1UNGD

Structural mechanism for the inhibition of cdk5-p25 by roscovitine, aloisine and indirubin.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
149
structure length
149
Chain Sequence
b'QASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 5
publication title Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 56
structure length 149
sequence length 149
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03261 CDK5_activator Cyclin-dependent kinase 5 activator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1ungD00
1H24B 3QHWB 4OR5B 4Y72B 4BCNB 1VOLA 2PMIB 4EOLB 3F5XB 4KRCB 4EORB 4I3ZB 1P5EB 4F6WB 3EIDB 1O9KB 2C5NB 2IVXA 5I5ZB 4EOPB 1G3NC 2CJMB 4CRLB 1AISB 2W9FA 2UZLB 4CFXB 5IDPB 4CFUD 3BHVB 2W9ZA 2WPAB 5HBHB 1OIYB 2WHBB 3MI9B 4CFWB 3TN8B 4BCMB 4BCHB 3LQ5B 1UNGD 2I53A 4EC9B 1H4LD 3DOGB 4EOMB 2X1NB 5HBJB 4BCOB 2C5OB 3M03A 1H26B 5CYIB 2R7GA 1OIUB 2WMBB 2C5XB 4F6SB 2CCIB 4FX3B 4TTHA 4F7NB 4EOJB 3BLHB 1H27B 4EONB 1PKDB 2EUFA 2G9XB 3H4CA 4KRDB 2PHGA 2CCHB 1O9KA 1GUXA 1GUXB 1JSTB 1UNLD 4BCFB 5IDNB 3TNWB 4OGRB 4F70B 1OL1B 1H1RB 3DDQB 4YOZA 5HQ0B 1FVVB 1ZP2A 3BLRB 5LQFB 2WFYB 4YC3B 5ICPB 1UNHD 4CFUB 2F2CA 5CEIB 2UZBB 3MY5B 1OKVB 4CXAB 1VINA 4ELLA 2PK2A 5L2WB 1TFBA 3RGFB 4BCPB 2V22B 1H1SB 1JKWA 1D3UB 1H1PB 4BCGB 3POMA 1F5QB 4EOIB 4ELJA 4EOKB 4UN0A 5HNBB 4BCKB 4NSTB 2IW8B 4YOSA 4BCQB 1OGUB 2I40B 4IMYB 1H25B 3O0GD 1H28B 2UZDB 1GY3B 3G33B 3EOCB 4ROEA 4BCMD 5ACBA 2WMAB 3TNIB 3BLQB 1VYWB 4EC8B 3BHUB 3MIAB 2W99A 1URCB 4EOQB 1OL2B 2PK9B 4EOSB 4F6UB 2IW9B 4RODA 2WXVB 2WEVB 1OI9B 2UUEB 2C4GB 3BHTB 3EJ1B 3K7AM 4BCIB 4BCND 1BU2A 3MY1B 4EOOB 4F7LB 4ROCA 2JGZB 1OKWB 4CFVB 3TNHB 5BNJB 5EFQB 1JOWA 2BPMB 2C5VB 2IW6B 4F7JB 5HVYB 2W96A 2WIPB 1FINB 1KXUA 1QMZB 2W2HA 5HBEB 1N4MA 3QHRB 4YOOA 1GH6B 5IF1B 2BKZB 1JSUB 4BCJB 4F7SB 1E9HB 2C6TB 4BCQD 4CFNB 1AD6A 1XO2A 3DDPB 4CFMB 5LMKB 2WIHB 2QDJA 2B9RA 5FGKB 4G6LB 1H1QB 1W98B 2UZEB 1C9BA 4II5B
chains in the Genus database with same CATH superfamily
