1UMTA

Stromelysin-1 catalytic domain with hydrophobic inhibitor bound, ph 7.0, 32oc, 20 mm cacl2, 15% acetonitrile; nmr average of 20 structures minimized with restraints
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
166
structure length
166
Chain Sequence
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STROMELYSIN-1
publication title Solution structure of the catalytic domain of human stromelysin complexed with a hydrophobic inhibitor.
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 25
structure length 166
sequence length 166
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1995-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1umtA00
3LQ0A 3BA0A 1BUDA 1QIAA 1XURA 1IADA 2K9CA 4J4MA 4H30A 1EAKA 2WO8A 2Z2DA 3USNA 2N8RA 4ILWD 3HDBA 2I47A 1A86A 2MLRA 1MMBA 5D3CA 4HX3A 3WV2A 3E8RA 3LJZA 1ND1A 1XUCA 1J7NA 5I4OA 1S4BP 1WNIA 4FXQA 1K7GA 4GR8A 1OM6A 3N2UA 5CZMA 1D7XA 1GE5A 3HYGA 1PWVA 5I0LA 1D8FA 1JAOA 1A85A 2OY2A 3RTSA 2USNA 2Y6CA 4JP4A 2J0TA 1O0TA 1BSWA 3LEAA 1Q3AA 1JIZA 4A3WA 3HBVP 3HDAP 3HB2P 2X3BA 4WF6A 1G4KA 4AIGA 1KAPP 1C7KA 1ZTQA 1FBLA 3AYKA 4ZR5A 5D2BA 2OW0A 2KRJA 2FV9A 3F19A 1KUHA 5I12A 1UTZA 3ELMA 3UVCA 1G9KA 5I2ZA 4IJOA 1PWPA 1YCMA 4GQLA 1I1IP 4L63A 4QKZA 456CA 1CIZA 3HBUP 1Z3JA 1XFWA 3NX7A 4FVLA 4XBHA 1HFSA 4GWNA 2YB9A 1RMZA 830CA 5JMYA 1MMPA 3EHYA 1BIWA 1OM8A 3ZVSA 1D8MA 1GKCA 3HY9A 2X7MA 1ZXCA 1QIBA 3HY7A 4H76A 1OS9A 2DW0A 4XM8A 1Y93A 2WOAA 2WO9A 1JK3A 1Y0VA 3KMEA 1ZXVA 3KWVC 1QICA 3L0TA 1YP1A 2W12A 1C8TA 1XFXA 1BKCE 3AYUA 1KBCA 3EDHA 1QJIA 1CAQA 1AF0A 4G0DA 4PKTA 3B8ZA 4L19A 3LJTA 4AXQA 1SATA 1KUFA 4GR3A 1JH1A 3P1VA 5D1TA 3DPEA 3O2XA 3F1AA 1JAPA 3KRYA 1RM8A 1GKDA 4GF1A 2PJTA 1O0QA 1CGLA 5D7WA 1JAQA 4CTHA 1ROSA 4I35A 2FV5A 3LQBA 4PKWA 1IAAA 3K7LA 5I43A 2X3AA 1DTHA 3LJGA 1ZVXA 1FM1A 2OY4A 1G05A 2RJQA 4GUYA 1I76A 5D1SA 4EFSA 4H82A 3ZXHA 2JIHA 3EDZA 2CKIA 2OXUA 3SHIA 2W0DA 5L7FA 2AYKA 2OVZA 4HMAA 3LK8A 1GE6A 1Y8JA 2D1OA 3KHIA 5BPAA 1HFCA 1JKYA 3RTTA 4JPAA 1I73A 966CA 1USNA 3LUNA 3TVCA 2DDFA 3VI1A 1GO8P 3P24A 1EB6A 3CKIA 1SLNA 1QUAA 2ERQA 2OW9A 1ATLA 1D5JA 2JT6A 2OVXA 1BKCA 1YQYA 1SLMA 1UTTA 2D1NA 1R1IA 1JANA 1ASTA 1IACA 3F18A 3G42A 2OZRA 1KUGA 1C3IA 4XCTA 3LGPA 3EHXA 3I7GA 1DMTA 2MZEA 1CXVA 1JJ9A 1MMRA 1PWUA 4WKIA 4IUWA 2DW2A 4H84A 1OMJA 3MA2A 1AKLA 3LIRA 3F15A 3F16A 1GXDA 1QJJA 1CK7A 3DNGA 5D1UA 3G5CA 4DPEA 4FXYP 3TS4A 5I3MA 5B5PA 4AUOA 2OI0A 1XFZA 1G12A 4A7BA 1EUBA 3U1RA 1G49A 3LE9A 2MZIA 3KECA 1K7QA 1OS2A 1KUIA 2E2DA 4H2EA 3L0VA 1ZS0A 2JNPA 1MNCA 2J83A 1FLSA 2OW2A 3OHOA 4WK7A 3V96B 1UEAA 3GBOA 2O36A 4DD8A 1IAEA 2CLTA 5BOTA 1BUVM 1GE7A 4AYKA 1CQRA 1UMTA 2K2GA 1JIWP 1MMQA 4Q1LA 1CGEA 3DL1A 5LABA 3O64A 3KMCA 1BKCI 3Q2GA 1YOUA 2L0RA 2MZHA 3ZUKA 5BOYA 1UMSA 4G9LA 1PWQA 2JT5A 4PKRA 3KEJA 2W14A 2HU6A 