1UOGA

Deacetoxycephalosporin c synthase complexed with deacetoxycephalosporin c
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
309
structure length
256
Chain Sequence
DTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDLVIDFFEHGSEAEKRAVTSPVPTMRRGFTGLSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFAPHYDLSMVTLIQQTLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVATSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIRRTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis of Cephalosporin Formation in a Mononuclear Ferrous Enzyme
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Oxidoreductase
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHETASE
total genus 80
structure length 256
sequence length 309
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 2003-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1uogA00
1W06A 1OC1A 5C3RA 1W28A 1RXGA 1W3XA 2CSGA 2IVJA 1UOFA 2Y60A 1UOBA 1W2AX 4XAEA 1UOGA 2VCMA 1BK0A 2IVIB 1E5RA 2VBPA 1W3VA 2VE1A 2DBIA 1E5IA 2BU9A 1IPSA 1DCSA 1W2OA 5APAA 3ZKUA 3ZOIA 1QJFA 1W2NA 1W03A 2BRTA 5C3PA 1ODMA 1UZWA 2BJSA 2Y6FA 1HJFA 1ODNA 1RXFA 1BLZA 3ZKYA 5C3OA 1HB4A 1HJGA 3OOXA 1W04A 1HB2A 2VBDA 2DBNA 1HB3A 1E5HA 2VBBA 2JB8A 1QIQA 1UO9A 3ON7A 1W9YA 4RGKA 1WA6X 5C3SA 2VAUA 2WO7A 1QJEA 1UNBA 2JB4A 1GP6A 1GP5A 1HB1A 4BB3A 5C3QA 1GP4A 1E5SA 1OBNA 1W05A
chains in the Genus database with same CATH superfamily
3S0MA 2WBKA 4FPYA 1B09A 3NJXA 1OMIA 5EYYA 3VBRB 1MVQA 3ACFA 2YFZA 1MQTC 4FVVA 2H0BA 2WNVA 5BNOC 1AYM3 2YMZA 4A42A 1TE1B 1OPMA 4BK4A 4MUVA 2PHXA 2Q4SA 3CNAA 2J22A 5IUQA 1GR3A 4DXTA 2JXAA 1FOD3 5E89A 2AYHA 1OPOA 1CAUB 4CEYC 5IK4A 2XR4A 1G9AA 1GSLA 3RYRA 1MZ6A 5JMOA 3WW2A 3PU3A 1A34A 4QDRA 3AKRA 4CDUC 3N7KA 1DFQA 2VUDA 2WSVA 4IV1C 4C1XA 1O4ZA 2DDUA 3KGZA 3QBQA 4QWNA 3FUOA 3DPRB 1NCRC 4W6XA 1NG0A 2HWC2 1ZZCA 3USUB 1LHOA 2RV9A 3POBA 2FMYA 4A2UA 3LOBA 2GP5A 1URXA 5C7GA 3KWVA 1UIJA 4PF1A 1PO11 1NY71 3I2DA 1IKPA 1GQGA 3HNBM 4XFAA 5FREA 4PDWC 4XACA 2D6MA 4C0HA 4KMQA 4DRVA 2C24A 2VL4A 1QJX2 4NRMA 3ZFFB 5CFCB 5G04L 4E27A 2NP0A 2SBAA 2JIGA 2ZX3A 3ETQA 3WDYA 1O4YA 4KQ7A 3TEYA 