4OR5B 4Y72B 2PMIB 3TW7A 4F6WB 3HB9A 2DPPB 3BG5A 2UZLB 5DQVA 2DD5B 5HBHB 2WHBB 4BCMB 3BG9A 3QYEA 4EC9B 3DOGB 2X1NB 2C5OB 3M03A 1H26B 2R7GA 1OIUB 4F6SB 4JX6A 4F7NB 2G9XB 2PHGA 2DD4B 1UNLD 5IDNB 3QWLA 4F70B 3QYBA 3DDQB 2QQ8A 3BLRB 3KHIA 5LQFB 4BBSM 5CEIB 4MFEA 4ELLA 2PK2A 1TFBA 4BCPB 4HLQA 4BCGB 4NSTB 3QYHB 3PO3S 4IMYB 5IHYA 2DMEA 1VYWB 4EC8B 2BS4A 4NC6A 3BG3A 2PK9B 2WXVB 3K7AM 2C4GB 3TNHB 3GTMS 3A8MB 2WIPB 2KMGA 1N4MA 3DTOA 4YOOA 1GH6B 1UGRB 2ZCFB 2G77A 4MFDA 2C6TB 2ZPBB 1AD6A 5LMKB 4BY7X 5FGKB 4G6LB 1W98B 1C9BA 4BCNB 4OB1B 2QDYB 1P5EB 1AHJB 2CJMB 2KR6A 1AISB 4CFXB 5IDPB 3BHVB 2W9ZA 2WJ9A 4Z6YA 2ZPIB 4BCHB 1H4LD 4BCOB 2CCIB 3BLHB 4EONB 4KRDB 3HO8A 2D0QB 2CCHB 4OB2B 1GUXB 4BCFB 3TNWB 1H1RB 5HQ0B 1FVVB 1ZP2A 2ZPFB 5EJCA 2WFYB 1E7PA 3QYGB 4YC3B 5ICPB 1UNHD 2F2CA 2UZBB 4HNTA 1H1PB 3POMA 4ELJA 5HNBB 4BCKB 2I40B 1H28B 2CYZB 4ROEA 3A8HB 2DXBB 2WMAB 3TNIB 2QF7A 3BHUB 4EOSB 2WEVB 1OI9B 2UUEB 3BHTB 3EJ1B 4BCIB 4BCND 1OKWB 5EFQB 1V29B 2QGSA 2BPMB 3HBLA 5HVYB 2AHJB 4BBRM 2CZ0B 2W2HA 3X24B 5IF1B 3VKHA 4F7SB 2ZPGB 4AI6A 2ZPHB 3DDPB 1H1QB 1VOLA 3HHTB 3B57A 4JX5A 1UGSB 4KRCB 4I3ZB 3EIDB 4ZGJB 2LW4A 4EOPB 1G3NC 2W9FA 3QZ9B 3QZ5B 2CZ7B 2WPAB 1OIYB 1UGQB 4CFWB 4EOMB 3LQ5B 5HBJB 2WMBB 2CZ1B 2C5XB 4FX3B 4TTHA 1PKDB 3X26B 1O9KA 1JSTB 1OL1B 4CFUB 3RGFB 1JKWA 1F5QB 4EOIB 3HZJA 3A8GB 4EOKB 4YOSA 3O0GD 3EOCB 3NDQA 3BLQB 3MIAB 1URCB 2QFZA 4EOQB 4OB3B 4RODA 4BXXX 1QLBA 2ZZDB 3DJBA 4ROCA 1BU2A 4CFVB 5BNJB 5DQWA 2C5VB 3DL1A 1FINB 3X28B 2PJQA 3QHRB 2BKZB 1FKMA 4BCJB 1E9HB 4CFNB 3TW6A 2WIHB 2QDJA 4BCQD 1H24B 3QHWB 4EOLB 3F5XB 4EORB 3VYGB 1O9KB 2C5NB 2IVXA 5I5ZB 4CRLB 4QSHA 4CFUD 1ENWA 4AKIA 3MI9B 1TD6A 3TN8B 4ZGEB 1UNGD 2I53A 2ZPEB 2BS2A 5CYIB 3WVDB 4EOJB 1H27B 2EUFA 3H4CA 1GUXA 3WVEB 3QXEB 4OGRB 4YOZA 4MIMA 1UGPB 4M6VA 2CZ6B 4FM4B 2IN3A 1IREB 4ZGDB 3MY5B 1OKVB 4CXAB 1VINA 5L2WB 3X20B 2V22B 3X25B 2DXCB 1H1SB 1D3UB 4UN0A 2IW8B 4BCQB 1OGUB 1H25B 2UZDB 1GY3B 3G33B 4BCMD 3A8OB 5ACBA 2W99A 4OB0B 1OL2B 4F6UB 2IW9B 4HL4A 3VKGA 4EOOB 3MY1B 4F7LB 2JGZB 4HNUA 2BS3A 1JOWA 2IW6B 4F7JB 2W96A 4AKGA 4LOCA 1KXUA 3A8LB 4BY1X 1QMZB 4JX4A 5HBEB 3VYHB 1JSUB 1XO2A 4CFMB 4AKHA 4HNVA 2B9RA 2UZEB 4II5B
chains in the Genus database with same CATH topology
