HV5A 4PKSA 1HTDA 1SLMA 3KHIA 3F15A 2FV5A 2X7MA 4DD8A 4CTHA 4H82A 3DSLA 2DDYA 1ZVXA 1CQRA 3LIRA 1XFYA 1R54A 4H49A 1IABA 1IAAA 1SLNA 1OS2A 4A3WA 1EUBA 3F1AA 1KAPP 3B8ZA 3U1RA 2D1NA 1A86A 4G0DA 2W15A 1OM7A 4L6TA 1R1IA 1ND1A 1SU3A 1JK3A 1YP1A 1ASTA 5LABA 1XFVA 4L19A 1MMBA 2OY4A 3F17A 4ZR5A 1JAPA 4IUWA 2AYKA 2K9CA 2MZHA 3TS4A 4H1QA 1R1HA 2OXUA 1BUDA 1ZTQA 966CA 1GKCA 1R1JA 2X3CA 4I35A 3AYUA 5H8XA 3EDIA 5CUHA 1UTZA 5I43A 1GKDA 4H3XA 3KEJA 4JQGA 2OVZA 3EHYA 3HY9A 1IADA 4JPAA 1CGFA 1GE7A 5I4OA 3Q2GA 5D1TA 1Y8JA 4GWMA 2W13A 5D1UA 1K7QA 4PKUA 1AYKA 3F18A 5BOTA 3B2ZA 2HU6A 1XFUA 1QUAA 3LGPA 1O0TA 3ZUKA 1BUVM 3B92A 3RTSA 1BKCI 1D5JA 1H71P 1Q3AA 1L6JA 2USNA 1BQOA 3P1VA 3K7NA 4EFSA 1KUFA 3SHIA 1GE5A 1JAOA 3I7IA 4XBHA 2W12A 1CXVA 4PKWA 1FBLA 2ERQA 3LJTA 2OW9A 1CK7A 4ILWD 3LK8A 4FVLA 2PJTA 2W0DA 1I76A 1J7NA 1ZXVA 1OS9A 3GBOA 1XURA 1XFWA 3WV2A 3HDBA 1PWPA 3DL1A 3P24A 1C8TA 3L0VA 2ERPA 3O64A 3LJZA 2AIGP 1JKYA 1ATLA 1XFZA 2JSDA 5BPAA 2O36A 4H30A 4JA1A 4WF6A 1QJIA 2MZIA 1KUHA 3ZVSA 2CLTA 3OHLA 3EDZA 1WNIA 2OVXA 1G49A 1QIBA 1K7IA 1B3DA 1B8YA 3L0TA 1KUGA 1Z3JA 4R3VA 3V96B 2D1OA 1AF0A 1YQYA 1KUKA 1JANA 2MLRA 3LILA 3WV3A 2DW2A 4XM6A 1PWVA 3VTGA 4GR0A 4XM8A 4A7BA 2XS4A 3OHOA 3HBUP 5I0LA 2XS3A 5D3CA 3ZXHA 2KRJA 4GQLA 5D1SA 4FXYP 2WO8A 1D8MA 2WOAA 1G12A 1GE6A 4HX3A 1ZXCA 5D2BA 1ZS0A 1SRPA 4PKQA 4Q1LA 1UMTA 1QIAA 1HFCA 1XUDA 2FV9A 1BSWA 3G5CA 4WKIA 1A85A 2Y6DA 3HBVP 2O3EA 3DWBA 2YB9A 1QJJA 3AYKA 2MZEA 1PWUA 4PKVA 4QKZA 3LJGA 2OW1A 2A8HA 3LKAA 4GWNA 1Y93A 2JT6A 2MLSA 1GO8P 3LQ0A 4XCTA 830CA 1DTHA 3NX7A 4AXQA 3LEAA 1QICA 2I47A 4J4MA 4DV8A 3VI1A 1D8FA 2OXZA 1IACA 1BQQM 3N2UA 1C7KA 1SMPA 4IJOA 3EHXA 1UTTA 4FXQA 1HOVA 2JNPA 5CXAA 4PKRA 1C3IA 4I03A
chains in the Genus database with same CATH superfamily
2OW0A 3K7LA 1MNCA 1USNA 3G42A 3UVCA 5L7FA 1JIWP 1OM6A 1SATA 1HY7A 2SRTA 2RJQA 3HDAP 2YUFA 5I2ZA 3TT4A 3F16A 4GUYA 1MMPA 1PWWA 1HFSA 2L0RA 5L79A 5I12A 4WK7A 1DMTA 1JH1A 4H76A 2E2DA 3EDHA 1JIZA 2WO9A 3KECA 5B5PA 3HY7A 2E3XA 1KUIA 4IN9A 1JAQA 3TVCA 1D7XA 3LUNA 4WKEA 1RM8A 1YCMA 3DTEA 3HYGA 1GXDA 1G9KA 3KEKA 4L63A 2CKIA 3WV1A 3LMCA 3F19A 3LUMA 2X3AA 4DPEA 1Y0VA 3ELMA 4AIGA 2DW1A 3KMCA 1S4BP 1OMJA 4H2EA 1GO7P 4WZVA 4ON1A 2EROA 2OXWA 3CKIA 3DPEA 1MMQA 1BKCA 2OY2A 3I7GA 4G9LA 1ROSA 3Q2HA 2Y6CA 2JT5A 2N8RA 3USNA 1CGEA 1K7GA 3KMEA 3TSKA 1BZSA 3LIKA 3E8RA 3O2XA 5B5OA 1BIWA 1MMRA 3AIGA 4DF9A 2DW0A 1XUCA 5JMYA 1IAGA 5I3MA 2OW2A 4JIJA 1ZP5A 4HMAA 5BOYA 1R55A 1AKLA 1PWQA 1G05A 1CAQA 3EWJA 4GR8A 2J0TA 1OO9A 1XFXA 3HB2P 3KRYA 2OZRA 1JJ9A 1G4KA 1BKCE 2DDFA 2POJA 2Z2DA 