2Y6DA 2A8HA 4JQGA 3DPFA 1HV5A 2XS3A 4I03A 4H1QA 3DWBA 1L6JA 5CXAA 1BM6A 4L6TA 5B5OA 3LKAA 1SRPA 4FU4A 4XM7A 3WV1A 1XFYA 2TCLA 1IABA 2OXZA 4WZVA 3I7IA 4DV8A 4PKSA 3VTGA 3DSLA 3K7NA 1SU3A 2DDYA 3N2VA 1R54A 1R1JA 1XFVA 3B2ZA 3TSKA 4DF9A 2DW1A 3Q2HA 5H8XA 4IN9A 1B3DA 1SMPA 1K7IA 1XFUA 2POJA 2W13A 2QPJA 1XUDA 1IAGA 1PWWA 4PKQA 1HY7A 4JA1A 1B8YA 1BQOA 1R55A 3OHLA 1ZP5A 4H3XA 1R1HA 1OM7A 2V4BA 5L79A 4H49A 2ERPA 1AYKA 3LUMA 3F17A 2RJPA 2YIGA 2OW1A 3EWJA 1HTDA 1CGFA 2EROA 3LILA 2W15A 4PKVA 1BQQM 3EDIA 1KUKA 4JIJA 1OO9A 3EDGA 5CUHA 4GR0A 3B92A 1HOVA 1GO7P 2OXWA 2MLSA 2XS4A 4GWMA 4XM6A 3LMCA 2SRTA 4ON1A 1H71P 3TT4A 4PKUA 2E3XA 3KEKA 2O3EA 2AIGP 4WKEA 2JSDA 4R3VA 3WV3A 3AIGA 3LIKA 1BZSA 2X3CA
chains in the Genus database with same CATH superfamily
3LQ0A 3BA0A 1BUDA 1QIAA 1XURA 1IADA 2K9CA 4J4MA 4H30A 1EAKA 2WO8A 2Z2DA 3USNA 2N8RA 1OZ9A 4ILWD 3HDBA 2I47A 1A86A 2MLRA 1MMBA 3DTKA 5D3CA 4HX3A 3WV2A 3E8RA 3LJZA 1ND1A 1XUCA 1J7NA 5I4OA 1S4BP 1WNIA 4FXQA 1K7GA 4GR8A 1OM6A 3N2UA 5CZMA 1D7XA 1GE5A 3HYGA 1PWVA 5I0LA 1D8FA 1JAOA 1A85A 2OY2A 3RTSA 2USNA 2Y6CA 4JP4A 2J0TA 1O0TA 1BSWA 3LEAA 1Q3AA 1JIZA 3DTIA 4A3WA 3HBVP 3HDAP 3HB2P 2X3BA 4WF6A 1G4KA 4AIGA 1KAPP 1C7KA 1ZTQA 1FBLA 3AYKA 4ZR5A 5D2BA 2OW0A 2KRJA 2FV9A 3F19A 1KUHA 5I12A 1UTZA 3ELMA 3UVCA 1G9KA 5I2ZA 4IJOA 1PWPA 1YCMA 4GQLA 1I1IP 4L63A 4QKZA 456CA 1CIZA 3HBUP 1Z3JA 1XFWA 3NX7A 4FVLA 4XBHA 1HFSA 4GWNA 2YB9A 1RMZA 830CA 5JMYA 1MMPA 3EHYA 1BIWA 1OM8A 3ZVSA 1D8MA 1GKCA 3HY9A 2X7MA 1ZXCA 1QIBA 3HY7A 4H76A 1OS9A 2DW0A 4XM8A 1Y93A 2WOAA 2WO9A 1JK3A 1Y0VA 3KMEA 1ZXVA 3KWVC 1QICA 3L0TA 1YP1A 2W12A 1C8TA 1XFXA 1BKCE 3AYUA 1KBCA 3EDHA 1QJIA 1CAQA 1AF0A 4G0DA 4PKTA 3B8ZA 4L19A 3LJTA 4AXQA 1SATA 1KUFA 4GR3A 1JH1A 3P1VA 5D1TA 3DPEA 3O2XA 3F1AA 1JAPA 3KRYA 1RM8A 1GKDA 4GF1A 2PJTA 1O0QA 1CGLA 5D7WA 1JAQA 4CTHA 1ROSA 4I35A 2FV5A 3LQBA 4PKWA 1IAAA 3K7LA 5I43A 2X3AA 1DTHA 1ZVXA 3LJGA 1TVIA 1FM1A 2OY4A 1G05A 2RJQA 4GUYA 1I76A 5D1SA 4EFSA 4H82A 3ZXHA 2JIHA 3EDZA 2CKIA 2OXUA 3SHIA 2W0DA 2YUFA 5L7FA 2AYKA 2OVZA 4HMAA 3LK8A 1GE6A 1Y8JA 2D1OA 3KHIA 5BPAA 1HFCA 1JKYA 3RTTA 4JPAA 1XM5A 1I73A 966CA 1USNA 3LUNA 3TVCA 2DDFA 3VI1A 1GO8P 3P24A 1EB6A 3CKIA 1SLNA 1QUAA 2ERQA 2OW9A 1ATLA 1D5JA 2JT6A 2OVXA 1BKCA 1YQYA 1SLMA 1UTTA 2D1NA 1R1IA 1JANA 1ASTA 1IACA 3F18A 3G42A 2OZRA 1KUGA 1C3IA 4XCTA 3LGPA 3EHXA 3I7GA 1DMTA 2MZEA 1CXVA 1JJ9A 1MMRA 1PWUA 4WKIA 4IUWA 2DW2A 4H84A 1OMJA 3MA2A 1AKLA 3LIRA 3F15A 3F16A 1GXDA 1QJJA 1CK7A 3DNGA 5D1UA 3G5CA 4DPEA 4FXYP 3TS4A 5I3MA 5B5PA 4AUOA 1XAXA 2OI0A 3DTEA 1XFZA 1G12A 4A7BA 1EUBA 3U1RA 1G49A 3LE9A 2MZIA 3KECA 1K7QA 1OS2A 1KUIA 2E2DA 4H2EA 3L0VA 1ZS0A 2JNPA 1MNCA 2J83A 1FLSA 2OW2A 3OHOA 4WK7A 3V96B 1UEAA 3GBOA 2O36A 4DD8A 1IAEA 2CLTA 5BOTA 1BUVM 1GE7A 4AYKA 1CQRA 1UMTA 2K2GA 1JIWP 1MMQA 4Q1LA 