1UOGA

Deacetoxycephalosporin c synthase complexed with deacetoxycephalosporin c
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
309
structure length
256
Chain Sequence
b'DTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDLVIDFFEHGSEAEKRAVTSPVPTMRRGFTGLSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFAPHYDLSMVTLIQQTLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVATSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIRRTSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHETASE
publication title The Structural Basis of Cephalosporin Formation in a Mononuclear Ferrous Enzyme
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Oxidoreductase
total genus 80
structure length 256
sequence length 309
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 2003-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1uogA00
1GP5A 5C3RA 1UOGA 1E5RA 1W2NA 2BJSA 1QJEA 1HB4A 1BK0A 1UNBA 5C3PA 2BU9A 2DBNA 2Y6FA 3OOXA 4RGKA 2BRTA 1HB3A 2VBDA 1ODNA 1GP6A 5APAA 1W04A 4BB3A 1W05A 2IVIB 2VAUA 3ON7A 1HJGA 1UZWA 2VE1A 3ZOIA 5C3SA 1DCSA 2JB8A 1OBNA 1RXFA 1W3VA 1HB1A 1W9YA 1E5HA 1QIQA 1W03A 5C3QA 2VCMA 1RXGA 2VBBA 2Y60A 1BLZA 1ODMA 1IPSA 1W2AX 1W3XA 1UOFA 1HJFA 1UOBA 1E5SA 1HB2A 2CSGA 1UO9A 2DBIA 1W06A 1W2OA 2WO7A 1W28A 2JB4A 1QJFA 3ZKUA 1WA6X 2IVJA 1OC1A 2VBPA 4XAEA 5C3OA 1GP4A 3ZKYA 1E5IA
chains in the Genus database with same CATH superfamily
1D4M3 4RHV2 2HYKA 4RHV3 2DYCA 1RUJ3 4BXSV 4WM8B 5F5AA 3ZSJA 5B2GB 1AF9A 1QXJA 4I02A 3BI3A 1UL9A 2EIEA 1GFF2 3RNSA 5GLUA 3SHRA 3E1F1 3BTYA 2R30A 4P02B 1H1AA 4GIQA 1NCQC 4GAZA 2E7QA 4Y22B 2IXLA 2ZGOA 1GMMA 4QWNA 5FZKA 1PX3A 2ZABA 4YLZA 5HXVA 5BPXA 5LBEA 4Z2AA 4YVWA 4HK9A 1PNFA 2CTVA 1CAWB 3N9PA 1J83A 1HQLA 3H50A 3VBSA 1J1LA 5DAQA 2QQWA 1NA1B 3H0OA 5FZMA 3VHRA 1S2BA 2ETEA 2O8QA 1C5IA 3I97A 1SPPB 1OKOA 1GZTA 1R093 3OBZA 2EAKA 3LIHA 1ACCA 1VLNA 3WW1A 1YO8A 3MEPA 4JHTA 5FRAA 3LOBA 2W1WA 4NPRA 4X6QB 2A3YA 3ZIWA 3LGRA 1PGL1 3I2OA 1FPN2 1G8WA 1W90A 2Q1FA 3N3HA 5CFCA 5JOYA 3V56A 1JH5A 1POV0 2XUMA 5KHIA 5JUVA 4YM0A 2X5IA 4OI1A 2XWJB 1S2KA 1XXNA 4DQAA 1F15A 3I49A 1UYXA 1ZZ7A 2BOIA 2R49A 2DU1A 1FYUA 3TEXA 2PQQA 2YC0A 1V9U3 4OHVA 1ZM1A 4FAHA 3UYJA 3N9QA 3NMBA 3GNEA 4XF1A 3OEBA 2R6QA 2D6KA 2EIDA 1W6PA 2PHFA 4Q4V1 4Q4Y3 4Q5OA 4XTPA 3I59A 4IEVA 5GLVA 2BQPA 4ASLA 4PLNA 3M2MA 4Q0UA 4FTBA 5L7OC 5LK5A 4TLGA 1QJU3 3UJOA 3TRSB 1MS9A 5A32B 4ZU5A 5FZAA 4E4ZA 5IVJA 1UN1A 3HMYA 1AYN2 3H42B 1AYN3 3IDAA 3I3QA 5A3WA 2QE3A 4EN8B 1ASJ1 4QPGC 1CVNA 2V4VA 2X10A 3PIJA 3WQBA 4FTSA 1S1AA 2PHWA 4BU2A 2WO2A 2WNVC 5FPUA 3AC0A 1UYYA 4QPYA 1UCXA 2BGPA 5JZGC 3KV4A 3JBG1 2CL2A 4PJYA 5LZ6A 1OF4A 3PURA 4XFBA 3A22A 1VMJA 1Q8QA 1SDWA 5A80A 5EQUA 2WSVA 1CAVA 4FI9A 3POEA 4QM8A 3JB8A 1CX4A 5FQ0B 1W6QA 4FXKB 2YY1A 4HT1T 4EE2A 4KG0A 3TEZA 3POGA 2KA3A 1I9RA 4AVSA 5KHGA 4ZU7A 3M7AA 4PQ9A 4YZ4A 1MQTB 4AI0A 3WV6A 4JGYC 1RIRA 1SDDB 2VY0A 3BTAA 4GH4B 5F8PA 4A7YA 5BNPC 2FDIA 1Q8VA 1WLWA 3THCA 1V6JA 1KEXA 4JGZC 4ATFA 1KFUL 4Y20B 4NHKA 2WNUB 2RS32 2W95A 4K40A 4QM9A 5IWFA 4COVA 4JTOA 5A3MA 3AMPA 1C8M2 2VZ3A 1E5RA 2Y6GA 3NNJA 1O4TA 1KGYA 3ZYHA 3WVJA 4K8FA 3U75A 2JDAA 4QDRA 5BNNB 1A3KA 1QF3A 2E26A 4JKKA 2RS11 4AI2A 5CADA 2NP0A 4AI9A 4YARA 1DLLA 2VXJA 2YC2A 1DYPA 2A70A 2JECA 5GZEA 3ZN6B 5A3NA 4DOUA 1UYPA 1VRBA 2KM2A 4P5HA 1A34A 1FAYA 5J1XA 2WZR3 2W2IA 4QX8A 2NM1A 3PMEA 3S30A 4LKFA 2CY6A 5A7NA 3OF1A 2LM3A 1OA4A 1T6BX 2ET7A 3AMHA 1QJX2 4M4RA 4YG3A 2WR9A 5DZEA 5APAA 5CFDC 3GZEA 1JXNA 1LHNA 2I2SA 2ZJCA 3P5BA 3PUAA 4CEWC 1H2MA 5JOZA 4YVSA 2XKOA 1J58A 2G9ZA 5EV7A 4TTGA 4KGQA 5IYYA 1QJY2 3JCIA 4RN5A 1AR61 2CWSA 3CU7A 1G7YA 2OPWA 1POV3 1TQ5A 4MGYE 5LA0A 2LROA 1IS3A 3VD9A 2BWAA 2OA2A 1OOPA 3IB3A 1OPOA 1UZVA 4XJ9A 4CDUC 4E2SA 3LDKA 2P37A 4DXTA 4I30A 4C0BA 5FPZA 1DZTA 5FLIA 2C9AA 1AZDA 2HWD1 3C8XA 1GZCA 2PTMA 4ARYA 1GSLA 1POQA 1VAVA 1WW6A 2TUNA 3GBGA 4WM7B 3ZXLA 4I0BA 4A7KA 4LHNA 1XSRA 4YNIA 4EZ4A 2QKDA 1FXZA 2JJ6A 2QBXA 4ITCA 4RFT0 2R041 4UOJA 4QU2A 3AP7A 2DVDA 4BYYA 5KWRA 2K46A 2NMOA 3Q8EA 5FO8B 1AR73 3HT2A 2ARBA 3EXUA 1RUF1 3INAA 4L99A 3UK9A 1GQGA 1G9BA 4AFBA 2E31A 2PELA 3DPRA 1Q43A 3ZFEB 1UXXX 4O61A 1Q8OA 1VBB2 1WW7A 1UPSA 3MW3A 4NIDA 5FZIA 1ODMA 2JENA 2QQUA 5D8AB 5CKNA 1H2LA 1VBA2 4AAPA 1GWKA 3V0BB 1H2KA 4AE2A 1Q5OA 2ZTNA 4R52A 3MGUA 3RVHA 2VZVA 3MI8A 4OHZA 1QOOA 1ULPA 1AJOA 2VNOA 5FZOB 4GMP1 1W9FA 4YWAA 1ST8A 4O65A 4IEXA 2XJQA 4LIVA 2MNGA 4JV4A 3NJVA 2CAUA 1DZQA 1X9PA 4QX7A 2VUJA 4YW4A 2PN5A 3AP4A 5C33A 3RFRA 3TWIA 3TN92 3N9MA 3ZKUA 5BY5A 2Q8DA 3MUZ1 4LO8A 2VQUA 1OC1A 3A0NA 3N9LA 4GB32 5F5CA 4AEKA 5ABJA 4QGNA 5K9YA 4GB33 4LJHA 5HXMA 2Z42A 2D7FA 2FQPA 3AL5A 3NJYA 4HKOA 4OMCA 2DUOA 4FFGA 3Q8BA 2XOMA 4LR4A 1U5XA 1UY1A 4CUBA 4QXCA 4B3NA 2DCTA 4XOGA 2XKPA 3JU9A 3UL2A 4IUGA 1A78A 3D5OA 2JDUA 2SLIA 1W9SA 3LSDA 5IK7A 2XVKA 3KT7A 1DQ4A 3O1PA 1JTZX 4IL7A 1S0IA 1AX2A 2GNMA 4PF5A 4QB2A 3U14A 3MFAA 1UNBA 4XZPA 1GICA 1SHWB 4FP2A 4META 2D3PA 2WT0A 5EWSA 4AQ2A 4PI0A 1YJLA 3RZLA 2NPIA 1ND3A 3GZUC 3RRDA 1DP0A 2H6CA 3LEMA 2WL1A 4KBBA 4IEZA 1JUIA 3VBRA 5CAZA 4I3PA 3AYEA 1WKYA 5DZFA 1W6OB 5GZCA 2D98A 3WP5A 5FY9A 1HB3A 2DVAA 2IUWA 4P9XA 4P5YA 1RUG3 1TG7A 4ISQA 1LOEA 3AJYA 1CAUA 1WCUA 3BU7A 3BGAA 3RSJA 1GZWA 3QACA 1W8WA 1H8TC 1O8SA 2CYFA 2ZX2A 3K77A 4HVRA 5A3LA 5IK4A 2QQNA 4LKDA 2Y38A 3JQXA 1D0HA 1ND2A 4AEJA 4O9GA 3VBOC 2H6BA 2JG9A 5JDBA 3OCPA 4LBMA 4WVMA 2WFF1 1HJGA 2VMGA 1UZWA 4L9BA 1VPHA 4LA2A 5LBCA 4XEZA 3ZYRA 4GZ9A 4CTEA 1GZ9A 1YI7A 3SH3A 1W6NA 4CCEA 1OURA 2JKXA 3S7EA 4Q2FA 2HWF1 5HCFA 2OQ6A 3WUDA 5C4WB 2EVXA 2EAAA 1JBCA 4AEDB 1JOBA 3MF9A 1Z7S2 4AOCA 3N7JA 5GLWA 1TMF1 4RR3C 5EYXA 4CEYC 3SKJE 3HPNA 3VDDA 4DINB 3ACGA 3NAPC 3KV9A 1JZ6A 1ZBA3 2RDQA 3AP6A 4YM2A 4V1PA 1GYKA 1K42A 4MVTA 1COV2 1R083 2CNAA 4LITA 4WZCA 5FZLA 4HKLA 5LK7B 1PIV3 1H1MA 1OLRA 2WJSA 3MV11 3VBHC 4BLIA 1OVSA 2AENA 5DABA 1IS6A 1CESA 3UT0A 1OH4A 3FHIB 1OA3A 3USUB 3LEGA 4ZHNA 4LK6A 2RR13 5EP9A 1T2XA 3PUSA 4JDMA 5JSRA 4FFIA 2CSGA 1ZRIA 2F17A 3OSDA 1W06A 2C4XA 2AUYA 4X6RB 4BPZA 1O3QA 2CV6A 3I3DA 3I3BA 3USSA 3ITQA 3PTYA 1J1TA 1IHMA 1XU1A 3ETQA 2RMU1 4Z82A 5F2WA 4YZ1A 4LA3A 5FPAA 5BNOB 3J9SA 5CKMA 1K5MB 4IGOA 3PUHA 4HG6B 2FCUA 1AUYA 4IV1C 4TYSA 4BK5A 3K75B 3EYPA 1BQPA 1OF3A 4HFSA 2AEYA 2ARXA 4MADA 4Y1UA 5FY8A 5G04L 2QQVA 5A7QA 1ZVFA 4D6RA 2BZDA 3ZVXA 1D4M1 1BZWA 1ZBE3 1FV2A 4QPGA 4RHV1 4QB1A 1REDA 4JVAA 3ZPYA 1NLRA 2J1AA 4XILA 3I8TA 4Q0SA 2W3JA 2VMIA 2ATFA 4PQQA 5FXVA 5A70A 3D8CA 1TVGA 2XBO2 2MEV3 3ZFGB 3ZPOA 1LHVA 4LK7A 4J1WA 3WDXA 1X33A 1QQP2 1UQXA 4JZRA 2W52A 4QHBA 3CZJA 4R9BA 5AVPA 1QQP3 4XABA 3LCPA 4GMP0 2J1TA 1JW6A 1O4ZA 5BYNA 2WAOA 2XJVA 5ANNA 1EPWA 4Y1XA 4FPFA 1OKQA 5FXWA 5GZFA 2YC4A 3SCGA 2PQSA 4YVWC 4JKLA 1W8UA 4IE6A 1LJ7A 1CONA 4ISRA 2W68A 3AYCA 5FCCA 4J1XA 4UFKA 3VBSC 2A3WA 1ULDA 2ZEYA 5J96B 4ZS2A 5L36A 1W0NA 2VU9A 3B69A 5A3TA 3I4IA 5FP4A 4XUTA 4M00A 4N53B 5FZDA 3WQ0A 4Q0VA 1NOVA 2VMFA 3RZJA 1K3IA 4NPMA 3ZMNA 1WMDA 4INDA 3A21A 2Q8OA 3SCFA 4A45A 5CFCC 1CR7A 2WUHA 4N43B 4K3UA 4FP3A 4XC9A 4HL0A 2X5IC 2YYOA 1VIWB 3K4ZA 3HQRA 1V6OA 5JPNB 1XPWA 3SH4A 4MLOA 1I1EA 2YBPA 1YWKA 2VQTA 5FOJB 1VBE3 3IT8A 5EIYB 1RJ7A 3HVDA 5KHKA 4CUGA 3FN9A 3D82A 1EV12 3JZVA 3NRUA 4XF4A 1IS5A 5IHRA 4Q4Y1 3TYJA 5CG8A 2HWE3 4CDWB 1VBC3 1KDKA 1ULFA 2XMLA 3QOPA 1LOCA 2WN2A 4L97A 5T52A 2NN8A 1IKQA 1ZZ9A 4KL1A 2VVDA 3OYWB 5E89A 1RTVA 4WVZA 4MX3A 5GLTA 4Q1PA 4QX1A 5FPXA 1GWMA 2W0XA 4J25A 4W8JA 3ECQA 3NVCA 2A5ZA 1JZ7A 3MBWA 1MZ6A 1AYN1 2V5DA 3WDUA 3ZDVA 2Y60A 1YI9A 4ZXEA 2H0VA 2WWJA 1V70A 2F4LA 5T50A 5IVCA 2D40A 2AH2A 1VR3A 1HQWA 1CAXA 4AFCA 3BIWE 3FBMA 5K0UB 4M3CE 1U5ZA 5FMOS 1UMIA 3H7JA 2VVEA 1U5IA 2DCYA 4QPIA 5CISA 3VZMA 4MH0E 1HN0A 3SC7X 1ZRCA 3B5LB 5J3UA 1Q8PA 1KITA 4CP9B 4XW3A 5I93A 4L2NA 2ZEZA 4XMIA 1AL23 3RZGA 4HVQA 4TLFA 2VW0A 3LE0A 4XAAA 4D7SA 1QU0A 2XXZA 1X8MA 2ZGTA 3MLKA 1RHI2 1O3TA 4CUAA 4YSFA 5H9RA 4MSVA 4WM8A 3AMNA 4DO0A 3MPPG 1MS8A 2YBSA 4Q0PA 4BLJA 4KQ7A 3TNQA 4D6QA 2RS31 3JD73 1QOTA 3ACIA 1W0OA 4XUPA 4UW4A 5HCHA 2WO1A 3AMMA 2FMYA 3H3ZA 5FFOC 1C8M1 3ZYIB 1OI6A 3DKWA 4COWA 1U5YA 4Y22A 4JQRA 5DXDA 1PZ9A 3P3PA 4QHZA 4L0PA 4CCMA 2FCVA 4DY5A 5FZGA 1CZSA 1V6IA 1JYCA 3LFIA 4RGAA 1LODA 1SLIA 1CAWA 2GNDA 4AAXA 4XJZA 3WNLA 3GCXA 1I6XA 3T30A 1NA1A 2GZWA 1HRI2 4G3YC 3AZYA 3O14A 3KCXA 2Y6FA 3HT1A 2JICA 1SPPA 3RWNA 3L9JT 2QQIA 4Z92B 3AYDA 1QXPA 2G9FA 3WNOA 1BBT2 2I74A 1AR83 4FQ4A 5FZHA 3GJBA 2HKXA 4RA0A 4ZKTB 2RDRA 3KGZA 5ANQA 5IVVA 3KF5A 1J3QA 4MUVA 5KC5A 5EJZB 1QJY1 2CHHA 3EBRA 4YVSC 1HRV2 1MS1A 2D6MA 1POV1 3FLTA 3OGJA 1DQ0A 2OX0A 2B45X 2JDNA 5F5QA 4A41A 5BNQA 1R64A 1RUE3 3NNFA 2ZBJA 2BBVA 4CCLA 4MGTA 3FE5A 4KG8A 2VECA 4NVPA 3O0XA 1LGBA 