1UNHA

Structural mechanism for the inhibition of cdk5-p25 by roscovitine, aloisine and indirubin.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
286
structure length
276
Chain Sequence
QKYEKLEKIYGTVFKAKNRHEIVALKRVRLDGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLANFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 5
publication title Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 78
structure length 276
sequence length 286
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1unhA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1unhA01
4BDFA 3LJ2A 3HKOA 1ZYDA 3AC3A 4TL0A 2HXQA 3C50A 3LE6A 1XHAA 4Y72A 3ZO2A 3JYAA 3AD4A 3OWLA 4M68A 1OITA 3F82A 5JZNA 5BVEA 1WBWA 4QP2A 3VUIA 5JH6A 3A99A 5IKWA 5HX6A 4QMXA 1Q8ZA 3FLZA 4S33A 3OHTA 5AP4A 5TF9A 3DK7A 2ITQA 2R3IA 4C8BA 2NPQA 2X2MA 3R8ZA 3G15A 2R3QA 1PKDA 4ZY5A 3V8TA 4BTMA 2OH4A 4QP6A 4IJ9A 4DLJA 5GINE 5K0KA 3COMA 4GVJA 2F7ZE 1IR3A 3TTJA 4GG7A 4P90A 3WE8A 4EYMA 4F7LA 5HU9A 3KRRA 2CN8A 3GNIB 3BWFA 4ZY4A 4TPTA 4ZTLA 4DEBA 4O7RA 5F1ZA 3ORLA 5D1JA 4ZIMA 1PMVA 2UZDA 4EOJA 4WNKA 4NKAA 4D2RA 3NNVA 4XV1A 3MJ2A 1Z9XA 5AR3A 5D7VA 4Q9SA 4D28A 4K18A 2BILB 2E2BA 5HLNA 4GG5A 4G17A 3U87A 1OUYA 3DBCA 3R8PA 3CXWA 4FG9A 3NWWA 3GCPA 5HVJA 2YAKA 3DPKA 4L00A 4ANQA 3OW3A 4JBVA 4UBAA 4M97A 1WBTA 3GU5A 4OT5A 1VZOA 2J5EA 1LUFA 2IVUA 4S30A 5IUGA 1UU7A 2WMVA 3HP5A 3VBXA 4KRCA 2XK7A 3COIA 3KMUA 4DGMA 5JT2A 4FSNA 2XUUA 4RJ3A 5ETFA 3DKGA 2VTHA 4XOZA 4B7TA 4CMOA 5EM8A 2WMSA 4YZCA 3BZ3A 1BL6A 3QTWA 3R01A 2ITUA 4CKRA 5JGAA 2XEYA 3KFAA 4S31A 2CPKE 2G01A 4LMUA 5M51A 2VWBA 2B54A 4NM0A 4PP9A 5G6VA 5HD7A 5E1SA 2C68A 2C6IA 4FTIA 2YJSA 3EOCA 4KBCA 4U3ZA 5CSWA 5DPVA 4IVCA 2AUHA 1BKXA 5D11A 3PP1A 2FVDA 5HBHA 4FEUA 2DUVA 3UPZA 4QMMA 3VS3A 4K2RA 4DH1A 4AA5A 5J9LA 3F3VA 1E1XA 4RVKA 4O7YA 3HAMA 3OVVA 3QTXA 2G9XA 2XIYA 4PPAA 3Q60A 4E73A 4YHFA 3F7ZA 3K54A 4C58A 2V62A 3QFVA 5C03A 2I40A 3BHHA 3OUNB 2VTPA 4FTUA 5KHWA 5DHJA 3E92A 3C13A 3VBVA 4A9YA 1YQJA 2HZ0A 3QALE 5AP6A 3NUAA 1ZAOA 5IF1A 1SZMA 4OAUC 3C1XA 2OFVA 3UO5A 1PMUA 3GU6A 5CNOA 4HGTA 5BVWA 1IEPA 2HWOA 3AT4A 3CE3A 3KVWA 3OMVA 2WIHA 3BHTA 4KIPA 3PVGA 5DT0A 3VQHA 3NPCA 3FMEA 4AE9A 4GKIA 2W9ZB 4FL2A 5EI6A 4MXCA 3KQ7A 5CF8A 2XNMA 4Y5QA 4OTWA 4BICA 4XV3A 4CQEA 3N9XA 2HW6A 4BBMA 1IRKA 1SVGA 2SRCA 3RM7A 3LXKA 3OBJA 5EHOA 4ZTSA 1XQZA 3VS5A 4J71A 1XH9A 4M15A 4RIOA 4AAAA 4BCHA 3MFRA 2OWBA 3RM6A 4YC8A 3DTCA 5HTIA 4O1PA 3MTFA 5EK7A 4LUEA 3Q9YA 1JWHA 3TCPA 1Q61A 1QPJA 4FT5A 2ZM1A 1OKVA 3CQEA 4O38A 2WTWA 4YC3A 4BZNA 3QWJA 4BBFA 4BR3A 2UW9A 3I81A 4G6OA 4U45A 1S9JA 3FMHA 3BYUA 3LFCA 5F4NA 2QCSA 3CY3A 4EOLA 4DC2A 4GJ3A 1MRYA 2PVNA 2GHLA 3PA3A 4QYGA 2YCQA 3VIDA 4F9AA 3WZUA 2VNYA 2F4JA 5HBJA 5ANIA 4BFMA 2FA2A 4PWNA 3FPQA 3W8LA 4YSJA 3CQUA 5IISA 3QRIA 5M53A 3RGFA 4BDJA 2ZB0A 4YJTA 3NNUA 5CAPA 2XIRA 3C4EA 1R39A 3HV7A 4UXLA 2YZLA 4ANSA 3DB8A 5DR2A 4HYUA 4WBBB 3C0HA 5J5TA 3C0GA 3C4ZA 1JLUE 3G33A 2QOCA 2J90A 3TT0A 2FSTX 3DJ5A 3UG1A 3V01A 2YCRA 4QNAA 3ZSHA 2XK3A 4MVFA 2J50A 3A4OX 2C5VA 4OTGA 3HV6A 3TUBA 2VTRA 3R7OA 2W1FA 2AYPA 4L43A 4NM5A 4PF4A 5L6WL 3UP7A 4TXCA 1U46A 3OWPA 3MS9A 5EDPA 3LVPA 3FI4A 3O51A 2GNJA 1YW2A 1R0PA 4RC2A 2YDKA 4PDOA 4FIGA 4C62A 4RFZA 4E26A 2IPXA 4KAOA 4ASEA 3KN5A 4MK0A 4CKJA 3MY0A 4R7HA 5EQPA 2X1NA 4FV3A 3OROA 4QP9A 4QRCA 3WIGA 5JFXA 5EQYA 4TW9A 2QQ7A 3ZDUA 1PXOA 2DYLA 2Z7LA 4TZRA 1Z5MA 3G6GA 4IVAA 5E8TA 3V8SA 2HZIA 4HZRA 4XP2A 3O0GA 1PHKA 2WTVA 3BPRA 4IB3A 4NUSA 3NW6A 2X4ZA 3D15A 2XNOA 2CGXA 4XH6A 4DG2E 4ZJIA 4ERWA 1Q24A 3R00A 1OIRA 4RX7A 5IMXA 3KN6A 4BTKA 2R3MA 4AWIA 3EFJA 3BQCA 4AF3A 3BLQA 4GUBA 4E5BA 3MVHA 2J0LA 3QZFA 4LM5A 4BWKA 3FEGA 5CQUA 3PJ3A 5AV0A 4DHFA 2R3FA 4FEVA 4V0GB 4YZBA 3R9OA 4MQ2A 1R0EA 3R1QA 4AX8A 2E9NA 4R1YA 1NA7A 3BWJA 4L8MA 1FMKA 3UPXA 4F0IA 5E9EA 4ALWA 1XBAA 3KRJA 4QD6A 5IPJA 4O82A 4G2FA 2IN6A 2IVVA 3GC0A 1Q8UA 4GIIA 4H36A 2JFMA 1Q62A 3C4WA 3LJ1A 4ANMA 4CGAA 4USFA 2GCDA 2VTJA 3FC2A 4GEOA 5CTPA 3BQRA 3DCVA 4MF1A 5AAFA 3RTPA 4UWCA 3CBLA 3VBWA 3NYXA 2RFNA 3EYHA 4DYMA 4RWJA 1UVRA 2ITNA 3ZLSA 2IVTA 4GMYA 4AQCA 4FOCA 4C3FA 2PVKA 4I93A 4B8MA 4CQGA 4R7BA 5GJFA 5BVKA 3TXOA 3UQGA 3F88A 4NYEA 2WFYA 4YJOA 4USEA 3AC2A 4APPA 3FMJA 3LXLA 3VS1A 2QO9A 3C4FA 4IJPA 1IG1A 3FUPA 3SW4A 5HTBA 3CPCA 2Y0AA 3L9NA 4X3FC 1U4DA 1R78A 4QNYA 4U79A 3LHJA 2HW7A 4IAAA 5LMAA 4EH6A 3RBWA 5CU0A 3UG2A 5ITAA 4IZ7A 2O2UA 5AAEA 4EYJA 3PLAE 3NYOA 4FIEA 3DDPA 4NK9A 3HDNA 5DT3A 2X6EA 1SNXA 4RIWB 3GU4A 2YN8A 2R7IA 3BE2A 5DEWA 4FIIA 4K1BA 4FX3A 4BDBA 3R9RA 4G9RA 2W05A 3DGKA 3OF0A 4M7IA 4QMOA 4RWLA 4C34A 4YTFA 3QC4A 3BU3A 4IIRA 4RIYB 5B2MA 5LWMA 2X8IA 4NCTA 5A4CA 5IQIA 3PJ8A 2W1IA 5A4QA 3DAEA 4FG7A 1UA2A 3V5TA 3U8WA 2ETRA 4EBWA 4YLKA 3I1AA 2ZV8A 2C0OA 1ZXEA 2C6EA 4RFMA 4FTMA 2VX1A 4FZDB 3FI2A 3U9NA 2GPHA 3BKBA 4XS2A 3E88A 2PE1A 1LPUA 4J97A 4DTAA 3IKAA 1S9IA 3PSBA 4QMZA 4JIAA 2CDZA 4CFVA 4E5AX 2JIIA 4RJ6A 4ZJJA 4WRSA 2XKFA 2Z2WA 4FMQA 5IQFA 2YLEA 2ZMDA 1OPLA 4ALUA 1H1PA 3DBQA 4MD8E 2O5KA 3DKFA 5T3QA 3RMFA 3NVMB 3ZSIA 5AP5A 3BE9A 3KF4A 5AP2A 3UOLA 4QT1A 2ZDUA 3RK7A 4DG3E 4F7SA 4ANOA 