2K2GA 4AUOA 3DNGA 1IAEA 1OM8A 3DPFA 1UMSA 1OZ9A 2OI0A 4GF1A 4PKTA 2J83A 3RTTA 2W14A 4GR3A 4JP4A 4AYKA 1BM6A 5D7WA 1UEAA 3N2VA 1CGLA 3DTIA 1I1IP 1KBCA 2TCLA 1FLSA 3KWVC 1I73A 3LQBA 4FU4A 1O0QA 1RMZA 3MA2A 5CZMA 2RJPA 3LE9A 4XM7A 1CIZA 2X3BA 1EAKA 4H84A 1FM1A 3BA0A 1EB6A 3EDGA 456CA 2JIHA 2QPJA 2YIGA 1YOUA 2V4BA 1HV5A 4PKSA 1HTDA 1SLMA 3KHIA 3F15A 2FV5A 2X7MA 4DD8A 4CTHA 4H82A 1XAXA 3DSLA 2DDYA 1ZVXA 1CQRA 3LIRA 1XFYA 1R54A 4H49A 1IABA 1IAAA 1SLNA 1OS2A 4A3WA 1EUBA 3F1AA 1KAPP 3B8ZA 3U1RA 2D1NA 1A86A 4G0DA 2W15A 1OM7A 4L6TA 1R1IA 1ND1A 1SU3A 1JK3A 1YP1A 1ASTA 5LABA 1XFVA 4L19A 1MMBA 2OY4A 3F17A 4ZR5A 1JAPA 4IUWA 2AYKA 2K9CA 2MZHA 3TS4A 4H1QA 1R1HA 2OXUA 1BUDA 1ZTQA 966CA 1GKCA 1R1JA 2X3CA 4I35A 3AYUA 5H8XA 3EDIA 5CUHA 1UTZA 5I43A 1GKDA 4H3XA 3KEJA 4JQGA 2OVZA 3EHYA 3HY9A 1IADA 4JPAA 1CGFA 1GE7A 5I4OA 3Q2GA 5D1TA 1Y8JA 4GWMA 2W13A 5D1UA 1K7QA 4PKUA 1AYKA 3F18A 5BOTA 3B2ZA 2HU6A 1TVIA 1QUAA 1XFUA 3LGPA 1O0TA 3ZUKA 1BUVM 3B92A 3RTSA 1BKCI 1D5JA 1H71P 1Q3AA 1L6JA 2USNA 1BQOA 3P1VA 3K7NA 4L7AA 4EFSA 1KUFA 3SHIA 1GE5A 3DTKA 1JAOA 3I7IA 4XBHA 2W12A 1CXVA 4PKWA 1FBLA 2ERQA 3LJTA 2OW9A 1CK7A 4ILWD 3LK8A 4FVLA 2PJTA 2W0DA 1I76A 1J7NA 1ZXVA 1OS9A 3GBOA 1XURA 1XFWA 3WV2A 3HDBA 1PWPA 3DL1A 3P24A 1C8TA 3L0VA 2ERPA 3O64A 3LJZA 2AIGP 1JKYA 1ATLA 1XFZA 2JSDA 5BPAA 2O36A 4H30A 4JA1A 4WF6A 1QJIA 2MZIA 1KUHA 3ZVSA 2CLTA 3OHLA 3EDZA 1WNIA 2OVXA 1G49A 1QIBA 1K7IA 1B3DA 1B8YA 3L0TA 1KUGA 1Z3JA 4R3VA 3V96B 2D1OA 1AF0A 1YQYA 1KUKA 1JANA 2MLRA 3LILA 3WV3A 2DW2A 4XM6A 1PWVA 3VTGA 4GR0A 1XM5A 4XM8A 4A7BA 2XS4A 3OHOA 3HBUP 5I0LA 2XS3A 5D3CA 3ZXHA 2KRJA 4GQLA 5D1SA 4FXYP 2WO8A 1D8MA 2WOAA 1G12A 1GE6A 4HX3A 1ZXCA 5D2BA 1ZS0A 1SRPA 4PKQA 4Q1LA 1UMTA 1QIAA 1HFCA 1XUDA 2FV9A 1BSWA 3G5CA 4WKIA 1A85A 2Y6DA 3HBVP 2O3EA 3DWBA 2YB9A 1QJJA 3AYKA 2MZEA 1PWUA 4PKVA 4QKZA 3LJGA 2OW1A 2A8HA 3LKAA 4GWNA 1Y93A 2JT6A 2MLSA 1GO8P 3LQ0A 4XCTA 830CA 1DTHA 3NX7A 4AXQA 3LEAA 1QICA 2I47A 4J4MA 4DV8A 3VI1A 1D8FA 2OXZA 1IACA 1BQQM 3N2UA 1C7KA 1SMPA 4IJOA 3EHXA 1UTTA 4FXQA 1HOVA 2JNPA 5CXAA 4PKRA 1C3IA 4I03A
chains in the Genus database with same CATH topology
2OW0A 3K7LA 1MNCA 1USNA 3G42A 3UVCA 5L7FA 1JIWP 1OM6A 1SATA 1HY7A 2SRTA 2RJQA 3HDAP 2YUFA 5I2ZA 3TT4A 3F16A 4GUYA 1MMPA 1PWWA 1HFSA 2L0RA 5L79A 5I12A 4WK7A 1DMTA 1JH1A 4H76A 2E2DA 3EDHA 1JIZA 2WO9A 3KECA 5B5PA 3HY7A 2E3XA 1KUIA 4IN9A 1JAQA 3TVCA 1D7XA 3LUNA 4WKEA 1RM8A 1YCMA 3DTEA 3HYGA 1GXDA 1G9KA 3KEKA 4L63A 2CKIA 3WV1A 3LMCA 3F19A 3LUMA 2X3AA 4DPEA 1Y0VA 3ELMA 4AIGA 2DW1A 3KMCA 1S4BP 1OMJA 4H2EA 1GO7P 4WZVA 4ON1A 