1H24B 3QHWB 4OR5B 4Y72B 4BCNB 1VOLA 2PMIB 4EOLB 3F5XB 4KRCB 4EORB 4I3ZB 1P5EB 4F6WB 3EIDB 1O9KB 2C5NB 2IVXA 5I5ZB 4EOPB 1G3NC 2CJMB 4CRLB 1AISB 2W9FA 2UZLB 4CFXB 5IDPB 4CFUD 3BHVB 2W9ZA 2WPAB 5HBHB 1OIYB 2WHBB 3MI9B 4CFWB 3TN8B 4BCMB 4BCHB 3LQ5B 1UNGD 2I53A 4EC9B 1H4LD 3DOGB 4EOMB 2X1NB 5HBJB 4BCOB 2C5OB 3M03A 1H26B 5CYIB 2R7GA 1OIUB 2WMBB 2C5XB 4F6SB 2CCIB 4FX3B 4TTHA 4F7NB 4EOJB 3BLHB 1H27B 4EONB 1PKDB 2EUFA 2G9XB 3H4CA 4KRDB 2PHGA 2CCHB 1O9KA 1GUXA 1GUXB 1JSTB 1UNLD 4BCFB 5IDNB 3TNWB 4OGRB 4F70B 1OL1B 1H1RB 3DDQB 4YOZA 5HQ0B 1FVVB 1ZP2A 3BLRB 5LQFB 2WFYB 4YC3B 5ICPB 1UNHD 4CFUB 2F2CA 5CEIB 2UZBB 3MY5B 1OKVB 4CXAB 1VINA 4ELLA 2PK2A 5L2WB 1TFBA 3RGFB 4BCPB 2V22B 1H1SB 1JKWA 1D3UB 1H1PB 4BCGB 3POMA 1F5QB 4EOIB 4ELJA 4EOKB 4UN0A 5HNBB 4BCKB 4NSTB 2IW8B 4YOSA 4BCQB 1OGUB 2I40B 4IMYB 1H25B 3O0GD 1H28B 2UZDB 1GY3B 3G33B 3EOCB 4ROEA 4BCMD 5ACBA 2WMAB 3TNIB 3BLQB 1VYWB 4EC8B 3BHUB 3MIAB 2W99A 1URCB 4EOQB 1OL2B 2PK9B 4EOSB 4F6UB 2IW9B 4RODA 2WXVB 2WEVB 1OI9B 2UUEB 2C4GB 3BHTB 3EJ1B 3K7AM 4BCIB 4BCND 1BU2A 3MY1B 4EOOB 4F7LB 4ROCA 2JGZB 1OKWB 4CFVB 3TNHB 5BNJB 5EFQB 1JOWA 2BPMB 2C5VB 2IW6B 4F7JB 5HVYB 2W96A 2WIPB 1FINB 1KXUA 1QMZB 2W2HA 5HBEB 1N4MA 3QHRB 4YOOA 1GH6B 5IF1B 2BKZB 1JSUB 4BCJB 4F7SB 1E9HB 2C6TB 4BCQD 4CFNB 1AD6A 1XO2A 3DDPB 4CFMB 5LMKB 2WIHB 2QDJA 2B9RA 5FGKB 4G6LB 1H1QB 1W98B 2UZEB 1C9BA 4II5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H24 B;  3QHW B;  4OR5 B;  4Y72 B;  4BCN B;  1VOL A;  2PMI B;  4EOL B;  3F5X B;  4KRC B;  4EOR B;  4I3Z B;  1P5E B;  4F6W B;  3EID B;  1O9K B;  2C5N B;  2IVX A;  5I5Z B;  4EOP B;  1G3N C;  2CJM B;  4CRL B;  1AIS B;  2W9F A;  2UZL B;  4CFX B;  5IDP B;  4CFU D;  3BHV B;  2W9Z A;  2WPA B;  5HBH B;  1OIY B;  2WHB B;  3MI9 B;  4CFW B;  3TN8 B;  4BCM B;  4BCH B;  3LQ5 B;  1UNG D;  2I53 A;  4EC9 B;  1H4L D;  3DOG B;  4EOM B;  2X1N B;  5HBJ B;  4BCO B;  2C5O B;  3M03 A;  1H26 B;  5CYI B;  2R7G A;  1OIU B;  2WMB B;  2C5X B;  4F6S B;  2CCI B;  4FX3 B;  4TTH A;  4F7N B;  4EOJ B;  3BLH B;  1H27 B;  4EON B;  1PKD B;  2EUF A;  2G9X B;  3H4C A;  4KRD B;  2PHG A;  2CCH B;  1O9K A;  1GUX A;  1GUX B;  1JST B;  1UNL D;  4BCF B;  5IDN B;  3TNW B;  4OGR B;  4F70 B;  1OL1 B;  1H1R B;  3DDQ B;  4YOZ A;  5HQ0 B;  1FVV B;  1ZP2 A;  3BLR B;  5LQF B;  2WFY B;  4YC3 B;  5ICP B;  1UNH D;  4CFU B;  2F2C A;  5CEI B;  2UZB B;  3MY5 