3RAKA 3RKBA 3ZDIA 1OB3A 2J6MA 2WQNA 3QYZA 4CCUA 1WBVA 4O0WA 3UIXA 4GV1A 4O0XA 1JKSA 5IQCA 3W32A 3H4JA 3QYWA 4FG8A 3MJ1A 4JBQA 3NNWA 4TTHB 5ANKA 4ZLYA 2HXLA 4BYIA 4XBUA 4JT3A 4C2WA 1VJYA 4NW6A 5DMZA 5JSMA 2IVSA 3LPBA 3ORXA 3QL8A 4CNHA 2R0UA 2OG8A 4BKYA 1A48A 4ACHA 2XK6A 3LJ0A 4DFLA 3RK5A 4O7NA 4NT4A 4HVDA 3TV4A 4AGWA 4WUAA 4OTPA 4YJRA 4D9TA 4JQ7A 4KIOA 3K2LA 3EL8A 5HO8A 2PVRA 4MX9A 1ZLTA 4CFMA 5AV2A 1GZ8A 4C02A 2PVFA 4IE9A 3HLLA 4WHZA 3C0IA 1XWSA 2FB8A 3M1SA 2QOHA 3MPMA 4PPBA 3ACKA 5IQHA 3LXPA 3DTWA 5KUPA 2WTIA 1OKWA 2WTKC 3NUNA 3P7BA 3QU0A 4YJNA 3R7IA 5HBEA 3TNQB 2OW3A 5AUUA 1CKPA 4HNFA 2BFYA 3F5UA 3FZ1A 4BCGA 5CF6A 1Y91A 3MBLA 5BMSA 1FVVA 5AUYA 4RA5A 3RZBA 4TWPA 4PMTA 3M2WA 4K77A 2GMXA 4GCJA 3GCQA 3KULB 3GXLA 4GYIA 5IA5A 3D7TB 2B52A 2RFDA 3VS7A 3Q32A 4O0YA 4KKEA 3QKMA 3FMLA 5FXRA 4D0WA 4L44A 2OK1A 3P79A 3QQUA 3DAKA 4YR8A 1WVXA 3TZ8A 5AIKA 2QC6A 3PJCA 5CSPA 1REJA 2X8EA 1GZNA 3B2WA 3WI6A 2BIKB 4NEUA 5DH3A 3U51A 5BYLA 3QKLA 4ZSGA 2VTSA 5I3OA 3RNIA 4Q9ZA 3RHXA 3F5PA 2J0IA 2PVJA 2XKCA 5HCZA 1H28A 4KABA 3W2QA 3HA6A 5CVGA 1FINA 2PMLX 3QX2A 4O91A 2X7FA 4RG0A 3LFFA 1U54A 2EXMA 4XG4A 3LXNA 5AV3A 5FTQA 3PZHA 1PY5A 4E93A 3RPOA 5IA4A 4OBQA 2ZM3A 2GHGA 2V7OA 4BCJA 4YC6A 5IQGA 3PXQA 3H9RA 3SV0A 4DFZE 1GZOA 3TIZA 1P2AA 5FBNC 2Z7RA 4JDKA 1BL7A 4X3FB 1H00A 5AUXA 3T9TA 3KA0A 4F7NA 2WU6A 5E8XA 3FI8A 5EH0A 5HZNA 1OPKA 3DAJA 1OL6A 3VAPA 3DK6A 4H05A 4R78A 4B9DA 5CSHA 2F7XE 3P23A 3ZRLA 2VU3A 3QUEA 1QCFA 3DQWA 3BEAA 3F3TA 4CFUA 4FSQA 2YCSA 2BZKB 2VTTA 2VWWA 3DZOA 3NEWA 3L1SA 3NNXA 3FY2A 3LFQA 4FL3A 5DRDA 3A61A 2B9IA 4NIFB 5E1EA 3UIUA 5BQ0A 5LARA 2WKMA 5AA8A 1Q3DA 5FP5A 2VTLA 4F08A 4J7BA 4FTAA 1OPJA 4AP7A 3MPAA 3EN5A 1NW1A 2QHMA 4UMTA 1YHSA 4JQEA 1MRVA 1ZOGA 4FKIA 4NM3A 3W10A 2EWAA 2WOTA 3HRCA 3TI1A 2GNIA 2R7BA 4TN6A 3HV4A 1PYEA 3BHYA 5ANGA 3GFWA 4G6LA 2B7AA 3IGOA 1I44A 3D5WA 2FUMA 1M7QA 1TVOA 3ZH8A 3AT2A 1GOLA 4H3QA 4O84A 4X2FA 3OTVA 4OW8A 3ZEWA 2OZOA 4ZOGA 1OECA 5L2QA 4DITA 4I6QA 1REKA 4PPCA 2QOKA 3WZKA 5TT7A 3FLWA 4BKJA 4IEBA 2QR7A 3PPJA 5J87A 4D1ZA 3W18A 5C1QB 1YVJA 4IXPA 3DU8A 4IVBA 4LYNA 4O22A 4I5PA 4L52A 2PTKA 4U6RA 3LLTA 1SNUA 4EK4A 4ZLOA 4QYEA 4W9XA 5HIBA 4UXQA 3CTHA 5IA0A 4A9SA 5M08A 2P55A 2VO7A 4RBLA 1YXTA 3IPHA 5DBXA 4C4HA 5KBQA 4I24A 4EC8A 3HMPA 2VO0A 3R02A 2IZRA 4P5ZA 2OF4A 4NSTA 1YXUA 3PIZA 4QTAA 4QTCA 5J1VA 2WIPA 1B39A 2VTOA 5G1XA 2HYYA 4AOIA 5BX0A 3CLYA 3EJ1A 4MWIA 3FYJX 1J1CA 4WSQA 4Y95A 4LGDA 4LOQA 3CS9A 4EUTA 4ZMFA 2BPMA 4CG9A 3VW6A 2WTKB 4H1MA 2F9GA 1K3AA 5AJQA 5M57A 3S1HA 4C37A 1TKIA 4QP8A 4L3JA 2J5FA 4YBKA 2UW0A 1OVEA 4BTFA 4F4PA 1SMHA 1H07A 3G90X 3MIAA 3ZRKA 2W4JA 3OEFX 4CFWA 1ZMUA 2XNGA 5A6OA 3ORZA 2QODA 4JG7A 3LAUA 4L3LA 1IA8A 3P86A 5IQBA 3A7JA 2EXEA 1UNGA 2YAAA 4EK8A 3GP0A 5EI2A 4FKJA 4XJ0A 5DI1A 4E3CA 5JZJA 3KB7A 3DDQA 3WE4A 4BGGA 3R8MA 4BI1A 3E7OA 3GI3A 3NW5A 4LV8A 3G5DA 4MYGA 5CYIA 4BYJA 2REIA 5CLPA 3P0MA 2JD5A 4UMPA 5IQDA 4RMZA 3E63A 4MQ1A 3PSDA 1VEBA 3Q52A 4W8EA 3VHEA 2PMIA 4RQVA 4D4SA 1MQ4A 5KMLA 1Q8WA 5IEYA 2WMWA 3RHKA 2E9PA 3MIYA 3E8CA 2Z7SA 3OY1A 1JOWB 4UV0A 4EWQA 3TN8A 3FI3A 5AADA 4YNEA 4G3DA 5ANEA 3DS6A 2C5NA 3HX4A 5BVDA 4FKGA 4I22A 5IUIA 4AE6A 4R5SA 5GIPE 3CD3A 4JG6A 3FAAA 3QRUA 2VO3A 5DG5A 3RP9A 4RC3A 4UWBA 5GIOE 4E4NA 4FIJA 2NP8A 2H8HA 3ZMMA 3FMDA 4RZVA 5HE3A 2C30A 3QLGA 4EZ5A 1W84A 4MNEB 2VWVA 3Q4CA 1PXLA 5FDXA 5JRSA 3R8UA 3NUUA 2R3NA 2I0YA 3BCEA 4AZFA 5AV4A 2CKPA 5GJDA 4JR7A 4Y46A 4RIXA 2QOLA 1KOBA 1JNKA 1RJBA 4FIHA 4NFNA 5AP0A 1U5QA 5DYJA 4OBPA 2IW8A 2PULA 3GEQA 4BGHA 1FMOE 5FBOA 4JVGA 4IAKA 4XMOA 4OUCA 3SDJA 3TNIA 5F9EA 1H1QA 1PXJA 2WO6A 3AMAA 2XEZA 5HORA 1H01A 4ZTHA 2CCHA 2FGIA 3F7WA 3HMIA 4EK5A 2QKRA 5FXQA 4KKGA 5EW9A 5KZIA 5C26A 3Q2JA 5K0XA 3I6WA 3MFTA 4FKTA 4QMLA 4U44A 4P4CA 3PXYA 4PDYA 3DKOA 2UVXA 5GNKA 3PXKA 3WILA 4K6ZA 2J9MA 4U0IA 5CWZA 2NRUA 4OR5A 4BRXA 4ASDA 2JBPA 3D4QA 4FT0A 4L46A 4EK3A 3KXHA 4EL9A 4HYIA 3KK9A 3KXNA 4E6AA 2PE0A 2JDSA 5EOBA 3SGCA 2HY0A 4XNEA 2LAVA 5E7RA 5CAOA 5J9ZA 1YXVA 3MV5A 3U9CA 3UDBA 4MCVA 1H26A 1NVRA 2OO8X 4F1TA 4YURA 4D2TA 4L68A 4KSPA 3D0EA 3GCSA 1TQMA 3ZO4A 4CRLA 2G15A 3OWJA 3JPVA 3KXZA 4Y85A 3W33A 3Q96A 1H25A 4KIKB 5HIEA 1ZYCA 3RWQA 3KY2A 1XO2B 5EHLA 3ZYAA 1O6KA 4IB5A 4EQUA 1WBOA 3QTQA 3ZFYA 4DLIA 4ANNA 5CEPA 5A3XA 4NJDA 4QPAA 1SVEA 4RFYA 2BHEA 3FSKA 2PZ5A 3WF6A 4ENXA 3TKHA 3R8LA 5L2WA 2QD9A 4DGLC 4V05A 2RL5A 3L8SA 4GK2A 5E8YA 3LM0A 4YNOA 3ROCA 4M69A 5K4JA 3N4TA 1OI9A 4PV0A 2UZLA 4ZZMA 4GH2A 5DLSA 4FE2A 2BRHA 3R22A 4G5JA 3I7BA 3R7EA 3IDBA 4YHJA 3TJCA 1ZOEA 4FTCA 4EH7A 2E9OA 2EB2A 3BLHA 2F2CB 3SX9A 5A9UA 3IW4A 2PWLA 4BCKA 4FA2A 2JKQA 3FHIA 5LCJA 1NVSA 1UKHA 4WOVA 2GHMA 3EWHA 3U4UA 4DGGA 3FLYA 2AC3A 4D1SA 2YM7A 2R3LA 1XR1A 2C6MA 1KV1A 2WEVA 3DJ6A 4IDTA 4PDPA 2A27A 3EFLA 4TYIA 4ASXA 4F1OA 3N4UA 3PRFA 4A4LA 4BF2A 5HX8A 4II5A 3ET7A 1YI6A 1IAHA 2YEXA 1OL7A 5LXMA 4R6VA 3SXSA 3PG3A 4Z55A 4L3PA 5E8VA 4HGLA 1M2PA 3VF9A 1UU3A 2CNVA 2Y9QA 4R8QA 4TRLA 1MP8A 4OTFA 5EYDA 5CXHA 4EH2A 1DAWA 3R6XA 3VULA 5JFSA 4DT9A 4FT3A 4JXFA 4TWNA 4CMUA 1BI8A 4H58A 4WRGA 5FEEA 4BIEA 4WSYA 1GNGA 4BWPA 