2EROA 2OXWA 3CKIA 3DPEA 1MMQA 1BKCA 2OY2A 3I7GA 4G9LA 1ROSA 3Q2HA 2Y6CA 2JT5A 2N8RA 3USNA 1CGEA 1K7GA 3KMEA 3TSKA 1BZSA 3LIKA 3E8RA 3O2XA 5B5OA 1BIWA 1MMRA 3AIGA 4DF9A 2DW0A 1XUCA 5JMYA 1IAGA 5I3MA 2OW2A 4JIJA 1ZP5A 4HMAA 5BOYA 1R55A 1AKLA 1PWQA 1G05A 1CAQA 3EWJA 4GR8A 2J0TA 1OO9A 1XFXA 3HB2P 3KRYA 2OZRA 1JJ9A 1G4KA 1BKCE 2DDFA 2POJA 2Z2DA 2K2GA 4AUOA 3DNGA 1IAEA 1OM8A 3DPFA 1UMSA 2OI0A 4GF1A 4PKTA 2J83A 3RTTA 2W14A 4GR3A 4JP4A 4AYKA 1BM6A 5D7WA 1UEAA 3N2VA 1CGLA 3DTIA 1I1IP 1KBCA 2TCLA 1FLSA 3KWVC 1I73A 3LQBA 4FU4A 1O0QA 1RMZA 3MA2A 5CZMA 2RJPA 3LE9A 4XM7A 1CIZA 2X3BA 1EAKA 4H84A 1FM1A 3BA0A 1EB6A 3EDGA 456CA 2JIHA 2QPJA 2YIGA 1YOUA 2V4BA 1HV5A 4PKSA 1HTDA 1SLMA 3KHIA 3F15A 2FV5A 2X7MA 4DD8A 4CTHA 4H82A 3DSLA 2DDYA 1ZVXA 1CQRA 3LIRA 1XFYA 1R54A 4H49A 1IABA 1IAAA 1SLNA 1OS2A 4A3WA 1EUBA 3F1AA 1KAPP 3B8ZA 3U1RA 2D1NA 1A86A 4G0DA 2W15A 1OM7A 4L6TA 1R1IA 1ND1A 1SU3A 1JK3A 1YP1A 1ASTA 5LABA 1XFVA 4L19A 1MMBA 2OY4A 3F17A 4ZR5A 1JAPA 4IUWA 2AYKA 2K9CA 2MZHA 3TS4A 4H1QA 1R1HA 2OXUA 1BUDA 1ZTQA 966CA 1GKCA 1R1JA 2X3CA 4I35A 3AYUA 5H8XA 3EDIA 5CUHA 1UTZA 5I43A 1GKDA 4H3XA 3KEJA 4JQGA 2OVZA 3EHYA 3HY9A 1IADA 4JPAA 1CGFA 1GE7A 5I4OA 3Q2GA 5D1TA 1Y8JA 4GWMA 2W13A 5D1UA 1K7QA 4PKUA 1AYKA 3F18A 5BOTA 3B2ZA 2HU6A 1XFUA 1QUAA 3LGPA 1O0TA 3ZUKA 1BUVM 3B92A 3RTSA 1BKCI 1D5JA 1H71P 1Q3AA 1L6JA 2USNA 1BQOA 3P1VA 3K7NA 4L7AA 4EFSA 1KUFA 3SHIA 1GE5A 3DTKA 1JAOA 3I7IA 4XBHA 2W12A 1CXVA 4PKWA 1FBLA 2ERQA 3LJTA 2OW9A 1CK7A 4ILWD 3LK8A 4FVLA 2PJTA 2W0DA 1I76A 1J7NA 1ZXVA 1OS9A 3GBOA 1XURA 1XFWA 3WV2A 3HDBA 1PWPA 3DL1A 3P24A 1C8TA 3L0VA 2ERPA 3O64A 3LJZA 2AIGP 1JKYA 1ATLA 1XFZA 2JSDA 5BPAA 2O36A 4H30A 4JA1A 4WF6A 1QJIA 2MZIA 1KUHA 3ZVSA 2CLTA 3OHLA 3EDZA 1WNIA 2OVXA 1G49A 1QIBA 1K7IA 1B3DA 1B8YA 3L0TA 1KUGA 1Z3JA 4R3VA 3V96B 2D1OA 1AF0A 1YQYA 1KUKA 1JANA 2MLRA 3LILA 3WV3A 2DW2A 4XM6A 1PWVA 3VTGA 4GR0A 4XM8A 4A7BA 2XS4A 3OHOA 3HBUP 5I0LA 2XS3A 5D3CA 3ZXHA 2KRJA 4GQLA 5D1SA 4FXYP 2WO8A 1D8MA 2WOAA 1G12A 1GE6A 4HX3A 1ZXCA 5D2BA 1ZS0A 1SRPA 4PKQA 4Q1LA 1UMTA 1QIAA 1HFCA 1XUDA 2FV9A 1BSWA 3G5CA 4WKIA 1A85A 2Y6DA 3HBVP 2O3EA 3DWBA 2YB9A 1QJJA 3AYKA 2MZEA 1PWUA 4PKVA 4QKZA 3LJGA 2OW1A 2A8HA 3LKAA 4GWNA 1Y93A 2JT6A 2MLSA 1GO8P 3LQ0A 4XCTA 830CA 1DTHA 3NX7A 4AXQA 3LEAA 1QICA 2I47A 4J4MA 4DV8A 3VI1A 1D8FA 2OXZA 1IACA 1BQQM 3N2UA 1C7KA 1SMPA 4IJOA 3EHXA 1UTTA 4FXQA 1HOVA 2JNPA 5CXAA 4PKRA 1C3IA 4I03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OW0 A;  3K7L A;  1MNC A;  1USN A;  3G42 A;  3UVC A;  5L7F A;  1JIW P;  1OM6 A;  1SAT A;  1HY7 A;  2SRT A;  