1CGEA 3DL1A 5LABA 3O64A 3KMCA 1BKCI 3Q2GA 1YOUA 2L0RA 2MZHA 3ZUKA 5BOYA 1UMSA 4G9LA 1PWQA 2JT5A 4PKRA 3KEJA 2W14A 2HU6A 2Y6DA 2A8HA 4JQGA 3DPFA 1HV5A 2XS3A 4I03A 4H1QA 3DWBA 1L6JA 5CXAA 1BM6A 4L6TA 5B5OA 3LKAA 1SRPA 4FU4A 4XM7A 3WV1A 1XFYA 2TCLA 1IABA 2OXZA 4WZVA 3I7IA 4DV8A 4PKSA 3VTGA 3DSLA 3K7NA 1SU3A 2DDYA 3N2VA 1R54A 1R1JA 1XFVA 3B2ZA 3TSKA 4DF9A 2DW1A 3Q2HA 5H8XA 4IN9A 1B3DA 1SMPA 1K7IA 1XFUA 2POJA 2W13A 2QPJA 1XUDA 1IAGA 1PWWA 4PKQA 1HY7A 4L7AA 4JA1A 1B8YA 1BQOA 1R55A 3OHLA 1ZP5A 4H3XA 1R1HA 1OM7A 2V4BA 5L79A 4H49A 2ERPA 1AYKA 3LUMA 3F17A 2RJPA 2YIGA 2OW1A 3EWJA 1HTDA 1CGFA 2EROA 3LILA 2W15A 4PKVA 1BQQM 3EDIA 1KUKA 4JIJA 1OO9A 3EDGA 5CUHA 4GR0A 3B92A 1HOVA 1GO7P 2OXWA 2MLSA 2XS4A 4GWMA 4XM6A 3LMCA 2SRTA 4ON1A 1H71P 3TT4A 4PKUA 2E3XA 3KEKA 2O3EA 2AIGP 4WKEA 2JSDA 4R3VA 3WV3A 3AIGA 3LIKA 1BZSA 2X3CA
chains in the Genus database with same CATH topology
3LQ0A 3BA0A 1BUDA 1QIAA 1XURA 1IADA 2K9CA 4J4MA 4H30A 1EAKA 2WO8A 2Z2DA 3USNA 2N8RA 4ILWD 3HDBA 2I47A 1A86A 2MLRA 1MMBA 3DTKA 5D3CA 4HX3A 3WV2A 3E8RA 3LJZA 1ND1A 1XUCA 1J7NA 5I4OA 1S4BP 1WNIA 4FXQA 1K7GA 4GR8A 1OM6A 3N2UA 5CZMA 1D7XA 1GE5A 3HYGA 1PWVA 5I0LA 1D8FA 1JAOA 1A85A 2OY2A 3RTSA 2USNA 2Y6CA 4JP4A 2J0TA 1O0TA 1BSWA 3LEAA 1Q3AA 1JIZA 3DTIA 4A3WA 3HBVP 3HDAP 3HB2P 2X3BA 4WF6A 1G4KA 4AIGA 1KAPP 1C7KA 1ZTQA 1FBLA 3AYKA 4ZR5A 5D2BA 2OW0A 2KRJA 2FV9A 3F19A 1KUHA 5I12A 1UTZA 3ELMA 3UVCA 1G9KA 5I2ZA 4IJOA 1PWPA 1YCMA 4GQLA 1I1IP 4L63A 4QKZA 456CA 1CIZA 3HBUP 1Z3JA 1XFWA 3NX7A 4FVLA 4XBHA 1HFSA 4GWNA 2YB9A 1RMZA 830CA 5JMYA 1MMPA 3EHYA 1BIWA 1OM8A 3ZVSA 1D8MA 1GKCA 3HY9A 2X7MA 1ZXCA 1QIBA 3HY7A 4H76A 1OS9A 2DW0A 4XM8A 1Y93A 2WOAA 2WO9A 1JK3A 1Y0VA 3KMEA 1ZXVA 3KWVC 1QICA 3L0TA 1YP1A 2W12A 1C8TA 1XFXA 1BKCE 3AYUA 1KBCA 3EDHA 1QJIA 1CAQA 1AF0A 4G0DA 4PKTA 3B8ZA 4L19A 3LJTA 4AXQA 1SATA 1KUFA 4GR3A 1JH1A 3P1VA 5D1TA 3DPEA 3O2XA 3F1AA 1JAPA 3KRYA 1RM8A 1GKDA 4GF1A 2PJTA 1O0QA 1CGLA 5D7WA 1JAQA 4CTHA 1ROSA 4I35A 2FV5A 3LQBA 4PKWA 1IAAA 3K7LA 5I43A 2X3AA 1DTHA 3LJGA 1ZVXA 1FM1A 2OY4A 1G05A 2RJQA 4GUYA 1I76A 5D1SA 4EFSA 4H82A 3ZXHA 2JIHA 3EDZA 2CKIA 2OXUA 3SHIA 2W0DA 2YUFA 5L7FA 2AYKA 2OVZA 4HMAA 3LK8A 1GE6A 1Y8JA 2D1OA 3KHIA 5BPAA 1HFCA 1JKYA 3RTTA 4JPAA 1I73A 966CA 1USNA 3LUNA 3TVCA 2DDFA 3VI1A 1GO8P 3P24A 1EB6A 3CKIA 1SLNA 1QUAA 2ERQA 2OW9A 1ATLA 1D5JA 2JT6A 2OVXA 1BKCA 1YQYA 1SLMA 1UTTA 2D1NA 1R1IA 1JANA 1ASTA 1IACA 3F18A 3G42A 2OZRA 1KUGA 1C3IA 4XCTA 3LGPA 3EHXA 3I7GA 1DMTA 2MZEA 1CXVA 1JJ9A 1MMRA 1PWUA 4WKIA 4IUWA 2DW2A 4H84A 1OMJA 3MA2A 1AKLA 3LIRA 3F15A 3F16A 1GXDA 1QJJA 1CK7A 3DNGA 5D1UA 3G5CA 4DPEA 4FXYP 3TS4A 5I3MA 5B5PA 4AUOA 2OI0A 3DTEA 1XFZA 1G12A 4A7BA 1EUBA 3U1RA 1G49A 3LE9A 2MZIA 3KECA 1K7QA 1OS2A 1KUIA 2E2DA 4H2EA 3L0VA 1ZS0A 2JNPA 1MNCA 2J83A 1FLSA 2OW2A 3OHOA 4WK7A 