2BFUL 2UWBA 4LXLA 1OOPC 3LWCA 1CWPA 1GUIA 4HZFA 1HXS2 2IC1A 2VE1A 3GYDA 1HXS3 5KXCA 1PVXA 2GALA 2F4PA 3QH7A 1NYWA 4LO7A 1CQ9A 2UWCA 3FC0A 3H7YA 5DUUA 3TBDA 3ZXDA 3UNPA 4LT5A 3WW4A 3PDQA 4Y5Z0 5FYMA 5C5TA 3GDBA 4X8PA 1QOSA 4Q1RA 1RUD2 5A32A 3AP9A 3HD8B 1DZRA 2XQRA 3KQ4B 1RUD3 4QD2A 1H8TA 1AR71 4NWWA 4BOWA 3OBAA 5F2SA 3ZYJB 1LNSA 1QIQA 4N9HA 1DF0A 5LATA 4BCUA 4QDQA 2EICA 2P2KA 3DPRC 1VBB1 4GKYA 5JSOA 3PTRB 2Y26A 3VBUB 4YGDA 3ZR5A 1PO23 1NE4A 2ENRA 1YQ2A 2YV8A 1EPZA 5IVBA 4IEPA 1VBA1 1W2AX 3IIAA 2VUAA 1DHKB 3DECA 1FATA 2XDVA 4WZFA 3KVBA 4YZ3A 4P9GA 5ACA2 2E32A 3OG2A 4QQOA 3M70A 2A6XA 1GWLA 1GNHA 5JR7B 1J3PA 5B4NA 2JDYA 1RMU3 1US3A 3M4FA 1GANA 3BODA 1SLLA 5FQ0A 2RM23 4LKEA 4PLOA 3POFA 3HOBA 4YW1A 1VRH2 3TN91 1LHOA 1ONAA 1MQTA 4UXAA 1LOBA 1VALA 2E33A 1OFSA 2BERA 4GB31 4EN7B 3J7NA 2P3KA 3HBKA 5ABJC 4CDQB 4Y20A 2WNUA 5DG2A 3THPA 1E5IA 3KHBA 3U4XA 1LOFA 4XFFA 1ULEA 4IW3A 4UI9L 4Q4W2 4XZUG 3H1MA 5C8CB 4Q4W3 3M3EA 1F35A 3T0AA 3WG4A 4EYUA 4IV3B 4QT6A 3K51A 4EWDA 2VZ1A 3ZN6A 1TNRA 3HR9A 3LF7A 3AZWA 3AKTA 5GJ6A 2QZ3A 1LHUA 4XFIA 3RS6A 3T2PA 3U11A 4W65A 4XJ8A 2Y8KA 1OSGA 4LORA 1ND3C 4O7XA 2WQZC 3MIHA 2ARAA 3VBRC 4DS0A 3J8F2 1RUH2 3WLUA 1RINA 3KSCA 1D4M2 5FP8A 4CCOA 1IG0A 1RUJ2 4JAAA 1OUSA 4COUA 3CMGA 3LPGA 1NCRB 3WDVA 4YW7A 1OQ1A 4PDWB 1IPKA 1YIPA 1Z0HA 1QDOA 5JOXA 3H8OA 3C3VA 4Q4X2 4XFHA 3VN4A 1G9FA 3DYPA 4Q4X3 3BOPA 2J1RA 3B7MA 1ND2C 2Y34A 4LLFA 1ENSA 3EJKA 4CXXA 2JG9C 1JYTA 5G05L 3AMQA 1W6MB 3K3NA 2OZJA 4WM7A 4JDOA 5ERLA 1QNWA 4FPHA 3ZOIA 2JDZA 4KWLA 4CCKA 4LUKA 4EZHA 4DY3A 1FNYA 1OBNA 2BDRA 3BPSA 4LO5B 4AVVA 1ZNPA 3BUCA 1R092 1Z7S1 2AC1A 4YGCA 4BMEA 5K4LA 5I0SA 3BYWA 5FK7A 4MOAA 2CGNA 4AW7A 1WBFA 5JXIA 4ET7A 2YDEA 4GJYA 1OFNA 2ZXQA 1KS5A 1Q3EA 2PAMA 1UIKA 2WDBA 2OUHA 2XB6C 5JIAA 3VDDC 3ZFEA 3ZR6A 1DGLA 5SV5A 1COV1 1PIV1 3WNKA 4TZDA 3E97A 3WD5A 4I2OA 5KC6A 3RYPA 3E5UA 5D8AA 3WF0A 4GXLA 1L7QA 3NKGA 1UU6A 1PMHX 5FREA 1BLZA 3V0BA 2A7AA 5FUNA 2BUKA 3FFQA 3T08A 1V9U2 1IPSA 4MGIE 5L9RA 1YFXA 1CZVA 2HLEA 2DVBA 1V6KA 1G6NA 1H0BA 1HB2A 2GP3A 5FZOA 1FX5A 3VZJA 4QKDA 4M0NA 2JE7A 5JXJA 1JYVA 1MS5A 2G19A 4Q4Y2 1UZZA 4Q8KA 1KD7A 1MZ5A 4Z8BA 1JU3A 4ES8A 2AYHA 3N36A 3WG1A 3POIA 1W39A 4IE4A 4BQ5A 1S0EA 1STMA 4BWOA 3H8XA 3L2YA 4ZY9A 1QJU2 2RV9A 5DQ0A 3J7MA 4TXWA 1C57A 3A23A 1RUI3 4XFAA 3MIFA 5EJ3A 1Z78A 2LTNA 1YQCA 5A3OA 3N7KA 3QCWA 4LNVA 2GU9A 5H9QA 1P8JA 1RVF3 4W6XA 3WW2A 3ZSEA 4HLTA 4FOVA 5F1RA 5I91A 1MR5A 2CGOA 2JE8A 3M1HA 1N1TA 2A73B 2XBO1 3KVAA 3ZXKA 4CDXB 2D6PA 3EHKA 4AHYA 2DFBA 2Q8EA 4ZZ8A 1UU5A 4MXWB 1ENXA 1QQP1 4RS5B 3CIHA 3N9OA 2GC2A 3LDBA 4AFAA 3N9NA 1OT5A 1A8MA 4PBPA 1UXZA 5A6QA 1YUDA 3Q8AA 2AEZA 3PJYA 1O3SA 1WCDJ 5CVRA 4GWNA 2OT7A 1W6OA 3HNYM 3C7HA 5FKCA 2BGCA 2OUJA 1H4HA 2O0OA 1RJ8A 1XBFA 3VBFB 1ZZBA 2LRPA 5C9AB 4M0HA 2XR4A 1MVQA 2XL7A 2OW4A 2WLQA 2WN3A 3MLJA 1F9KA 1VB2A 4DXZA 4IGPA 1CPNA 3SH5A 4L11A 1W8HA 4F7ZA 4CU9A 1UY3A 3AP5A 2RDNA 3IDBB 1WGPA 2GDFA 3E5XA 4OI0A 4N9IA 3ZMOA 1XSQA 1HV0A 4OI4A 2VOKA 1LOAA 1WMXA 2D5HA 2YMZA 3K46A 3IMMA 1A6CA 1FMD3 3OTFA 4LE4A 2X29A 5KXEA 2Q1ZB 1J84A 3PL0A 1Y43B 2VMEA 4LTAA 1MZEA 5F3IA 2RHPA 2VGDA 3CHXA 3HN3A 4RSUA 2OKXA 2HJIA 4L92A 5C4WA 2WZR2 2FDKA 1JU4A 5GLZA 1ZRRA 2WFPA 1ULOA 2YROA 4JHZA 4NOTA 5DG1A 1G9DA 1EV11 1VMHA 1DCSA 2HWE1 5JVVA 2C26A 4FAGA 4COYA 5JI9A 1ZYBA 1J59A 4A4AA 1LU1A 4IETA 5FYBA 4BHPA 1GBGA 3KF3A 5IT6A 1MEC3 2VD7A 3FLPA 2QQJA 1L3JA 3CL1A 2WLPA 4PF1A 1IG3A 2ADDA 5EXOA 4BQXA 4FT8A 4Z2WA 5TSWA 3IDCB 4A2UA 4CCJA 2WA4A 4CCDA 2WYFA 2VUDA 4H3WA 2W1QA 2AZ5A 2DTWA 1LENA 4LQRA 2O8OA 5IAVA 3ZXAC 4E2QA 3IKWA 4BH9A 2PHTA 4BQ4A 3SISA 4XIOA 1SLBA 2IXKA 3USUA 4AFMA 1C1LA 4AVBA 2RS52 4XJWA 2RS53 2GSYA 5F6KA 3MV01 1TME3 1WMEA 4CZSA 5T3NA 1JYNA 5LWBA 3E6CC 4EN6B 1E5SA 2X09A 3DXUA 3HAGA 5I0UA 1GR3A 3C7FA 4KMQA 4BQWA 3RMXA 2JE9A 2DVGA 4Y26A 4QPIC 3KLSA 4KGGA 3FFZA 4B7KA 5BNOA 4OHWA 1K5MA 1MVEA 1I3HA 2YFZA 3OUHA 1AR72 2Z79A 3KGLA 2J1EA 2NZ9A 2R7EB 3CJIB 1JHJA 4NRMA 4XJUA 4OLLA 5FZ0A 3VZKA 2C1FA 5IJRA 2QUOA 1PK6B 1RUNA 1KRIA 1RHI1 1S2EA 1YQ5A 3Q9OA 1VBD3 4DXRA 2PAEA 5F6LB 3LA7A 3ILFA 3A7QA 5CG9A 2WS92 2XQXA 3N35A 4XAEA 1GP4A 2WS93 3FJSA 4I09A 2PA7A 4P00B 1QH6A 4WM8C 1W2UA 3ZFGA 4Z07A 5KHJA 5FZEA 2R1BA 1GQPA 2YGLA 1LESA 3H9AA 1NXMA 2TBVA 2VZOA 4UBHA 4X8NA 3VKLA 2DCJA 5IFTA 5A6ZA 1URXA 2A3XA 1JZ5A 3AZVA 2BJSA 5I8SA 3U1XA 2ZMLA 3WSOA 3ME2A 3WP3A 3O5SA 1KQRA 2E9QA 2QJVA 1HRI1 3PVBB 2BU9A 3VZLA 3ZYFA 2P5BA 1NA1C 3WHTA 3ZXFA 4YW6A 3I54A 1H9PA 3MHZA 4GULA 5FLHA 5FZ8A 3ST7A 1XYPA 2Z5WA 3OPZA 3O0VA 4N53A 2DUQA 4RL7A 3VB9A 1UOJA 2GH8A 4CU6A 1LGCA 3GBWA 4M4PA 1BBT1 1XB9A 2WKKA 3JQWA 2Y6KA 1NQDA 3RJ2X 3SMHA 3VHPA 4CU8A 3FX3A 5FY0A 4BZ4A 2BNOA 2VBDA 3GM8A 2C5DA 1LTEA 4CP0A 1JYWA 4UWDA 2ZA9A 3C7GA 3CNAA 2GN7A 4XJAA 3S5QA 3LDRA 1VB4A 2JX9A 2P17A 5T5OA 2B42B 1HRV1 3AB0A 2DVFA 4LBQB 4MZUA 5GZGA 1VMFA 2HWC3 1RUE1 3O0WA 5A7WB 3RYKA 3WUCA 2WSUA 4EV0A 2R072 3IPVB 1FOD3 5M0TA 2XONA 2R073 3FMGA 3LSEA 5F9TA 3POJA 1UKGA 4BJ0A 2EIGA 5FO9B 1XQNA 3CQOA 3D0JA 1JN2P 2QTWB 2QVSB 3B01A 3I2FA 3I2GA 2Q0AA 5DAXA 1HXS1 4Y5SA 5D1IA 2VVFA 5FZFA 3THTA 3T2QA 4CDWA 1DGRA 3VHNA 1UYZA 1SLAA 3HJRA 3POSA 4BM8A 4EN9B 3J4UH 2JB8A 1OA2A 2B39A 3WP6A 1H2NA 1XNAA 2MHFA 1RUG2 1MS3A 1UPIA 2R1DA 3OYWA 4BK4A 1Y9QA 4AQSA 4D94A 1RUD1 2VH9A 3HNBM 2PHLA 1LEMA 3POWA 3J7HA 3ZX7A 2BOJA 1BMV2 4IESA 4QAWA 4XQ4A 2VMCA 1GNYA 1C4RA 1MZFA 3GHNA 1E5HA 3H3UA 4LBOA 3U0ZA 2WWUA 4PI2A 1UZ0A 3LB9A 3ORJA 2P3IA 4P9IA 2ZZJA 2QCSB 3POBA 1FNZA 5FZ9A 4FVVA 1NZIA 1W8OA 1AXKA 2D5FA 5CNAA 2CDPA 5F5IA 4DZGA 4H14A 1YHFA 4R8HA 2QZ2A 5FYVA 1CAVB 1EAH2 5H9PA 1FT9A 3VDAA 5DDJ3 1UOBA 1EAH3 1W6QB 2VUCA 4C1WA 3Q8FA 4Y33A 3ASIA 3IBMA 3M3CA 2FDHA 5ACA1 1E57A 4XUOA 3RGBA 3W5NA 1TEIA 1ZBA2 3GZTB 4MV2A 1VRH1 3KMHA 3QLQA 1R082 5K8SA 1DIWA 1PIV2 1MQTC 2X53S 2NYYA 3AJZA 4NHLA 4GH4C 4HPKA 2GP5A 4M3CB 4MGZE 2WABA 5DAWA 2ZZQA 4HONA 3WHUA 1BVVA 4ES9A 5HPOA 4C90A 3TB0A 2WNUC 1JHNA 2FZ2A 1OQDA 1LR5A 2RR12 4OHXA 4Q4W1 1LOFC 2A6ZA 5DUVA 5A6XA 2AREA 1O59A 5DN2A 4AI1A 4Q8LA 4UYBA 2PHXA 1L7LA 4CYDA 5FWEA 2UYAA 3ZDSA 1NQJA 3UGGA 5E6HA 1DQ1A 5FBZA 2FMDA 5KXDA 2R0FA 1HB4A 2BWCA 5FXXA 1DGRN 1SFNA 4KU7A 4ZXKA 1NLQA 1S4CA 2GAUA 5C3PA 2ZKNA 1W9TA 1ENRA 2OYZA 5KHHA 4K1ZA 5JSPA 1OQEA 4NR1A 1KJRA 3E5QA 5LA2A 3OUJA 5T5JA 2V4AA 3J8F1 1OLQA 1RUH1 2WC2A 1ZBE2 3V0AB 2UU8A 1I5PA 1H9WA 5A6YA 1RUC2 3T0DA 1BHGA 3OD4A 4UT5A 1QWRA 3GZAA 1RUJ1 1RUC3 2ET1A 3KZ4C 4XF3A 5A33B 2JG8A 2VOTA 2MEV2 5FP3A 5IW0A 4LE3A 4EJRA 3T3YA 2JEMA 4R9CA 3RZKA 1F5FA 4Q4V3 1OXCA 2RDSA 1SEFA 4Q4X1 2BW8A 4XBLA 4D8MA 3KQRA 1K45A 2V09A 4HN0A 5FTTC 2VW2A 4KWJA 4LBQD 4RGGA 1R1A3 5FV3A 5GZDA 3SLIA 3S57A 4JC1A 4OZXA 1YIFA 2ILMA 4K8RB 3T2TA 4MG2A 4XF0A 2YB7A 4CUCA 3U37A 3U4SA 1V6MA 2ZEWA 4WM7C 2BYVE 1TE1B 2ZCWA 2YZ4A 1AVBA 1V00A 3B9IA 4GA9A 4C91A 3P3NA 1SACA 3ETPA 1ASJ3 1R091 3OPTA 1NX9A 4AHXA 5KR7A 5HCBA 3F95A 1REFA 2RG4A 2LUWA 2W46A 1C8NA 4LPLA 4PIZA 1YQ6A 2B5HA 2J1UA 4RQPB 2J1VA 1JYIA 2P6HA 5FIXA 3RWKX 5LEKA 4Y1YA 3ZFEC 3JBG3 1CD3G 4RD7A 5J37A 1NY72 5LCWL 2AACA 2W1UA 2D3RA 4JQTA 5JMOA 5D8AC 4A6SA 5IATA 4NHXA 4I01A 1V9U1 2VNVA 1VBE2 4W4ZA 3K48A 1CGPA 4OHYA 3FLRA 4EQVA 3LKJA 4NHMA 3KCYA 4DMIA 1CJDA 2HWE2 5ABJB 1VBC2 2IFWA 2QFEA 1S0DA 5FYTA 2CWMA 3JXSA 3PVNA 4HETA 4LEJA 1S0CA 5B4XA 3I2KA 1G86A 2A6YA 1QJZA 2PAKA 2VNGA 4AHZA 4GQ7A 1RL3A 1H8VA 1SZBA 1QJU1 1RUI1 2ZACA 2NMNA 3AZZA 4QQHA 5SV8A 4L8QA 3PU8A 4QX2A 4GD4A 4PCRA 4CDQA 4MGQA 1S0GA 4E27A 2EXKA 1LEDA 1RVF1 4H55A 3UKTA 3B02A 1ZA4A 2VBPA 3ZFFB 3T0BA 3MIGA 5C8CA 4LHSA 3ACFA 3Q8CA 5C8WA 2GMEA 4IE0A 1UX6A 3I3MA 1KXGA 4IV3A 3ATGA 3LA2A 3BN6A 3WDTA 3VKMA 1BXHA 1B35B 2KD7A 3VV1A 4N8MA 3HNMA 3RG0A 5FP9A 4UW3A 3W58A 3ZYPA 3BKZA 1SCSA 1W2NA 3T1MA 4QHOA 1QJEA 2PLV2 1BK0A 3NJXA 3BPZA 5FYUA 1AL22 1NAEA 2PLV3 1AR63 3NQHA 3IM0A 5BV6A 2J7MA 1DYOA 2ZGMA 5A1AA 2DBNA 1VAMA 4AGGA 2LALA 4TN7A 2ADEA 2ZX0A 3WEZA 1NCQB 1DU3D 1QNYA 3CKHA 4KI5M 3MUY1 2NLRA 3ZLIA 5A1FA 2HYXA 3MW4A 1WD4A 3UKVA 5JMCA 1NCRA 2OQ7A 3AKPA 4FFHA 4LBNA 2VL4A 4IQPA 2Z69A 2HWD3 2WT2A 5FOBB 3VKOA 4PDWA 4SBVA 3S5AA 2VO5A 3JD72 4H7LA 2V5YA 5JXHA 4TSVA 5LBBA 3WF1A 1HKDA 5KXBA 1C28A 4AGVA 3DEMA 3T2OA 2VTFA 5FMOL 1W0PA 1C3HA 2R043 1W6MA 3G7DA 1S0JA 5J09A 1M4WA 3ON7A 5IVEA 1G9CA 4A7ZA 3OGGA 4ATEA 2QQMA 4NJ4A 1RUF3 1RYYA 4A6OA 1I5ZA 2IXIA 2WZR1 1ULCA 2YG0A 5C4WC 2VOXA 4AEDC 3UV9A 5IK8A 2XJSA 2XJTA 4FOYA 2DWRA 3BVCA 2OZ6A 2JWPA 1H4GA 2ZGLA 5FWJA 5JCTA 1AR82 3E6DA 2X8KA 1LAJA 2ID4A 2RE9A 2VCCA 3SEPA 1X50A 1RXFA 1ZZ6A 4I0WB 1O5LA 1W3VA 4OUSA 2GC1A 4XXPA 4ZS3A 1VP6A 4FPLA 4OI2A 5DAVA 1DGWA 2BFUS 1Y9GA 3ZYBA 3LQCA 4Y4YA 5FXZA 3AKRA 1PNGA 1W8ZA 1RUE2 1PM7A 1BEV3 4QKFA 5JAXA 4LKSA 4QB6A 1M06G 3ABZA 2BBAA 1H1IA 1DDLA 4JX0A 1W03A 2RS51 3GJAA 4XFGA 1G9AA 1NLSA 2VCMA 2VBBA 5L7OB 2BTVC 5DMYA 4LBLA 5FYZA 5I0TA 3PVEA 4GWIA 4V2VA 5FLJA 2KR2A 1IZ3A 5I8TA 3AVSA 3S7IA 3NO8A 4QPGB 2DDUA 3CEWA 4K20A 1JZ2A 3CBNA 3VD7A 1V6NA 4LIUA 5BNOC 2WNVB 4NUBA 3K4AA 4E4SA 1K5MC 1PVC2 2I07B 4P08A 1KDMA 2GC3A 3GF6A 1PVC3 2JXAA 1OVPA 1WMFA 1UKRA 4HK8A 4OUMA 5JZGB 4NIGA 4XYXA 3W20A 1QJFA 4AYUA 3W5MA 2Q30A 2WS91 4AHWA 5CA6A 4MO3M 4CDXA 1O8PA 1PO22 1SBFA 1F2NA 1HN1A 3QD6A 2WQ8A 2D93A 2VZTA 2UY9A 3B3QE 4MXWA 4O9EA 3UETA 3ZFGC 4AZZA 1HX6A 4RS5A 3FBYA 4QKBA 4XURA 5LRSA 1X82A 3DYOA 2HBTA 1ZRDA 1DBNA 2VJXA 1GP5A 1F5JA 2E51A 3WXPA 4JGYB 1REEA 1UMZA 4HSJA 5BNPB 1SFYA 1N3PA 1OUXA 1RMU2 1SLTA 2RJ2A 2HBUA 3ELNA 4JGZB 3WCRA 2W92A 3EO6A 4S2DA 5FMDA 2WT1A 1YCIA 2RM22 1CJPA 3A4UA 4FPGA 4XE9A 5LRRA 3BTZA 4DNYA 4QU1A 1YRZA 2ZPXA 2VCAA 3VBFA 3O1MA 5C9AA 1SG3A 2CU5A 4AXOA 4E2GA 2CGPA 3NNMA 2VG9A 4GH4A 5EJ1B 4NHYA 1NE6A 4N53C 4XF9A 4Y3OA 4HOOA 3ES4A 4OCTA 2BRTA 1O5UA 3BALA 3MDPA 5I0RA 4OFGA 1HDKA 2GN3A 2HWF3 3U10A 5L9VA 5CIRA 4N43C 4FPOB 1OH3A 2XGXA 5BNNA 4AG4A 4MHUA 2FZ1A 4F3JA 2O14A 1JMUB 4PIXA 3O1TA 1XC6A 3AVRA 1XJAA 2RJKA 3V65A 2R071 3DL3A 4BXFA 1QEXA 4FTEA 3DKQA 3FZ3A 4Q26A 4GJZA 5CFDB 1QH7A 4V2WA 5CB7A 3VZNA 2UY8A 2WNEA 4CEWB 4F83A 1CX1A 1EP0A 2R063 2G1MA 3MFCA 3T1LA 1H6XA 3MIBA 1N1YA 4OMDA 4IE5A 3SNMA 3VD4A 1ZA7A 2WO3A 3DYMA 4WVWA 3RZMA 1LHWA 2ZHMA 1XNDA 4CDWC 4NPLA 1OLMA 1V0AA 3O12A 3BB6A 2Q1MA 3I2DA 2DFCA 2WWSA 1D2QA 2HH9A 1RUG1 3LZZA 4XVHA 4CDUB 4ZPIA 1T6GC 2D97A 1UU4A 4LMFA 5AC92 3KB5A 1PMIA 4LBJA 4UF0B 3CO2A 4YW3A 4AQTA 5AC93 5DZGA 3ACHA 5FYCA 2J42A 3QBQA 3CZUA 3N7LA 3PU3A 4E8DA 1BMV1 5HV0A 3M8LA 5JR2A 2ZGNA 3LEKA 4K21A 3DXTA 3ZIXA 1WW4A 3LFMA 4MGKE 5A1LA 1W99A 2XJPA 3SCHA 4OQ9A 3ZXEA 3GALA 2RMU3 5FPLA 2HWB3 1PGW2 3M3IA 3NV3A 5FZ7A 2ERFA 1XNTA 4NAOA 1ULGA 1EAH1 1LULA 3ZSKA 3BTXA 4WV8A 3ROUA 5E8AA 2ZHLA 2ORXA 4PT6A 2BNMA 3CF6E 1OMIA 4A3ZA 4YG0A 1GNZA 4FPJA 4QKNA 1UO9A 2Y33A 4YM1A 2YBKA 3RJRA 5I0DA 4MHRA 3T4HB 2PFWA 2ZX4A 3CJIA 1ZBA1 2WO7A 3WCSA 1PK6A 3B93A 3O1SA 3ENRA 5FYIA 3HIFA 1R081 2C0ZA 3NNGA 3WNMA 1PHMA 3BIEA 1YNAA 4ARXA 1VAKA 4I3GA 1Q8SA 3SITA 5F37A 5FK8A 5HV4A 2VZQA 5FYYA 1HLCA 1SQ4A 2RR11 5LW9A 2WQ4A 4IEWA 4Y1VA 1Y3TA 4CP1A 2MPFA 4P14A 2Q4SA 5IAXA 3SEEA 1K5JA 1XNBA 3LAGA 4XUQA 5FPVA 5LASA 4YFZA 2VOWA 2W94A 1QHDA 2G9GA 2YXSA 2D6NA 3I7DA 1N3QA 5BXXA 3EQEA 3ILRA 2TEPA 5T5LA 4CE8A 1NZCA 4F8AA 1FPN3 1XNKA 4UFJA 1AJKA 4NRPA 2DUPA 4J6GA 1WD3A 5JIUA 4FOQA 1RUI2 2EALA 1PX4A 3E6BA 3LPFA 4IERA 4CVUA 1QGLA 1RVF2 1WLDA 1ZBE1 3AKQA 5IK5A 3K4DA 2YGMA 3CJXA 3LA3A 1RUC1 4DXSA 4XACA 2WZEA 4LBQA 2X05A 2ZGKA 4EROA 2XH6A 3URFA 1W9WA 3WR0A 5IVFA 1WWYA 1YYNA 2MEV1 5A7WA 1GLHA 2JG8C 3WW3A 4CP2A 1MS0A 4NAMA 3IPVA 3GBFA 4Y4RA 5JWPA 2PHDA 3N7MA 3M3OA 5AFEA 3FUOA 1W05A 2VZSA 3KS7A 1JI6A 3FL7A 4BA6A 5KBFA 5LA1A 1R1A1 2Y0IA 1YC61 4LHLA 3D6EA 3MLLA 3VD3A 2WA3A 3AK0A 1H8TB 2DU0A 1AR92 4YPJA 2XPJA 1HW5A 1AR93 1O6UA 2QQPA 4RFRB 2W87A 3OY8B 2NQYA 5C6CA 3EB7A 5FZ4A 1Q56A 3VBOB 2VOVA 2XJRA 5EFUA 4C8DA 4UBGA 1DLCA 2Q5TA 4GALA 1RC6A 1PGSA 1NG0A 1NXD1 4OULA 3ILNA 1WUVA 2V73A 4QMAA 5FUPA 3KWVA 3LEIA 4MYEA 4UW6A 4A42A 3ES1A 2IWGB 4JTNA 4RYDA 4URTA 4IEQA 2BP6A 1X9TA 1NY71 2LS6A 1JODA 3VBUC 2BV4A 3OBTA 5CU1A 2ZGQA 4B1MA 1FMD2 2IZWA 5DUWA 1X36A 1A8DA 4RR3B 4CEYB 1IQAA 2DCZA 2W91A 4LLOA 2G4IA 4SLIA 5C3QA 3NAPB 2B9UA 1RXGA 4XPVA 2FDGA 4AR2A 1VBE1 3VGIA 3I2HA 4H2AA 2QDNA 1AYM2 4YRDA 1YFUA 4HKWA 4AEDA 1AYM3 1W3XA 5J98B 3VBHB 2PMWB 1VBC1 1F4AA 4JKMA 4DFSA 4CPBD 2P3YA 4YM3A 2EXJA 3OPWA 2DBIA 3VKFC 1MEC2 2RS33 5F3EA 2ZAAA 4JRAA 2J22A 3K3OA 2ORZA 1C8M3 3U07A 1OD3A 3J7LA 1SCRA 1UF2C 2OVUA 4KBZA 3WQ7A 3DUIA 1ZRFA 2PHUA 1GOGA 3PNAA 4M3CA 5FY1A 3ZN5A 2VPVA 4YGBA 1JYXA 1J3RA 3ZM8A 1JUHA 4CDQC 3DF0A 2WAAA 1GOHA 2JKBA 2VR4A 2IXJA 3KCCA 3NV2A 4UAPA 3WDWA 4EWEA 1TME2 2GNBA 5FJKA 5C8CC 2D3SA 4IV1B 4IDZA 2ZEXA 4XHBA 1OPMA 5IVYA 2XWBB 4I0AA 4IV3C 1IGOA 4QPWA 1QJX3 3R4SA 4NROA 2WNOA 5C3RA 3EMRA 4XDOA 3AYAA 1O3RA 2FD8A 2PLV1 1CPMA 2FDJA 1QJY3 2RVAA 1WW5A 2XG3A 1AL21 1PO12 3C2UA 4UFHA 1DQ2A 1PO13 3ZYGA 1JZ4A 2PHRA 2HEYF 2B46X 2DV9A 4AVAA 3V0AA 2ZMNA 1B09A 2GC0A 4U2AA 1S55A 2RJLA 1BKZA 4AL9A 1VBD2 3OOXA 1V6LA 5A7OA 4M01A 5A33A 5FAXA 1NT0A 3O1RA 2H0BA 4Q0QA 4IEOA 1NCRC 4YVWB 5JPMB 2ZX3A 3JD71 4PDWC 5FY4A 4D6SA 3VBSB 1GOFA 3LIGA 2ZS6B 3MF6A 2A75A 4IEYA 3B9CA 1ENQA 1SBEA 2GH2A 3O1VA 1UY0A 2VCBA 3CLPA 1K12A 2A6VA 2Y6JA 5C5UA 2LW8A 1RGSA 4FXGB 4FO9A 1JOJA 5ISLA 3AXEA 5CFCB 2EF6A 1DQ6A 2VZUA 5LA9A 1H30A 3KV6A 1C1FA 1CIYA 2ES3A 1VBB3 2VTXJ 2X5IB 2YHJA 4P9YA 1AR81 5FJHA 5T5PA 5FR3A 2W47A 1VBA3 4IGQA 4DUVA 3LD8A 3OUIA 4RQPA 4ZZ5A 3HQXA 4OYUA 2C24A 3K2OA 1WA4A 1BK1A 4HANA 4N43A 5D2AA 5F32A 5FZBA 3VHOA 3WOGA 3KHCA 5T55A 3BU0A 3O1OA 2HWC2 1BEV1 1D7PM 1W2TA 4NE9A 2OS2A 5FPBA 4B29A 1SFPA 2D6OX 3AFKA 3VKNA 1W6PB 4S2HA 1FOD2 4BQYA 1LOGA 2VM9A 3J26N 2BPA2 3I59B 4KWUA 1SBDA 1XRUA 4AVCA 2E7AA 1D0GA 1UY2A 3WINE 5LEJA 4C0HA 5E88A 3TN93 4JDNA 4Z1VA 2P3JA 3T4VA 2A71A 1QXRA 2EXIA 2B8MA 4AVTA 1XU2A 1HIXA 2UYBA 1DG6A 2ZMKA 3THDA 2ZGUA 4E4DX 2VW1A 4N7UA 1UOFA 1HJFA 1IPJA 1VJ2A 3APBA 4CCCA 4ONUA 4H7MA 3RMYA 5LY2A 1JOPA 3O7OA 1F8VA 4Q27A 5LBFA 1UD1A 5FKBA 2XL9A 5T54A 1MS4A 5HBAA 3WNXA 3B94A 4DRVA 4LULA 1PVC1 3I2JA 2XJUA 4R9DA 1DFQA 3IAPA 3VL8A 1MACA 2ZGSA 2R0HA 3TNPB 3W9AA 4HXCA 5K7PA 1W28A 3PMSA 3MO4A 3WQ1A 3ZFFA 2Y6HA 4XCAA 4CXYA 4Y1ZA 3UGFA 1FI2A 1XYOA 1PO21 2A1XA 1WLTA 2ZGRA 4CDXC 5FY7A 5K0UA 4ZU4A 3PJQA 1B35A 1BJQA 2R16A 1MPXA 5DDJ2 1US2A 4FPEA 2Q8CA 4RS5C 3AL6A 4XBNA 3TEWA 3WNNA 4AWDA 4CP9A 1YFYA 4LHKA 4QX5A 1RMU1 4FPYA 1UW8A 4WVVA 3OJBA 2RM21 4FQZA 4URAA 1OLME 4XFCA 4QQLA 3NWKA 3RZHA 1NCQA 1OHFA 3R05A 5H9SA 1DQ5A 3VBFC 3B00A 3KT4A 4XDQA 2VTXA 2OIIA 5C9AC 1XE0A 4RGKA 2AGSA 3WNPA 3HWJA 3BCWA 3NW4A 1O7FA 3GHMA 2JDMA 3OB8A 3OGSA 5C7GA 2E7TA 2B9VA 1JS9A 4A3XA 1N3OA 4D69A 4YW5A 1WCSA 1Z7S3 2TNFA 3TOJA 5BNNC 4A44A 3OGRA 1LECA 2FBEA 4BB3A 1HV1A 2E6VA 3WT3A 1UMHA 1PGL2 2R061 4EN0A 1IQDC 3ZSLA 5FDBA 1YLLA 1COV3 4YVSB 5L9BA 3I3EA 1WCQA 3ZO0B 1CZTA 4UFLA 5LY1A 2P6CA 4JCKA 2HEWF 2VXRA 4UW5A 2ZX1A 3UESA 4B4RA 1SLCA 1TZOA 1LB2A 1TNFA 5FYSA 2XVGA 1LGNA 4JRLA 1OOPB 3VDCA 5AC91 1GKBA 3FHQA 4XETA 4GWMA 5J48A 3IN9A 3X29B 1PZ8A 2D44A 1S0FA 1ZX5A 2Z2SB 4Q4V2 1DGWX 4QQPA 1IS4A 2YPDA 4XUNA 5FO7B 4B4PA 5L7OA 2ZGPA 2UWAA 2HWB1 5JI7A 3MYXA 1R1A2 2V72A 1PGW1 2D43A 3GCWA 2C6SA 3KD4A 5CBLA 4UFIA 4XDPA 4N90A 5C70A 2K0GA 2D6LX 2B4KA 3H3LA 2HEVF 4HN1A 1NUKA 4NRQA 2VULA 2BVVA 2IXHA 4R9AA 3HQUA 4XXAA 3MIDA 4CXWA 3IIIA 3DPRB 1GU3A 2EIBA 4XBQA 1ASJ2 1SMVA 2QDRA 3FWEA 4XHXA 1PMJX 4DUXA 2WRAA 3H1WA 2PXJA 2WNVA 4QDSA 3S6PA 3JUUA 3RYRA 1APNA 4W6WA 5FUIA 5HI0A 2XBO3 1QDCA 2BVBA 4N7IA 4FBFA 4YZ2A 3WZ1A 5JZGA 3CJIC 1S0BA 1R1ZA 1PK6C 1KFXL 3JBG2 3KM5A 4EWAA 5A3PA 1UX7A 3W59A 4YGEA 3ACLA 5JOWA 3VBUA 3H8RA 3UGHA 1EYBA 2Y6LA 3HBZA 5IUQA 4K7JA 4P9WA 3QH6A 5FZ6A 3NSTA 4DEQA 2YFUA 3T09A 2WZ8A 4BISA 4NIAA 1BYHA 4QQ2A 3RQ0A 2YUEA 2OPKA 4QX3A 4OVEA 4K1YA 4JGYA 1IOAA 1WLCA 4GWJA 2YPJA 5BNPA 3ALQA 5C71A 2W08A 2P34A 1N1VA 3M3QA 1AL0G 4JGZA 1BCXA 4WBBA 1YJKA 4CU7A 1FPN1 1ZREA 4MXVA 3F2ZA 4AI8A 1UOGA 2VZPA 4BIOA 5HCAA 4LO6B 3ZN4A 4AFDA 4BDVB 5F7UA 5AVAA 4FPCA 3WDYA 3AX4A 3VD5A 4D3WA 2F6BA 4E4HA 2RS12 3SXWA 2JDPA 2RS13 4LUMA 1O4YA 4ASKA 1FV3A 3MW2A 4KNCA 2SBAA 3D3AA 5E16A 4W6YA 2VMHA 1ND3B 4R4ZA 1EV13 4LBKA 4AF9A 4BQ1A 3G6JB 1ODNA 2JD9A 5EYYA 3VBRB 4NWVA 5GM0A 1GP6A 5CFDA 1X7NA 2Y0OA 1Y9MA 5FZ1A 4CEWA 2WBKA 4FOWA 2N7GA 4XIKA 2CAVA 2QQOA 1CAUB 4S2FA 4ASMB 5D21A 1AR62 1AR91 1GZWB 1YEWA 2ZHKA 5GALA 1Y4WA 3R6SA 3MICA 4OZOA 3ZXGA 3DGTA 3CDZB 1F4HA 1HQNA 3H8UA 2ZAHA 4CDUA 1W8NA 3RI9A 1ND2B 5CYYA 3W21A 4UF0A 3JB4C 4AK3A 4XQWA 4Q29A 5C3SA 2JG9B 1GQHA 5FMBA 5F3CA 4WVMB 3AKSA 2HWD2 4QGLA 3V64A 4HVOA 5DPNA 3WP4A 3HN1A 4FFFA 5JLVA 1VE0A 5JXGA 1W6NB 4D0QA 2DF7A 1Y7BA 4TWTA 4COZA 1WZXA 1N47A 4UFMA 2VC9A 4Y5TA 1HB1A 4XMAA 4CCNA 2R042 1FMD1 4DPNA 2CDOA 1YFWA 2QQKA 4BE3A 2O1QA 4CPBA 5L19A 3I2IA 1W8FA 2C9KA 3AM2A 4NN0A 2E63A 3IWZA 3VDDB 5EPAA 1RUF2 2XHNA 1LCLA 4MGSA 1AYM1 1ZZCA 5F39A 3PUIA 1RHI3 4GKXA 3P6BA 4PLMA 4QXHA 2JDKA 5FY5A 4R4XA 4XCBA 1O91A 3PHMA 2DURA 1CN1A 4HPKB 4E8CA 2GMMA 1XOYA 3IAQA 4G9SB 3RDIA 1MEC1 3OEAA 3GXUA 4BQ2A 3WY6A 1RB8G 3OGVA 4LOSA 2VQAA 3LOIA 2AR6A 3KT1A 5L73A 4B1LA 2VQ0A 5CEHA 4P9JA 1BEV2 2W39A 4U36A 4GMP3 3OBRA 5FYHA 1XNCA 4NMIA 2K2SA 2UURA 2WINB 3A0KA 1RUOA 3D4KA 1HRI3 2Z4FA 3IDEA 1WA6X 4NIHA 2IVJA 4PBOA 2A6WA 4B7EA 1TME1 2KXLA 4BQ3A 1LU2A 5C3OA 4AGRA 1AXYA 3FHAA 3SKVA 3ZKYA 5J36A 1QJX1 5IFPA 3TEYA 3VUOA 4QXKA 5CKQA 1BBT3 4PIYA 3UKNA 3PLQA 4FPKA 4Y24A 5FBJA 3KV5A 1UAIA 5CZKA 2W9XA 4ZONA 3NL1A 2EXHA 