4A44A 2CWSA 3C7FA 4RN5A 4XFGA 2ES3A 2RDNA 5HBAA 2YY1A 1LOEA 1I5PA 1JI6A 5ACA2 3PL0A 2ATFA 2WABA 4GJZA 4E8DA 1Z7S3 3QOPA 4CCOA 1PK6C 2CAUA 3ZIWA 3A0KA 2A71A 2E53A 3BN6A 2V5YA 2WWSA 2Y6FA 2BOJA 4YG3A 4L97A 1BMV2 1HB4A 2DVDA 4FPEA 3PIJA 4P00B 1ZX5A 3BI3A 3Q8BA 3KV5A 5A1FA 4KWJA 5HXVA 1ULOA 1Y9QA 4HK8A 1XOYA 2PLV3 3WSOA 1K3IA 1LRHA 1VALA 2WAAA 1W0OA 5IFTA 3LWCA 2HWD3 4Y1YA 4CRQA 2N7GA 1QEXA 3PHMA 1TMF1 2ZGSA 1YQ8A 3ZR6A 5AFEA 5CA6A 5KHGA 1VBA3 1H8TB 3M3EA 1ZRDA 3N9QA 1JYCA 1ULFA 2VMHA 1W2OA 4BQ4A 1AR62 3LA3A 4XFBA 5T5PA 2ZGMA 4GAZA 4UWDA 2B9VA 5F8PA 1EV11 3NWKA 1RUE1 1CZTA 1LULA 1DG6A 1QJU2 1S2KA 3AYCA 3LOIA 2FDFA 4HG6B 1UPIA 3BTAA 3FHAA 4ZXKA 3CKHA 3VDCA 1LTEA 4ONUA 3P3PA 4Q4Y2 3UL2A 3ILRA 4IV3B 2X5IC 2VCAA 3VBRC 3GDBA 3VBHC 3DF0A 1BBT2 2XJQA 2X5IB 4EWAA 3MEPA 4Q0PA 1JZ2A 4PI0A 1H1AA 1LGNA 1T6GC 3EB7A 3IZOA 1N1VA 2VBPA 4S2DA 1RUG2 1MS1A 1YIFA 2RR13 3SCHA 3VHNA 4A7ZA 4E2SA 2BBAA 3FN9A 3WDWA 2FCVA 4AEKA 3GHMA 3H3LA 4CCDA 5AVPA 2LALA 3K75B 1R091 5FYIA 4BISA 1D7PM 4CDUB 3T2PA 2K9ZA 3OOXA 3SC7X 1W04A 4NIDA 4Q4V1 5KXBA 1AL23 1COV2 3K46A 5FYHA 2ZMLA 1PO23 1W0PA 2JB4A 2Q0AA 3DPRA 3SCFA 1TMF3 3DGTA 1RUD1 1VP6A 1OF3A 2YHJA 3SH5A 4JVAA 2VMIA 4RHV3 4AHXA 4BLIA 4RL7A 1VJ2A 3J9SA 1YFUA 3FZ3A 4XJUA 4R9AA 5A6QA 3MF6A 1EPZA 2XQRA 2OQ6A 3KS7A 4KG8A 3WHTA 4EN7B 1FAYA 1POQA 1AYN1 1RUG1 5DUUA 2BBVA 2BU9A 1WLTA 2G9GA 1C1LA 1F4HA 2XL7A 3R4DB 4MXWA 4QPGB 4PQQA 3WQ7A 1K45A 1QDOA 1UY3A 2WYSA 2Q30A 3OY8A 3P1IA 3UNPA 1XE8A 2PN5A 3HD8B 2VQ0A 5A3OA 2XVLA 4LBMA 3PU8A 5FMOL 5GZGA 4BQ1A 1MS4A 3GBWA 3VDDC 1F35A 2R042 2R041 4BZ4A 5A32A 5ISLA 2F4PA 1Z7S2 3PVOA 3VKOA 1DF0A 5JI7A 1KRIA 3KD4A 2JECA 4XXAA 5FZ9A 2FDHA 2VUCA 4FXGB 3TWIA 3WW1A 4FCAA 4QGLA 4X6QB 3JD73 4CDWC 2QQJA 3VKNA 5FPZA 1BZWA 3MW3A 1FT9A 1QOSA 2IFRA 2YC2A 3M3CA 1N3QA 1OLQA 1C5IA 2IZWA 1MEC2 4LE4A 1H1IA 4SLIA 1C57A 1POV0 1QNYA 1Y7BA 2VZ1A 2CY6A 2WS93 3LD8A 3J7MA 1OOPA 5ERLA 4NHXA 4HSLA 2R1BA 2WFF2 3GBFA 5IJRA 1QJY2 1JZ4A 3GCWA 4TSVA 4YYOA 1V6KA 3IIIA 5C3QA 3VD4A 4U2AA 2AGSA 2UWAA 1UOJA 2LUWA 1YFWA 1AR73 2WWJA 1HDKA 4E4HA 1FYUA 5FJKA 2P3YA 4Q29A 3RPQA 2A6ZA 2R0HA 3SITA 2JE9A 4MHRA 2AC1A 2QBXA 2VZSA 