B;  1OKV B;  4CXA B;  1VIN A;  4ELL A;  2PK2 A;  5L2W B;  1TFB A;  3RGF B;  4BCP B;  2V22 B;  1H1S B;  1JKW A;  1D3U B;  1H1P B;  4BCG B;  3POM A;  1F5Q B;  4EOI B;  4ELJ A;  4EOK B;  4UN0 A;  5HNB B;  4BCK B;  4NST B;  2IW8 B;  4YOS A;  4BCQ B;  1OGU B;  2I40 B;  4IMY B;  1H25 B;  3O0G D;  1H28 B;  2UZD B;  1GY3 B;  3G33 B;  3EOC B;  4ROE A;  4BCM D;  5ACB A;  2WMA B;  3TNI B;  3BLQ B;  1VYW B;  4EC8 B;  3BHU B;  3MIA B;  2W99 A;  1URC B;  4EOQ B;  1OL2 B;  2PK9 B;  4EOS B;  4F6U B;  2IW9 B;  4ROD A;  2WXV B;  2WEV B;  1OI9 B;  2UUE B;  2C4G B;  3BHT B;  3EJ1 B;  3K7A M;  4BCI B;  4BCN D;  1BU2 A;  3MY1 B;  4EOO B;  4F7L B;  4ROC A;  2JGZ B;  1OKW B;  4CFV B;  3TNH B;  5BNJ B;  5EFQ B;  1JOW A;  2BPM B;  2C5V B;  2IW6 B;  4F7J B;  5HVY B;  2W96 A;  2WIP B;  1FIN B;  1KXU A;  1QMZ B;  2W2H A;  5HBE B;  1N4M A;  3QHR B;  4YOO A;  1GH6 B;  5IF1 B;  2BKZ B;  1JSU B;  4BCJ B;  4F7S B;  1E9H B;  2C6T B;  4BCQ D;  4CFN B;  1AD6 A;  1XO2 A;  3DDP B;  4CFM B;  5LMK B;  2WIH B;  2QDJ A;  2B9R A;  5FGK B;  4G6L B;  1H1Q B;  1W98 B;  2UZE B;  1C9B A;  4II5 B; 
#chains in the Genus database with same CATH topology
 4OR5 B;  4Y72 B;  2PMI B;  3TW7 A;  4F6W B;  3HB9 A;  2DPP B;  3BG5 A;  2UZL B;  5DQV A;  2DD5 B;  5HBH B;  2WHB B;  4BCM B;  3BG9 A;  3QYE A;  4EC9 B;  3DOG B;  2X1N B;  2C5O B;  3M03 A;  1H26 B;  2R7G A;  1OIU B;  4F6S B;  4JX6 A;  4F7N B;  2G9X B;  2PHG A;  2DD4 B;  1UNL D;  5IDN B;  3QWL A;  4F70 B;  3QYB A;  3DDQ B;  2QQ8 A;  3BLR B;  3KHI A;  5LQF B;  4BBS M;  5CEI B;  4MFE A;  4ELL A;  2PK2 A;  1TFB A;  4BCP B;  4HLQ A;  4BCG B;  4NST B;  3QYH B;  3PO3 S;  4IMY B;  5IHY A;  2DME A;  1VYW B;  4EC8 B;  2BS4 A;  4NC6 A;  3BG3 A;  2PK9 B;  2WXV B;  3K7A M;  2C4G B;  3TNH B;  3GTM S;  3A8M B;  2WIP B;  2KMG A;  1N4M A;  3DTO A;  4YOO A;  1GH6 B;  1UGR B;  2ZCF B;  2G77 A;  4MFD A;  2C6T B;  2ZPB B;  1AD6 A;  5LMK B;  4BY7 X;  5FGK B;  4G6L B;  1W98 B;  1C9B A;  4BCN B;  4OB1 B;  2QDY B;  1P5E B;  1AHJ B;  2CJM B;  2KR6 A;  1AIS B;  4CFX B;  5IDP B;  3BHV B;  2W9Z A;  2WJ9 A;  4Z6Y A;  2ZPI B;  4BCH B;  1H4L D;  4BCO B;  2CCI B;  3BLH B;  4EON B;  4KRD B;  3HO8 A;  2D0Q