3V96B 1UEAA 3GBOA 2O36A 4DD8A 1IAEA 2CLTA 5BOTA 1BUVM 1GE7A 4AYKA 1CQRA 1UMTA 2K2GA 1JIWP 1MMQA 4Q1LA 1CGEA 3DL1A 5LABA 3O64A 3KMCA 1BKCI 3Q2GA 1YOUA 2L0RA 2MZHA 3ZUKA 5BOYA 1UMSA 4G9LA 1PWQA 2JT5A 4PKRA 3KEJA 2W14A 2HU6A 2Y6DA 2A8HA 4JQGA 3DPFA 1HV5A 2XS3A 4I03A 4H1QA 3DWBA 1L6JA 5CXAA 1BM6A 4L6TA 5B5OA 3LKAA 1SRPA 4FU4A 4XM7A 3WV1A 1XFYA 2TCLA 1IABA 2OXZA 4WZVA 3I7IA 4DV8A 4PKSA 3VTGA 3DSLA 3K7NA 1SU3A 2DDYA 3N2VA 1R54A 1R1JA 1XFVA 3B2ZA 3TSKA 4DF9A 2DW1A 3Q2HA 5H8XA 4IN9A 1B3DA 1SMPA 1K7IA 1XFUA 2POJA 2W13A 2QPJA 1XUDA 1IAGA 1PWWA 4PKQA 1HY7A 4L7AA 4JA1A 1B8YA 1BQOA 1R55A 3OHLA 1ZP5A 4H3XA 1R1HA 1OM7A 2V4BA 5L79A 4H49A 2ERPA 1AYKA 3LUMA 3F17A 2RJPA 2YIGA 2OW1A 3EWJA 1HTDA 1CGFA 2EROA 3LILA 2W15A 4PKVA 1BQQM 3EDIA 1KUKA 4JIJA 1OO9A 3EDGA 5CUHA 4GR0A 3B92A 1HOVA 1GO7P 2OXWA 2MLSA 2XS4A 4GWMA 4XM6A 3LMCA 2SRTA 4ON1A 1H71P 3TT4A 4PKUA 2E3XA 3KEKA 2O3EA 2AIGP 4WKEA 2JSDA 4R3VA 3WV3A 3AIGA 3LIKA 1BZSA 2X3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LQ0 A;  3BA0 A;  1BUD A;  1QIA A;  1XUR A;  1IAD A;  2K9C A;  4J4M A;  4H30 A;  1EAK A;  2WO8 A;  2Z2D A;  3USN A;  2N8R A;  4ILW D;  3HDB A;  2I47 A;  1A86 A;  2MLR A;  1MMB A;  5D3C A;  4HX3 A;  3WV2 A;  3E8R A;  3LJZ A;  1ND1 A;  1XUC A;  1J7N A;  5I4O A;  1S4B P;  1WNI A;  4FXQ A;  1K7G A;  4GR8 A;  1OM6 A;  3N2U A;  5CZM A;  1D7X A;  1GE5 A;  3HYG A;  1PWV A;  5I0L A;  1D8F A;  1JAO A;  1A85 A;  2OY2 A;  3RTS A;  2USN A;  2Y6C A;  4JP4 A;  2J0T A;  1O0T A;  1BSW A;  3LEA A;  1Q3A A;  1JIZ A;  4A3W A;  3HBV P;  3HDA P;  3HB2 P;  2X3B A;  4WF6 A;  1G4K A;  4AIG A;  1KAP P;  1C7K A;  1ZTQ A;  1FBL A;  3AYK A;  4ZR5 A;  5D2B A;  2OW0 A;  2KRJ A;  2FV9 A;  3F19 A;  1KUH A;  5I12 A;  1UTZ A;  3ELM A;  3UVC A;  1G9K A;  5I2Z A;  4IJO A;  1PWP A;  1YCM A;  4GQL A;  1I1I P;  4L63 A;  4QKZ A;  456C A;  1CIZ A;  3HBU P;  1Z3J A;  1XFW A;  3NX7 A;  4FVL A;  4XBH A;  1HFS A;  4GWN A;  2YB9 A;  1RMZ A;  830C A;  5JMY A;  1MMP A;  3EHY A;  1BIW A;  1OM8 A;  3ZVS A;  1D8M A;  1GKC A;  3HY9 A;  2X7M A;  1ZXC A;  1QIB A;  3HY7 A;  4H76 A;  1OS9 A;  2DW0 A;  4XM8 A;  1Y93 A;  2WOA A;  2WO9 A;  1JK3 A;  1Y0V A;  3KME A;  1ZXV A;  3KWV C;  1QIC A;  3L0T A;  1YP1 A;  2W12 A;  1C8T A;  1XFX A;  1BKC E;  3AYU A;  1KBC A;  3EDH A;  1QJI A;  1CAQ A;  1AF0 A;  4G0D A;  4PKT A;  3B8Z A;  4L19 A;  3LJT A;  4AXQ A;  1SAT A;  1KUF A;  4GR3 A;  1JH1 A;  3P1V A;  5D1T A;  3DPE A;  3O2X A;  3F1A A;  1JAP A;  3KRY A;  1RM8 A;  1GKD A;  4GF1 A;  2PJT A;  1O0Q A;  1CGL A;  5D7W A;  1JAQ A;  4CTH A;  1ROS A;  4I35 A;  2FV5 A;  3LQB A;  4PKW A;  1IAA A;  3K7L A;  5I43 A;  2X3A A;  1DTH A;  3LJG A;  1ZVX A;  1FM1 A;  2OY4 A;  1G05 A;  2RJQ A;  4GUY A;  1I76 A;  5D1S A;  4EFS A;  4H82 A;  3ZXH A;  2JIH A;  3EDZ A;  2CKI A;  2OXU A;  3SHI A;  2W0D A;  5L7F A;  2AYK A;  2OVZ A;  4HMA A;  3LK8 A;  1GE6 A;  1Y8J A;  2D1O A;  3KHI A;  5BPA A;  1HFC A;  1JKY A;  3RTT A;  4JPA A;  1I73 A;  966C A;  1USN A;  3LUN A;  3TVC A;  2DDF A;  3VI1 A;  1GO8 P;  3P24 A;  1EB6 A;  3CKI A;  1SLN A;  1QUA A;  2ERQ A;  2OW9 A;  1ATL A;  1D5J A;  2JT6 A;  2OVX A;  1BKC A;  1YQY A;  1SLM A;  1UTT A;  2D1N A;  1R1I A;  1JAN A;  1AST A;  1IAC A;  3F18 A;  3G42 A;  2OZR A;  1KUG A;  1C3I A;  4XCT A;  3LGP A;  3EHX A;  3I7G A;  1DMT A;  2MZE A;  1CXV A;  1JJ9 A;  1MMR A;  1PWU A;  4WKI A;  4IUW A;  2DW2 A;  4H84 A;  1OMJ A;  3MA2 A;  1AKL A;  3LIR A;  3F15 A;  3F16 A;  1GXD A;  1QJJ A;  1CK7 A;  3DNG A;  5D1U A;  3G5C A;  4DPE A;  4FXY P;  3TS4 A;  5I3M A;  5B5P A;  4AUO A;  2OI0 A;  1XFZ A;  1G12 A;  4A7B A;  1EUB A;  3U1R A;  1G49 A;  3LE9 A;  2MZI A;  3KEC A;  1K7Q A;  1OS2 A;  1KUI A;  2E2D A;  4H2E A;  3L0V A;  1ZS0 A;  2JNP A;  1MNC A;  2J83 A;  1FLS A;  2OW2 A;  3OHO A;  4WK7 A;  3V96 B;  1UEA A;  3GBO A;  2O36 A;  4DD8 A;  1IAE A;  2CLT A;  5BOT A;  1BUV M;  1GE7 A;  4AYK A;  1CQR A;  1UMT A;  2K2G A;  1JIW P;  1MMQ A;  4Q1L A;  1CGE A;  3DL1 A;  5LAB A;  3O64 A;  3KMC A;  1BKC I;  3Q2G A;  1YOU A;  2L0R A;  2MZH A;  3ZUK A;  5BOY A;  1UMS A;  4G9L A;  1PWQ A;  2JT5 A;  4PKR A;  3KEJ A;  2W14 A;  2HU6 A;  2Y6D A;  2A8H A;  4JQG A;  3DPF A;  1HV5 A;  2XS3 A;  4I03 A;  4H1Q A;  3DWB A;  1L6J A;  5CXA A;  1BM6 A;  4L6T A;  5B5O A;  3LKA A;  1SRP A;  4FU4 A;  4XM7 A;  3WV1 A;  1XFY A;  2TCL A;  1IAB A;  2OXZ A;  4WZV A;  3I7I A;  4DV8 A;  4PKS A;  3VTG A;  3DSL A;  3K7N A;  1SU3 A;  2DDY A;  3N2V A;  1R54 A;  1R1J A;  1XFV A;  3B2Z A;  3TSK A;  4DF9 A;  2DW1 A;  3Q2H A;  5H8X A;  4IN9 A;  1B3D A;  1SMP A;  1K7I A;  1XFU A;  2POJ A;  2W13 A;  2QPJ A;  1XUD A;  1IAG A;  1PWW A;  4PKQ A;  1HY7 A;  4JA1 A;  1B8Y A;  1BQO A;  1R55 A;  3OHL A;  1ZP5 A;  4H3X A;  1R1H A;  1OM7 A;  2V4B A;  5L79 A;  4H49 A;  2ERP A;  1AYK A;  3LUM A;  3F17 A;  2RJP A;  2YIG A;  2OW1 A;  3EWJ A;  1HTD A;  1CGF A;  2ERO A;  3LIL A;  2W15 A;  4PKV A;  1BQQ M;  3EDI A;  1KUK A;  4JIJ A;  1OO9 A;  3EDG A;  5CUH A;  4GR0 A;  3B92 A;  1HOV A;  1GO7 P;  2OXW A;  2MLS A;  2XS4 A;  4GWM A;  4XM6 A;  3LMC A;  2SRT A;  4ON1 A;  1H71 P;  3TT4 A;  4PKU A;  2E3X A;  3KEK A;  2O3E A;  2AIG P;  4WKE A;  2JSD A;  4R3V A;  3WV3 A;  3AIG A;  3LIK A;  1BZS A;  2X3C A; 
#chains in the Genus database with same CATH topology