2RJQ A;  3HDA P;  5I2Z A;  3TT4 A;  3F16 A;  4GUY A;  1MMP A;  1PWW A;  1HFS A;  2L0R A;  5L79 A;  5I12 A;  4WK7 A;  1DMT A;  1JH1 A;  4H76 A;  2E2D A;  3EDH A;  1JIZ A;  2WO9 A;  3KEC A;  5B5P A;  3HY7 A;  2E3X A;  1KUI A;  4IN9 A;  1JAQ A;  3TVC A;  1D7X A;  3LUN A;  4WKE A;  1RM8 A;  1YCM A;  3HYG A;  1GXD A;  1G9K A;  3KEK A;  4L63 A;  2CKI A;  3WV1 A;  3LMC A;  3F19 A;  3LUM A;  2X3A A;  4DPE A;  1Y0V A;  3ELM A;  4AIG A;  2DW1 A;  3KMC A;  1S4B P;  1OMJ A;  4H2E A;  1GO7 P;  4WZV A;  4ON1 A;  2ERO A;  2OXW A;  3CKI A;  3DPE A;  1MMQ A;  1BKC A;  2OY2 A;  3I7G A;  4G9L A;  1ROS A;  3Q2H A;  2Y6C A;  2JT5 A;  2N8R A;  3USN A;  1CGE A;  1K7G A;  3KME A;  3TSK A;  1BZS A;  3LIK A;  3E8R A;  3O2X A;  5B5O A;  1BIW A;  1MMR A;  3AIG A;  4DF9 A;  2DW0 A;  1XUC A;  5JMY A;  1IAG A;  5I3M A;  2OW2 A;  4JIJ A;  1ZP5 A;  4HMA A;  5BOY A;  1R55 A;  1AKL A;  1PWQ A;  1G05 A;  1CAQ A;  3EWJ A;  4GR8 A;  2J0T A;  1OO9 A;  1XFX A;  3HB2 P;  3KRY A;  2OZR A;  1JJ9 A;  1G4K A;  1BKC E;  2DDF A;  2POJ A;  2Z2D A;  2K2G A;  4AUO A;  3DNG A;  1IAE A;  1OM8 A;  3DPF A;  1UMS A;  2OI0 A;  4GF1 A;  4PKT A;  2J83 A;  3RTT A;  2W14 A;  4GR3 A;  4JP4 A;  4AYK A;  1BM6 A;  5D7W A;  1UEA A;  3N2V A;  1CGL A;  1I1I P;  1KBC A;  2TCL A;  1FLS A;  3KWV C;  1I73 A;  3LQB A;  4FU4 A;  1O0Q A;  1RMZ A;  3MA2 A;  5CZM A;  2RJP A;  3LE9 A;  4XM7 A;  1CIZ A;  2X3B A;  1EAK A;  4H84 A;  1FM1 A;  3BA0 A;  1EB6 A;  3EDG A;  456C A;  2JIH A;  2QPJ A;  2YIG A;  1YOU A;  2V4B A;  1HV5 A;  4PKS A;  1HTD A;  1SLM A;  3KHI A;  3F15 A;  2FV5 A;  2X7M A;  4DD8 A;  4CTH A;  4H82 A;  3DSL A;  2DDY A;  1ZVX A;  1CQR A;  3LIR A;  1XFY A;  1R54 A;  4H49 A;  1IAB A;  1IAA A;  1SLN A;  1OS2 A;  4A3W A;  1EUB A;  3F1A A;  1KAP P;  3B8Z A;  3U1R A;  2D1N A;  1A86 A;  4G0D A;  2W15 A;  1OM7 A;  4L6T A;  1R1I A;  1ND1 A;  1SU3 A;  1JK3 A;  1YP1 A;  1AST A;  5LAB A;  1XFV A;  4L19 A;  1MMB A;  2OY4 A;  3F17 A;  4ZR5 A;  1JAP A;  4IUW A;  2AYK A;  2K9C A;  2MZH A;  3TS4 A;  4H1Q A;  1R1H A;  2OXU A;  1BUD A;  1ZTQ A;  966C A;  1GKC A;  1R1J A;  2X3C A;  4I35 A;  3AYU A;  5H8X A;  3EDI A;  5CUH A;  1UTZ A;  5I43 A;  1GKD A;  4H3X A;  3KEJ A;  4JQG A;  2OVZ A;  3EHY A;  3HY9 A;  1IAD A;  4JPA A;  1CGF A;  1GE7 A;  5I4O A;  3Q2G A;  5D1T A;  1Y8J A;  4GWM A;  2W13 A;  5D1U A;  1K7Q A;  4PKU A;  1AYK A;  3F18 A;  5BOT A;  3B2Z A;  2HU6 A;  1XFU A;  1QUA A;  3LGP A;  1O0T A;  3ZUK A;  1BUV M;  3B92 A;  3RTS A;  1BKC I;  1D5J A;  1H71 P;  1Q3A A;  1L6J A;  2USN A;  1BQO A;  3P1V