B;  2CCH B;  4OB2 B;  1GUX B;  4BCF B;  3TNW B;  1H1R B;  5HQ0 B;  1FVV B;  1ZP2 A;  2ZPF B;  5EJC A;  2WFY B;  1E7P A;  3QYG B;  4YC3 B;  5ICP B;  1UNH D;  2F2C A;  2UZB B;  4HNT A;  1H1P B;  3POM A;  4ELJ A;  5HNB B;  4BCK B;  2I40 B;  1H28 B;  2CYZ B;  4ROE A;  3A8H B;  2DXB B;  2WMA B;  3TNI B;  2QF7 A;  3BHU B;  4EOS B;  2WEV B;  1OI9 B;  2UUE B;  3BHT B;  3EJ1 B;  4BCI B;  4BCN D;  1OKW B;  5EFQ B;  1V29 B;  2QGS A;  2BPM B;  3HBL A;  5HVY B;  2AHJ B;  4BBR M;  2CZ0 B;  2W2H A;  3X24 B;  5IF1 B;  3VKH A;  4F7S B;  2ZPG B;  4AI6 A;  2ZPH B;  3DDP B;  1H1Q B;  1VOL A;  3HHT B;  3B57 A;  4JX5 A;  1UGS B;  4KRC B;  4I3Z B;  3EID B;  4ZGJ B;  2LW4 A;  4EOP B;  1G3N C;  2W9F A;  3QZ9 B;  3QZ5 B;  2CZ7 B;  2WPA B;  1OIY B;  1UGQ B;  4CFW B;  4EOM B;  3LQ5 B;  5HBJ B;  2WMB B;  2CZ1 B;  2C5X B;  4FX3 B;  4TTH A;  1PKD B;  3X26 B;  1O9K A;  1JST B;  1OL1 B;  4CFU B;  3RGF B;  1JKW A;  1F5Q B;  4EOI B;  3HZJ A;  3A8G B;  4EOK B;  4YOS A;  3O0G D;  3EOC B;  3NDQ A;  3BLQ B;  3MIA B;  1URC B;  2QFZ A;  4EOQ B;  4OB3 B;  4ROD A;  4BXX X;  1QLB A;  2ZZD B;  3DJB A;  4ROC A;  1BU2 A;  4CFV B;  5BNJ B;  5DQW A;  2C5V B;  3DL1 A;  1FIN B;  3X28 B;  2PJQ A;  3QHR B;  2BKZ B;  1FKM A;  4BCJ B;  1E9H B;  4CFN B;  3TW6 A;  2WIH B;  2QDJ A;  4BCQ D;  1H24 B;  3QHW B;  4EOL B;  3F5X B;  4EOR B;  3VYG B;  1O9K B;  2C5N B;  2IVX A;  5I5Z B;  4CRL B;  4QSH A;  4CFU D;  1ENW A;  4AKI A;  3MI9 B;  1TD6 A;  3TN8 B;  4ZGE B;  1UNG D;  2I53 A;  2ZPE B;  2BS2 A;  5CYI B;  3WVD B;  4EOJ B;  1H27 B;  2EUF A;  3H4C A;  1GUX A;  3WVE B;  3QXE B;  4OGR B;  4YOZ A;  4MIM A;  1UGP B;  4M6V A;  2CZ6 B;  4FM4 B;  2IN3 A;  1IRE B;  4ZGD B;  3MY5 B;  1OKV B;  4CXA B;  1VIN A;  5L2W B;  3X20 B;  2V22 B;  3X25 B;  2DXC B;  1H1S B;  1D3U B;  4UN0 A;  2IW8 B;  4BCQ B;  1OGU B;  1H25 B;  2UZD B;  1GY3 B;  3G33 B;  4BCM D;  3A8O B;  5ACB A;  2W99 A;  4OB0 B;  1OL2 B;  4F6U B;  2IW9 B;  4HL4 A;  3VKG A;  4EOO B;  3MY1 B;  4F7L B;  2JGZ B;  4HNU A;  2BS3 A;  1JOW A;  2IW6 B;  4F7J B;  2W96 A;  4AKG A;  4LOC A;  1KXU A;  3A8L B;  4BY1 X;  1QMZ B;  4JX4 A;  5HBE B;  3VYH B;  1JSU B;  1XO2 A;  4CFM B;  4AKH A;  4HNV A;  2B9R A;  2UZE B;  4II5 B; 