1HRV3 1PO11 2JG8B 2YU2A 2DCKA 2L9LA 4D7TA 3SQOA 1PZ7A 2J1SA 5EHDA 3NV4A 4DEVA 2BGOA 4KH9A 4KU8A 4NIIA 4LOTA 3WX5A 3IMNA 1EY2A 1VBD1 3PIGA 4AQ6A 1L7RA 3WF4A 1LRHA 4CSWA 4XQDA 3RPQA 4DIQA 3VDBA 4FSJA 2W5FA 4IXLA 3ZSMA 2ZKLA 3R0RA 1NKGA 3RZZA 1XYNA 4FCAA 2FHRA 1OD5A 1D4VB 3UJQA 3C7OA 4XTMA 1QKQA 3L2HA 5DUXA 5F3GA 4D7YA 1UY4A 5FZ3A 1AX0A 4BMBA 4LO4B 4W50A 1W04A 3DN7A 4DUWA 3N4MA 1UWWA 2JDHA 3BOWA 2YU1A 1AHSA 1AXZA 3NV1A 4E9KA 3AZXA 3R4DB 2VMDA 2ZOEB 1EUTA 2IVIB 1UIJA 3GGLA 3OY8A 3WG2A 4AI3A 5E1RA 4YZ5A 2VAUA 4HSLA 2QNKA 2JIJA 1KJLA 3C7EA 3VBOA 1YQ8A 1WCKA 2IFRA 2IXCA 3P1IA 1QY4A 4QXBA 3IZOA 5LB6A 3NJZA 1JZ8A 2JIGA 1BVP1 2PYTA 1ALYA 3ZXJA 2WFF2 1XE8A 2XLFA 2FDFA 2WFF3 2ZHNA 3MIEA 4AEMA 3FUQA 5BUVA 2WYSA 1H6YA 4DRRA 3VZOA 4DB5A 1EUUA 4ORFA 4RQPC 4YG6A 2HWF2 3O1UA 4NO4A 2P4EA 3WF3A 2GMPA 5AFBA 2W1SA 2XHKA 1X8EA 2HWC1 3H1YA 5ACA3 4G4FA 4QGMA 1QMJA 1ZZ8A 2EA7A 2JD4A 4RR3A 5A7PA 4CEYA 1RITA 3PVOA 1FOD1 2WZPP 3NAPA 1TMF2 2VNRA 2P1BA 2VZRA 4QX0A 1W9YA 5FMCA 1TMF3 1W8TA 1GV9A 2GNTA 1IKPA 4M3CF 3D0SA 3WG3A 2FCTA 2ARCA 5I8YA 1VRH3 1LKNA 4OUEA 5EZWA 2R062 3NKTA 1U0AA 1YXWA 2E53A 2XUEA 3POYA 3VL9A 3MZHA 5DAPA 3VBHA 1D2SA 1DYKA 3MPBA 1WBLA 2OXBA 3U78A 5FP7A 4S2GA 5A3UA 3DCQA 4B4QA 4IEUA 4CA9A 4C1XA 2BNNA 4KWKA 3R4UA 3VLBB 3WF2A 4B8EA 4PHZA 3S0MA 4HBNA 2BEOA 5A7SA 1CIWA 2I45A 4CRQA 1CAXB 1W2OA 3RI8A 4YFWA 2R32A 4K9SA 3AFGA 3NNLA 1C5HA 1F31A 2DTYA 2XLAA 2Y64A 4QPIB 5GKAC 4P9LA 2B7YA 2K9ZA 4OQ8A 2WIIB 4K6BA 2RMU2 3ZFFC 2JB4A 1XE7A 1KS4A 2HWB2 2XVLA 1UZYA 3AXDA 1AX1A 3DV8A 4IV1A 3OD0A 4YW2A 4HMZA 2QQLA 2XLGA 3HEIA 1JZ3A 3PUQA 4IE7A 4YYOA 1U12A 4BIFA 3TAYA 5K0UC 5DDJ1 5FZCA 1N1SA 1B35C 1PM4A 5J7MA 3J8F3 1RUH3
chains in the Genus database with same CATH topology
1GP5A 5C3RA 1UOGA 1E5RA 1W2NA 2BJSA 1QJEA 1HB4A 1BK0A 1UNBA 5C3PA 2BU9A 2DBNA 2Y6FA 3OOXA 4RGKA 2BRTA 1HB3A 2VBDA 1ODNA 1GP6A 5APAA 1W04A 4BB3A 1W05A 2IVIB 2VAUA 3ON7A 1HJGA 1UZWA 2VE1A 3ZOIA 5C3SA 1DCSA 2JB8A 1OBNA 1RXFA 1W3VA 1HB1A 1W9YA 1E5HA 1QIQA 1W03A 5C3QA 2VCMA 1RXGA 2VBBA 2Y60A 1BLZA 1ODMA 1IPSA 1W2AX 1W3XA 1UOFA 1HJFA 1UOBA 1E5SA 1HB2A 2CSGA 1UO9A 2DBIA 1W06A 1W2OA 2WO7A 1W28A 2JB4A 1QJFA 3ZKUA 1WA6X 2IVJA 1OC1A 2VBPA 4XAEA 5C3OA 1GP4A 3ZKYA 1E5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GP5 A;  5C3R A;  1UOG A;  1E5R A;  1W2N A;  2BJS A;  1QJE A;  1HB4 A;  1BK0 A;  1UNB A;  5C3P A;  2BU9 A;  2DBN A;  2Y6F A;  3OOX A;  4RGK A;  2BRT A;  1HB3 A;  2VBD A;  1ODN A;  1GP6 A;  5APA A;  1W04 A;  4BB3 A;  1W05 A;  2IVI B;  2VAU A;  3ON7 A;  1HJG A;  1UZW A;  2VE1 A;  3ZOI A;  5C3S A;  1DCS A;  2JB8 A;  1OBN A;  1RXF A;  1W3V A;  1HB1 A;  1W9Y A;  1E5H A;  1QIQ A;  1W03 A;  5C3Q A;  2VCM A;  1RXG A;  2VBB A;  2Y60 A;  1BLZ A;  1ODM A;  1IPS A;  1W2A X;  1W3X A;  1UOF A;  1HJF A;  1UOB A;  1E5S A;  1HB2 A;  2CSG A;  1UO9 A;  2DBI A;  1W06 A;  1W2O A;  2WO7 A;  1W28 A;  2JB4 A;  1QJF A;  3ZKU A;  1WA6 X;  2IVJ A;  1OC1 A;  2VBP A;  4XAE A;  5C3O A;  1GP4 A;  3ZKY A;  1E5I A; 
#chains in the Genus database with same CATH topology
 1D4M 3;  4RHV 2;  2HYK A;  4RHV 3;  2DYC A;  1RUJ 3;  4BXS V;  4WM8 B;  5F5A A;  3ZSJ A;  5B2G B;  1AF9 A;  1QXJ A;  4I02 A;  3BI3 A;  1UL9 A;  2EIE A;  1GFF 2;  3RNS A;  5GLU A;  3SHR A;  3E1F 1;  3BTY A;  2R30 A;  4P02 B;  1H1A A;  4GIQ A;  1NCQ C;  4GAZ A;  2E7Q A;  4Y22 B;  2IXL A;  2ZGO A;  1GMM A;  4QWN A;  5FZK A;  1PX3 A;  2ZAB A;  4YLZ A;  5HXV A;  5BPX A;  5LBE A;  4Z2A A;  4YVW A;  4HK9 A;  1PNF A;  2CTV A;  1CAW B;  3N9P A;  1J83 A;  1HQL A;  3H50 A;  3VBS A;  1J1L A;  5DAQ A;  2QQW A;  1NA1 B;  3H0O A;  5FZM A;  3VHR A;  1S2B A;  2ETE A;  2O8Q A;  1C5I A;  3I97 A;  1SPP B;  1OKO A;  1GZT A;  1R09 3;  3OBZ A;  2EAK A;  3LIH A;  1ACC A;  1VLN A;  3WW1 A;  1YO8 A;  3MEP A;  4JHT A;  5FRA A;  3LOB A;  2W1W A;  4NPR A;  4X6Q B;  2A3Y A;  3ZIW A;  3LGR A;  1PGL 1;  3I2O A;  1FPN 2;  1G8W A;  1W90 A;  2Q1F A;  3N3H A;  5CFC A;  5JOY A;  3V56 A;  1JH5 A;  1POV 0;  2XUM A;  5KHI A;  5JUV A;  4YM0 A;  2X5I A;  4OI1 A;  2XWJ B;  1S2K A;  1XXN A;  4DQA A;  1F15 A;  3I49 A;  1UYX A;  1ZZ7 A;  2BOI A;  2R49 A;  2DU1 A;  1FYU A;  3TEX A;  2PQQ A;  2YC0 A;  1V9U 3;  4OHV A;  1ZM1 A;  4FAH A;  3UYJ A;  3N9Q A;  3NMB A;  3GNE A;  4XF1 A;  3OEB A;  2R6Q A;  2D6K A;  2EID A;  1W6P A;  2PHF A;  4Q4V 1;  4Q4Y 3;  4Q5O A;  4XTP A;  3I59 A;  4IEV A;  5GLV A;  2BQP A;  4ASL A;  4PLN A;  3M2M A;  4Q0U A;  4FTB A;  5L7O C;  5LK5 A;  4TLG A;  1QJU 3;  3UJO A;  3TRS B;  1MS9 A;  5A32 B;  4ZU5 A;  5FZA A;  4E4Z A;  5IVJ A;  1UN1 A;  3HMY A;  1AYN 2;  3H42 B;  1AYN 3;  3IDA A;  3I3Q A;  5A3W A;  2QE3 A;  4EN8 B;  1ASJ 1;  4QPG C;  1CVN A;  2V4V A;  2X10 A;  3PIJ A;  3WQB A;  4FTS A;  1S1A A;  2PHW A;  4BU2 A;  2WO2 A;  2WNV C;  5FPU A;  3AC0 A;  1UYY A;  4QPY A;  1UCX A;  2BGP A;  5JZG C;  3KV4 A;  3JBG 1;  2CL2 A;  4PJY A;  5LZ6 A;  1OF4 A;  3PUR A;  4XFB A;  3A22 A;  1VMJ A;  1Q8Q A;  1SDW A;  5A80 A;  5EQU A;  2WSV A;  1CAV A;  4FI9 A;  3POE A;  4QM8 A;  3JB8 A;  1CX4 A;  5FQ0 B;  1W6Q A;  4FXK B;  2YY1 A;  4HT1 T;  4EE2 A;  4KG0 A;  3TEZ A;  3POG A;  2KA3 A;  1I9R A;  4AVS A;  5KHG A;  4ZU7 A;  3M7A A;  4PQ9 A;  4YZ4 A;  1MQT B;  4AI0 A;  3WV6 A;  4JGY C;  1RIR A;  1SDD B;  2VY0 A;  3BTA A;  4GH4 B;  5F8P A;  4A7Y A;  5BNP C;  2FDI A;  1Q8V A;  1WLW A;  3THC A;  1V6J A;  1KEX A;  4JGZ C;  4ATF A;  1KFU L;  4Y20 B;  4NHK A;  2WNU B;  2RS3 2;  2W95 A;  4K40 A;  4QM9 A;  5IWF A;  4COV A;  4JTO A;  5A3M A;  3AMP A;  1C8M 2;  2VZ3 A;  1E5R A;  2Y6G A;  3NNJ A;  1O4T A;  1KGY A;  3ZYH A;  3WVJ A;  4K8F A;  3U75 A;  2JDA A;  4QDR A;  5BNN B;  1A3K A;  1QF3 A;  2E26 A;  4JKK A;  2RS1 1;  4AI2 A;  5CAD A;  2NP0 A;  4AI9 A;  4YAR A;  1DLL A;  2VXJ A;  2YC2 A;  1DYP A;  2A70 A;  2JEC A;  5GZE A;  3ZN6 B;  5A3N A;  4DOU A;  1UYP A;  1VRB A;  2KM2 A;  4P5H A;  1A34 A;  1FAY A;  5J1X A;  2WZR 3;  2W2I A;  4QX8 A;  2NM1 A;  3PME A;  3S30 A;  4LKF A;  2CY6 A;  5A7N A;  3OF1 A;  2LM3 A;  1OA4 A;  1T6B X;  2ET7 A;  3AMH A;  1QJX 2;  4M4R A;  4YG3 A;  2WR9 A;  5DZE A;  5APA A;  5CFD C;  3GZE A;  1JXN A;  1LHN A;  2I2S A;  2ZJC A;  3P5B A;  3PUA A;  4CEW C;  1H2M A;  5JOZ A;  4YVS A;  2XKO A;  1J58 A;  2G9Z A;  5EV7 A;  4TTG A;  4KGQ A;  5IYY A;  1QJY 2;  3JCI A;  4RN5 A;  1AR6 1;  2CWS A;  3CU7 A;  1G7Y A;  2OPW A;  1POV 3;  1TQ5 A;  4MGY E;  5LA0 A;  2LRO A;  1IS3 A;  3VD9 A;  2BWA A;  2OA2 A;  1OOP A;  3IB3 A;  1OPO A;  1UZV A;  4XJ9 A;  4CDU C;  4E2S A;  3LDK A;  2P37 A;  4DXT A;  4I30 A;  4C0B A;  5FPZ A;  1DZT A;  5FLI A;  2C9A A;  1AZD A;  2HWD 1;  3C8X A;  1GZC A;  2PTM A;  4ARY A;  1GSL A;  1POQ A;  1VAV A;  1WW6 A;  2TUN A;  3GBG A;  4WM7 B;  3ZXL A;  4I0B A;  4A7K A;  4LHN A;  1XSR A;  4YNI A;  4EZ4 A;  2QKD A;  1FXZ A;  2JJ6 A;  2QBX A;  4ITC A;  4RFT 0;  2R04 1;  4UOJ A;  4QU2 A;  3AP7 A;  2DVD A;  4BYY A;  5KWR A;  2K46 A;  2NMO A;  3Q8E A;  5FO8 B;  1AR7 3;  3HT2 A;  2ARB A;  3EXU A;  1RUF 1;  3INA A;  4L99 A;  3UK9 A;  1GQG A;  1G9B A;  4AFB A;  2E31 A;  2PEL A;  3DPR A;  1Q43 A;  3ZFE B;  1UXX X;  4O61 A;  1Q8O A;  1VBB 2;  1WW7 A;  1UPS A;  3MW3 A;  4NID A;  5FZI A;  1ODM A;  2JEN A;  2QQU A;  5D8A B;  5CKN A;  1H2L A;  1VBA 2;  4AAP A;  1GWK A;  3V0B B;  1H2K A;  4AE2 A;  1Q5O A;  2ZTN A;  4R52 A;  3MGU A;  3RVH A;  2VZV A;  3MI8 A;  4OHZ A;  1QOO A;  1ULP A;  1AJO A;  2VNO A;  5FZO B;  4GMP 1;  1W9F A;  4YWA A;  1ST8 A;  4O65 A;  4IEX A;  2XJQ A;  4LIV A;  2MNG A;  4JV4 A;  3NJV A;  2CAU A;  1DZQ A;  1X9P A;  4QX7 A;  2VUJ A;  4YW4 A;  2PN5 A;  3AP4 A;  5C33 A;  3RFR A;  3TWI A;  3TN9 2;  3N9M A;  3ZKU A;  5BY5 A;  2Q8D A;  3MUZ 1;  4LO8 A;  2VQU A;  1OC1 A;  3A0N A;  3N9L A;  4GB3 2;  5F5C A;  4AEK A;  5ABJ A;  4QGN A;  5K9Y A;  4GB3 3;  4LJH A;  5HXM A;  2Z42 A;  2D7F A;  2FQP A;  3AL5 A;  3NJY A;  4HKO A;  4OMC A;  2DUO A;  4FFG A;  3Q8B A;  2XOM A;  4LR4 A;  1U5X A;  1UY1 A;  4CUB A;  4QXC A;  4B3N A;  2DCT A;  4XOG A;  2XKP A;  3JU9 A;  3UL2 A;  4IUG A;  1A78 A;  3D5O A;  2JDU A;  2SLI A;  1W9S A;  3LSD A;  5IK7 A;  2XVK A;  3KT7 A;  1DQ4 A;  3O1P A;  1JTZ X;  4IL7 A;  1S0I A;  1AX2 A;  2GNM A;  4PF5 A;  4QB2 A;  3U14 A;  3MFA A;  1UNB A;  4XZP A;  1GIC A;  1SHW B;  4FP2 A;  4MET A;  2D3P A;  2WT0 A;  5EWS A;  4AQ2 A;  4PI0 A;  1YJL A;  3RZL A;  2NPI A;  1ND3 A;  3GZU C;  3RRD A;  1DP0 A;  2H6C A;  3LEM A;  2WL1 A;  4KBB A;  4IEZ A;  1JUI A;  3VBR A;  5CAZ A;  4I3P A;  3AYE A;  1WKY A;  5DZF A;  1W6O B;  5GZC A;  2D98 A;  3WP5 A;  5FY9 A;  1HB3 A;  2DVA A;  2IUW A;  4P9X