1UMUA

Structure determination of umud' by mad phasing of the selenomethionyl protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
105
structure length
105
Chain Sequence
DYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPITISSEDTLDVFGVVIHVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the UmuD' protein and its regulation in response to DNA damage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sos mutagenesis
molecule keywords UMUD'
total genus 14
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 1996-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 1umuA00
1JHEA 1JHFA 4ME8A 1T7DA 1AY9A 1KN9A 4NV4A 2HNFA 2FKDA 2HO0A 4K8WA 1B12A 1F39A 3K2ZA 3JSPA 3BDNA 2FJRA 1I4VA 3S04A 3IIQA 3JSOA 1JHHA 4N31A 1KCAA 1JHCA 1UMUA
chains in the Genus database with same CATH superfamily
1JHEA 1JHFA 4ME8A 1T7DA 1AY9A 1KN9A 4NV4A 2HNFA 2FKDA 2HO0A 4K8WA 1B12A 1F39A 3K2ZA 3JSPA 3BDNA 2FJRA 1I4VA 3S04A 3IIQA 3JSOA 1JHHA 4N31A 1KCAA 1JHCA 1UMUA
chains in the Genus database with same CATH topology
1JHEA 1JHFA 4ME8A 1T7DA 1AY9A 1KN9A 4NV4A 2HNFA 2FKDA 2HO0A 4K8WA 1B12A 1F39A 3K2ZA 3JSPA 3BDNA 2FJRA 1I4VA 3S04A 3IIQA 3JSOA 1JHHA 4N31A 1KCAA 1JHCA 1UMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JHE A;  1JHF A;  4ME8 A;  1T7D A;  1AY9 A;  1KN9 A;  4NV4 A;  2HNF A;  2FKD A;  2HO0 A;  4K8W A;  1B12 A;  1F39 A;  3K2Z A;  3JSP A;  3BDN A;  2FJR A;  1I4V A;  3S04 A;  3IIQ A;  3JSO A;  1JHH A;  4N31 A;  1KCA A;  1JHC A;  1UMU A; 
#chains in the Genus database with same CATH topology
 1JHE A;  1JHF A;  4ME8 A;  1T7D A;  1AY9 A;  1KN9 A;  4NV4 A;  2HNF A;  2FKD A;  2HO0 A;  4K8W A;  1B12 A;  1F39 A;  3K2Z A;  3JSP A;  3BDN A;  2FJR A;  1I4V A;  3S04 A;  3IIQ A;  3JSO A;  1JHH A;  4N31 A;  1KCA A;  1JHC A;  1UMU A; 
#chains in the Genus database with same CATH homology
 1JHE A;  1JHF A;  4ME8 A;  1T7D A;  1AY9 A;  1KN9 A;  4NV4 A;  2HNF A;  2FKD A;  2HO0 A;  4K8W A;  1B12 A;  1F39 A;  3K2Z A;  3JSP A;  3BDN A;  2FJR A;  1I4V A;  3S04 A;  3IIQ A;  3JSO A;  1JHH A;  4N31 A;  1KCA A;  1JHC A;  1UMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...