#chains in the Genus database with same CATH homology
 1H24 B;  3QHW B;  4OR5 B;  4Y72 B;  4BCN B;  1VOL A;  2PMI B;  4EOL B;  3F5X B;  4KRC B;  4EOR B;  4I3Z B;  1P5E B;  4F6W B;  3EID B;  1O9K B;  2C5N B;  2IVX A;  5I5Z B;  4EOP B;  1G3N C;  2CJM B;  4CRL B;  1AIS B;  2W9F A;  2UZL B;  4CFX B;  5IDP B;  4CFU D;  3BHV B;  2W9Z A;  2WPA B;  5HBH B;  1OIY B;  2WHB B;  3MI9 B;  4CFW B;  3TN8 B;  4BCM B;  4BCH B;  3LQ5 B;  1UNG D;  2I53 A;  4EC9 B;  1H4L D;  3DOG B;  4EOM B;  2X1N B;  5HBJ B;  4BCO B;  2C5O B;  3M03 A;  1H26 B;  5CYI B;  2R7G A;  1OIU B;  2WMB B;  2C5X B;  4F6S B;  2CCI B;  4FX3 B;  4TTH A;  4F7N B;  4EOJ B;  3BLH B;  1H27 B;  4EON B;  1PKD B;  2EUF A;  2G9X B;  3H4C A;  4KRD B;  2PHG A;  2CCH B;  1O9K A;  1GUX A;  1GUX B;  1JST B;  1UNL D;  4BCF B;  5IDN B;  3TNW B;  4OGR B;  4F70 B;  1OL1 B;  1H1R B;  3DDQ B;  4YOZ A;  5HQ0 B;  1FVV B;  1ZP2 A;  3BLR B;  5LQF B;  2WFY B;  4YC3 B;  5ICP B;  1UNH D;  4CFU B;  2F2C A;  5CEI B;  2UZB B;  3MY5 B;  1OKV B;  4CXA B;  1VIN A;  4ELL A;  2PK2 A;  5L2W B;  1TFB A;  3RGF B;  4BCP B;  2V22 B;  1H1S B;  1JKW A;  1D3U B;  1H1P B;  4BCG B;  3POM A;  1F5Q B;  4EOI B;  4ELJ A;  4EOK B;  4UN0 A;  5HNB B;  4BCK B;  4NST B;  2IW8 B;  4YOS A;  4BCQ B;  1OGU B;  2I40 B;  4IMY B;  1H25 B;  3O0G D;  1H28 B;  2UZD B;  1GY3 B;  3G33 B;  3EOC B;  4ROE A;  4BCM D;  5ACB A;  2WMA B;  3TNI B;  3BLQ B;  1VYW B;  4EC8 B;  3BHU B;  3MIA B;  2W99 A;  1URC B;  4EOQ B;  1OL2 B;  2PK9 B;  4EOS B;  4F6U B;  2IW9 B;  4ROD A;  2WXV B;  2WEV B;  1OI9 B;  2UUE B;  2C4G B;  3BHT B;  3EJ1 B;  3K7A M;  4BCI B;  4BCN D;  1BU2 A;  3MY1 B;  4EOO B;  4F7L B;  4ROC A;  2JGZ B;  1OKW B;  4CFV B;  3TNH B;  5BNJ B;  5EFQ B;  1JOW A;  2BPM B;  2C5V B;  2IW6 B;  4F7J B;  5HVY B;  2W96 A;  2WIP B;  1FIN B;  1KXU A;  1QMZ B;  2W2H A;  5HBE B;  1N4M A;  3QHR B;  4YOO A;  1GH6 B;  5IF1 B;  2BKZ B;  1JSU B;  4BCJ B;  4F7S B;  1E9H B;  2C6T B;  4BCQ D;  4CFN B;  1AD6 A;  1XO2 A;  3DDP B;  4CFM B;  5LMK B;  2WIH B;  2QDJ A;  2B9R A;  5FGK B;  4G6L B;  1H1Q B;  1W98 B;  2UZE B;  1C9B A;  4II5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...