A;  4P5Y A;  1RUG 3;  1TG7 A;  4ISQ A;  1LOE A;  3AJY A;  1CAU A;  1WCU A;  3BU7 A;  3BGA A;  3RSJ A;  1GZW A;  3QAC A;  1W8W A;  1H8T C;  1O8S A;  2CYF A;  2ZX2 A;  3K77 A;  4HVR A;  5A3L A;  5IK4 A;  2QQN A;  4LKD A;  2Y38 A;  3JQX A;  1D0H A;  1ND2 A;  4AEJ A;  4O9G A;  3VBO C;  2H6B A;  2JG9 A;  5JDB A;  3OCP A;  4LBM A;  4WVM A;  2WFF 1;  1HJG A;  2VMG A;  1UZW A;  4L9B A;  1VPH A;  4LA2 A;  5LBC A;  4XEZ A;  3ZYR A;  4GZ9 A;  4CTE A;  1GZ9 A;  1YI7 A;  3SH3 A;  1W6N A;  4CCE A;  1OUR A;  2JKX A;  3S7E A;  4Q2F A;  2HWF 1;  5HCF A;  2OQ6 A;  3WUD A;  5C4W B;  2EVX A;  2EAA A;  1JBC A;  4AED B;  1JOB A;  3MF9 A;  1Z7S 2;  4AOC A;  3N7J A;  5GLW A;  1TMF 1;  4RR3 C;  5EYX A;  4CEY C;  3SKJ E;  3HPN A;  3VDD A;  4DIN B;  3ACG A;  3NAP C;  3KV9 A;  1JZ6 A;  1ZBA 3;  2RDQ A;  3AP6 A;  4YM2 A;  4V1P A;  1GYK A;  1K42 A;  4MVT A;  1COV 2;  1R08 3;  2CNA A;  4LIT A;  4WZC A;  5FZL A;  4HKL A;  5LK7 B;  1PIV 3;  1H1M A;  1OLR A;  2WJS A;  3MV1 1;  3VBH C;  4BLI A;  1OVS A;  2AEN A;  5DAB A;  1IS6 A;  1CES A;  3UT0 A;  1OH4 A;  3FHI B;  1OA3 A;  3USU B;  3LEG A;  4ZHN A;  4LK6 A;  2RR1 3;  5EP9 A;  1T2X A;  3PUS A;  4JDM A;  5JSR A;  4FFI A;  2CSG A;  1ZRI A;  2F17 A;  3OSD A;  1W06 A;  2C4X A;  2AUY A;  4X6R B;  4BPZ A;  1O3Q A;  2CV6 A;  3I3D A;  3I3B A;  3USS A;  3ITQ A;  3PTY A;  1J1T A;  1IHM A;  1XU1 A;  3ETQ A;  2RMU 1;  4Z82 A;  5F2W A;  4YZ1 A;  4LA3 A;  5FPA A;  5BNO B;  3J9S A;  5CKM A;  1K5M B;  4IGO A;  3PUH A;  4HG6 B;  2FCU A;  1AUY A;  4IV1 C;  4TYS A;  4BK5 A;  3K75 B;  3EYP A;  1BQP A;  1OF3 A;  4HFS A;  2AEY A;  2ARX A;  4MAD A;  4Y1U A;  5FY8 A;  5G04 L;  2QQV A;  5A7Q A;  1ZVF A;  4D6R A;  2BZD A;  3ZVX A;  1D4M 1;  1BZW A;  1ZBE 3;  1FV2 A;  4QPG A;  4RHV 1;  4QB1 A;  1RED A;  4JVA A;  3ZPY A;  1NLR A;  2J1A A;  4XIL A;  3I8T A;  4Q0S A;  2W3J A;  2VMI A;  2ATF A;  4PQQ A;  5FXV A;  5A70 A;  3D8C A;  1TVG A;  2XBO 2;  2MEV 3;  3ZFG B;  3ZPO A;  1LHV A;  4LK7 A;  4J1W A;  3WDX A;  1X33 A;  1QQP 2;  1UQX A;  4JZR A;  2W52 A;  4QHB A;  3CZJ A;  4R9B A;  5AVP A;  1QQP 3;  4XAB A;  3LCP A;  4GMP 0;  2J1T A;  1JW6 A;  1O4Z A;  5BYN A;  2WAO A;  2XJV A;  5ANN A;  1EPW A;  4Y1X A;  4FPF A;  1OKQ A;  5FXW A;  5GZF A;  2YC4 A;  3SCG A;  2PQS A;  4YVW C;  4JKL A;  1W8U A;  4IE6 A;  1LJ7 A;  1CON A;  4ISR A;  2W68 A;  3AYC A;  5FCC A;  4J1X A;  4UFK A;  3VBS C;  2A3W A;  1ULD A;  2ZEY A;  5J96 B;  4ZS2 A;  5L36 A;  1W0N A;  2VU9 A;  3B69 A;  5A3T A;  3I4I A;  5FP4 A;  4XUT A;  4M00 A;  4N53 B;  5FZD A;  3WQ0 A;  4Q0V A;  1NOV A;  2VMF A;  3RZJ A;  1K3I A;  4NPM A;  3ZMN A;  1WMD A;  4IND A;  3A21 A;  2Q8O A;  3SCF A;  4A45 A;  5CFC C;  1CR7 A;  2WUH A;  4N43 B;  4K3U A;  4FP3 A;  4XC9 A;  4HL0 A;  2X5I C;  2YYO A;  1VIW B;  3K4Z A;  3HQR A;  1V6O A;  5JPN B;  1XPW A;  3SH4 A;  4MLO A;  1I1E A;  2YBP A;  1YWK A;  2VQT A;  5FOJ B;  1VBE 3;  3IT8 A;  5EIY B;  1RJ7 A;  3HVD A;  5KHK A;  4CUG A;  3FN9 A;  3D82 A;  1EV1 2;  3JZV A;  3NRU A;  4XF4 A;  1IS5 A;  5IHR A;  4Q4Y 1;  3TYJ A;  5CG8 A;  2HWE 3;  4CDW B;  1VBC 3;  1KDK A;  1ULF A;  2XML A;  3QOP A;  1LOC A;  2WN2 A;  4L97 A;  5T52 A;  2NN8 A;  1IKQ A;  1ZZ9 A;  4KL1 A;  2VVD A;  3OYW B;  5E89 A;  1RTV A;  4WVZ A;  4MX3 A;  5GLT A;  4Q1P A;  4QX1 A;  5FPX A;  1GWM A;  2W0X A;  4J25 A;  4W8J A;  3ECQ A;  3NVC A;  2A5Z A;  1JZ7 A;  3MBW A;  1MZ6 A;  1AYN 1;  2V5D A;  3WDU A;  3ZDV A;  2Y60 A;  1YI9 A;  4ZXE A;  2H0V A;  2WWJ A;  1V70 A;  2F4L A;  5T50 A;  5IVC A;  2D40 A;  2AH2 A;  1VR3 A;  1HQW A;  1CAX A;  4AFC A;  3BIW E;  3FBM A;  5K0U B;  4M3C E;  1U5Z A;  5FMO S;  1UMI A;  3H7J A;  2VVE A;  1U5I A;  2DCY A;  4QPI A;  5CIS A;  3VZM A;  4MH0 E;  1HN0 A;  3SC7 X;  1ZRC A;  3B5L B;  5J3U A;  1Q8P A;  1KIT A;  4CP9 B;  4XW3 A;  5I93 A;  4L2N A;  2ZEZ A;  4XMI A;  1AL2 3;  3RZG A;  4HVQ A;  4TLF A;  2VW0 A;  3LE0 A;  4XAA A;  4D7S A;  1QU0 A;  2XXZ A;  1X8M A;  2ZGT A;  3MLK A;  1RHI 2;  1O3T A;  4CUA A;  4YSF A;  5H9R A;  4MSV A;  4WM8 A;  3AMN A;  4DO0 A;  3MPP G;  1MS8 A;  2YBS A;  4Q0P A;  4BLJ A;  4KQ7 A;  3TNQ A;  4D6Q A;  2RS3 1;  3JD7 3;  1QOT A;  3ACI A;  1W0O A;  4XUP A;  4UW4 A;  5HCH A;  2WO1 A;  3AMM A;  2FMY A;  3H3Z A;  5FFO C;  1C8M 1;  3ZYI B;  1OI6 A;  3DKW A;  4COW A;  1U5Y A;  4Y22 A;  4JQR A;  5DXD A;  1PZ9 A;  3P3P A;  4QHZ A;  4L0P A;  4CCM A;  2FCV A;  4DY5 A;  5FZG A;  1CZS A;  1V6I A;  1JYC A;  3LFI A;  4RGA A;  1LOD A;  1SLI A;  1CAW A;  2GND A;  4AAX A;  4XJZ A;  3WNL A;  3GCX A;  1I6X A;  3T30 A;  1NA1 A;  2GZW A;  1HRI 2;  4G3Y C;  3AZY A;  3O14 A;  3KCX A;  2Y6F A;  3HT1 A;  2JIC A;  1SPP A;  3RWN A;  3L9J T;  2QQI A;  4Z92 B;  3AYD A;  1QXP A;  2G9F A;  3WNO A;  1BBT 2;  2I74 A;  1AR8 3;  4FQ4 A;  5FZH A;  3GJB A;  2HKX A;  4RA0 A;  4ZKT B;  2RDR A;  3KGZ A;  5ANQ A;  5IVV A;  3KF5 A;  1J3Q A;  4MUV A;  5KC5 A;  5EJZ B;  1QJY 1;  2CHH A;  3EBR A;  4YVS C;  1HRV 2;  1MS1 A;  2D6M A;  1POV 1;  3FLT A;  3OGJ A;  1DQ0 A;  2OX0 A;  2B45 X;  2JDN A;  5F5Q A;  4A41 A;  5BNQ A;  1R64 A;  1RUE 3;  3NNF A;  2ZBJ A;  2BBV A;  4CCL A;  4MGT A;  3FE5 A;  4KG8 A;  2VEC A;  4NVP A;  3O0X A;  1LGB A;  2BFU L;  2UWB A;  4LXL A;  1OOP C;  3LWC A;  1CWP A;  1GUI A;  4HZF A;  1HXS 2;  2IC1 A;  2VE1 A;  3GYD A;  1HXS 3;  5KXC A;  1PVX A;  2GAL A;  2F4P A;  3QH7 A;  1NYW A;  4LO7 A;  1CQ9 A;  2UWC A;  3FC0 A;  3H7Y A;  5DUU A;  3TBD A;  3ZXD A;  3UNP A;  4LT5 A;  3WW4 A;  3PDQ A;  4Y5Z 0;  5FYM A;  5C5T A;  3GDB A;  4X8P A;  1QOS A;  4Q1R A;  1RUD 2;  5A32 A;  3AP9 A;  3HD8 B;  1DZR A;  2XQR A;  3KQ4 B;  1RUD 3;  4QD2 A;  1H8T A;  1AR7 1;  4NWW A;  4BOW A;  3OBA A;  5F2S A;  3ZYJ B;  1LNS A;  1QIQ A;  4N9H A;  1DF0 A;  5LAT A;  4BCU A;  4QDQ A;  2EIC A;  2P2K A;  3DPR C;  1VBB 1;  4GKY A;  5JSO A;  3PTR B;  2Y26 A;  3VBU B;  4YGD A;  3ZR5 A;  1PO2 3;  1NE4 A;  2ENR A;  1YQ2 A;  2YV8 A;  1EPZ A;  5IVB A;  4IEP A;  1VBA 1;  1W2A X;  3IIA A;  2VUA A;  1DHK B;  3DEC A;  1FAT A;  2XDV A;  4WZF A;  3KVB A;  4YZ3 A;  4P9G A;  5ACA 2;  2E32 A;  3OG2 A;  4QQO A;  3M70 A;  2A6X A;  1GWL A;  1GNH A;  5JR7 B;  1J3P A;  5B4N A;  2JDY A;  1RMU 3;  1US3 A;  3M4F A;  1GAN A;  3BOD A;  1SLL A;  5FQ0 A;  2RM2 3;  4LKE A;  4PLO A;  3POF A;  3HOB A;  4YW1 A;  1VRH 2;  3TN9 1;  1LHO A;  1ONA A;  1MQT A;  4UXA A;  1LOB A;  1VAL A;  2E33 A;  1OFS A;  2BER A;  4GB3 1;  4EN7 B;  3J7N A;  2P3K A;  3HBK A;  5ABJ C;  4CDQ B;  4Y20 A;  2WNU A;  5DG2 A;  3THP A;  1E5I A;  3KHB A;  3U4X A;  1LOF A;  4XFF A;  1ULE A;  4IW3 A;  4UI9 L;  4Q4W 2;  4XZU G;  3H1M A;  5C8C B;  4Q4W 3;  3M3E A;  1F35 A;  3T0A A;  3WG4 A;  4EYU A;  4IV3 B;  4QT6 A;  3K51 A;  4EWD A;  2VZ1 A;  3ZN6 A;  1TNR A;  3HR9 A;  3LF7 A;  3AZW A;  3AKT A;  5GJ6 A;  2QZ3 A;  1LHU A;  4XFI A;  3RS6 A;  3T2P A;  3U11 A;  4W65 A;  4XJ8 A;  2Y8K A;  1OSG A;  4LOR A;  1ND3 C;  4O7X A;  2WQZ C;  3MIH A;  2ARA A;  3VBR C;  4DS0 A;  3J8F 2;  1RUH 2;  3WLU A;  1RIN A;  3KSC A;  1D4M 2;  5FP8 A;  4CCO A;  1IG0 A;  1RUJ 2;  4JAA A;  1OUS A;  4COU A;  3CMG A;  3LPG A;  1NCR B;  3WDV A;  4YW7 A;  1OQ1 A;  4PDW B;  1IPK A;  1YIP A;  1Z0H A;  1QDO A;  5JOX A;  3H8O A;  3C3V A;  4Q4X 2;  4XFH A;  3VN4 A;  1G9F A;  3DYP A;  4Q4X 3;  3BOP A;  2J1R A;  3B7M A;  1ND2 C;  2Y34 A;  4LLF A;  1ENS A;  3EJK A;  4CXX A;  2JG9 C;  1JYT A;  5G05 L;  3AMQ A;  1W6M B;  3K3N A;  2OZJ A;  4WM7 A;  4JDO A;  5ERL A;  1QNW A;  4FPH A;  3ZOI A;  2JDZ A;  4KWL A;  4CCK A;  4LUK A;  4EZH A;  4DY3 A;  1FNY A;  1OBN A;  2BDR A;  3BPS A;  4LO5 B;  4AVV A;  1ZNP A;  3BUC A;  1R09 2;  1Z7S 1;  2AC1 A;  4YGC A;  4BME A;  5K4L A;  5I0S A;  3BYW A;  5FK7 A;  4MOA A;  2CGN A;  4AW7 A;  1WBF A;  5JXI A;  4ET7 A;  2YDE A;  4GJY A;  1OFN A;  2ZXQ A;  1KS5 A;  1Q3E A;  2PAM A;  1UIK A;  2WDB A;  2OUH A;  2XB6 C;  5JIA A;  3VDD C;  3ZFE A;  3ZR6 A;  1DGL A;  5SV5 A;  1COV 1;  1PIV 1;  3WNK A;  4TZD A;  3E97 A;  3WD5 A;  4I2O A;  5KC6 A;  3RYP A;  3E5U A;  5D8A A;  3WF0 A;  4GXL A;  1L7Q A;  3NKG A;  1UU6 A;  1PMH X;  5FRE A;  1BLZ A;  3V0B A;  2A7A A;  5FUN A;  2BUK A;  3FFQ A;  3T08 A;  1V9U 2;  1IPS A;  4MGI E;  5L9R A;  1YFX A;  1CZV A;  2HLE A;  2DVB A;  1V6K A;  1G6N A;  1H0B A;  1HB2 A;  2GP3 A;  5FZO A;  1FX5 A;  3VZJ A;  4QKD A;  4M0N A;  2JE7 A;  5JXJ A;  1JYV A;  1MS5 A;  2G19 A;  4Q4Y 2;  1UZZ A;  4Q8K A;  1KD7 A;  1MZ5 A;  4Z8B A;  1JU3 A;  4ES8 A;  2AYH A;  3N36 A;  3WG1 A;  3POI A;  1W39 A;  4IE4 A;  4BQ5 A;  1S0E A;  1STM A;  4BWO A;  3H8X A;  3L2Y A;  4ZY9 A;  1QJU 2;  2RV9 