A;  3K7N A;  4EFS A;  1KUF A;  3SHI A;  1GE5 A;  1JAO A;  3I7I A;  4XBH A;  2W12 A;  1CXV A;  4PKW A;  1FBL A;  2ERQ A;  3LJT A;  2OW9 A;  1CK7 A;  4ILW D;  3LK8 A;  4FVL A;  2PJT A;  2W0D A;  1I76 A;  1J7N A;  1ZXV A;  1OS9 A;  3GBO A;  1XUR A;  1XFW A;  3WV2 A;  3HDB A;  1PWP A;  3DL1 A;  3P24 A;  1C8T A;  3L0V A;  2ERP A;  3O64 A;  3LJZ A;  2AIG P;  1JKY A;  1ATL A;  1XFZ A;  2JSD A;  5BPA A;  2O36 A;  4H30 A;  4JA1 A;  4WF6 A;  1QJI A;  2MZI A;  1KUH A;  3ZVS A;  2CLT A;  3OHL A;  3EDZ A;  1WNI A;  2OVX A;  1G49 A;  1QIB A;  1K7I A;  1B3D A;  1B8Y A;  3L0T A;  1KUG A;  1Z3J A;  4R3V A;  3V96 B;  2D1O A;  1AF0 A;  1YQY A;  1KUK A;  1JAN A;  2MLR A;  3LIL A;  3WV3 A;  2DW2 A;  4XM6 A;  1PWV A;  3VTG A;  4GR0 A;  4XM8 A;  4A7B A;  2XS4 A;  3OHO A;  3HBU P;  5I0L A;  2XS3 A;  5D3C A;  3ZXH A;  2KRJ A;  4GQL A;  5D1S A;  4FXY P;  2WO8 A;  1D8M A;  2WOA A;  1G12 A;  1GE6 A;  4HX3 A;  1ZXC A;  5D2B A;  1ZS0 A;  1SRP A;  4PKQ A;  4Q1L A;  1UMT A;  1QIA A;  1HFC A;  1XUD A;  2FV9 A;  1BSW A;  3G5C A;  4WKI A;  1A85 A;  2Y6D A;  3HBV P;  2O3E A;  3DWB A;  2YB9 A;  1QJJ A;  3AYK A;  2MZE A;  1PWU A;  4PKV A;  4QKZ A;  3LJG A;  2OW1 A;  2A8H A;  3LKA A;  4GWN A;  1Y93 A;  2JT6 A;  2MLS A;  1GO8 P;  3LQ0 A;  4XCT A;  830C A;  1DTH A;  3NX7 A;  4AXQ A;  3LEA A;  1QIC A;  2I47 A;  4J4M A;  4DV8 A;  3VI1 A;  1D8F A;  2OXZ A;  1IAC A;  1BQQ M;  3N2U A;  1C7K A;  1SMP A;  4IJO A;  3EHX A;  1UTT A;  4FXQ A;  1HOV A;  2JNP A;  5CXA A;  4PKR A;  1C3I A;  4I03 A; 
#chains in the Genus database with same CATH topology
 2OW0 A;  3K7L A;  1MNC A;  1USN A;  3G42 A;  3UVC A;  5L7F A;  1JIW P;  1OM6 A;  1SAT A;  1HY7 A;  2SRT A;  2RJQ A;  3HDA P;  2YUF A;  5I2Z A;  3TT4 A;  3F16 A;  4GUY A;  1MMP A;  1PWW A;  1HFS A;  2L0R A;  5L79 A;  5I12 A;  4WK7 A;  1DMT A;  1JH1 A;  4H76 A;  2E2D A;  3EDH A;  1JIZ A;  2WO9 A;  3KEC A;  5B5P A;  3HY7 A;  2E3X A;  1KUI A;  4IN9 A;  1JAQ A;  3TVC A;  1D7X A;  3LUN A;  4WKE A;  1RM8 A;  1YCM A;  3DTE A;  3HYG A;  1GXD A;  1G9K A;  3KEK A;  4L63 A;  2CKI A;  3WV1 A;  3LMC A;  3F19 A;  3LUM A;  2X3A A;  4DPE A;  1Y0V A;  3ELM A;  4AIG A;  2DW1 A;  3KMC A;  1S4B P;  1OMJ A;  4H2E A;  1GO7 P;  4WZV A;  4ON1 A;  2ERO A;  2OXW A;  3CKI A;  3DPE A;  1MMQ A;  1BKC A;  2OY2 A;  3I7G A;  4G9L A;  1ROS A;  3Q2H A;  2Y6C A;  2JT5 A;  2N8R A;  3USN A;  1CGE A;  1K7G A;  3KME A;  3TSK A;  1BZS A;  3LIK A;  3E8R A;  3O2X A;  5B5O A;  1BIW A;  1MMR A;  3AIG A;  4DF9 A;  2DW0 A;  1XUC A;  5JMY A;  1IAG A;  5I3M A;  2OW2 