1UMUA

Structure determination of umud' by mad phasing of the selenomethionyl protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
105
structure length
105
Chain Sequence
b'DYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPITISSEDTLDVFGVVIHVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UMUD'
molecule tags Sos mutagenesis
source organism Escherichia coli
publication title Structure of the UmuD' protein and its regulation in response to DNA damage.
pubmed doi rcsb
total genus 14
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature ec 3.4.21.-:
pdb deposition date 1996-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 1umuA00
4K8WA 1KCAA 1F39A 4ME8A 2FJRA 2HO0A 1I4VA 3JSPA 1UMUA 4N31A 1JHCA 3IIQA 1B12A 1JHHA 2HNFA 1JHFA 1KN9A 3S04A 1AY9A 4NV4A 3BDNA 1T7DA 3JSOA 3K2ZA 2FKDA 1JHEA
chains in the Genus database with same CATH superfamily
4K8WA 1KCAA 1F39A 4ME8A 2FJRA 2HO0A 1I4VA 3JSPA 1UMUA 4N31A 1JHCA 3IIQA 1B12A 1JHHA 2HNFA 1JHFA 1KN9A 3S04A 1AY9A 4NV4A 3BDNA 1T7DA 3JSOA 3K2ZA 2FKDA 1JHEA
chains in the Genus database with same CATH topology
4K8WA 1KCAA 1F39A 4ME8A 2FJRA 2HO0A 1I4VA 3JSPA 1UMUA 4N31A 1JHCA 3IIQA 1B12A 1JHHA 2HNFA 1JHFA 1KN9A 3S04A 1AY9A 4NV4A 3BDNA 1T7DA 3JSOA 3K2ZA 2FKDA 1JHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K8W A;  1KCA A;  1F39 A;  4ME8 A;  2FJR A;  2HO0 A;  1I4V A;  3JSP A;  1UMU A;  4N31 A;  1JHC A;  3IIQ A;  1B12 A;  1JHH A;  2HNF A;  1JHF A;  1KN9 A;  3S04 A;  1AY9 A;  4NV4 A;  3BDN A;  1T7D A;  3JSO A;  3K2Z A;  2FKD A;  1JHE A; 
#chains in the Genus database with same CATH topology
 4K8W A;  1KCA A;  1F39 A;  4ME8 A;  2FJR A;  2HO0 A;  1I4V A;  3JSP A;  1UMU A;  4N31 A;  1JHC A;  3IIQ A;  1B12 A;  1JHH A;  2HNF A;  1JHF A;  1KN9 A;  3S04 A;  1AY9 A;  4NV4 A;  3BDN A;  1T7D A;  3JSO A;  3K2Z A;  2FKD A;  1JHE A; 
#chains in the Genus database with same CATH homology
 4K8W A;  1KCA A;  1F39 A;  4ME8 A;  2FJR A;  2HO0 A;  1I4V A;  3JSP A;  1UMU A;  4N31 A;  1JHC A;  3IIQ A;  1B12 A;  1JHH A;  2HNF A;  1JHF A;  1KN9 A;  3S04 A;  1AY9 A;  4NV4 A;  3BDN A;  1T7D A;  3JSO A;  3K2Z A;  2FKD A;  1JHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...