A;  5DQ0 A;  3J7M A;  4TXW A;  1C57 A;  3A23 A;  1RUI 3;  4XFA A;  3MIF A;  5EJ3 A;  1Z78 A;  2LTN A;  1YQC A;  5A3O A;  3N7K A;  3QCW A;  4LNV A;  2GU9 A;  5H9Q A;  1P8J A;  1RVF 3;  4W6X A;  3WW2 A;  3ZSE A;  4HLT A;  4FOV A;  5F1R A;  5I91 A;  1MR5 A;  2CGO A;  2JE8 A;  3M1H A;  1N1T A;  2A73 B;  2XBO 1;  3KVA A;  3ZXK A;  4CDX B;  2D6P A;  3EHK A;  4AHY A;  2DFB A;  2Q8E A;  4ZZ8 A;  1UU5 A;  4MXW B;  1ENX A;  1QQP 1;  4RS5 B;  3CIH A;  3N9O A;  2GC2 A;  3LDB A;  4AFA A;  3N9N A;  1OT5 A;  1A8M A;  4PBP A;  1UXZ A;  5A6Q A;  1YUD A;  3Q8A A;  2AEZ A;  3PJY A;  1O3S A;  1WCD J;  5CVR A;  4GWN A;  2OT7 A;  1W6O A;  3HNY M;  3C7H A;  5FKC A;  2BGC A;  2OUJ A;  1H4H A;  2O0O A;  1RJ8 A;  1XBF A;  3VBF B;  1ZZB A;  2LRP A;  5C9A B;  4M0H A;  2XR4 A;  1MVQ A;  2XL7 A;  2OW4 A;  2WLQ A;  2WN3 A;  3MLJ A;  1F9K A;  1VB2 A;  4DXZ A;  4IGP A;  1CPN A;  3SH5 A;  4L11 A;  1W8H A;  4F7Z A;  4CU9 A;  1UY3 A;  3AP5 A;  2RDN A;  3IDB B;  1WGP A;  2GDF A;  3E5X A;  4OI0 A;  4N9I A;  3ZMO A;  1XSQ A;  1HV0 A;  4OI4 A;  2VOK A;  1LOA A;  1WMX A;  2D5H A;  2YMZ A;  3K46 A;  3IMM A;  1A6C A;  1FMD 3;  3OTF A;  4LE4 A;  2X29 A;  5KXE A;  2Q1Z B;  1J84 A;  3PL0 A;  1Y43 B;  2VME A;  4LTA A;  1MZE A;  5F3I A;  2RHP A;  2VGD A;  3CHX A;  3HN3 A;  4RSU A;  2OKX A;  2HJI A;  4L92 A;  5C4W A;  2WZR 2;  2FDK A;  1JU4 A;  5GLZ A;  1ZRR A;  2WFP A;  1ULO A;  2YRO A;  4JHZ A;  4NOT A;  5DG1 A;  1G9D A;  1EV1 1;  1VMH A;  1DCS A;  2HWE 1;  5JVV A;  2C26 A;  4FAG A;  4COY A;  5JI9 A;  1ZYB A;  1J59 A;  4A4A A;  1LU1 A;  4IET A;  5FYB A;  4BHP A;  1GBG A;  3KF3 A;  5IT6 A;  1MEC 3;  2VD7 A;  3FLP A;  2QQJ A;  1L3J A;  3CL1 A;  2WLP A;  4PF1 A;  1IG3 A;  2ADD A;  5EXO A;  4BQX A;  4FT8 A;  4Z2W A;  5TSW A;  3IDC B;  4A2U A;  4CCJ A;  2WA4 A;  4CCD A;  2WYF A;  2VUD A;  4H3W A;  2W1Q A;  2AZ5 A;  2DTW A;  1LEN A;  4LQR A;  2O8O A;  5IAV A;  3ZXA C;  4E2Q A;  3IKW A;  4BH9 A;  2PHT A;  4BQ4 A;  3SIS A;  4XIO A;  1SLB A;  2IXK A;  3USU A;  4AFM A;  1C1L A;  4AVB A;  2RS5 2;  4XJW A;  2RS5 3;  2GSY A;  5F6K A;  3MV0 1;  1TME 3;  1WME A;  4CZS A;  5T3N A;  1JYN A;  5LWB A;  3E6C C;  4EN6 B;  1E5S A;  2X09 A;  3DXU A;  3HAG A;  5I0U A;  1GR3 A;  3C7F A;  4KMQ A;  4BQW A;  3RMX A;  2JE9 A;  2DVG A;  4Y26 A;  4QPI C;  3KLS A;  4KGG A;  3FFZ A;  4B7K A;  5BNO A;  4OHW A;  1K5M A;  1MVE A;  1I3H A;  2YFZ A;  3OUH A;  1AR7 2;  2Z79 A;  3KGL A;  2J1E A;  2NZ9 A;  2R7E B;  3CJI B;  1JHJ A;  4NRM A;  4XJU A;  4OLL A;  5FZ0 A;  3VZK A;  2C1F A;  5IJR A;  2QUO A;  1PK6 B;  1RUN A;  1KRI A;  1RHI 1;  1S2E A;  1YQ5 A;  3Q9O A;  1VBD 3;  4DXR A;  2PAE A;  5F6L B;  3LA7 A;  3ILF A;  3A7Q A;  5CG9 A;  2WS9 2;  2XQX A;  3N35 A;  4XAE A;  1GP4 A;  2WS9 3;  3FJS A;  4I09 A;  2PA7 A;  4P00 B;  1QH6 A;  4WM8 C;  1W2U A;  3ZFG A;  4Z07 A;  5KHJ A;  5FZE A;  2R1B A;  1GQP A;  2YGL A;  1LES A;  3H9A A;  1NXM A;  2TBV A;  2VZO A;  4UBH A;  4X8N A;  3VKL A;  2DCJ A;  5IFT A;  5A6Z A;  1URX A;  2A3X A;  1JZ5 A;  3AZV A;  2BJS A;  5I8S A;  3U1X A;  2ZML A;  3WSO A;  3ME2 A;  3WP3 A;  3O5S A;  1KQR A;  2E9Q A;  2QJV A;  1HRI 1;  3PVB B;  2BU9 A;  3VZL A;  3ZYF A;  2P5B A;  1NA1 C;  3WHT A;  3ZXF A;  4YW6 A;  3I54 A;  1H9P A;  3MHZ A;  4GUL A;  5FLH A;  5FZ8 A;  3ST7 A;  1XYP A;  2Z5W A;  3OPZ A;  3O0V A;  4N53 A;  2DUQ A;  4RL7 A;  3VB9 A;  1UOJ A;  2GH8 A;  4CU6 A;  1LGC A;  3GBW A;  4M4P A;  1BBT 1;  1XB9 A;  2WKK A;  3JQW A;  2Y6K A;  1NQD A;  3RJ2 X;  3SMH A;  3VHP A;  4CU8 A;  3FX3 A;  5FY0 A;  4BZ4 A;  2BNO A;  2VBD A;  3GM8 A;  2C5D A;  1LTE A;  4CP0 A;  1JYW A;  4UWD A;  2ZA9 A;  3C7G A;  3CNA A;  2GN7 A;  4XJA A;  3S5Q A;  3LDR A;  1VB4 A;  2JX9 A;  2P17 A;  5T5O A;  2B42 B;  1HRV 1;  3AB0 A;  2DVF A;  4LBQ B;  4MZU A;  5GZG A;  1VMF A;  2HWC 3;  1RUE 1;  3O0W A;  5A7W B;  3RYK A;  3WUC A;  2WSU A;  4EV0 A;  2R07 2;  3IPV B;  1FOD 3;  5M0T A;  2XON A;  2R07 3;  3FMG A;  3LSE A;  5F9T A;  3POJ A;  1UKG A;  4BJ0 A;  2EIG A;  5FO9 B;  1XQN A;  3CQO A;  3D0J A;  1JN2 P;  2QTW B;  2QVS B;  3B01 A;  3I2F A;  3I2G A;  2Q0A A;  5DAX A;  1HXS 1;  4Y5S A;  5D1I A;  2VVF A;  5FZF A;  3THT A;  3T2Q A;  4CDW A;  1DGR A;  3VHN A;  1UYZ A;  1SLA A;  3HJR A;  3POS A;  4BM8 A;  4EN9 B;  3J4U H;  2JB8 A;  1OA2 A;  2B39 A;  3WP6 A;  1H2N A;  1XNA A;  2MHF A;  1RUG 2;  1MS3 A;  1UPI A;  2R1D A;  3OYW A;  4BK4 A;  1Y9Q A;  4AQS A;  4D94 A;  1RUD 1;  2VH9 A;  3HNB M;  2PHL A;  1LEM A;  3POW A;  3J7H A;  3ZX7 A;  2BOJ A;  1BMV 2;  4IES A;  4QAW A;  4XQ4 A;  2VMC A;  1GNY A;  1C4R A;  1MZF A;  3GHN A;  1E5H A;  3H3U A;  4LBO A;  3U0Z A;  2WWU A;  4PI2 A;  1UZ0 A;  3LB9 A;  3ORJ A;  2P3I A;  4P9I A;  2ZZJ A;  2QCS B;  3POB A;  1FNZ A;  5FZ9 A;  4FVV A;  1NZI A;  1W8O A;  1AXK A;  2D5F A;  5CNA A;  2CDP A;  5F5I A;  4DZG A;  4H14 A;  1YHF A;  4R8H A;  2QZ2 A;  5FYV A;  1CAV B;  1EAH 2;  5H9P A;  1FT9 A;  3VDA A;  5DDJ 3;  1UOB A;  1EAH 3;  1W6Q B;  2VUC A;  4C1W A;  3Q8F A;  4Y33 A;  3ASI A;  3IBM A;  3M3C A;  2FDH A;  5ACA 1;  1E57 A;  4XUO A;  3RGB A;  3W5N A;  1TEI A;  1ZBA 2;  3GZT B;  4MV2 A;  1VRH 1;  3KMH A;  3QLQ A;  1R08 2;  5K8S A;  1DIW A;  1PIV 2;  1MQT C;  2X53 S;  2NYY A;  3AJZ A;  4NHL A;  4GH4 C;  4HPK A;  2GP5 A;  4M3C B;  4MGZ E;  2WAB A;  5DAW A;  2ZZQ A;  4HON A;  3WHU A;  1BVV A;  4ES9 A;  5HPO A;  4C90 A;  3TB0 A;  2WNU C;  1JHN A;  2FZ2 A;  1OQD A;  1LR5 A;  2RR1 2;  4OHX A;  4Q4W 1;  1LOF C;  2A6Z A;  5DUV A;  5A6X A;  2ARE A;  1O59 A;  5DN2 A;  4AI1 A;  4Q8L A;  4UYB A;  2PHX A;  1L7L A;  4CYD A;  5FWE A;  2UYA A;  3ZDS A;  1NQJ A;  3UGG A;  5E6H A;  1DQ1 A;  5FBZ A;  2FMD A;  5KXD A;  2R0F A;  1HB4 A;  2BWC A;  5FXX A;  1DGR N;  1SFN A;  4KU7 A;  4ZXK A;  1NLQ A;  1S4C A;  2GAU A;  5C3P A;  2ZKN A;  1W9T A;  1ENR A;  2OYZ A;  5KHH A;  4K1Z A;  5JSP A;  1OQE A;  4NR1 A;  1KJR A;  3E5Q A;  5LA2 A;  3OUJ A;  5T5J A;  2V4A A;  3J8F 1;  1OLQ A;  1RUH 1;  2WC2 A;  1ZBE 2;  3V0A B;  2UU8 A;  1I5P A;  1H9W A;  5A6Y A;  1RUC 2;  3T0D A;  1BHG A;  3OD4 A;  4UT5 A;  1QWR A;  3GZA A;  1RUJ 1;  1RUC 3;  2ET1 A;  3KZ4 C;  4XF3 A;  5A33 B;  2JG8 A;  2VOT A;  2MEV 2;  5FP3 A;  5IW0 A;  4LE3 A;  4EJR A;  3T3Y A;  2JEM A;  4R9C A;  3RZK A;  1F5F A;  4Q4V 3;  1OXC A;  2RDS A;  1SEF A;  4Q4X 1;  2BW8 A;  4XBL A;  4D8M A;  3KQR A;  1K45 A;  2V09 A;  4HN0 A;  5FTT C;  2VW2 A;  4KWJ A;  4LBQ D;  4RGG A;  1R1A 3;  5FV3 A;  5GZD A;  3SLI A;  3S57 A;  4JC1 A;  4OZX A;  1YIF A;  2ILM A;  4K8R B;  3T2T A;  4MG2 A;  4XF0 A;  2YB7 A;  4CUC A;  3U37 A;  3U4S A;  1V6M A;  2ZEW A;  4WM7 C;  2BYV E;  1TE1 B;  2ZCW A;  2YZ4 A;  1AVB A;  1V00 A;  3B9I A;  4GA9 A;  4C91 A;  3P3N A;  1SAC A;  3ETP A;  1ASJ 3;  1R09 1;  3OPT A;  1NX9 A;  4AHX A;  5KR7 A;  5HCB A;  3F95 A;  1REF A;  2RG4 A;  2LUW A;  2W46 A;  1C8N A;  4LPL A;  4PIZ A;  1YQ6 A;  2B5H A;  2J1U A;  4RQP B;  2J1V A;  1JYI A;  2P6H A;  5FIX A;  3RWK X;  5LEK A;  4Y1Y A;  3ZFE C;  3JBG 3;  1CD3 G;  4RD7 A;  5J37 A;  1NY7 2;  5LCW L;  2AAC A;  2W1U A;  2D3R A;  4JQT A;  5JMO A;  5D8A C;  4A6S A;  5IAT A;  4NHX A;  4I01 A;  1V9U 1;  2VNV A;  1VBE 2;  4W4Z A;  3K48 A;  1CGP A;  4OHY A;  3FLR A;  4EQV A;  3LKJ A;  4NHM A;  3KCY A;  4DMI A;  1CJD A;  2HWE 2;  5ABJ B;  1VBC 2;  2IFW A;  2QFE A;  1S0D A;  5FYT A;  2CWM A;  3JXS A;  3PVN A;  4HET A;  4LEJ A;  1S0C A;  5B4X A;  3I2K A;  1G86 A;  2A6Y A;  1QJZ A;  2PAK A;  2VNG A;  4AHZ A;  4GQ7 A;  1RL3 A;  1H8V A;  1SZB A;  1QJU 1;  1RUI 1;  2ZAC A;  2NMN A;  3AZZ A;  4QQH A;  5SV8 A;  4L8Q A;  3PU8 A;  4QX2 A;  4GD4 A;  4PCR A;  4CDQ A;  4MGQ A;  1S0G A;  4E27 A;  2EXK A;  1LED A;  1RVF 1;  4H55 A;  3UKT A;  3B02 A;  1ZA4 A;  2VBP A;  3ZFF B;  3T0B A;  3MIG A;  5C8C A;  4LHS A;  3ACF A;  3Q8C A;  5C8W A;  2GME A;  4IE0 A;  1UX6 A;  3I3M A;  1KXG A;  4IV3 A;  3ATG A;  3LA2 A;  3BN6 A;  3WDT A;  3VKM A;  1BXH A;  1B35 B;  2KD7 A;  3VV1 A;  4N8M A;  3HNM A;  3RG0 A;  5FP9 A;  4UW3 A;  3W58 A;  3ZYP A;  3BKZ A;  1SCS A;  1W2N A;  3T1M A;  4QHO A;  1QJE A;  2PLV 2;  1BK0 A;  3NJX A;  3BPZ A;  5FYU A;  1AL2 2;  1NAE A;  2PLV 3;  1AR6 3;  3NQH A;  3IM0 A;  5BV6 A;  2J7M A;  1DYO A;  2ZGM A;  5A1A A;  2DBN A;  1VAM A;  4AGG A;  2LAL A;  4TN7 A;  2ADE A;  2ZX0 A;  3WEZ A;  1NCQ B;  1DU3 D;  1QNY A;  3CKH A;  4KI5 M;  3MUY 1;  2NLR A;  3ZLI A;  5A1F A;  2HYX A;  3MW4 A;  1WD4 A;  3UKV A;  5JMC A;  1NCR A;  2OQ7 A;  3AKP A;  4FFH A;  4LBN A;  2VL4 A;  4IQP A;  2Z69 A;  2HWD 3;  2WT2 A;  5FOB B;  3VKO A;  4PDW A;  4SBV A;  3S5A A;  