4RX5A 4HVGA 3DQXA 1KE9A 1VYWA 3NYVA 1PMNA 3O71A 5BYZA 3UBDA 1EH4A 1J3HA 3TNPC 5ACBC 1DI8A 3ZFXA 2Y6OA 5DGZA 2XF0A 5J95A 4UMRA 4JLCA 3O2MA 4MKCA 4IQ6A 5AP1A 5CU2A 4OTRA 3FQHA 4R3RA 5HIDA 2J0JA 4QO9A 3NDMA 4ALVA 2ZV7A 3KREA 3UVPA 3QTRA 3V5QA 5JQ5A 5J5SA 4FZAB 5CX9A 4AOJA 3Q4UA 4TYHA 2O0UA 1BUHA 4LL0A 2JKOA 4ZSAA 3G0FA 4X6RA 3HL7A 4YP8A 4F0GA 1T45A 2QU6A 3PFQA 3ZO3A 2R5TA 4F9BA 4LOOA 2O8YA 3U6IA 4FIFA 1PXPA 1NY3A 1URWA 5L8KA 5DRBA 2A2AA 3Q5ZA 2QOQA 5IA3A 2XBJA 2VWIA 2QOBA 4YHTA 3D83A 3OUKA 3HECA 4TKSA 4IANA 2ETKA 2X7OA 1ZY4A 5JGDA 4U43A 4GU9A 5EI8A 1O6YA 2V22A 2QO2A 4Z9LA 2QU5A 4MEDA 5IEVA 3QUPA 1GAGA 3I79A 4FNZA 2C3KA 4U3YA 4X0MA 5E8WA 4AFJA 5LVOA 4PTEA 4BDGA 4WIHA 1H24A 4O7SA 4FSUA 5HO6A 5BUEA 3DT1A 2J7TA 3E64A 3EQPA 3QZIA 4RVLA 2JIUA 5FQDC 3TM0A 4DE4A 2J51A 4BC6A 2PL0A 4XEYA 4TNDA 3NUSA 3ZEPA 4BWXA 4K9YA 4EH5A 2UW7A 1YRPA 4F65A 3KEXA 3KXXA 5M56A 2BRBA 2PHKA 4KUJA 4G5PA 5L6OA 3F3ZA 2P2HA 4IM0A 2IZUA 4A9TA 3LQ8A 5EFQA 4K0YA 4R1VA 2OZAA 2WQMA 3ANRA 3VS4A 3SXRA 2X39A 1U5RA 4HYHA 3F3UA 3PP0A 3RPSA 4O6LA 4ZK5A 3ZUTA 3RNYA 3A60A 3TNWA 4BCNA 5AFVA 2OI4X 3Q53A 5KE0A 4FV8A 3ZC5A 1UU9A 5JFVA 3GUBA 4XCUA 2OH0E 4GFGA 3COKA 3PE1A 5L8LA 3AQVA 5H2UA 3I5NA 2JFLA 4PUZA 4EC9A 3NX8A 3ACJA 4HZSA 3UZRA 1TQPA 2OXXA 4FC0A 3NAYA 1Q3WA 2PPQA 3ERKA 3F66A 4HGSA 3PA4A 4JDHA 3ULIA 3C4CA 2CGUA 4JJRA 4DEHA 2R3OA 2W1HA 4WD5A 3MB7A 3ZRMA 3RCDA 2CGWA 3NCZA 4FKPA 5AUWA 2E9UA 5EHYA 2UZBA 1JQHA 2YABA 1R3CA 2OGVA 4I41A 2XZSA 1PF8A 4WNMA 2PVMA 4FKUA 4G3CA 1NXKA 4I5MA 1JKKA 3O17A 4R3PA 4D4RA 5I4NA 4C4GA 3FC1X 4IDVA 4EUUA 1KSWA 4WT6A 4XHKB 5AX3A 2ZDTA 3R1NA 4X6QC 4Q5EA 4YU2A 4MD7E 2QLUA 2J4ZA 4KRDA 4FUXA 4X2GA 4I5CA 3LMIA 5J8IA 3E8NA 5AR7A 4LRKA 1ZYLA 2I0VA 3WYXA 4ZZOA 3IDPA 5J9YA 5KHXA 4F6SA 5HHWA 4YJPA 3RAIA 4AA4A 4NCTC 2YJRA 3UE4A 3E7VA 2XJ2A 4KBAA 5BNJA 4QMQA 2BVAA 1M52A 3BV2A 2ZJWA 3BU5A 4BDCA 1OBDA 2GTNA 5E8UA 3VUDA 4FT9A 4JRNA 4U5JA 1QL6A 1CKIA 4QTEA 3GOPA 2R4BA 3OXTA 4FYNA 3BEGA 3E62A 5M4FA 2KTYA 1YWVA 2PZIA 4C7TA 5M4CA 5HVYA 4FSWA 4L7SA 5ETCA 3EHAA 4FSZA 3V5PA 4EJNA 4FTTA 4N6ZA 3C5UA 2G2IA 3A2CA 5CENA 3O8UA 1YI3A 2O64A 4B0GA 3L9LA 1Q8YA 3FQEA 2P3GX 4QP7A 5EDRA 1CTPE 4GT4A 4MWHA 4BHZA 4H3PA 4CG8A 3BBTB 4BCFA 4BL1A 1OL2A 3LFDA 4FOBA 4ZS4A 2JKKA 2G1TA 4ITJA 4PTCA 4R3CA 4BKZA 4DH3A 3N4VA 1E9HA 4MF0A 4IAZA 3SA0A 4PNIA 5EKNA 1H1WA 4E1ZA 4OTHA 4G31A 2OXYA 5FLFA 3AC1A 3T3VA 4O83A 3L8VA 4FL1A 5CVFA 3LIJA 1JPAA 1OIQA 3B8QA 1A9UA 5JFWA 4FSTA 1FQ1B 4KWPA 3D5UA 3UGCA 5DR6A 4FTNA 4YPSA 3QTZA 1Q41A 2ITWA 4Y83A 4BI0A 2ESMA 1ZRZA 2NRYA 2PUPA 5EM5A 3NW7A 4U9AA 3VBTA 4JBOA 3MY5A 4CZTA 4QOXA 4KB8A 2B55A 4CRSA 4G3FA 5FGKA 2C5OA 4IB1A 3UOJA 1GY3A 4QMTA 4C4EA 3AGLA 3LFSA 5EYMA 3UMWA 3WZJA 4JDJA 2C47A 4Z16A 4QYFA 5ACKA 3F3WA 3FKNA 3BLRA 4AW2A 4X21A 4IM2A 4XLIA 3VHKA 2ZYBA 4QMNA 3V5LA 5H8BA 2UV2A 4FTKA 2NNWB 3GOKA 3GCVA 4DH7A 4DFBA 1QPDA 2V55A 3ODYX 2ITOA 5HE0A 3MH3A 3O7LD 1O6LA 3Q9XA 3QRKA 1B38A 3OBGA 3S4QA 4O86A 4MXZA 2XKDA 2YERA 4J95A 4C4FA 3OEZA 3TNHA 5EM7A 5EW8A 3G51A 4RQKA 3HGKA 4FZ6A 3SKCA 3SXFA 5LMBA 4YO6A 2WPAA 3ORPA 4JBPA 2UVYA 1U59A 2JEDA 4F63A 4CFNA 5I9YA 4FVQA 2YDIA 2EXCX 1JKTA 3PPKA 4Y5HA 3VC4A 3V04A 5AR5A 3MB6A 1PW2A 3OTUA 4MXYA 4XYFA 5LQFA 5LVPA 4IADA 4OTDA 2UUEA 4IC8A 4KIQA 2VX3A 2DQ7X 3VN9A 2BTSA 5HU3A 2R64A 2BROA 2NO3A 2PZRA 2WXVA 2CLXA 3BHUA 4CTCA 4CXAA 2B1PA 2PY3A 4JRVA 2YIRA 5TKDA 3EKKA 4CTBA 3E87A 3NIEA 3ZXTA 2C6TA 4GFMA 2UZVA 3FBVA 3HDMA 4FKSA 4JAJA 5D41A 3ZLXA 4L9IA 4D5KA 2XK4A 4IBMA 2BKZA 5I9XA 4G3GA 3KCFA 2R3RA 3IW5A 2P0CA 4EI4A 4CLIA 3IOPA 2YISA 3BGPA 3GQLA 3QD3A 4J96A 4M84A 4ITHA 4RPVA 3TDVA 3EN4A 2UZTA 2WELA 5LOHA 2GU8A 4BCMA 5FTGA 3MVMA 3F69A 4DT8A 3VNTA 3OOMA 2VN9A 4GIHA 2XM8A 4MBIA 4FV9A 5H3QA 3CEKA 3CJFA 3D9VA 3WARA 2BCJA 2UW3A 3S00A 1Q99A 4EOIA 4AZEA 3VQUA 5C8NA 2ITZA 2HZNA 3FY0A 5AM6A 3SQQA 3EQBA 2QOIA 3AT3A 4KKHA 4J1RA 4HW7A 1DI9A 3MVLA 4G1WA 4FV0A 3ZS5A 2W1EA 2V0DA 2Z7QA 3MW1A 5E8ZA 4D2WA 4WG5A 1ZYSA 2YIXA 2HELA 3LKMA 3GT8A 4NM7A 1RW8A 4A07A 3IO7A 1Y6AA 2BR1A 1Q5KA 3QUDA 4GFOA 2C0TA 3PDTA 1UNLA 3DLSA 2BZJA 2BHHA 3JY0A 2DS1A 2BDFA 4W4XA 2BMCA 1WVYA 3AG9A 3H9OA 3PXZA 2BUJA 3BYMA 3QLFA 4XG6A 3JY9A 5FUTA 2JDTA 5IH6A 3MVJA 3MWUA 4M67A 5A14A 2PVHA 5C4LA 1HCKA 4UB7A 3KULA 1Z57A 4NJ3A 4LG4A 3P9JA 4GVAA 4DN5A 5BPYA 3S0OA 3JUHA 2PE2A 2C3JA 3OT3A 3IW7A 4AN9A 4FKWA 3OC1A 2Y8OA 4WNPA 2G2FA 5C27A 3W8QA 5KKRC 2QG5A 3HVCA 2EB3A 2R3KA 3TTIA 2CKQA 2C6DA 4CSVA 5KCVA 1L3RE 5CF4A 5M09A 4FR4A 5DVRA 4PMPA 1QPEA 5A6NA 3KCKA 2PUIA 4C4IA 3NYNA 3FXXA 5A4TA 2QLQA 3MI9A 2W5HA 5HG5A 4F64A 3R7YA 1FVTA 4Q5HA 2QONA 2BDWA 3E3BX 3FXWA 3OD6X 4MH7A 4QYYA 3ZCLA 2VTQA 4U41A 4D58A 1F3MC 3CKWA 3FYKX 4U80A 3DZQA 3ORIA 3E8DA 4IX6A 4XG7A 2XP2A 3ZUVA 4CT2A 4O0SA 2WQEA 2ZAZA 2BFXA 3W1FA 2H9VA 4DCAA 3G2FA 2CJMA 2W0JA 4YJSA 4AZSA 2PU8A 2BIYA 4L01A 3ZFMA 3WF7A 3WZDA 4ARKA 5FTOA 4XUFA 4HYSA 3LFBA 4RJ5A 3MN3A 2XM9A 3ZBXA 3TDWA 4PNKA 4G3EA 2W4OA 5EYKA 2IJMA 4F1MA 3HMOA 3EMGA 3HUBA 2BTRA 4FTRA 3E93A 2PVYA 4NTSA 5L4QA 1ZZ2A 3EZVA 4CVAA 5L3AA 5J79A 4EOPA 3IG7A 3MGYA 4U8ZA 3UOKA 2WMBA 4IFGA 4BDIA 3C4XA 