 3LQ0 A;  3BA0 A;  1BUD A;  1QIA A;  1XUR A;  1IAD A;  2K9C A;  4J4M A;  4H30 A;  1EAK A;  2WO8 A;  2Z2D A;  3USN A;  2N8R A;  1OZ9 A;  4ILW D;  3HDB A;  2I47 A;  1A86 A;  2MLR A;  1MMB A;  3DTK A;  5D3C A;  4HX3 A;  3WV2 A;  3E8R A;  3LJZ A;  1ND1 A;  1XUC A;  1J7N A;  5I4O A;  1S4B P;  1WNI A;  4FXQ A;  1K7G A;  4GR8 A;  1OM6 A;  3N2U A;  5CZM A;  1D7X A;  1GE5 A;  3HYG A;  1PWV A;  5I0L A;  1D8F A;  1JAO A;  1A85 A;  2OY2 A;  3RTS A;  2USN A;  2Y6C A;  4JP4 A;  2J0T A;  1O0T A;  1BSW A;  3LEA A;  1Q3A A;  1JIZ A;  3DTI A;  4A3W A;  3HBV P;  3HDA P;  3HB2 P;  2X3B A;  4WF6 A;  1G4K A;  4AIG A;  1KAP P;  1C7K A;  1ZTQ A;  1FBL A;  3AYK A;  4ZR5 A;  5D2B A;  2OW0 A;  2KRJ A;  2FV9 A;  3F19 A;  1KUH A;  5I12 A;  1UTZ A;  3ELM A;  3UVC A;  1G9K A;  5I2Z A;  4IJO A;  1PWP A;  1YCM A;  4GQL A;  1I1I P;  4L63 A;  4QKZ A;  456C A;  1CIZ A;  3HBU P;  1Z3J A;  1XFW A;  3NX7 A;  4FVL A;  4XBH A;  1HFS A;  4GWN A;  2YB9 A;  1RMZ A;  830C A;  5JMY A;  1MMP A;  3EHY A;  1BIW A;  1OM8 A;  3ZVS A;  1D8M A;  1GKC A;  3HY9 A;  2X7M A;  1ZXC A;  1QIB A;  3HY7 A;  4H76 A;  1OS9 A;  2DW0 A;  4XM8 A;  1Y93 A;  2WOA A;  2WO9 A;  1JK3 A;  1Y0V A;  3KME A;  1ZXV A;  3KWV C;  1QIC A;  3L0T A;  1YP1 A;  2W12 A;  1C8T A;  1XFX A;  1BKC E;  3AYU A;  1KBC A;  3EDH A;  1QJI A;  1CAQ A;  1AF0 A;  4G0D A;  4PKT A;  3B8Z A;  4L19 A;  3LJT A;  4AXQ A;  1SAT A;  1KUF A;  4GR3 A;  1JH1 A;  3P1V A;  5D1T A;  3DPE A;  3O2X A;  3F1A A;  1JAP A;  3KRY A;  1RM8 A;  1GKD A;  4GF1 A;  2PJT A;  1O0Q A;  1CGL A;  5D7W A;  1JAQ A;  4CTH A;  1ROS A;  4I35 A;  2FV5 A;  3LQB A;  4PKW A;  1IAA A;  3K7L A;  5I43 A;  2X3A A;  1DTH A;  1ZVX A;  3LJG A;  1TVI A;  1FM1 A;  2OY4 A;  1G05 A;  2RJQ A;  4GUY A;  1I76 A;  5D1S A;  4EFS A;  4H82 A;  3ZXH A;  2JIH A;  3EDZ A;  2CKI A;  2OXU A;  3SHI A;  2W0D A;  2YUF A;  5L7F A;  2AYK A;  2OVZ A;  4HMA A;  3LK8 A;  1GE6 A;  1Y8J A;  2D1O A;  3KHI A;  5BPA A;  1HFC A;  1JKY A;  3RTT A;  4JPA A;  1XM5 A;  1I73 A;  966C A;  1USN A;  3LUN A;  3TVC A;  2DDF A;  3VI1 A;  1GO8 P;  3P24 A;  1EB6 A;  3CKI A;  1SLN A;  1QUA A;  2ERQ A;  2OW9 A;  1ATL A;  1D5J A;  2JT6 A;  2OVX A;  1BKC A;  1YQY A;  1SLM A;  1UTT A;  2D1N A;  1R1I A;  1JAN A;  1AST A;  1IAC A;  3F18 A;  3G42 A;  2OZR A;  1KUG A;  1C3I A;  4XCT A;  3LGP A;  3EHX A;  3I7G A;  1DMT A;  2MZE A;  1CXV A;  1JJ9 A;  1MMR A;  1PWU A;  4WKI A;  4IUW A;  2DW2 A;  4H84 A;  1OMJ A;  3MA2 A;  1AKL A;  3LIR A;  3F15 A;  3F16 A;  1GXD A;  1QJJ A;  1CK7 A;  3DNG A;  5D1U A;  3G5C A;  4DPE A;  4FXY P;  3TS4 A;  5I3M A;  5B5P A;  4AUO A;  1XAX A;  2OI0 A;  3DTE A;  1XFZ A;  1G12 A;  4A7B A;  1EUB A;  3U1R A;  1G49 A;  3LE9 A;  2MZI A;  3KEC A;  1K7Q A;  1OS2 A;  1KUI A;  2E2D A;  4H2E A;  3L0V A;  1ZS0 A;  2JNP A;  1MNC A;  2J83 A;  1FLS A;  2OW2 A;  3OHO A;  4WK7 A;  3V96 B;  1UEA A;  3GBO A;  2O36 A;  4DD8 A;  1IAE A;  2CLT A;  5BOT A;  1BUV M;  1GE7 A;  4AYK A;  1CQR A;  1UMT A;  2K2G A;  1JIW P;  1MMQ A;  4Q1L A;  1CGE A;  3DL1 A;  5LAB A;  3O64 A;  3KMC A;  1BKC I;  3Q2G A;  