2VO5 A;  3JD7 2;  4H7L A;  2V5Y A;  5JXH A;  4TSV A;  5LBB A;  3WF1 A;  1HKD A;  5KXB A;  1C28 A;  4AGV A;  3DEM A;  3T2O A;  2VTF A;  5FMO L;  1W0P A;  1C3H A;  2R04 3;  1W6M A;  3G7D A;  1S0J A;  5J09 A;  1M4W A;  3ON7 A;  5IVE A;  1G9C A;  4A7Z A;  3OGG A;  4ATE A;  2QQM A;  4NJ4 A;  1RUF 3;  1RYY A;  4A6O A;  1I5Z A;  2IXI A;  2WZR 1;  1ULC A;  2YG0 A;  5C4W C;  2VOX A;  4AED C;  3UV9 A;  5IK8 A;  2XJS A;  2XJT A;  4FOY A;  2DWR A;  3BVC A;  2OZ6 A;  2JWP A;  1H4G A;  2ZGL A;  5FWJ A;  5JCT A;  1AR8 2;  3E6D A;  2X8K A;  1LAJ A;  2ID4 A;  2RE9 A;  2VCC A;  3SEP A;  1X50 A;  1RXF A;  1ZZ6 A;  4I0W B;  1O5L A;  1W3V A;  4OUS A;  2GC1 A;  4XXP A;  4ZS3 A;  1VP6 A;  4FPL A;  4OI2 A;  5DAV A;  1DGW A;  2BFU S;  1Y9G A;  3ZYB A;  3LQC A;  4Y4Y A;  5FXZ A;  3AKR A;  1PNG A;  1W8Z A;  1RUE 2;  1PM7 A;  1BEV 3;  4QKF A;  5JAX A;  4LKS A;  4QB6 A;  1M06 G;  3ABZ A;  2BBA A;  1H1I A;  1DDL A;  4JX0 A;  1W03 A;  2RS5 1;  3GJA A;  4XFG A;  1G9A A;  1NLS A;  2VCM A;  2VBB A;  5L7O B;  2BTV C;  5DMY A;  4LBL A;  5FYZ A;  5I0T A;  3PVE A;  4GWI A;  4V2V A;  5FLJ A;  2KR2 A;  1IZ3 A;  5I8T A;  3AVS A;  3S7I A;  3NO8 A;  4QPG B;  2DDU A;  3CEW A;  4K20 A;  1JZ2 A;  3CBN A;  3VD7 A;  1V6N A;  4LIU A;  5BNO C;  2WNV B;  4NUB A;  3K4A A;  4E4S A;  1K5M C;  1PVC 2;  2I07 B;  4P08 A;  1KDM A;  2GC3 A;  3GF6 A;  1PVC 3;  2JXA A;  1OVP A;  1WMF A;  1UKR A;  4HK8 A;  4OUM A;  5JZG B;  4NIG A;  4XYX A;  3W20 A;  1QJF A;  4AYU A;  3W5M A;  2Q30 A;  2WS9 1;  4AHW A;  5CA6 A;  4MO3 M;  4CDX A;  1O8P A;  1PO2 2;  1SBF A;  1F2N A;  1HN1 A;  3QD6 A;  2WQ8 A;  2D93 A;  2VZT A;  2UY9 A;  3B3Q E;  4MXW A;  4O9E A;  3UET A;  3ZFG C;  4AZZ A;  1HX6 A;  4RS5 A;  3FBY A;  4QKB A;  4XUR A;  5LRS A;  1X82 A;  3DYO A;  2HBT A;  1ZRD A;  1DBN A;  2VJX A;  1GP5 A;  1F5J A;  2E51 A;  3WXP A;  4JGY B;  1REE A;  1UMZ A;  4HSJ A;  5BNP B;  1SFY A;  1N3P A;  1OUX A;  1RMU 2;  1SLT A;  2RJ2 A;  2HBU A;  3ELN A;  4JGZ B;  3WCR A;  2W92 A;  3EO6 A;  4S2D A;  5FMD A;  2WT1 A;  1YCI A;  2RM2 2;  1CJP A;  3A4U A;  4FPG A;  4XE9 A;  5LRR A;  3BTZ A;  4DNY A;  4QU1 A;  1YRZ A;  2ZPX A;  2VCA A;  3VBF A;  3O1M A;  5C9A A;  1SG3 A;  2CU5 A;  4AXO A;  4E2G A;  2CGP A;  3NNM A;  2VG9 A;  4GH4 A;  5EJ1 B;  4NHY A;  1NE6 A;  4N53 C;  4XF9 A;  4Y3O A;  4HOO A;  3ES4 A;  4OCT A;  2BRT A;  1O5U A;  3BAL A;  3MDP A;  5I0R A;  4OFG A;  1HDK A;  2GN3 A;  2HWF 3;  3U10 A;  5L9V A;  5CIR A;  4N43 C;  4FPO B;  1OH3 A;  2XGX A;  5BNN A;  4AG4 A;  4MHU A;  2FZ1 A;  4F3J A;  2O14 A;  1JMU B;  4PIX A;  3O1T A;  1XC6 A;  3AVR A;  1XJA A;  2RJK A;  3V65 A;  2R07 1;  3DL3 A;  4BXF A;  1QEX A;  4FTE A;  3DKQ A;  3FZ3 A;  4Q26 A;  4GJZ A;  5CFD B;  1QH7 A;  4V2W A;  5CB7 A;  3VZN A;  2UY8 A;  2WNE A;  4CEW B;  4F83 A;  1CX1 A;  1EP0 A;  2R06 3;  2G1M A;  3MFC A;  3T1L A;  1H6X A;  3MIB A;  1N1Y A;  4OMD A;  4IE5 A;  3SNM A;  3VD4 A;  1ZA7 A;  2WO3 A;  3DYM A;  4WVW A;  3RZM A;  1LHW A;  2ZHM A;  1XND A;  4CDW C;  4NPL A;  1OLM A;  1V0A A;  3O12 A;  3BB6 A;  2Q1M A;  3I2D A;  2DFC A;  2WWS A;  1D2Q A;  2HH9 A;  1RUG 1;  3LZZ A;  4XVH A;  4CDU B;  4ZPI A;  1T6G C;  2D97 A;  1UU4 A;  4LMF A;  5AC9 2;  3KB5 A;  1PMI A;  4LBJ A;  4UF0 B;  3CO2 A;  4YW3 A;  4AQT A;  5AC9 3;  5DZG A;  3ACH A;  5FYC A;  2J42 A;  3QBQ A;  3CZU A;  3N7L A;  3PU3 A;  4E8D A;  1BMV 1;  5HV0 A;  3M8L A;  5JR2 A;  2ZGN A;  3LEK A;  4K21 A;  3DXT A;  3ZIX A;  1WW4 A;  3LFM A;  4MGK E;  5A1L A;  1W99 A;  2XJP A;  3SCH A;  4OQ9 A;  3ZXE A;  3GAL A;  2RMU 3;  5FPL A;  2HWB 3;  1PGW 2;  3M3I A;  3NV3 A;  5FZ7 A;  2ERF A;  1XNT A;  4NAO A;  1ULG A;  1EAH 1;  1LUL A;  3ZSK A;  3BTX A;  4WV8 A;  3ROU A;  5E8A A;  2ZHL A;  2ORX A;  4PT6 A;  2BNM A;  3CF6 E;  1OMI A;  4A3Z A;  4YG0 A;  1GNZ A;  4FPJ A;  4QKN A;  1UO9 A;  2Y33 A;  4YM1 A;  2YBK A;  3RJR A;  5I0D A;  4MHR A;  3T4H B;  2PFW A;  2ZX4 A;  3CJI A;  1ZBA 1;  2WO7 A;  3WCS A;  1PK6 A;  3B93 A;  3O1S A;  3ENR A;  5FYI A;  3HIF A;  1R08 1;  2C0Z A;  3NNG A;  3WNM A;  1PHM A;  3BIE A;  1YNA A;  4ARX A;  1VAK A;  4I3G A;  1Q8S A;  3SIT A;  5F37 A;  5FK8 A;  5HV4 A;  2VZQ A;  5FYY A;  1HLC A;  1SQ4 A;  2RR1 1;  5LW9 A;  2WQ4 A;  4IEW A;  4Y1V A;  1Y3T A;  4CP1 A;  2MPF A;  4P14 A;  2Q4S A;  5IAX A;  3SEE A;  1K5J A;  1XNB A;  3LAG A;  4XUQ A;  5FPV A;  5LAS A;  4YFZ A;  2VOW A;  2W94 A;  1QHD A;  2G9G A;  2YXS A;  2D6N A;  3I7D A;  1N3Q A;  5BXX A;  3EQE A;  3ILR A;  2TEP A;  5T5L A;  4CE8 A;  1NZC A;  4F8A A;  1FPN 3;  1XNK A;  4UFJ A;  1AJK A;  4NRP A;  2DUP A;  4J6G A;  1WD3 A;  5JIU A;  4FOQ A;  1RUI 2;  2EAL A;  1PX4 A;  3E6B A;  3LPF A;  4IER A;  4CVU A;  1QGL A;  1RVF 2;  1WLD A;  1ZBE 1;  3AKQ A;  5IK5 A;  3K4D A;  2YGM A;  3CJX A;  3LA3 A;  1RUC 1;  4DXS A;  4XAC A;  2WZE A;  4LBQ A;  2X05 A;  2ZGK A;  4ERO A;  2XH6 A;  3URF A;  1W9W A;  3WR0 A;  5IVF A;  1WWY A;  1YYN A;  2MEV 1;  5A7W A;  1GLH A;  2JG8 C;  3WW3 A;  4CP2 A;  1MS0 A;  4NAM A;  3IPV A;  3GBF A;  4Y4R A;  5JWP A;  2PHD A;  3N7M A;  3M3O A;  5AFE A;  3FUO A;  1W05 A;  2VZS A;  3KS7 A;  1JI6 A;  3FL7 A;  4BA6 A;  5KBF A;  5LA1 A;  1R1A 1;  2Y0I A;  1YC6 1;  4LHL A;  3D6E A;  3MLL A;  3VD3 A;  2WA3 A;  3AK0 A;  1H8T B;  2DU0 A;  1AR9 2;  4YPJ A;  2XPJ A;  1HW5 A;  1AR9 3;  1O6U A;  2QQP A;  4RFR B;  2W87 A;  3OY8 B;  2NQY A;  5C6C A;  3EB7 A;  5FZ4 A;  1Q56 A;  3VBO B;  2VOV A;  2XJR A;  5EFU A;  4C8D A;  4UBG A;  1DLC A;  2Q5T A;  4GAL A;  1RC6 A;  1PGS A;  1NG0 A;  1NXD 1;  4OUL A;  3ILN A;  1WUV A;  2V73 A;  4QMA A;  5FUP A;  3KWV A;  3LEI A;  4MYE A;  4UW6 A;  4A42 A;  3ES1 A;  2IWG B;  4JTN A;  4RYD A;  4URT A;  4IEQ A;  2BP6 A;  1X9T A;  1NY7 1;  2LS6 A;  1JOD A;  3VBU C;  2BV4 A;  3OBT A;  5CU1 A;  2ZGQ A;  4B1M A;  1FMD 2;  2IZW A;  5DUW A;  1X36 A;  1A8D A;  4RR3 B;  4CEY B;  1IQA A;  2DCZ A;  2W91 A;  4LLO A;  2G4I A;  4SLI A;  5C3Q A;  3NAP B;  2B9U A;  1RXG A;  4XPV A;  2FDG A;  4AR2 A;  1VBE 1;  3VGI A;  3I2H A;  4H2A A;  2QDN A;  1AYM 2;  4YRD A;  1YFU A;  4HKW A;  4AED A;  1AYM 3;  1W3X A;  5J98 B;  3VBH B;  2PMW B;  1VBC 1;  1F4A A;  4JKM A;  4DFS A;  4CPB D;  2P3Y A;  4YM3 A;  2EXJ A;  3OPW A;  2DBI A;  3VKF C;  1MEC 2;  2RS3 3;  5F3E A;  2ZAA A;  4JRA A;  2J22 A;  3K3O A;  2ORZ A;  1C8M 3;  3U07 A;  1OD3 A;  3J7L A;  1SCR A;  1UF2 C;  2OVU A;  4KBZ A;  3WQ7 A;  3DUI A;  1ZRF A;  2PHU A;  1GOG A;  3PNA A;  4M3C A;  5FY1 A;  3ZN5 A;  2VPV A;  4YGB A;  1JYX A;  1J3R A;  3ZM8 A;  1JUH A;  4CDQ C;  3DF0 A;  2WAA A;  1GOH A;  2JKB A;  2VR4 A;  2IXJ A;  3KCC A;  3NV2 A;  4UAP A;  3WDW A;  4EWE A;  1TME 2;  2GNB A;  5FJK A;  5C8C C;  2D3S A;  4IV1 B;  4IDZ A;  2ZEX A;  4XHB A;  1OPM A;  5IVY A;  2XWB B;  4I0A A;  4IV3 C;  1IGO A;  4QPW A;  1QJX 3;  3R4S A;  4NRO A;  2WNO A;  5C3R A;  3EMR A;  4XDO A;  3AYA A;  1O3R A;  2FD8 A;  2PLV 1;  1CPM A;  2FDJ A;  1QJY 3;  2RVA A;  1WW5 A;  2XG3 A;  1AL2 1;  1PO1 2;  3C2U A;  4UFH A;  1DQ2 A;  1PO1 3;  3ZYG A;  1JZ4 A;  2PHR A;  2HEY F;  2B46 X;  2DV9 A;  4AVA A;  3V0A A;  2ZMN A;  1B09 A;  2GC0 A;  4U2A A;  1S55 A;  2RJL A;  1BKZ A;  4AL9 A;  1VBD 2;  3OOX A;  1V6L A;  5A7O A;  4M01 A;  5A33 A;  5FAX A;  1NT0 A;  3O1R A;  2H0B A;  4Q0Q A;  4IEO A;  1NCR C;  4YVW B;  5JPM B;  2ZX3 A;  3JD7 1;  4PDW C;  5FY4 A;  4D6S A;  3VBS B;  1GOF A;  3LIG A;  2ZS6 B;  3MF6 A;  2A75 A;  4IEY A;  3B9C A;  1ENQ A;  1SBE A;  2GH2 A;  3O1V A;  1UY0 A;  2VCB A;  3CLP A;  1K12 A;  2A6V A;  2Y6J A;  5C5U A;  2LW8 A;  1RGS A;  4FXG B;  4FO9 A;  1JOJ A;  5ISL A;  3AXE A;  5CFC B;  2EF6 A;  1DQ6 A;  2VZU A;  5LA9 A;  1H30 A;  3KV6 A;  1C1F A;  1CIY A;  2ES3 A;  1VBB 3;  2VTX J;  2X5I B;  2YHJ A;  4P9Y A;  1AR8 1;  5FJH A;  5T5P A;  5FR3 A;  2W47 A;  1VBA 3;  4IGQ A;  4DUV A;  3LD8 A;  3OUI A;  4RQP A;  4ZZ5 A;  3HQX A;  4OYU A;  2C24 A;  3K2O A;  1WA4 A;  1BK1 A;  4HAN A;  4N43 A;  5D2A A;  5F32 A;  5FZB A;  3VHO A;  3WOG A;  3KHC A;  5T55 A;  3BU0 A;  3O1O A;  2HWC 2;  1BEV 1;  1D7P M;  1W2T A;  4NE9 A;  2OS2 A;  5FPB A;  4B29 A;  1SFP A;  2D6O X;  3AFK A;  3VKN A;  1W6P B;  4S2H A;  1FOD 2;  4BQY A;  1LOG A;  2VM9 A;  3J26 N;  2BPA 2;  3I59 B;  4KWU A;  1SBD A;  1XRU A;  4AVC A;  2E7A A;  1D0G A;  1UY2 A;  3WIN E;  5LEJ A;  4C0H A;  5E88 A;  3TN9 3;  4JDN A;  4Z1V A;  2P3J A;  3T4V A;  2A71 A;  1QXR A;  2EXI A;  2B8M A;  4AVT A;  1XU2 A;  1HIX A;  2UYB A;  1DG6 A;  2ZMK A;  3THD A;  2ZGU A;  4E4D X;  2VW1 A;  4N7U A;  1UOF A;  1HJF A;  1IPJ A;  1VJ2 A;  3APB A;  4CCC A;  4ONU A;  4H7M A;  3RMY A;  