4MXXA 1U54B 3QQHA 4RVMA 3T9IA 4CV8A 3A8WA 4B4LA 2V7AA 3KL8A 3R7UA 4L53A 2WB8A 4MHAA 4C3PA 2YDJA 3CGFA 3ORMA 4CFXA 2CCIA 2EVAA 3AMYA 4PL4A 4IAFA 5KO1A 3EL7A 4FTLA 2BZHB 4FODA 1UNHA 3UMXA 4ZLZA 4M3QA 1CKJA 2VO6A 2GNGA 2PUUA 4FV6A 3GC9A 3UQFA 4FT7A 1YDSE 1XKKA 3KXGA 1LR4A 2RGPA 5BMMA 2VTMA 1DM2A 3HUCA 3QCSA 1JSUA 4UZHA 2ITTA 3FL4A 3QD4A 1OBGA 3QXOA 3HA8A 5CALA 1MUOA 3EQHA 4H39A 4YO4A 3KGAA 3FJQE 5HKMA 4NFMA 4IWPA 2CGVA 5LWNA 2CNQA 4FICA 3SG8A 3R9HA 1G8AA 3TKIA 2CSNA 4FKOA 1WBPA 2AC5A 2OSCA 4PL3A 4CEGA 2P4IA 3ZHPC 5KMIA 4BCQA 4X2JA 1KWPA 3VUTA 3A4PA 3UO6A 3D14A 3PLSA 1F0QA 2BDJA 5HE2A 2YIWA 3ENHA 2ERZE 2IZSA 1MQBA 4CFFA 3FKLA 3EN7A 5DIAA 4K8AA 2BAKA 4RRVA 2UZOA 5IMEA 3R73A 3QX4A 3HEGA 4O7LA 2H34A 2QOFA 2WTJA 3KKVA 4GYGA 3FLQA 3R63A 4I5HA 4YTIA 3ELJA 5IDPA 3GCUA 4QP4A 2WMTA 3HZTA 1J91A 5KMOA 2C1AA 2QKWB 1JBPE 4XP3A 3L9MA 1H0WA 3F2NA 3IW6A 1K9AA 4EKKA 5HLWA 4GKHA 3NVKI 1STCE 2XNBA 3PJ1A 3FXZA 3LCTA 5CASA 4P5QA 3A7FA 2BRGA 2X7GA 5ANDA 3RALA 4PDSA 2JKMA 2OU7A 4GK3A 3QA0A 3AD6A 2QHNA 4D9UA 3A8XA 4EHVA 3Q6UA 4YZDA 4ZTRA 4RLKA 3FLNC 1SYKA 2BAJA 4DH5A 2IW6A 3NUYA 2YIQA 1BI7A 3G6HA 3QTUA 3RI1A 2W1GA 2YFXA 4L45A 4AGUA 3QCYA 4RWKA 2X8DA 3PYYA 3KC3A 4IM3A 3UO4A 4ZZNA 4UX9A 4QPSA 2Y7JA 2ZOQA 4ERKA 4EQMA 3DBEA 4O0VA 3FZRA 3EQFA 4FVPA 2C6KA 3GC7A 2Q83A 5CEQA 4ANBA 2GQGA 2XYNA 4J8NA 2CNUA 4DBXA 3CTQA 5CVHA 2XIKA 3O8TA 5DFPA 4EZ3A 4I6FA 1OKYA 1Y8GA 2R3PA 3AC8A 1W0XC 4I94A 4JR3A 4QMSA 2FSMX 5D10A 1BX6A 2RFSA 4RLLA 4ZTQA 4PY1A 4J99A 3VS2A 2DWBA 4FK6A 1Y6BA 5HNGA 4ACCA 4DG0E 1M17A 4GUEA 4HNIA 5I9VA 2VWYA 4I0SA 5I9ZA 5J1WA 3IOKA 4E6QA 4BB4A 3D2IA 3LCOA 3G9LX 3RAHA 1CDKA 3AC5A 4TNBA 5HOAA 1J7IA 2O65A 5GJGA 4RJ4A 4XG2A 2JDOA 4FSMA 3S2PA 4EOMA 3LQ3A 2BAQA 4FI1A 4LQMA 4RZWA 3Q2MA 3BYSA 3CY2A 3ZLYA 5LMKA 2A0CX 3VWAA 4BDHA 3H10A 2XRUA 3H0ZA 2ONLA 3R04A 1XH8A 3SC1A 3ZLWA 5L6PA 1XBCA 4M12A 3H3CA 3R28A 3O96A 4YGAA 3ALNA 4FV7A 4MAOA 1OZ1A 3CD8A 4L7FA 5FEQA 5CEKA 3LFEA 1TQIA 3EKNA 1W82A 4EOKA 4D1XA 4Y73A 4IHPA 1M2RA 3LZBA 3I6UA 4FF8A 2YITA 1V0BA 4I1ZA 3R1SA 5DEYA 3CPBA 4F6UA 5CSVA 4DTKA 4XLVA 1NVQA 2C1BA 1IAJA 3ATSA 2P2IA 5AX9A 5HG9A 2UZUE 2WZJA 2XMYA 5E92A 3GFEA 3GC8A 2VZ6A 5M4UA 2QNJA 3LCKA 4FKVA 4RC4A 3VRZA 3B2TA 3SRVB 3C7QA 4RIXB 4BDAA 4EJ7A 4C61A 2YLFA 4O2PA 2X4FA 3UNZA 5BVFA 2C69A 4TYGA 5CANA 2OXDA 3MPTA 3QZHA 4ZMEA 1ZARA 4HCVA 2B9HA 4W4WA 2VWUA 3ETAA 1ZZLA 3LM5A 2YM5A 4CZYB 1WCCA 3W16A 3JR1A 2Z02A 3UIMA 4ONAA 4I0RA 4C33A 3RPYA 4EOQA 1XJDA 3WF8A 5GHVA 2IZTA 5CAVA 1H4LA 2Q0BA 2F49A 2JLDA 2YZAA 4PTGA 3WIKA 5CAUA 2YWPA 3ENMA 4U97A 4AW0A 5C01A 1H0VA 4YPDA 2BRMA 2I6LA 1O9UA 4E8AA 3BYVA 2R9SA 4Z7HA 1PMEA 5DWRA 2BALA 3ZXZA 3R0TA 5EKOA 2HY81 2ZM4A 1CM8A 3QZGA 1LP4A 3RVGA 3TZ7A 4F70A 2LGCA 4YTCA 4M14A 2VD5A 3FWQA 3EH9A 3OP5A 4IACA 4IAIA 4J98A 4QP1A 5CI7A 4UY9A 5F94A 3KRXA 3Q9WA 3QD2B 5EYCA 1AGWA 1BLXA 5F20A 5IDNA 3WF9A 2YA9A 3OXIA 2WD1A 2WHBA 1W8CA 3NMUF 4XOYA 4ENYA 3ORTA 3MSSA 3C5IA 3F6XA 3ATTA 4GRBA 4APCA 3W2SA 1RQQA 3QF9A 3ALOA 2B4SB 2W9FB 5HEZA 5K9IA 2OF2A 1RE8A 2R3HA 3GQIA 4ORKA 2OIQA 3FHRA 5CY3A 5HICA 4UYNA 3L8XA 3MY1A 3Q6WA 4USDA 4EH8A 3OW4A 4YTHA 3BGQA 3BV3A 4L67A 1Q97A 2QI8A 2OKRA 2JIVA 3KMMA 2B0QA 4O0TA 3V5JA 1YWNA 3WYYA 4E6CA 5HD4A 5DT4A 3P78A 3NAXA 5L8JA 3QXPA 4W4YA 4M69B 3R30A 4QQCA 3LFNA 2PMOX 4AT4A 3FL5A 4HVIA 3DNEA 4LV5A 3HNGA 3B8RA 3WOWA 4HVSA 2C0IA 4BDDA 3GGFA 3PG1A 4I3ZA 2VTAA 3P1AA 4ZXTA 2Y4IC 5D12A 3LCDA 4FUYA 3N51A 1V0PA 3P7CA 4GJ2A 4WUNA 4BHNA 3COHA 4YJVA 4QYHA 4FBXA 3FMKA 5AMNA 4O81A 3P5KA 4F09A 4GK4A 5C4KA 3O23A 2IWIA 5CT7A 1P4OA 3F61A 3KMWA 1WFCA 4FK3A 4M13A 4FTJA 2YCFA 4CYIA 2CHLA 5HNIX 1F5QA 4IWQA 2B9JA 5IA1A 4KA3A 1HOWA 3EIDA 4FV2A 5ANJA 3E3PA 3OCSA 4O1OA 2W17A 4Z7GA 4S34A 4O21A 1H27A 4C57A 1L8TA 1JKLA 3JVRA 2XH5A 4I21A 2XKEA 3QWKA 3EQCA 3VUGA 3OT8A 5K5NA 4CKIA 4EEVA 3U4WA 5CQWA 4AGDA 3QRJA 3E8EA 3MA3A 3U54A 2ACXA 3DB6A 4J52A 2W7XA 1YDRE 4NTTA 5H9BA 3REPA 2JITA 4BCPA 2X2LA 3ZC6A 3O7LB 3VRYA 3RAWA 3QCXA 2XNPA 4G6NA 4I6HA 5C9CA 3T8OA 3QGYA 4KD1A 4KS7A 5F95A 4FEQA 4IX4A 3RPRA 5CS6A 5HG8A 4E6DA 1G8SA 4BI2A 2UZNA 1V0OA 3POZA 3W2OA 3RPVA 2JAVA 2PZYA 5AA9A 5KMNA 4BIBA 1PXKA 3EZRA 3W55A 3ZZWA 5L2IA 3QHRA 3QHWA 5JK3A 2X6DA 4TYHB 5EM6A 5HCYA 1ATPE 5IQAA 4EK6A 3M42A 4AGCA 2VWXA 3OY3A 2BKKA 4RT7A 2WNTA 3ZUUA 4YBJA 3R7VA 3VBYA 2WQOA 3TUDA 3VW8A 3A7GA 1FGIA 4BY9E 2A19B 4RA4A 5EW3A 5FEDA 3D5VA 5DOSA 1OM1A 5AM7A 3NCGA 4UZDA 3L8PA 2Y6MA 4N6YA 2YM4A 3F9NA 2I7QA 3UVRA 2XS0A 4EH4A 3Q4ZA 3GU8A 3HV5A 3I7CA 3OCBA 4C35A 4EQCA 5I5ZA 5JEBA 3TZ9A 4LRMA 1PKGA 4W9WA 3TJDA 3IS5A 2VAGA 2X2KA 4TYEA 5FM3A 1YWRA 1ZYJA 2PVLA 5HLPA 4R77A 4RGJA 3OWKA 2UW6A 1J7UA 3BU6A 2J0KA 5T68A 4BTJA 1SM2A 4HCUA 3TL8A 3JVSA 4O7ZA 4K11A 4OBOA 1YI4A 2OZAB 4IZAA 3IQ7A 3V8WA 2GFCA 2PK9A 4G34A 2XK9A 3K5VA 4F9WA 3PRIA 4F0FA 4FNXA 3KRWA 4FSYA 4FV5A 4NW5A 1M14A 2GS2A 4I4FA 5LVMA 3DY7A 4UMQA 2OJIA 3DXPA 2RKUA 4WG4A 1FVRA 4XP0A 5C8MA 1RDQE 2J2IB 2FH9A 4F9CA 2FSLX 3CGOA 3EQGA 5AR4A 1AQ1A 4JX7A 5IZFA 3CCNA 3NS9A 3QQJA 4IMYA 3RZFA 2VTNA 3THBA 3MDYA 4YUQA 3TEIA 4GW8A 3OCGA 1H1RA 4U7ZA 2WGJA 1APME 4WKQA 