1YOU A;  2L0R A;  2MZH A;  3ZUK A;  5BOY A;  1UMS A;  4G9L A;  1PWQ A;  2JT5 A;  4PKR A;  3KEJ A;  2W14 A;  2HU6 A;  2Y6D A;  2A8H A;  4JQG A;  3DPF A;  1HV5 A;  2XS3 A;  4I03 A;  4H1Q A;  3DWB A;  1L6J A;  5CXA A;  1BM6 A;  4L6T A;  5B5O A;  3LKA A;  1SRP A;  4FU4 A;  4XM7 A;  3WV1 A;  1XFY A;  2TCL A;  1IAB A;  2OXZ A;  4WZV A;  3I7I A;  4DV8 A;  4PKS A;  3VTG A;  3DSL A;  3K7N A;  1SU3 A;  2DDY A;  3N2V A;  1R54 A;  1R1J A;  1XFV A;  3B2Z A;  3TSK A;  4DF9 A;  2DW1 A;  3Q2H A;  5H8X A;  4IN9 A;  1B3D A;  1SMP A;  1K7I A;  1XFU A;  2POJ A;  2W13 A;  2QPJ A;  1XUD A;  1IAG A;  1PWW A;  4PKQ A;  1HY7 A;  4L7A A;  4JA1 A;  1B8Y A;  1BQO A;  1R55 A;  3OHL A;  1ZP5 A;  4H3X A;  1R1H A;  1OM7 A;  2V4B A;  5L79 A;  4H49 A;  2ERP A;  1AYK A;  3LUM A;  3F17 A;  2RJP A;  2YIG A;  2OW1 A;  3EWJ A;  1HTD A;  1CGF A;  2ERO A;  3LIL A;  2W15 A;  4PKV A;  1BQQ M;  3EDI A;  1KUK A;  4JIJ A;  1OO9 A;  3EDG A;  5CUH A;  4GR0 A;  3B92 A;  1HOV A;  1GO7 P;  2OXW A;  2MLS A;  2XS4 A;  4GWM A;  4XM6 A;  3LMC A;  2SRT A;  4ON1 A;  1H71 P;  3TT4 A;  4PKU A;  2E3X A;  3KEK A;  2O3E A;  2AIG P;  4WKE A;  2JSD A;  4R3V A;  3WV3 A;  3AIG A;  3LIK A;  1BZS A;  2X3C A; 
#chains in the Genus database with same CATH homology
 3LQ0 A;  3BA0 A;  1BUD A;  1QIA A;  1XUR A;  1IAD A;  2K9C A;  4J4M A;  4H30 A;  1EAK A;  2WO8 A;  2Z2D A;  3USN A;  2N8R A;  4ILW D;  3HDB A;  2I47 A;  1A86 A;  2MLR A;  1MMB A;  3DTK A;  5D3C A;  4HX3 A;  3WV2 A;  3E8R A;  3LJZ A;  1ND1 A;  1XUC A;  1J7N A;  5I4O A;  1S4B P;  1WNI A;  4FXQ A;  1K7G A;  4GR8 A;  1OM6 A;  3N2U A;  5CZM A;  1D7X A;  1GE5 A;  3HYG A;  1PWV A;  5I0L A;  1D8F A;  1JAO A;  1A85 A;  2OY2 A;  3RTS A;  2USN A;  2Y6C A;  4JP4 A;  2J0T A;  1O0T A;  1BSW A;  3LEA A;  1Q3A A;  1JIZ A;  3DTI A;  4A3W A;  3HBV P;  3HDA P;  3HB2 P;  2X3B A;  4WF6 A;  1G4K A;  4AIG A;  1KAP P;  1C7K A;  1ZTQ A;  1FBL A;  3AYK A;  4ZR5 A;  5D2B A;  2OW0 A;  2KRJ A;  2FV9 A;  3F19 A;  1KUH A;  5I12 A;  1UTZ A;  3ELM A;  3UVC A;  1G9K A;  5I2Z A;  4IJO A;  1PWP A;  1YCM A;  4GQL A;  1I1I P;  4L63 A;  4QKZ A;  456C A;  1CIZ A;  3HBU P;  1Z3J A;  1XFW A;  3NX7 A;  4FVL A;  4XBH A;  1HFS A;  4GWN A;  2YB9 A;  1RMZ A;  830C A;  5JMY A;  1MMP A;  3EHY A;  1BIW A;  1OM8 A;  3ZVS A;  1D8M A;  1GKC A;  3HY9 A;  2X7M A;  1ZXC A;  1QIB A;  3HY7 A;  4H76 A;  1OS9 A;  2DW0 A;  4XM8 A;  1Y93 A;  2WOA A;  2WO9 A;  1JK3 A;  1Y0V A;  3KME A;  1ZXV A;  3KWV C;  1QIC A;  3L0T A;  1YP1 A;  2W12 A;  1C8T A;  1XFX A;  1BKC E;  3AYU A;  1KBC A;  3EDH A;  1QJI A;  1CAQ A;  1AF0 A;  4G0D A;  4PKT A;  3B8Z A;  4L19 A;  3LJT A;  4AXQ A;  1SAT A;  1KUF A;  4GR3 A;  1JH1 A;  3P1V A;  5D1T A;  3DPE A;  3O2X A;  3F1A A;  1JAP A;  3KRY A;  1RM8 A;  1GKD A;  4GF1 A;  