A;  4JIJ A;  1ZP5 A;  4HMA A;  5BOY A;  1R55 A;  1AKL A;  1PWQ A;  1G05 A;  1CAQ A;  3EWJ A;  4GR8 A;  2J0T A;  1OO9 A;  1XFX A;  3HB2 P;  3KRY A;  2OZR A;  1JJ9 A;  1G4K A;  1BKC E;  2DDF A;  2POJ A;  2Z2D A;  2K2G A;  4AUO A;  3DNG A;  1IAE A;  1OM8 A;  3DPF A;  1UMS A;  1OZ9 A;  2OI0 A;  4GF1 A;  4PKT A;  2J83 A;  3RTT A;  2W14 A;  4GR3 A;  4JP4 A;  4AYK A;  1BM6 A;  5D7W A;  1UEA A;  3N2V A;  1CGL A;  3DTI A;  1I1I P;  1KBC A;  2TCL A;  1FLS A;  3KWV C;  1I73 A;  3LQB A;  4FU4 A;  1O0Q A;  1RMZ A;  3MA2 A;  5CZM A;  2RJP A;  3LE9 A;  4XM7 A;  1CIZ A;  2X3B A;  1EAK A;  4H84 A;  1FM1 A;  3BA0 A;  1EB6 A;  3EDG A;  456C A;  2JIH A;  2QPJ A;  2YIG A;  1YOU A;  2V4B A;  1HV5 A;  4PKS A;  1HTD A;  1SLM A;  3KHI A;  3F15 A;  2FV5 A;  2X7M A;  4DD8 A;  4CTH A;  4H82 A;  1XAX A;  3DSL A;  2DDY A;  1ZVX A;  1CQR A;  3LIR A;  1XFY A;  1R54 A;  4H49 A;  1IAB A;  1IAA A;  1SLN A;  1OS2 A;  4A3W A;  1EUB A;  3F1A A;  1KAP P;  3B8Z A;  3U1R A;  2D1N A;  1A86 A;  4G0D A;  2W15 A;  1OM7 A;  4L6T A;  1R1I A;  1ND1 A;  1SU3 A;  1JK3 A;  1YP1 A;  1AST A;  5LAB A;  1XFV A;  4L19 A;  1MMB A;  2OY4 A;  3F17 A;  4ZR5 A;  1JAP A;  4IUW A;  2AYK A;  2K9C A;  2MZH A;  3TS4 A;  4H1Q A;  1R1H A;  2OXU A;  1BUD A;  1ZTQ A;  966C A;  1GKC A;  1R1J A;  2X3C A;  4I35 A;  3AYU A;  5H8X A;  3EDI A;  5CUH A;  1UTZ A;  5I43 A;  1GKD A;  4H3X A;  3KEJ A;  4JQG A;  2OVZ A;  3EHY A;  3HY9 A;  1IAD A;  4JPA A;  1CGF A;  1GE7 A;  5I4O A;  3Q2G A;  5D1T A;  1Y8J A;  4GWM A;  2W13 A;  5D1U A;  1K7Q A;  4PKU A;  1AYK A;  3F18 A;  5BOT A;  3B2Z A;  2HU6 A;  1TVI A;  1QUA A;  1XFU A;  3LGP A;  1O0T A;  3ZUK A;  1BUV M;  3B92 A;  3RTS A;  1BKC I;  1D5J A;  1H71 P;  1Q3A A;  1L6J A;  2USN A;  1BQO A;  3P1V A;  3K7N A;  4L7A A;  4EFS A;  1KUF A;  3SHI A;  1GE5 A;  3DTK A;  1JAO A;  3I7I A;  4XBH A;  2W12 A;  1CXV A;  4PKW A;  1FBL A;  2ERQ A;  3LJT A;  2OW9 A;  1CK7 A;  4ILW D;  3LK8 A;  4FVL A;  2PJT A;  2W0D A;  1I76 A;  1J7N A;  1ZXV A;  1OS9 A;  3GBO A;  1XUR A;  1XFW A;  3WV2 A;  3HDB A;  1PWP A;  3DL1 A;  3P24 A;  1C8T A;  3L0V A;  2ERP A;  3O64 A;  3LJZ A;  2AIG P;  1JKY A;  1ATL A;  1XFZ A;  2JSD A;  5BPA A;  2O36 A;  4H30 A;  4JA1 A;  4WF6 A;  1QJI A;  2MZI A;  1KUH A;  3ZVS A;  2CLT A;  3OHL A;  3EDZ A;  1WNI A;  2OVX A;  1G49 A;  1QIB A;  1K7I A;  1B3D A;  1B8Y A;  3L0T A;  1KUG A;  1Z3J A;  4R3V A;  3V96 B;  2D1O A;  1AF0 A;  1YQY A;  1KUK A;  1JAN A;  2MLR A;  3LIL A;  3WV3 A;  2DW2 A;  4XM6 A;  1PWV A;  3VTG A;  4GR0 A;  1XM5 A;  4XM8 A;  4A7B A;  