5HO7A 2CKOA 4JI9A 4X2NA 4BZDA 4QP3A 4PMMA 2R3GA 2UW5A 4DA5A 1UV5A 1LEZA 4A06A 2XRWA 2PMNX 3AD5A 2Y4IB 4L6QA 3DFAA 1GIIA 5JRQA 2QURA 4JDIA 5CU4A 5CI6A 3GENA 4NH1A 1XH6A 4DFUA 4NL0A 3MFSA 1SVHA 4ACGA 4QTDA 4ITIA 4A9RA 1GJOA 1QPCA 4GL9A 4HPUE 3VF8A 4BIDA 4D4YA 3ODZX 4EZ7A 3EFWA 4FKQA 2C3LA 4FSRA 3ZOSA 5LVNA 3OXZA 3HAVA 2ERKA 4LGGA 3HRBA 3VBQA 4V04A 1MRUA 1OIYA 5LCKA 5HTCA 2GNHA 1XH4A 4KSQA 4BGQA 4DEIA 4AA0A 2GS6A 2QR8A 4PX6A 3HMNA 3SD0A 5BUIA 5IH5A 4DCEA 3JS2A 1UWHA 2ITPA 2XJ1A 4QTBA 2X0GA 4ZTMA 2UZWE 5AR8A 1Q4LA 1W7HA 2WMAA 3NR9A 4P7EA 5L2TA 4Q2AA 3LOKA 3I0QA 3PXRA 1OL5A 2XBAA 3MFUA 4V0GA 3QQFA 3DOGA 2EUFB 3OZ6A 5FD2A 3RJCA 5I3RA 3FZTA 1ZOHA 4QQ5A 3SVVA 3PUPA 3PIYA 3MH0A 3F5GA 4MBJA 5C8KA 5ETIA 3CKXA 3I4BA 4TY1A 3TZMA 2GQRA 2B53A 2ETMA 2XNEA 4LUDA 4QPMA 3Q9ZA 3UTOA 1KE8A 3NGAA 2J0MB 3VVHA 4AW1A 4EH3A 1DS5A 3F2RA 3HV3A 2OICA 1H8FA 2R0IA 3GBZA 1Q8TA 4AOTA 4DAWA 2QO7A 4ACDA 4CT1A 1H1SA 4D2SA 2GDOA 1QMZA 1FOTA 2W1CA 2QVSE 4E4XA 5B2KA 3RWPA 4U42A 2FYSA 2RSVA 4FKRA 4QMYA 5IUHA 4ACMA 4BDEA 5HGIA 3NSZA 5J7BA 4FEWA 1URCA 4BZOA 3R2BA 4L42A 2XA4A 1OGUA 1YXXA 4LL5A 1FBNA 1AD5A 2ZV9A 4AZTA 4ZSJA 2VTIA 2WMXA 3IK3A 3OS3A 3BHVA 4O2ZA 4BCOA 2GTMA 4G16A 3U6HA 5M07A 4ASZA 3SLSA 2A4LA 4XV9A 3LQ5A 3I60A 4UYAA 5GZ8A 3PY1A 1HCLA 3P7AA 3Q5IA 2WMQA 3VO3A 3IONA 5FRIA 5AUVA 3DLZA 4ZTNA 3PY0A 2F2UA 4V01A 4DEEA 4XG3A 4PMSA 4RIWA 2WMUA 4PQNA 2OJ9A 4J8MA 4JL9A 5IQEA 3BGZA 3EN6A 3FZSA 4WO5A 5BUJA 4O0RA 4ANLA 2JDVA 3C51A 4N70A 2HCKA 3OCTA 3NIZA 4JIKA 4RIYA 4W8DA 3HRFA 5DN3A 4EKLA 2G2HA 4JQ8A 4WBOA 4LOPA 2OJFE 2XYUA 1XBBA 2CN5A 1WBSA 5I9UA 4GT3A 4M0YA 4AUAA 5BVNA 1P14A 4WNOA 3ZO1A 5DA3A 2R3JA 2ITVA 4OT6A 4O6EA 2YIYA 2PYWA 4F99A 2HZ4A 4FNYA 2ZVAA 4FGBA 2WU7A 3QTIA 4IX5A 5IG1A 4LMNA 4AXAA 3QQKA 4AN3A 3ZBFA 5M55A 3VJOA 4AU8A 3ZM4A 4EWHA 5AAGA 1CMKE 5FP6A 5H8GA 2I0HA 4XG8A 4A9UA 3TV7A 3QTSA 2XNNA 4J53A 4BDKA 4CMTA 5HNBA 4GSBA 4D2VA 3TKUA 3K5UA 1ZWSA 4JOAA 5CXZA 4I20A 4A4OA 4DTBA 5GZAA 4IAYA 4LGHA 2X9EA 3W2CA 3FDNA 3ITZA 5LVLA 1Y8YA 3P4KA 4AZVA 5CF5A 3BX5A 5KX8A 5DNRA 5FG8A 3AXWA 3SW7A 5TOZA 4PRJA 1WZYA 3QQGA 3UOHA 5KMJA 4TYJA 4AS0A 3AC4A 3R2YA 2VWZA 5E8SA 3UNKA 4O7TA 2Q0NA 3D94A 4N57A 4DFYA 4X3JA 2C6OA 3WBLA 5K4IA 1NT2A 1YOMA 5HESA 2C3IB 4RJ7A 3BRBA 3ZSGA 4R5YA 3M11A 5TE0A 5BVOA 4E4MA 3EQIA 3AMBA 4IZYA 1WBNA 3G9NA 5CAQA 4MXAA 4AZWA 1WMKA 5CZIA 5LJJA 2I0EA 4YSMA 3FZPA 1A06A 2VGOA 3HP2A 2C4GA 4B99A 4KS8A 4ZY6A 4XRLA 3V6RA 4CYJA 3PA5A 5M06A 4IFCA 4GS6A 3C9WA 4FKLA 4IW0A 4B8LA 2UVZA 3PY3A 3UJGA 4LFIA 3ORNA 4CV9A 4XX9A 1M2QA 3OG7A 1JVPP 2GSFA 2VGPA 2HAKA 3PWDA 4I92A 4QMUA 3ULZA 3LMGA 3VUHA 4X2KA 3VS6A 2HOGA 3GB2A 3VUMA 5HVKA 4XBRA 4O27B 4ZP5A 4QQJA 2JBOA 2RG6A 3SAYA 2RFEA 3D7TA 2O63A 1KE6A 3PXFA 5E4HA 1R1WA 1YKRA 3CTJA 3QC9A 4PL5A 3FV8A 4Z3VA 1FGKA 4OGRA 5A4LA 3A7IA 1YOLA 2WEIA 4BBEA 5JGBA 3BI6A 4NKSA 1PYXA 4HPTE 4QMWA 3NUPA 1BYGA 4FTQA 1FPUA 1ZMWA 3CJGA 3AGMA 1PRYA 3QA8A 4YJUA 3QKKA 3F2AA 4RWIA 4CLJA 3PPZA 4HOKA 4EORA 5A46A 2X81A 1E1VA 3IDCA 2ZMCA 5A54A 3U55A 3TV6A 3I5ZA 2FO0A 5CNNA 4XG9A 4WA9A 4EHEA 3FLSA 5ETAA 4IVDA 2OIBA 4OTIA 4IX3A 2YM3A 4IWOA 3NLBA 4FGRA 1ND4A 4C59A 3R1YA 3FE3A 3O50A 5AEPA 3R83A 4NWMA 3R71A 5AUZA 4X3FA 4C4JA 4QQTA 3R9NA 3GVUA 2W5BA 4ZSEA 4QMPA 2GS7A 4A7CA 4AN2A 3UZTA 2VV9A 2Y4PA 4ZEGA 1DAYA 3LLAA 1G3NA 4GT5A 2B9FA 4DINA 4RVTA 4N4SA 4X7QA 4RJ8A 3H0YA 3UC4A 4U40A 3DXQA 4NIFA 5DR9A 5HI2A 3LW0A 3V51A 3DNDA 5T6KA 3BYOA 1G5SA 2JC6A 3UQCA 3BELA 1OMWA 1PXIA 1WAKA 4D0XA 2PUNA 2QG7A 2W1DA 3ZZEA 1YHVA 3R9DA 3U6JA 4ZJVA 4E7WA 2W1ZA 2C5XA 3MA6A 5J7HA 1KV2A 3ZU7A 3JXWA 2W5AA 3KF7A 1KOAA 4RX8A 1IA9A 3KRLA 3LFAA 1YHWA 3D5XA 3AOXA 1T46A 3FPMA 1UWJA 3PSCA 4CZUA 4EONA 3CC6A 2RF9A 3QBNA 4F7JA 4EHGA 3WF5A 3EQDA 4IH8A 4UWYA 2HIWA 1YXSA 3LCSA 5LMKC 3D2KA 4HCTA 3PTGA 4OLIA 3MYGA 2ONLC 4MBLA 4I6BA 3W2PA 4HJOA 3V3VA 5AUTA 5M44A 1GZKA 2JAMA 5CEMA 4G9CA 3DK3A 2R2PA 4FVRA 2V5QA 3GU7A 3V5WA 2EU9A 3VJNA 5FDPA 2P33A 1ERKA 3VUKA 2VUWA 4AFEA 1YOJA 4BCIA 4EH9A 3KK8A 4MNFA 2XIXA 5K3YA 2H6DA 4S32A 2IG7A 4FZ7A 4D55A 4AW5A 3EYGA 2Z60A 2UZEA 4O96A 3SG9A 4E20A 4E5WA 3DFCB 5CT0A 2ITXA 5GZ9A 2F57A 1X8BA 3OOGA 1LEWA 4DBNA 1IASA 4DEGA 2HK5A 5IEXA 2GNLA 4P2KA 3TUCA 1K2PA 3H9FA 4DF3A 3IECA 5AP7A 2ZV2A 4O0UA 3EQRA 5EDQA 5CU3A 3PVWA 3TWJA 3ORKA 5M4IA 1W83A 5JN2A 4JAIA 4EHZA 1VYZA 3RINA 3HYHA 4D2PA 5EQEA 4NZWB 2WTCA 4C3RA 2VNWA 4IB0A 3MH2A 2BZIB 5E90A 3BBWA 5D7AA 1OKZA 4BVUA 3Q4TA 4MTAA 5CU6A 5B0XA 4UMUA 2IO6A 3P08A 3FZOA 3KVXA 5CSXA 5A4EA 1W98A 5KKRB 2PSQA 4C0TA 2IW9A 3UYTA 2W4KA 2XJ0A 1GIHA 3POOA 4WG3A 3WZEA 1JAMA 3FSFA 3MESA 4ID7A 2OIDA 3K3JA 4DGNA 3DBDA 4FEXA 1WVWA 5JQ8A 3NZ0A 2OLCA 3ZONA 4B6LA 2RIOA 2GFSA 3D7ZA 3G0EA 2WTDA 4JS8A 4TWCA 3UZPA 3ANQA 4C36A 3DV3A 2XK8A 3K3IA 2OFUA 4W4VA 4DGOA 2H96A 4C38A 2ZB1A 3QQLA 1P4FA 4YZNA 3NUXA 5KNJA 1UU8A 5HG7A 2VX0A 4JNWA 3ZTXA 4RSSA 2XIZA 3TG1A 1UKIA 3R7GA 5FWKK 5JMSA 3R21A 5E91A 3PVBA 2YM6A 4RX9A 4AT3A 4EOSA 5I9WA 1ZMVA 5AR2A 1KE7A 2WQBA 4FZFB 2JDRA 3NRMA 4XRJA 4C2VA 4K33A 3PE2A 2Z8CA 3DXNA 2W96B 5D9HA 4JG8A 5CEOA 3FQSA 5FM2A 5H8EA 3EB0A 3I0OA 3DA6A 1ZY5A 