4OULA 4P9GA 4DO0A 3OGGA 1G7YA 1FPN3 4NUBA 4LBJA 3WZ1A 3ST7A 2VY0A 3NQHA 4JDMA 2KR2A 4RR3B 5I8SA 4Q0VA 1W6OB 1W6PB 4XF3A 2GC1A 3D6EA 4CUCA 1PMJX 3TEWA 3A7QA 3POIA 5FZIA 4Y22B 4FOVA 4K7JA 1E5SA 4F8AA 3NW4A 4N53B 3OTFA 3WT3A 1CGPA 1V6MA 1WZXA 2V73A 2VNRA 1UIKA 1FV2A 4QMAA 2CGPA 3O7OA 1F9KA 3PUQA 4LULA 2XH6A 2EXKA 1JYWA 1S4CA 3FL7A 1JN2P 5FZGA 2NLRA 1OVPA 4CEWC 4CYDA 1YQ5A 2A3WA 2ZZQA 3ZFGA 1QWRA 2JJ6A 5K8SA 4C1WA 3CLPA 5KBFA 1IQDC 3CIHA 5F2SA 4JC1A 1DGRA 1QQP3 4XJZA 1VBE3 3NNGA 3MICA 4COZA 1UXXX 2RR11 4R9BA 1RVF1 3Q8EA 4RS5A 3CJXA 2LTNA 2JG9A 1AX1A 1HX6A 4Z82A 3WCSA 4HBNA 3MDPA 2BWCA 4D7TA 3PURA 4E2QA 2YV8A 4MGTA 5T52A 4AG4A 1RUH2 3E6DA 4LJHA 1JOPA 4M4PA 1MEC1 2ARXA 3ATGA 4V1PA 3BTYA 1UY1A 2WL1A 3WQBA 1UOFA 2RM21 4N43C 1W8OA 4HK9A 3EHKA 1CZVA 1RMU3 3DYMA 4I3PA 4JZRA 1X50A 5FKCA 1J1LA 1RUE3 4IUGA 4LO5B 4Y26A 4IEPA 4QDSA 2FD8A 4J1WA 2C6SA 2O0OA 2ZS6B 1UZWA 2EXHA 2RMU1 1UXZA 2VGDA 2YBSA 2ADEA 3LB9A 3U78A 3ZSJA 5FUIA 3OYWB 3HWJA 3B69A 3NKTA 4K40A 3IAQA 3BALA 4RSUA 5FZMA 3Q9OA 2YZ4A 4M0HA 4OUSA 3AZZA 1UZYA 2NMOA 1REFA 4GALA 2R32A 3CU7A 4PQ9A 1YQ2A 2ZGRA 1O91A 4CDXA 2QQLA 1UD1A 2ARAA 1JS9A 1UL9A 4QAWA 2Y0OA 3VBUA 4A41A 2Y64A 3N7MA 3OGVA 4QQPA 1AR93 4XUTA 4YM3A 5J09A 2BP6A 5GKAC 4YRDA 3VBHA 2GSYA 1XU1A 1UX6A 4H7LA 4MX3A 5DZGA 3QD6A 3RFRA 2WNUC 2PFWA 1SHWB 3RWKX 4CCLA 3MF9A 3SQOA 3ZVXA 3ZN4A 4ASLA 1OKQA 4H14A 1KJLA 1JW6A 3W20A 4AYUA 2A1XA 3L9JT 4R4XA 5IW0A 2Y33A 3S5QA 1QH6A 1HN0A 3HBZA 1AXYA 1H30A 1QXJA 2CGNA 3ASIA 3LEIA 4LO4B 2FDIA 3INAA 1RUC2 5FRAA 2WZPP 4XF4A 1ZBE1 4ZHNA 2X29A 2QE3A 3ZM8A 3VUOA 1PIV3 1OBNA 1RUI3 2OUJA 4BPZA 1AL21 4D6RA 1LOCA 1QH7A 1R092 2R7EB 1RC6A 4N43A 5FWJA 5CYYA 4YW4A 1RUH3 4BE3A 1UQXA 2P3JA 3B9CA 3WNMA 5C6CA 3VDBA 2IVIB 2VMEA 4AGVA 5FZ3A 1RJ8A 3HQXA 4UFLA 3MPBA 3OYWA 2CHHA 4K1ZA 3FC0A 1LCLA 2R073 1SBDA 4BCUA 1WWYA 5IT6A 1FMD1 3I59B 3LIHA 4K20A 2ZKNA 2X5IA 5DDJ3 4MGQA 4BIOA 3KCCA 2DVBA 4LA3A 4IXLA 2HLEA 1DP0A 1DGRN 2DVGA 4AL9A 5CVRA 4LBLA 1W0NA 5LK7B 1SBEA 3AYDA 2PHFA 3WHUA 3W59A 2Y38A 3KCYA 3ZFGB 1U0AA 1ZRRA 3H8XA 1U5IA 1JZ8A 3R4SA 4OI1A 1CAVB 3FX3A 4D69A 2QQNA 2NMNA 2A73B 1S2BA 4YZ3A 1HN1A 1WCQA 1O3QA 4UBGA 