2XS4 A;  3OHO A;  3HBU P;  5I0L A;  2XS3 A;  5D3C A;  3ZXH A;  2KRJ A;  4GQL A;  5D1S A;  4FXY P;  2WO8 A;  1D8M A;  2WOA A;  1G12 A;  1GE6 A;  4HX3 A;  1ZXC A;  5D2B A;  1ZS0 A;  1SRP A;  4PKQ A;  4Q1L A;  1UMT A;  1QIA A;  1HFC A;  1XUD A;  2FV9 A;  1BSW A;  3G5C A;  4WKI A;  1A85 A;  2Y6D A;  3HBV P;  2O3E A;  3DWB A;  2YB9 A;  1QJJ A;  3AYK A;  2MZE A;  1PWU A;  4PKV A;  4QKZ A;  3LJG A;  2OW1 A;  2A8H A;  3LKA A;  4GWN A;  1Y93 A;  2JT6 A;  2MLS A;  1GO8 P;  3LQ0 A;  4XCT A;  830C A;  1DTH A;  3NX7 A;  4AXQ A;  3LEA A;  1QIC A;  2I47 A;  4J4M A;  4DV8 A;  3VI1 A;  1D8F A;  2OXZ A;  1IAC A;  1BQQ M;  3N2U A;  1C7K A;  1SMP A;  4IJO A;  3EHX A;  1UTT A;  4FXQ A;  1HOV A;  2JNP A;  5CXA A;  4PKR A;  1C3I A;  4I03 A; 
#chains in the Genus database with same CATH homology
 2OW0 A;  3K7L A;  1MNC A;  1USN A;  3G42 A;  3UVC A;  5L7F A;  1JIW P;  1OM6 A;  1SAT A;  1HY7 A;  2SRT A;  2RJQ A;  3HDA P;  2YUF A;  5I2Z A;  3TT4 A;  3F16 A;  4GUY A;  1MMP A;  1PWW A;  1HFS A;  2L0R A;  5L79 A;  5I12 A;  4WK7 A;  1DMT A;  1JH1 A;  4H76 A;  2E2D A;  3EDH A;  1JIZ A;  2WO9 A;  3KEC A;  5B5P A;  3HY7 A;  2E3X A;  1KUI A;  4IN9 A;  1JAQ A;  3TVC A;  1D7X A;  3LUN A;  4WKE A;  1RM8 A;  1YCM A;  3DTE A;  3HYG A;  1GXD A;  1G9K A;  3KEK A;  4L63 A;  2CKI A;  3WV1 A;  3LMC A;  3F19 A;  3LUM A;  2X3A A;  4DPE A;  1Y0V A;  3ELM A;  4AIG A;  2DW1 A;  3KMC A;  1S4B P;  1OMJ A;  4H2E A;  1GO7 P;  4WZV A;  4ON1 A;  2ERO A;  2OXW A;  3CKI A;  3DPE A;  1MMQ A;  1BKC A;  2OY2 A;  3I7G A;  4G9L A;  1ROS A;  3Q2H A;  2Y6C A;  2JT5 A;  2N8R A;  3USN A;  1CGE A;  1K7G A;  3KME A;  3TSK A;  1BZS A;  3LIK A;  3E8R A;  3O2X A;  5B5O A;  1BIW A;  1MMR A;  3AIG A;  4DF9 A;  2DW0 A;  1XUC A;  5JMY A;  1IAG A;  5I3M A;  2OW2 A;  4JIJ A;  1ZP5 A;  4HMA A;  5BOY A;  1R55 A;  1AKL A;  1PWQ A;  1G05 A;  1CAQ A;  3EWJ A;  4GR8 A;  2J0T A;  1OO9 A;  1XFX A;  3HB2 P;  3KRY A;  2OZR A;  1JJ9 A;  1G4K A;  1BKC E;  2DDF A;  2POJ A;  2Z2D A;  2K2G A;  4AUO A;  3DNG A;  1IAE A;  1OM8 A;  3DPF A;  1UMS A;  2OI0 A;  4GF1 A;  4PKT A;  2J83 A;  3RTT A;  2W14 A;  4GR3 A;  4JP4 A;  4AYK A;  1BM6 A;  5D7W A;  1UEA A;  3N2V A;  1CGL A;  3DTI A;  1I1I P;  1KBC A;  2TCL A;  1FLS A;  3KWV C;  1I73 A;  3LQB A;  4FU4 A;  1O0Q A;  1RMZ A;  3MA2 A;  5CZM A;  2RJP A;  3LE9 A;  4XM7 A;  1CIZ A;  2X3B A;  1EAK A;  4H84 A;  1FM1 A;  3BA0 A;  1EB6 A;  3EDG A;  456C A;  2JIH A;  2QPJ A;  2YIG A;  1YOU A;  2V4B A;  1HV5 A;  4PKS A;  1HTD A;  1SLM A;  3KHI A;  3F15 A;  2FV5 A;  2X7M A;  