3A62A 4MNEA 3IGGA 2ITYA 5FXSA 5KBRA 3V6SA 3QGWA 2XB7A 4MXOA 4D5HA 2O3PA 2W06A 3PIXA 3BIZA 4TWOA 4YZMA 4I0TA 1GIJA 1PJKA 3OFMA 3S3IA 4M8TA 2UW8A 5KMMA 2FSOX 1H08A 3FKOA 3L9PA 3W2RA 2GQSA 4N0SA 3PWYA 4I23A 4H3BA 4EBVA 3QCQA 5TO8A 3MH1A 4AACA 3ZM9A 4QMVA 5HE1A 4M0ZA 4O7WA 4YLLA 5EOLA 2YWVA 1BMKA 2GNFA 4CD0A 4M66A 3A7HA 5B2LA 3RCJA 5ICPA 1B6CB 5AP3A 4IWDA 4BN1A 3SOCA 1XH5A 5KMKA 2QOOA 4FV1A 2JGZA 3HMMA 3SRVA 1J7LA 4FYOA 3Q3BA 2UW4A 1KE5A 2HWPA 3QD0A 5EG3A 4ZSLA 4FTOA 4AT5A 5AV1A 3CP9A 3UNJA 3UODA 3O8PA 4H1JA 5HCXA 3DKCA 1PXMA 3CR0A 2YACA 4I4EA 2XVDA 5IU2A 1J1BA 2C6LA 3VS0A 3PZEA 1CSNA 3CSVA 3QAME 3MTLA 4HGEA 3S95A 3SHEA 1V1KA 3DBFA 2WMRA 4E4LA 3PJ2A 4FV4A 4F6WA 3CQWA 4JX3A 3KXMA 5HQ0A 1JSTA 2HENA 2XCHA 3II5A 1YDTE 4UEUA 4YZ9A 5KZ0A 3Q04A 3UVQA 4D4VA 4UN0C 5BYYA 5L2SA 4DEAA 4S2ZA 2XCKA 4HVHA 4YJQA 5IA2A 5AWMA 2W99B 1PXNA 4IC7A 2C5YA 4KIKA 2WAJA 2YHVA 1I09A 4DH8A 3FMNA 4U81A 5CEIA 1Y57A 2CKEA 3KU2A 1KUTA 5DE2A 2OJJA 2X9FA 1OIUA 4R7IA 1OL1A 3EN9A 3RK9A 4UALA 4DFXE 4YMJA 1M7NA 3H30A 3UP2A 2YM8A 2CMWA 3UYSA 5TR6A 4DFNA 3DJ7A 4GU6A 4IZ5A 4Y8DA 2A1AB 4XV2A 4CCBA 4AG8A 4OAVB 2F7EE 2CLQA 4PP7A 3UIBA 2OJGA 1JSVA 4TT7A 3LMHA 5IH4A 2E9VA 2WOUA 3ROYA 1OUKA 3F5XA 3FMMA 4OTQA 3ID6C 3EFKA 4NU1A 4F9YA 4ZAUA 4EOOA 3TACA 3SOAA 5AIRA 3UC3A 5JKGA 3IW8A 3PVUA 3CIKA 3E5AA 4MD9E 4FNWA 1VR2A 2RG5A 1P5EA 2VRXA 4LRJA 5ANOA 2KULA 1XH7A 5B7VA 3QRTA 5I0BA 3T3UA 2BRNA 4LI5A 3TIYA 4YLJA 4DEDA 4ZS0A 4KNBA 4A4XA 5K5XA 4KINA 2I1MA 2PZPA 4O7VA 2OBJA 3R8VA 4KBKA 5CZHA
chains in the Genus database with same CATH superfamily
4BDFA 3LJ2A 3HKOA 1ZYDA 3AC3A 2XALA 4TL0A 2HXQA 3C50A 3LE6A 1XHAA 4Y72A 3ZO2A 3JYAA 4DHJA 3AD4A 3OWLA 3TMOA 4M68A 1OITA 3F82A 5JZNA 5BVEA 1WBWA 4QP2A 3VUIA 5JH6A 3A99A 5IKWA 5HX6A 4QMXA 1Q8ZA 3FLZA 4S33A 3OHTA 5AP4A 5TF9A 3DK7A 2ITQA 2R3IA 4C8BA 2NPQA 2X2MA 3R8ZA 3G15A 2R3QA 1PKDA 4ZY5A 3V8TA 4BTMA 2OH4A 4QP6A 4IJ9A 3W0RA 4DLJA 5GINE 5K0KA 3COMA 4GVJA 2F7ZE 1IR3A 3TTJA 4GG7A 4P90A 3WE8A 4EYMA 4F7LA 5HU9A 3KRRA 2CN8A 3GNIB 3BWFA 4ZY4A 4TPTA 4ZTLA 4DEBA 4O7RA 5F1ZA 3ORLA 5D1JA 4ZIMA 1PMVA 2UZDA 4EOJA 4WNKA 4NKAA 4D2RA 3NNVA 4XV1A 3MJ2A 1Z9XA 5AR3A 5D7VA 4Q9SA 4D28A 4K18A 2BILB 2E2BA 5HLNA 4GG5A 4G17A 3U87A 1OUYA 3DBCA 3R8PA 3CXWA 4FG9A 3NWWA 3GCPA 5HVJA 2YAKA 3DPKA 4L00A 4ANQA 3OW3A 3VONA 4JBVA 4UBAA 4M97A 1WBTA 3GU5A 4OT5A 1VZOA 2J5EA 1LUFA 2IVUA 4S30A 5IUGA 1UU7A 2WMVA 3HP5A 3VBXA 4KRCA 2XK7A 3COIA 3KMUA 4DGMA 5JT2A 4FSNA 2XUUA 4RJ3A 5ETFA 3DKGA 2VTHA 4XOZA 4B7TA 4CMOA 2XARA 5EM8A 2WMSA 4YZCA 3BZ3A 1BL6A 3QTWA 3R01A 2ITUA 4CKRA 5JGAA 2XEYA 3KFAA 4S31A 2CPKE 2G01A 4LMUA 5M51A 2VWBA 2B54A 4NM0A 4PP9A 5G6VA 5HD7A 5E1SA 2C68A 2C6IA 4FTIA 2YJSA 3EOCA 4KBCA 4U3ZA 5CSWA 5DPVA 4IVCA 2AUHA 1BKXA 5D11A 3PP1A 2FVDA 5HBHA 4FEUA 2DUVA 3UPZA 4QMMA 3VS3A 4K2RA 4DH1A 4AA5A 5J9LA 3F3VA 1E1XA 4RVKA 4O7YA 3HAMA 3OVVA 3QTXA 2G9XA 2XIYA 4PPAA 2A98A 3Q60A 4E73A 4YHFA 3F7ZA 3K54A 4C58A 2V62A 3QFVA 5C03A 2I40A 3BHHA 3OUNB 2VTPA 4FTUA 5KHWA 5DHJA 3E92A 3C13A 3VBVA 4A9YA 1YQJA 2HZ0A 3QALE 5AP6A 3NUAA 1ZAOA 5IF1A 1SZMA 4OAUC 3C1XA 2OFVA 3UO5A 1PMUA 3GU6A 5CNOA 4HGTA 5BVWA 1IEPA 3TYKA 2HWOA 3AT4A 3CE3A 3KVWA 3OMVA 2WIHA 3BHTA 4KIPA 3PVGA 5DT0A 3VQHA 3NPCA 3FMEA 4AE9A 4GKIA 2W9ZB 4FL2A 5EI6A 4MXCA 3KQ7A 5CF8A 2XNMA 4Y5QA 4OTWA 4BICA 4XV3A 4CQEA 3N9XA 2HW6A 4BBMA 1IRKA 1SVGA 2SRCA 3RM7A 3LXKA 3OBJA 5EHOA 4ZTSA 1XQZA 3VS5A 4J71A 1XH9A 4M15A 4RIOA 4AAAA 4BCHA 3MFRA 2OWBA 3RM6A 4YC8A 3DTCA 5HTIA 4O1PA 3MTFA 5EK7A 4LUEA 3Q9YA 1JWHA 3TCPA 1Q61A 1QPJA 4FT5A 2ZM1A 1OKVA 3CQEA 4O38A 2WTWA 4YC3A 4BZNA 3QWJA 4BBFA 4BR3A 2UW9A 3I81A 4G6OA 4U45A 1S9JA 1TFFA 3FMHA 3BYUA 3LFCA 5F4NA 2QCSA 3CY3A 2NYAA 4EOLA 4DC2A 4GJ3A 1MRYA 2PVNA 2GHLA 3PA3A 4QYGA 2YCQA 3VIDA 4F9AA 3WZUA 2VNYA 2F4JA 5HBJA 5ANIA 4BFMA 2FA2A 4PWNA 3FPQA 3W8LA 4YSJA 3CQUA 5IISA 3QRIA 3NFGB 5M53A 3RGFA 4BDJA 2ZB0A 4YJTA 3NNUA 5CAPA 2XIRA 3C4EA 1R39A 3HV7A 4UXLA 2YZLA 4LDTA 4ANSA 3DB8A 5DR2A 4HYUA 4WBBB 3C0HA 5J5TA 3C0GA 3C4ZA 1JLUE 3G33A 2QOCA 2J90A 3TT0A 2FSTX 3DJ5A 3UG1A 3V01A 2YCRA 4QNAA 3ZSHA 2XK3A 4MVFA 2J50A 3A4OX 2C5VA 4OTGA 3HV6A 3TUBA 2VTRA 3R7OA 2W1FA 2AYPA 4L43A 4NM5A 4PF4A 5L6WL 3UP7A 4TXCA 1U46A 3OWPA 3MS9A 5EDPA 3LVPA 3FI4A 3O51A 2GNJA 1YW2A 1R0PA 4RC2A 2YDKA 4PDOA 4FIGA 4C62A 4RFZA 4E26A 2IPXA 4KAOA 4ASEA 3KN5A 4MK0A 4CKJA 3MY0A 4R7HA 5EQPA 2X1NA 4FV3A 3OROA 4QP9A 4QRCA 3WIGA 5JFXA 5EQYA 4TW9A 2QQ7A 3ZDUA 1PXOA 2DYLA 2Z7LA 4TZRA 1Z5MA 3G6GA 4IVAA 5E8TA 3V8SA 2HZIA 4HZRA 4XP2A 3O0GA 1PHKA 2WTVA 3BPRA 4IB3A 4NUSA 3NW6A 2X4ZA 3D15A 2XNOA 2CGXA 4XH6A 4DG2E 4ZJIA 4ERWA 1Q24A 3R00A 1OIRA 4RX7A 5IMXA 3KN6A 4BTKA 2R3MA 4AWIA 3EFJA 3BQCA 4AF3A 3BLQA 4GUBA 4E5BA 3MVHA 2J0LA 3QZFA 4LM5A 4BWKA 3FEGA 5CQUA 3PJ3A 3NFFB 5AV0A 4DHFA 2R3FA 4FEVA 4V0GB 4YZBA 3R9OA 4MQ2A 1R0EA 3R1QA 4AX8A 2E9NA 4R1YA 1NA7A 3BWJA 4L8MA 1FMKA 3UPXA 4F0IA 5E9EA 4ALWA 1XBAA 3KRJA 4QD6A 5IPJA 4O82A 4G2FA 2IN6A 2IVVA 3GC0A 1Q8UA 4GIIA 4H36A 2JFMA 1Q62A 3C4WA 3LJ1A 4ANMA 4CGAA 4USFA 2GCDA 2VTJA 3UDZA 3FC2A 4GEOA 5CTPA 3BQRA 3DCVA 4MF1A 5AAFA 3RTPA 4UWCA 