5LY2 A;  1JOP A;  3O7O A;  1F8V A;  4Q27 A;  5LBF A;  1UD1 A;  5FKB A;  2XL9 A;  5T54 A;  1MS4 A;  5HBA A;  3WNX A;  3B94 A;  4DRV A;  4LUL A;  1PVC 1;  3I2J A;  2XJU A;  4R9D A;  1DFQ A;  3IAP A;  3VL8 A;  1MAC A;  2ZGS A;  2R0H A;  3TNP B;  3W9A A;  4HXC A;  5K7P A;  1W28 A;  3PMS A;  3MO4 A;  3WQ1 A;  3ZFF A;  2Y6H A;  4XCA A;  4CXY A;  4Y1Z A;  3UGF A;  1FI2 A;  1XYO A;  1PO2 1;  2A1X A;  1WLT A;  2ZGR A;  4CDX C;  5FY7 A;  5K0U A;  4ZU4 A;  3PJQ A;  1B35 A;  1BJQ A;  2R16 A;  1MPX A;  5DDJ 2;  1US2 A;  4FPE A;  2Q8C A;  4RS5 C;  3AL6 A;  4XBN A;  3TEW A;  3WNN A;  4AWD A;  4CP9 A;  1YFY A;  4LHK A;  4QX5 A;  1RMU 1;  4FPY A;  1UW8 A;  4WVV A;  3OJB A;  2RM2 1;  4FQZ A;  4URA A;  1OLM E;  4XFC A;  4QQL A;  3NWK A;  3RZH A;  1NCQ A;  1OHF A;  3R05 A;  5H9S A;  1DQ5 A;  3VBF C;  3B00 A;  3KT4 A;  4XDQ A;  2VTX A;  2OII A;  5C9A C;  1XE0 A;  4RGK A;  2AGS A;  3WNP A;  3HWJ A;  3BCW A;  3NW4 A;  1O7F A;  3GHM A;  2JDM A;  3OB8 A;  3OGS A;  5C7G A;  2E7T A;  2B9V A;  1JS9 A;  4A3X A;  1N3O A;  4D69 A;  4YW5 A;  1WCS A;  1Z7S 3;  2TNF A;  3TOJ A;  5BNN C;  4A44 A;  3OGR A;  1LEC A;  2FBE A;  4BB3 A;  1HV1 A;  2E6V A;  3WT3 A;  1UMH A;  1PGL 2;  2R06 1;  4EN0 A;  1IQD C;  3ZSL A;  5FDB A;  1YLL A;  1COV 3;  4YVS B;  5L9B A;  3I3E A;  1WCQ A;  3ZO0 B;  1CZT A;  4UFL A;  5LY1 A;  2P6C A;  4JCK A;  2HEW F;  2VXR A;  4UW5 A;  2ZX1 A;  3UES A;  4B4R A;  1SLC A;  1TZO A;  1LB2 A;  1TNF A;  5FYS A;  2XVG A;  1LGN A;  4JRL A;  1OOP B;  3VDC A;  5AC9 1;  1GKB A;  3FHQ A;  4XET A;  4GWM A;  5J48 A;  3IN9 A;  3X29 B;  1PZ8 A;  2D44 A;  1S0F A;  1ZX5 A;  2Z2S B;  4Q4V 2;  1DGW X;  4QQP A;  1IS4 A;  2YPD A;  4XUN A;  5FO7 B;  4B4P A;  5L7O A;  2ZGP A;  2UWA A;  2HWB 1;  5JI7 A;  3MYX A;  1R1A 2;  2V72 A;  1PGW 1;  2D43 A;  3GCW A;  2C6S A;  3KD4 A;  5CBL A;  4UFI A;  4XDP A;  4N90 A;  5C70 A;  2K0G A;  2D6L X;  2B4K A;  3H3L A;  2HEV F;  4HN1 A;  1NUK A;  4NRQ A;  2VUL A;  2BVV A;  2IXH A;  4R9A A;  3HQU A;  4XXA A;  3MID A;  4CXW A;  3III A;  3DPR B;  1GU3 A;  2EIB A;  4XBQ A;  1ASJ 2;  1SMV A;  2QDR A;  3FWE A;  4XHX A;  1PMJ X;  4DUX A;  2WRA A;  3H1W A;  2PXJ A;  2WNV A;  4QDS A;  3S6P A;  3JUU A;  3RYR A;  1APN A;  4W6W A;  5FUI A;  5HI0 A;  2XBO 3;  1QDC A;  2BVB A;  4N7I A;  4FBF A;  4YZ2 A;  3WZ1 A;  5JZG A;  3CJI C;  1S0B A;  1R1Z A;  1PK6 C;  1KFX L;  3JBG 2;  3KM5 A;  4EWA A;  5A3P A;  1UX7 A;  3W59 A;  4YGE A;  3ACL A;  5JOW A;  3VBU A;  3H8R A;  3UGH A;  1EYB A;  2Y6L A;  3HBZ A;  5IUQ A;  4K7J A;  4P9W A;  3QH6 A;  5FZ6 A;  3NST A;  4DEQ A;  2YFU A;  3T09 A;  2WZ8 A;  4BIS A;  4NIA A;  1BYH A;  4QQ2 A;  3RQ0 A;  2YUE A;  2OPK A;  4QX3 A;  4OVE A;  4K1Y A;  4JGY A;  1IOA A;  1WLC A;  4GWJ A;  2YPJ A;  5BNP A;  3ALQ A;  5C71 A;  2W08 A;  2P34 A;  1N1V A;  3M3Q A;  1AL0 G;  4JGZ A;  1BCX A;  4WBB A;  1YJK A;  4CU7 A;  1FPN 1;  1ZRE A;  4MXV A;  3F2Z A;  4AI8 A;  1UOG A;  2VZP A;  4BIO A;  5HCA A;  4LO6 B;  3ZN4 A;  4AFD A;  4BDV B;  5F7U A;  5AVA A;  4FPC A;  3WDY A;  3AX4 A;  3VD5 A;  4D3W A;  2F6B A;  4E4H A;  2RS1 2;  3SXW A;  2JDP A;  2RS1 3;  4LUM A;  1O4Y A;  4ASK A;  1FV3 A;  3MW2 A;  4KNC A;  2SBA A;  3D3A A;  5E16 A;  4W6Y A;  2VMH A;  1ND3 B;  4R4Z A;  1EV1 3;  4LBK A;  4AF9 A;  4BQ1 A;  3G6J B;  1ODN A;  2JD9 A;  5EYY A;  3VBR B;  4NWV A;  5GM0 A;  1GP6 A;  5CFD A;  1X7N A;  2Y0O A;  1Y9M A;  5FZ1 A;  4CEW A;  2WBK A;  4FOW A;  2N7G A;  4XIK A;  2CAV A;  2QQO A;  1CAU B;  4S2F A;  4ASM B;  5D21 A;  1AR6 2;  1AR9 1;  1GZW B;  1YEW A;  2ZHK A;  5GAL A;  1Y4W A;  3R6S A;  3MIC A;  4OZO A;  3ZXG A;  3DGT A;  3CDZ B;  1F4H A;  1HQN A;  3H8U A;  2ZAH A;  4CDU A;  1W8N A;  3RI9 A;  1ND2 B;  5CYY A;  3W21 A;  4UF0 A;  3JB4 C;  4AK3 A;  4XQW A;  4Q29 A;  5C3S A;  2JG9 B;  1GQH A;  5FMB A;  5F3C A;  4WVM B;  3AKS A;  2HWD 2;  4QGL A;  3V64 A;  4HVO A;  5DPN A;  3WP4 A;  3HN1 A;  4FFF A;  5JLV A;  1VE0 A;  5JXG A;  1W6N B;  4D0Q A;  2DF7 A;  1Y7B A;  4TWT A;  4COZ A;  1WZX A;  1N47 A;  4UFM A;  2VC9 A;  4Y5T A;  1HB1 A;  4XMA A;  4CCN A;  2R04 2;  1FMD 1;  4DPN A;  2CDO A;  1YFW A;  2QQK A;  4BE3 A;  2O1Q A;  4CPB A;  5L19 A;  3I2I A;  1W8F A;  2C9K A;  3AM2 A;  4NN0 A;  2E63 A;  3IWZ A;  3VDD B;  5EPA A;  1RUF 2;  2XHN A;  1LCL A;  4MGS A;  1AYM 1;  1ZZC A;  5F39 A;  3PUI A;  1RHI 3;  4GKX A;  3P6B A;  4PLM A;  4QXH A;  2JDK A;  5FY5 A;  4R4X A;  4XCB A;  1O91 A;  3PHM A;  2DUR A;  1CN1 A;  4HPK B;  4E8C A;  2GMM A;  1XOY A;  3IAQ A;  4G9S B;  3RDI A;  1MEC 1;  3OEA A;  3GXU A;  4BQ2 A;  3WY6 A;  1RB8 G;  3OGV A;  4LOS A;  2VQA A;  3LOI A;  2AR6 A;  3KT1 A;  5L73 A;  4B1L A;  2VQ0 A;  5CEH A;  4P9J A;  1BEV 2;  2W39 A;  4U36 A;  4GMP 3;  3OBR A;  5FYH A;  1XNC A;  4NMI A;  2K2S A;  2UUR A;  2WIN B;  3A0K A;  1RUO A;  3D4K A;  1HRI 3;  2Z4F A;  3IDE A;  1WA6 X;  4NIH A;  2IVJ A;  4PBO A;  2A6W A;  4B7E A;  1TME 1;  2KXL A;  4BQ3 A;  1LU2 A;  5C3O A;  4AGR A;  1AXY A;  3FHA A;  3SKV A;  3ZKY A;  5J36 A;  1QJX 1;  5IFP A;  3TEY A;  3VUO A;  4QXK A;  5CKQ A;  1BBT 3;  4PIY A;  3UKN A;  3PLQ A;  4FPK A;  4Y24 A;  5FBJ A;  3KV5 A;  1UAI A;  5CZK A;  2W9X A;  4ZON A;  3NL1 A;  2EXH A;  1HRV 3;  1PO1 1;  2JG8 B;  2YU2 A;  2DCK A;  2L9L A;  4D7T A;  3SQO A;  1PZ7 A;  2J1S A;  5EHD A;  3NV4 A;  4DEV A;  2BGO A;  4KH9 A;  4KU8 A;  4NII A;  4LOT A;  3WX5 A;  3IMN A;  1EY2 A;  1VBD 1;  3PIG A;  4AQ6 A;  1L7R A;  3WF4 A;  1LRH A;  4CSW A;  4XQD A;  3RPQ A;  4DIQ A;  3VDB A;  4FSJ A;  2W5F A;  4IXL A;  3ZSM A;  2ZKL A;  3R0R A;  1NKG A;  3RZZ A;  1XYN A;  4FCA A;  2FHR A;  1OD5 A;  1D4V B;  3UJQ A;  3C7O A;  4XTM A;  1QKQ A;  3L2H A;  5DUX A;  5F3G A;  4D7Y A;  1UY4 A;  5FZ3 A;  1AX0 A;  4BMB A;  4LO4 B;  4W50 A;  1W04 A;  3DN7 A;  4DUW A;  3N4M A;  1UWW A;  2JDH A;  3BOW A;  2YU1 A;  1AHS A;  1AXZ A;  3NV1 A;  4E9K A;  3AZX A;  3R4D B;  2VMD A;  2ZOE B;  1EUT A;  2IVI B;  1UIJ A;  3GGL A;  3OY8 A;  3WG2 A;  4AI3 A;  5E1R A;  4YZ5 A;  2VAU A;  4HSL A;  2QNK A;  2JIJ A;  1KJL A;  3C7E A;  3VBO A;  1YQ8 A;  1WCK A;  2IFR A;  2IXC A;  3P1I A;  1QY4 A;  4QXB A;  3IZO A;  5LB6 A;  3NJZ A;  1JZ8 A;  2JIG A;  1BVP 1;  2PYT A;  1ALY A;  3ZXJ A;  2WFF 2;  1XE8 A;  2XLF A;  2FDF A;  2WFF 3;  2ZHN A;  3MIE A;  4AEM A;  3FUQ A;  5BUV A;  2WYS A;  1H6Y A;  4DRR A;  3VZO A;  4DB5 A;  1EUU A;  4ORF A;  4RQP C;  4YG6 A;  2HWF 2;  3O1U A;  4NO4 A;  2P4E A;  3WF3 A;  2GMP A;  5AFB A;  2W1S A;  2XHK A;  1X8E A;  2HWC 1;  3H1Y A;  5ACA 3;  4G4F A;  4QGM A;  1QMJ A;  1ZZ8 A;  2EA7 A;  2JD4 A;  4RR3 A;  5A7P A;  4CEY A;  1RIT A;  3PVO A;  1FOD 1;  2WZP P;  3NAP A;  1TMF 2;  2VNR A;  2P1B A;  2VZR A;  4QX0 A;  1W9Y A;  5FMC A;  1TMF 3;  1W8T A;  1GV9 A;  2GNT A;  1IKP A;  4M3C F;  3D0S A;  3WG3 A;  2FCT A;  2ARC A;  5I8Y A;  1VRH 3;  1LKN A;  4OUE A;  5EZW A;  2R06 2;  3NKT A;  1U0A A;  1YXW A;  2E53 A;  2XUE A;  3POY A;  3VL9 A;  3MZH A;  5DAP A;  3VBH A;  1D2S A;  1DYK A;  3MPB A;  1WBL A;  2OXB A;  3U78 A;  5FP7 A;  4S2G A;  5A3U A;  3DCQ A;  4B4Q A;  4IEU A;  4CA9 A;  4C1X A;  2BNN A;  4KWK A;  3R4U A;  3VLB B;  3WF2 A;  4B8E A;  4PHZ A;  3S0M A;  4HBN A;  2BEO A;  5A7S A;  1CIW A;  2I45 A;  4CRQ A;  1CAX B;  1W2O A;  3RI8 A;  4YFW A;  2R32 A;  4K9S A;  3AFG A;  3NNL A;  1C5H A;  1F31 A;  2DTY A;  2XLA A;  2Y64 A;  4QPI B;  5GKA C;  4P9L A;  2B7Y A;  2K9Z A;  4OQ8 A;  2WII B;  4K6B A;  2RMU 2;  3ZFF C;  2JB4 A;  1XE7 A;  1KS4 A;  2HWB 2;  2XVL A;  1UZY A;  3AXD A;  1AX1 A;  3DV8 A;  4IV1 A;  3OD0 A;  4YW2 A;  4HMZ A;  2QQL A;  2XLG A;  3HEI A;  1JZ3 A;  3PUQ A;  4IE7 A;  4YYO A;  1U12 A;  4BIF A;  3TAY A;  5K0U C;  5DDJ 1;  5FZC A;  1N1S A;  1B35 C;  1PM4 A;  5J7M A;  3J8F 3;  1RUH 3; 
#chains in the Genus database with same CATH homology
 1GP5 A;  5C3R A;  1UOG A;  1E5R A;  1W2N A;  2BJS A;  1QJE A;  1HB4 A;  1BK0 A;  1UNB A;  5C3P A;  2BU9 A;  2DBN A;  2Y6F A;  3OOX A;  4RGK A;  2BRT A;  1HB3 A;  2VBD A;  1ODN A;  1GP6 A;  5APA A;  1W04 A;  4BB3 A;  1W05 A;  2IVI B;  2VAU A;  3ON7 A;  1HJG A;  1UZW A;  2VE1 A;  3ZOI A;  5C3S A;  1DCS A;  2JB8 A;  1OBN A;  1RXF A;  1W3V A;  1HB1 A;  1W9Y A;  1E5H A;  1QIQ A;  1W03 A;  5C3Q A;  2VCM A;  1RXG A;  2VBB A;  2Y60 A;  1BLZ A;  1ODM A;  1IPS A;  1W2A X;  1W3X A;  1UOF A;  1HJF A;  1UOB A;  1E5S A;  1HB2 A;  2CSG A;  1UO9 A;  2DBI A;  1W06 A;  1W2O A;  2WO7 A;  1W28 A;  2JB4 A;  1QJF A;  3ZKU A;  1WA6 X;  2IVJ A;  1OC1 A;  2VBP A;  4XAE A;  5C3O A;  1GP4 A;  3ZKY A;  1E5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...