2PJT A;  1O0Q A;  1CGL A;  5D7W A;  1JAQ A;  4CTH A;  1ROS A;  4I35 A;  2FV5 A;  3LQB A;  4PKW A;  1IAA A;  3K7L A;  5I43 A;  2X3A A;  1DTH A;  3LJG A;  1ZVX A;  1FM1 A;  2OY4 A;  1G05 A;  2RJQ A;  4GUY A;  1I76 A;  5D1S A;  4EFS A;  4H82 A;  3ZXH A;  2JIH A;  3EDZ A;  2CKI A;  2OXU A;  3SHI A;  2W0D A;  2YUF A;  5L7F A;  2AYK A;  2OVZ A;  4HMA A;  3LK8 A;  1GE6 A;  1Y8J A;  2D1O A;  3KHI A;  5BPA A;  1HFC A;  1JKY A;  3RTT A;  4JPA A;  1I73 A;  966C A;  1USN A;  3LUN A;  3TVC A;  2DDF A;  3VI1 A;  1GO8 P;  3P24 A;  1EB6 A;  3CKI A;  1SLN A;  1QUA A;  2ERQ A;  2OW9 A;  1ATL A;  1D5J A;  2JT6 A;  2OVX A;  1BKC A;  1YQY A;  1SLM A;  1UTT A;  2D1N A;  1R1I A;  1JAN A;  1AST A;  1IAC A;  3F18 A;  3G42 A;  2OZR A;  1KUG A;  1C3I A;  4XCT A;  3LGP A;  3EHX A;  3I7G A;  1DMT A;  2MZE A;  1CXV A;  1JJ9 A;  1MMR A;  1PWU A;  4WKI A;  4IUW A;  2DW2 A;  4H84 A;  1OMJ A;  3MA2 A;  1AKL A;  3LIR A;  3F15 A;  3F16 A;  1GXD A;  1QJJ A;  1CK7 A;  3DNG A;  5D1U A;  3G5C A;  4DPE A;  4FXY P;  3TS4 A;  5I3M A;  5B5P A;  4AUO A;  2OI0 A;  3DTE A;  1XFZ A;  1G12 A;  4A7B A;  1EUB A;  3U1R A;  1G49 A;  3LE9 A;  2MZI A;  3KEC A;  1K7Q A;  1OS2 A;  1KUI A;  2E2D A;  4H2E A;  3L0V A;  1ZS0 A;  2JNP A;  1MNC A;  2J83 A;  1FLS A;  2OW2 A;  3OHO A;  4WK7 A;  3V96 B;  1UEA A;  3GBO A;  2O36 A;  4DD8 A;  1IAE A;  2CLT A;  5BOT A;  1BUV M;  1GE7 A;  4AYK A;  1CQR A;  1UMT A;  2K2G A;  1JIW P;  1MMQ A;  4Q1L A;  1CGE A;  3DL1 A;  5LAB A;  3O64 A;  3KMC A;  1BKC I;  3Q2G A;  1YOU A;  2L0R A;  2MZH A;  3ZUK A;  5BOY A;  1UMS A;  4G9L A;  1PWQ A;  2JT5 A;  4PKR A;  3KEJ A;  2W14 A;  2HU6 A;  2Y6D A;  2A8H A;  4JQG A;  3DPF A;  1HV5 A;  2XS3 A;  4I03 A;  4H1Q A;  3DWB A;  1L6J A;  5CXA A;  1BM6 A;  4L6T A;  5B5O A;  3LKA A;  1SRP A;  4FU4 A;  4XM7 A;  3WV1 A;  1XFY A;  2TCL A;  1IAB A;  2OXZ A;  4WZV A;  3I7I A;  4DV8 A;  4PKS A;  3VTG A;  3DSL A;  3K7N A;  1SU3 A;  2DDY A;  3N2V A;  1R54 A;  1R1J A;  1XFV A;  3B2Z A;  3TSK A;  4DF9 A;  2DW1 A;  3Q2H A;  5H8X A;  4IN9 A;  1B3D A;  1SMP A;  1K7I A;  1XFU A;  2POJ A;  2W13 A;  2QPJ A;  1XUD A;  1IAG A;  1PWW A;  4PKQ A;  1HY7 A;  4L7A A;  4JA1 A;  1B8Y A;  1BQO A;  1R55 A;  3OHL A;  1ZP5 A;  4H3X A;  1R1H A;  1OM7 A;  2V4B A;  5L79 A;  4H49 A;  2ERP A;  1AYK A;  3LUM A;  3F17 A;  2RJP A;  2YIG A;  2OW1 A;  3EWJ A;  1HTD A;  1CGF A;  2ERO A;  3LIL A;  2W15 A;  4PKV A;  1BQQ M;  3EDI A;  1KUK A;  4JIJ A;  1OO9 A;  3EDG A;  5CUH A;  4GR0 A;  3B92 A;  1HOV A;  1GO7 P;  2OXW A;  2MLS A;  2XS4 A;  4GWM A;  4XM6 A;  3LMC A;  2SRT A;  4ON1 A;  1H71 P;  3TT4 A;  4PKU A;  2E3X A;  3KEK A;  2O3E A;  2AIG P;  4WKE A;  2JSD A;  4R3V A;  3WV3 A;  3AIG A;  3LIK A;  1BZS A;  2X3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...