3CBLA 3VBWA 3NYXA 2RFNA 3EYHA 4DYMA 4RWJA 1UVRA 2ITNA 3ZLSA 2IVTA 4GMYA 4AQCA 4FOCA 4C3FA 2PVKA 4I93A 4B8MA 4CQGA 4R7BA 5GJFA 5BVKA 3TXOA 3UQGA 3F88A 4NYEA 2WFYA 3BL7A 4LV7A 4YJOA 4USEA 3AC2A 4APPA 3FMJA 3LXLA 3VS1A 2QO9A 3C4FA 4IJPA 1IG1A 3FUPA 3SW4A 5HTBA 3CPCA 2Y0AA 3L9NA 4X3FC 1U4DA 1R78A 4QNYA 4U79A 3LHJA 2HW7A 4IAAA 5LMAA 4EH6A 3RBWA 5CU0A 3UG2A 5ITAA 4IZ7A 2O2UA 5AAEA 4EYJA 3PLAE 3NYOA 4FIEA 3DDPA 4NK9A 3HDNA 5DT3A 2X6EA 1SNXA 4RIWB 3GU4A 2YN8A 2R7IA 3BE2A 5DEWA 4FIIA 4K1BA 4FX3A 4BDBA 3R9RA 4G9RA 2W05A 3DGKA 3OF0A 4M7IA 4QMOA 4RWLA 4C34A 4YTFA 3QC4A 3BU3A 4IIRA 4RIYB 5B2MA 5LWMA 2X8IA 4NCTA 5A4CA 5IQIA 3PJ8A 2W1IA 5A4QA 3DAEA 4FG7A 1UA2A 3V5TA 3U8WA 2ETRA 4EBWA 4YLKA 3I1AA 2ZV8A 2C0OA 1ZXEA 2C6EA 4RFMA 4FTMA 2VX1A 4FZDB 3FI2A 3U9NA 2GPHA 3BKBA 4XS2A 3E88A 2PE1A 3W0OA 1LPUA 4J97A 4DTAA 3IKAA 1S9IA 3PSBA 4QMZA 4JIAA 2CDZA 4CFVA 4E5AX 2JIIA 4RJ6A 4ZJJA 4WRSA 2XKFA 2Z2WA 4FMQA 5IQFA 2YLEA 2ZMDA 1OPLA 4ALUA 1H1PA 3DBQA 3BL9A 4MD8E 2O5KA 3DKFA 5T3QA 3RMFA 3NVMB 3ZSIA 5AP5A 3BE9A 3KF4A 5AP2A 3UOLA 4QT1A 2ZDUA 3RK7A 4DG3E 4F7SA 4ANOA 3RAKA 3RKBA 3ZDIA 1OB3A 2J6MA 2WQNA 3QYZA 4CCUA 1WBVA 4O0WA 3UIXA 4GV1A 4O0XA 1JKSA 5IQCA 3W32A 3H4JA 3QYWA 4FG8A 3MJ1A 4JBQA 3NNWA 4TTHB 5ANKA 4ZLYA 2HXLA 4BYIA 4XBUA 4JT3A 4C2WA 1VJYA 4NW6A 5DMZA 5JSMA 2IVSA 3LPBA 3ORXA 3QL8A 4CNHA 2R0UA 2OG8A 4BKYA 1A48A 4ACHA 2XK6A 3LJ0A 4DFLA 3RK5A 4O7NA 4NT4A 4HVDA 3TV4A 4AGWA 4WUAA 4OTPA 4YJRA 4D9TA 4JQ7A 4KIOA 3K2LA 3EL8A 5HO8A 2PVRA 4MX9A 1ZLTA 4CFMA 5AV2A 1GZ8A 4C02A 2PVFA 4IE9A 3HLLA 4WHZA 3C0IA 1XWSA 2FB8A 3M1SA 2QOHA 3MPMA 4PPBA 3ACKA 5IQHA 3LXPA 3DTWA 5KUPA 2WTIA 1OKWA 2WTKC 3NUNA 3P7BA 3QU0A 4YJNA 3R7IA 5HBEA 3TNQB 2OW3A 5AUUA 1CKPA 4AQKA 4HNFA 2BFYA 3F5UA 3FZ1A 4BCGA 5CF6A 1Y91A 3MBLA 5BMSA 2X0OA 1FVVA 5AUYA 4RA5A 3RZBA 4TWPA 4PMTA 3M2WA 4K77A 2GMXA 4GCJA 3GCQA 3KULB 3GXLA 4GYIA 5IA5A 3D7TB 2B52A 2RFDA 3VS7A 3Q32A 4O0YA 4KKEA 3QKMA 3FMLA 5FXRA 4D0WA 4L44A 2OK1A 3P79A 3QQUA 3DAKA 4YR8A 1WVXA 3TZ8A 5AIKA 2QC6A 3PJCA 5CSPA 1REJA 2X8EA 1GZNA 3B2WA 3WI6A 2BIKB 4NEUA 5DH3A 3U51A 5BYLA 3QKLA 4ZSGA 2VTSA 5I3OA 3RNIA 4Q9ZA 3RHXA 3F5PA 2J0IA 2PVJA 2XKCA 5HCZA 1H28A 4KABA 3W2QA 3HA6A 5CVGA 1FINA 2PMLX 3QX2A 4O91A 2X7FA 4RG0A 3LFFA 1U54A 2EXMA 4XG4A 3LXNA 5AV3A 5FTQA 3PZHA 1PY5A 4E93A 3RPOA 5IA4A 4OBQA 2ZM3A 2GHGA 2V7OA 4BCJA 4YC6A 5IQGA 3PXQA 3H9RA 3SV0A 4DFZE 1GZOA 3TIZA 1P2AA 5FBNC 2Z7RA 4JDKA 1BL7A 4X3FB 1H00A 5AUXA 3T9TA 3KA0A 4F7NA 2WU6A 5E8XA 3FI8A 5EH0A 5HZNA 1OPKA 3DAJA 1OL6A 3VAPA 3DK6A 4H05A 4R78A 4B9DA 5CSHA 2F7XE 3P23A 3ZRLA 2VU3A 3QUEA 1QCFA 3DQWA 3BEAA 3F3TA 4CFUA 4FSQA 2YCSA 2BZKB 2VTTA 2VWWA 3DZOA 3NEWA 3L1SA 3NNXA 3FY2A 3LFQA 4FL3A 5DRDA 3A61A 2B9IA 4NIFB 5E1EA 3UIUA 5BQ0A 5LARA 2WKMA 5AA8A 1Q3DA 5FP5A 2VTLA 4F08A 4J7BA 4FTAA 1OPJA 4AP7A 3MPAA 3EN5A 1NW1A 4F78A 2QHMA 4UMTA 1YHSA 4JQEA 1MRVA 1ZOGA 4FKIA 4NM3A 3W10A 2EWAA 2WOTA 3HRCA 3TI1A 2GNIA 2R7BA 4TN6A 3HV4A 1PYEA 3BHYA 5ANGA 3GFWA 4G6LA 2B7AA 3IGOA 1I44A 3D5WA 2FUMA 1M7QA 1TVOA 3ZH8A 3AT2A 1GOLA 4H3QA 4O84A 4X2FA 3OTVA 4OW8A 3ZEWA 2OZOA 4ZOGA 1OECA 5L2QA 4DITA 4I6QA 1REKA 4PPCA 2QOKA 3WZKA 5TT7A 3FLWA 4BKJA 1ST4A 4IEBA 2QR7A 3PPJA 5J87A 4D1ZA 3W18A 5C1QB 1YVJA 4IXPA 3DU8A 4IVBA 4LYNA 4O22A 4I5PA 4L52A 2PTKA 4U6RA 3LLTA 1SNUA 4EK4A 4ZLOA 4QYEA 4W9XA 5HIBA 2X0PA 4UXQA 3CTHA 5IA0A 4AXDA 4A9SA 5M08A 2P55A 2VO7A 4RBLA 1YXTA 3IPHA 5DBXA 4C4HA 5KBQA 4I24A 4EC8A 3HMPA 2VO0A 3R02A 2IZRA 4P5ZA 2OF4A 4DHIB 4NSTA 1YXUA 3PIZA 4QTAA 4QTCA 5J1VA 2WIPA 1B39A 2VTOA 5G1XA 2HYYA 4AOIA 5BX0A 3CLYA 3EJ1A 4MWIA 3FYJX 1J1CA 4WSQA 4Y95A 4LGDA 4LOQA 3CS9A 4EUTA 4ZMFA 2BPMA 4CG9A 3VW6A 2WTKB 4H1MA 2F9GA 1K3AA 5AJQA 5M57A 3S1HA 4C37A 1TKIA 4QP8A 4L3JA 2J5FA 4YBKA 2UW0A 1OVEA 4BTFA 4F4PA 1SMHA 1H07A 3G90X 3MIAA 3ZRKA 2W4JA 3OEFX 4CFWA 1ZMUA 2XNGA 5A6OA 3ORZA 2QODA 4JG7A 3LAUA 4L3LA 1IA8A 3P86A 5IQBA 3A7JA 2EXEA 1UNGA 2YAAA 4EK8A 3GP0A 5EI2A 4FKJA 4XJ0A 5DI1A 4E3CA 5JZJA 4BJJA 3KB7A 3DDQA 3WE4A 4BGGA 3R8MA 4BI1A 3E7OA 3GI3A 3NW5A 4LV8A 3G5DA 4MYGA 5CYIA 4BYJA 2REIA 5CLPA 3P0MA 2JD5A 4UMPA 5IQDA 4RMZA 3E63A 4MQ1A 3PSDA 1VEBA 3Q52A 4W8EA 3VHEA 2PMIA 4RQVA 4D4SA 1MQ4A 5KMLA 1Q8WA 5IEYA 1VLRA 2WMWA 3RHKA 2E9PA 3MIYA 3E8CA 2Z7SA 3OY1A 1JOWB 4UV0A 4EWQA 3TN8A 3FI3A 5AADA 4YNEA 4G3DA 5ANEA 3DS6A 2C5NA 3HX4A 5BVDA 4FKGA 4I22A 5IUIA 4AE6A 4R5SA 5GIPE 3CD3A 4JG6A 3FAAA 3QRUA 2VO3A 5DG5A 3RP9A 4RC3A 4UWBA 5GIOE 4E4NA 4FIJA 2NP8A 2H8HA 3ZMMA 3FMDA 4RZVA 5HE3A 2C30A 3QLGA 4EZ5A 1W84A 4MNEB 2VWVA 3Q4CA 1PXLA 5FDXA 5JRSA 3R8UA 3NUUA 2R3NA 2I0YA 3BCEA 4AZFA 5AV4A 2CKPA 4MUQA 5GJDA 4JR7A 4Y46A 4RIXA 2QOLA 1KOBA 1JNKA 1RJBA 4FIHA 4NFNA 5AP0A 1U5QA 5DYJA 4OBPA 2IW8A 2PULA 3GEQA 4BGHA 1FMOE 5FBOA 4JVGA 4IAKA 4XMOA 4OUCA 3SDJA 3TNIA 5F9EA 1H1QA 1PXJA 2WO6A 3AMAA 2XEZA 5HORA 1H01A 4ZTHA 2CCHA 2FGIA 3F7WA 3HMIA 4EK5A 2QKRA 5FXQA 4KKGA 5EW9A 5KZIA 5C26A 3Q2JA 5K0XA 3I6WA 3MFTA 4FKTA 4QMLA 4U44A 4P4CA 3PXYA 4PDYA 3DKOA 2UVXA 5GNKA 3PXKA 3WILA 4K6ZA 2J9MA 4U0IA 5CWZA 2NRUA 4OR5A 4BRXA 4ASDA 2JBPA 3D4QA 4FT0A 4L46A 4EK3A 3KXHA 4EL9A 4HYIA 3KK9A 