4DD8 A;  4CTH A;  4H82 A;  3DSL A;  2DDY A;  1ZVX A;  1CQR A;  3LIR A;  1XFY A;  1R54 A;  4H49 A;  1IAB A;  1IAA A;  1SLN A;  1OS2 A;  4A3W A;  1EUB A;  3F1A A;  1KAP P;  3B8Z A;  3U1R A;  2D1N A;  1A86 A;  4G0D A;  2W15 A;  1OM7 A;  4L6T A;  1R1I A;  1ND1 A;  1SU3 A;  1JK3 A;  1YP1 A;  1AST A;  5LAB A;  1XFV A;  4L19 A;  1MMB A;  2OY4 A;  3F17 A;  4ZR5 A;  1JAP A;  4IUW A;  2AYK A;  2K9C A;  2MZH A;  3TS4 A;  4H1Q A;  1R1H A;  2OXU A;  1BUD A;  1ZTQ A;  966C A;  1GKC A;  1R1J A;  2X3C A;  4I35 A;  3AYU A;  5H8X A;  3EDI A;  5CUH A;  1UTZ A;  5I43 A;  1GKD A;  4H3X A;  3KEJ A;  4JQG A;  2OVZ A;  3EHY A;  3HY9 A;  1IAD A;  4JPA A;  1CGF A;  1GE7 A;  5I4O A;  3Q2G A;  5D1T A;  1Y8J A;  4GWM A;  2W13 A;  5D1U A;  1K7Q A;  4PKU A;  1AYK A;  3F18 A;  5BOT A;  3B2Z A;  2HU6 A;  1XFU A;  1QUA A;  3LGP A;  1O0T A;  3ZUK A;  1BUV M;  3B92 A;  3RTS A;  1BKC I;  1D5J A;  1H71 P;  1Q3A A;  1L6J A;  2USN A;  1BQO A;  3P1V A;  3K7N A;  4L7A A;  4EFS A;  1KUF A;  3SHI A;  1GE5 A;  3DTK A;  1JAO A;  3I7I A;  4XBH A;  2W12 A;  1CXV A;  4PKW A;  1FBL A;  2ERQ A;  3LJT A;  2OW9 A;  1CK7 A;  4ILW D;  3LK8 A;  4FVL A;  2PJT A;  2W0D A;  1I76 A;  1J7N A;  1ZXV A;  1OS9 A;  3GBO A;  1XUR A;  1XFW A;  3WV2 A;  3HDB A;  1PWP A;  3DL1 A;  3P24 A;  1C8T A;  3L0V A;  2ERP A;  3O64 A;  3LJZ A;  2AIG P;  1JKY A;  1ATL A;  1XFZ A;  2JSD A;  5BPA A;  2O36 A;  4H30 A;  4JA1 A;  4WF6 A;  1QJI A;  2MZI A;  1KUH A;  3ZVS A;  2CLT A;  3OHL A;  3EDZ A;  1WNI A;  2OVX A;  1G49 A;  1QIB A;  1K7I A;  1B3D A;  1B8Y A;  3L0T A;  1KUG A;  1Z3J A;  4R3V A;  3V96 B;  2D1O A;  1AF0 A;  1YQY A;  1KUK A;  1JAN A;  2MLR A;  3LIL A;  3WV3 A;  2DW2 A;  4XM6 A;  1PWV A;  3VTG A;  4GR0 A;  4XM8 A;  4A7B A;  2XS4 A;  3OHO A;  3HBU P;  5I0L A;  2XS3 A;  5D3C A;  3ZXH A;  2KRJ A;  4GQL A;  5D1S A;  4FXY P;  2WO8 A;  1D8M A;  2WOA A;  1G12 A;  1GE6 A;  4HX3 A;  1ZXC A;  5D2B A;  1ZS0 A;  1SRP A;  4PKQ A;  4Q1L A;  1UMT A;  1QIA A;  1HFC A;  1XUD A;  2FV9 A;  1BSW A;  3G5C A;  4WKI A;  1A85 A;  2Y6D A;  3HBV P;  2O3E A;  3DWB A;  2YB9 A;  1QJJ A;  3AYK A;  2MZE A;  1PWU A;  4PKV A;  4QKZ A;  3LJG A;  2OW1 A;  2A8H A;  3LKA A;  4GWN A;  1Y93 A;  2JT6 A;  2MLS A;  1GO8 P;  3LQ0 A;  4XCT A;  830C A;  1DTH A;  3NX7 A;  4AXQ A;  3LEA A;  1QIC A;  2I47 A;  4J4M A;  4DV8 A;  3VI1 A;  1D8F A;  2OXZ A;  1IAC A;  1BQQ M;  3N2U A;  1C7K A;  1SMP A;  4IJO A;  3EHX A;  1UTT A;  4FXQ A;  1HOV A;  2JNP A;  5CXA A;  4PKR A;  1C3I A;  4I03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...