3KXNA 4E6AA 2PE0A 2JDSA 5EOBA 3SGCA 2HY0A 4XNEA 2LAVA 5E7RA 5CAOA 5J9ZA 1YXVA 3MV5A 3U9CA 3UDBA 4MCVA 1H26A 1NVRA 2OO8X 4F1TA 4YURA 4D2TA 4L68A 4KSPA 3D0EA 3GCSA 1TQMA 3ZO4A 4CRLA 2G15A 3OWJA 3JPVA 3KXZA 4Y85A 3W33A 3Q96A 1H25A 4KIKB 5HIEA 1ZYCA 3RWQA 3KY2A 1XO2B 5EHLA 3ZYAA 1O6KA 4IB5A 4EQUA 1WBOA 3QTQA 3ZFYA 4DLIA 4ANNA 5CEPA 5A3XA 4NJDA 4QPAA 1SVEA 4RFYA 2BHEA 3FSKA 2PZ5A 3WF6A 4ENXA 3TKHA 3R8LA 5L2WA 2QD9A 4DGLC 4V05A 2RL5A 3L8SA 4GK2A 5E8YA 3LM0A 4YNOA 3ROCA 4M69A 5K4JA 3N4TA 1OI9A 4PV0A 2UZLA 4ZZMA 4GH2A 5DLSA 4FE2A 2BRHA 3R22A 4G5JA 3I7BA 3R7EA 3IDBA 4YHJA 3TJCA 1ZOEA 4FTCA 4EH7A 2E9OA 2EB2A 3BLHA 2F2CB 3SX9A 5A9UA 3IW4A 2PWLA 4BCKA 4FA2A 2JKQA 3FHIA 5LCJA 1NVSA 1UKHA 4WOVA 2GHMA 3EWHA 3U4UA 4DGGA 3FLYA 2AC3A 4D1SA 4I6LA 2YM7A 2R3LA 1XR1A 2C6MA 1KV1A 2WEVA 3DJ6A 4IDTA 4PDPA 3AKKA 2A27A 3EFLA 4TYIA 4ASXA 4F1OA 3N4UA 3PRFA 4A4LA 4BF2A 5HX8A 4II5A 3ET7A 1YI6A 1IAHA 2YEXA 1OL7A 5LXMA 4R6VA 3SXSA 3PG3A 4Z55A 4L3PA 5E8VA 4HGLA 1M2PA 3VF9A 1UU3A 2CNVA 2Y9QA 4R8QA 4TRLA 1MP8A 4OTFA 5EYDA 5CXHA 4EH2A 1DAWA 3R6XA 3VULA 5JFSA 4DT9A 4FT3A 4JXFA 4TWNA 4CMUA 1BI8A 4H58A 4WRGA 5FEEA 4BIEA 4WSYA 1GNGA 4BWPA 4RX5A 4HVGA 3DQXA 1KE9A 1VYWA 3NYVA 1PMNA 3O71A 5BYZA 3UBDA 1EH4A 1J3HA 3TNPC 5ACBC 1DI8A 3ZFXA 2Y6OA 5DGZA 2XF0A 5J95A 4UMRA 4JLCA 3O2MA 4MKCA 4IQ6A 5AP1A 5CU2A 4OTRA 3FQHA 4R3RA 5HIDA 2J0JA 4QO9A 3NDMA 4ALVA 2ZV7A 3KREA 3UVPA 3QTRA 3V5QA 5JQ5A 5J5SA 4FZAB 5CX9A 4AOJA 3Q4UA 4TYHA 2O0UA 1BUHA 4LL0A 2JKOA 4ZSAA 3G0FA 4X6RA 3HL7A 4YP8A 4F0GA 1T45A 2QU6A 3PFQA 3ZO3A 2R5TA 4F9BA 4LOOA 2O8YA 3U6IA 4FIFA 1PXPA 1NY3A 1URWA 5L8KA 5DRBA 2A2AA 3Q5ZA 2QOQA 5IA3A 2XBJA 2VWIA 2QOBA 4YHTA 3D83A 3OUKA 3HECA 4TKSA 4IANA 2ETKA 2X7OA 1ZY4A 5JGDA 4U43A 4GU9A 5EI8A 1O6YA 2V22A 2QO2A 4Z9LA 2QU5A 4MEDA 5IEVA 3QUPA 1GAGA 3I79A 4FNZA 2C3KA 4U3YA 4X0MA 5E8WA 4AFJA 5LVOA 4PTEA 4BDGA 4WIHA 1H24A 4O7SA 4FSUA 5HO6A 5BUEA 3DT1A 2J7TA 3E64A 3EQPA 3QZIA 4RVLA 2JIUA 5FQDC 3TM0A 4DE4A 2J51A 4BC6A 2PL0A 4XEYA 4TNDA 3NUSA 3ZEPA 4BWXA 4K9YA 4EH5A 2UW7A 1YRPA 4F65A 3KEXA 3KXXA 5M56A 2BRBA 2PHKA 4KUJA 2ZFYA 4G5PA 5L6OA 3F3ZA 2P2HA 4IM0A 2IZUA 4A9TA 3LQ8A 5EFQA 4K0YA 4R1VA 2OZAA 2WQMA 3ANRA 3VS4A 3SXRA 2X39A 1U5RA 4HYHA 3F3UA 3PP0A 3RPSA 4O6LA 4ZK5A 3ZUTA 3RNYA 3A60A 3TNWA 4BCNA 5AFVA 2OI4X 3Q53A 5KE0A 4FV8A 3ZC5A 1UU9A 5JFVA 3GUBA 4XCUA 2OH0E 4GFGA 3UDSA 3COKA 3PE1A 5L8LA 3AQVA 5H2UA 3I5NA 2JFLA 4PUZA 4EC9A 3NX8A 3ACJA 4HZSA 3UZRA 1TQPA 2OXXA 4FC0A 3NAYA 1Q3WA 2PPQA 3ERKA 3F66A 4HGSA 3PA4A 4JDHA 3ULIA 3C4CA 2CGUA 4JJRA 4DEHA 2R3OA 2W1HA 4WD5A 3MB7A 3ZRMA 3RCDA 2CGWA 3NCZA 4FKPA 5AUWA 2E9UA 5EHYA 2UZBA 1JQHA 3KIOC 2YABA 1R3CA 2OGVA 4I41A 2XZSA 1PF8A 4WNMA 2PVMA 4FKUA 4G3CA 1NXKA 4I5MA 1JKKA 3O17A 4R3PA 4D4RA 5I4NA 4C4GA 3FC1X 4IDVA 4EUUA 1KSWA 4WT6A 4XHKB 5AX3A 3P5JC 2ZDTA 3R1NA 4X6QC 4Q5EA 4YU2A 4MD7E 2QLUA 2J4ZA 4KRDA 4FUXA 4X2GA 4I5CA 3LMIA 4AXFA 5J8IA 3E8NA 5AR7A 4LRKA 1ZYLA 2I0VA 3WYXA 4ZZOA 3IDPA 5J9YA 5KHXA 4F6SA 5HHWA 4YJPA 3RAIA 4AA4A 4NCTC 2YJRA 3UE4A 3E7VA 2XJ2A 4KBAA 5BNJA 4QMQA 2BVAA 1M52A 3BV2A 2ZJWA 3W0PA 3BU5A 4BDCA 1OBDA 2GTNA 5E8UA 3VUDA 4FT9A 4JRNA 4U5JA 1QL6A 1CKIA 4QTEA 1W2FA 3GOPA 2R4BA 3OXTA 4FYNA 3BEGA 3E62A 5M4FA 2KTYA 1YWVA 2PZIA 4C7TA 5M4CA 5HVYA 4FSWA 4L7SA 5ETCA 3EHAA 4FSZA 3V5PA 4EJNA 4FTTA 4N6ZA 3C5UA 2G2IA 3A2CA 5CENA 3O8UA 1YI3A 2O64A 4B0GA 3L9LA 1Q8YA 3FQEA 2P3GX 4QP7A 5EDRA 1CTPE 4GT4A 4MWHA 4BHZA 4H3PA 4CG8A 3BBTB 4BCFA 4BL1A 1OL2A 3LFDA 4FOBA 4ZS4A 2JKKA 2G1TA 4ITJA 4PTCA 4R3CA 4BKZA 4DH3A 3N4VA 1E9HA 4MF0A 4IAZA 3SA0A 4PNIA 5EKNA 1H1WA 4E1ZA 4OTHA 4G31A 2OXYA 5FLFA 3AC1A 3T3VA 4O83A 3L8VA 4QDEA 4FL1A 5CVFA 3LIJA 1JPAA 1OIQA 3B8QA 1A9UA 5JFWA 4FSTA 1FQ1B 4KWPA 3D5UA 3UGCA 5DR6A 4FTNA 4YPSA 3QTZA 1Q41A 2ITWA 4Y83A 4BI0A 2ESMA 1ZRZA 2NRYA 2PUPA 5EM5A 3NW7A 4U9AA 3VBTA 4JBOA 3MY5A 4CZTA 4QOXA 4KB8A 2B55A 4CRSA 4G3FA 5FGKA 2C5OA 4IB1A 3UOJA 1GY3A 4QMTA 4C4EA 3AGLA 3LFSA 5EYMA 3UMWA 3WZJA 4JDJA 2C47A 4Z16A 4QYFA 5ACKA 3F3WA 3FKNA 3BLRA 4AW2A 4X21A 4IM2A 4XLIA 3VHKA 2ZYBA 4QMNA 3V5LA 5H8BA 2UV2A 4FTKA 4O4BB 2NNWB 3GOKA 3GCVA 4DH7A 4DFBA 1QPDA 2V55A 3ODYX 2ITOA 5HE0A 3MH3A 3O7LD 1O6LA 3Q9XA 3QRKA 1B38A 3OBGA 3S4QA 4O86A 4MXZA 2XKDA 2YERA 4J95A 4C4FA 3OEZA 3TNHA 5EM7A 5EW8A 3G51A 4RQKA 3HGKA 4FZ6A 3SKCA 3SXFA 5LMBA 4YO6A 2WPAA 3ORPA 4JBPA 2UVYA 1U59A 2JEDA 4F63A 4CFNA 5I9YA 4FVQA 2YDIA 2EXCX 1JKTA 3PPKA 4Y5HA 3VC4A 3V04A 5AR5A 3MB6A 1PW2A 3OTUA 4MXYA 4XYFA 5LQFA 4DDGA 5LVPA 1W2CA 4IADA 4OTDA 2UUEA 4IC8A 4KIQA 2VX3A 2DQ7X 3VN9A 2BTSA 5HU3A 2R64A 2BROA 2NO3A 2PZRA 2WXVA 2CLXA 3BHUA 4CTCA 4CXAA 2B1PA 2PY3A 4JRVA 2YIRA 5TKDA 3AKJA 3EKKA 4CTBA 3E87A 3NIEA 3ZXTA 2C6TA 4GFMA 2UZVA 3FBVA 3HDMA 4FKSA 4JAJA 5D41A 3ZLXA 4L9IA 4D5KA 2XK4A 4IBMA 2BKZA 5I9XA 4G3GA 1XMLA 3KCFA 2R3RA 3IW5A 2P0CA 4EI4A 4CLIA 3IOPA 2YISA 3BGPA 3GQLA 3QD3A 4J96A 4M84A 4ITHA 4RPVA 3TDVA 3EN4A 2UZTA 2WELA 5LOHA 2GU8A 4BCMA 5FTGA 3MVMA 3F69A 4DT8A 3VNTA 3OOMA 3ML1A 2VN9A 4GIHA 2XM8A 4MBIA 4FV9A 5H3QA 3CEKA 3CJFA 3D9VA 3WARA 2BCJA 2UW3A 3S00A 1Q99A 4EOIA 2AEGA 4AZEA 3VQUA 5C8NA 2ITZA