5IK5A 2A6YA 2ZBJA 1SZBA 5IATA 5EV7A 3AFGA 3B01A 4I02A 5EQUA 1BHGA 3TAYA 1AX2A 4KH9A 3ZYGA 2TEPA 3LPGA 4QHBA 1PZ8A 3VGIA 1NA1C 2J7MA 3LKJA 3ZYBA 4CCNA 5A7WA 5A7OA 3U14A 3WQ0A 3O12A 5FYTA 1UY2A 1SLCA 2ARBA 3OJBA 3WG3A 2QFEA 5LCWL 2ZHLA 2PHWA 4EWEA 4IW3A 5CBLA 4ZXEA 1PX3A 3KHCA 3LCPA 1BMV1 1DYPA 1KITA 3GJAA 1VE0A 3IPVB 4LLOA 2B5HA 2EVXA 2XJPA 1K42A 4XUNA 5FZ1A 3UESA 1SLTA 4QPYA 1JUIA 3AXEA 4UFJA 3K4DA 3G7DA 1LOFA 4ORFA 3OD0A 4QM8A 3RZZA 1T2XA 4WVWA 2OYZA 5DAXA 2BTVC 2JWPA 5FO8B 2Z2SB 3PJQA 1RUOA 4EN6B 2X53S 2KD7A 1PGSA 2VCCA 2ORXA 3I59A 2OQ7A 2OT7A 1JZ7A 3TN91 4IE0A 2AEZA 3CMGA 1ACCA 3DV8A 4ZU5A 3ZSMA 2CAVA 2KA3A 3U75A 1Y9GA 2Y34A 3E1F1 2BWAA 1OT5A 1ZZ8A 5A1LA 4XYXA 2WDBA 3GYDA 5BY5A 1EV13 1WCSA 1JH5A 1RVF3 3MV01 3AYEA 3CJIC 3TEXA 4MG2A 5GLVA 2XJUA 4CDXC 2WT0A 4BQYA 1HW5A 2A6VA 1PNFA 1QMJA 4YZ5A 3NNFA 2XHKA 5FY7A 3THCA 4NIAA 2VECA 3N36A 1W8WA 1WMDA 5CADA 1SPPA 4GWMA 1C4RA 4FAHA 5J98B 1O5UA 3POEA 2BGPA 1LECA 4IERA 2DU1A 5FZOB 3J7NA 3ABZA 5LA2A 1N3PA 4NIIA 3N9LA 3HQUA 5C9AB 1CAWB 4JQTA 2D93A 4L2NA 1JXNA 1M4WA 2PLV1 4WM7C 3ZYFA 4BYYA 1SLBA 3H8RA 2BW8A 3WUDA 1BK0A 3IT8A 1G6NA 1GZCA 2FBEA 4AQ2A 4ES8A 4LEJA 5D8AB 2OS2A 1PX4A 3OSDA 1ENRA 3PLQA 3TYJA 2Z5WA 4MLOA 1W90A 2ZZJA 3T08A 2JD4A 1J3QA 2XKPA 3EBRA 2W91A 3VDDB 2PHUA 2QZ3A 4LQRA 5J7MA 4TXWA 1C28A 2VBBA 5E88A 3GCXA 2PQSA 5FV3A 1CX1A 1W2TA 2DV9A 2W68A 4ISRA 3WVJA 4RR3A 3ZFGC 3E5UA 4IE7A 1W9TA 4L9BA 2OPKA 3RVHA 3WF3A 1CD3G 4QPWA 1OD3A 5FPLA 4D3WA 3POGA 4XOGA 4EN9B 3TEZA 1KDMA 4YM0A 4Q2FA 4OCTA 4LTAA 5T5OA 5C8WA 2K0GA 4NE9A 4OVEA 1BBT3 4CPBA 4C91A 1O3RA 2VXJA 5JIUA 1QJY1 3A21A 1S0EA 3DL3A 5FAXA 4LKSA 3OCPA 1FI2A 5CKQA 4ZZ8A 4JGYB 1YXWA 2WZEA 4NAOA 1DHKB 4O9EA 3MFCA 3S7IA 4XEZA 3MUZ1 4WVMA 2YU1A 4ZZ5A 2CGOA 1HJGA 1AJKA 4FI9A 2ZEXA 1HXS2 1W8FA 4I0AA 4QGNA 3IN9A 4GKYA 3WNKA 4LO8A 4FOYA 4WM8A 2ERFA 3V0BB 1EPWA 1DLLA 4CEYA 4GH4C 4NVPA 3D82A 3OUHA 1WMEA 1SACA 2DCYA 5IVFA 4KWLA 2CTVA 2GAUA 4K21A 5LEJA 4Q8LA 5F2WA 1DQ2A 5JIAA 4I2OA 2I45A 1PVC1 2O1QA 3OB8A 4FPOB 1AR63 4YG6A 5H9QA 3GNEA 3UYJA 2F4LA 3HOBA 4F83A 4LHSA 4XJWA 1BLZA 4E4DX 5L7OC 3ENRA 3ZYHA 2JDUA 4XBQA 4XIOA 4Q5OA 2F6BA 4DFSA 1CJPA 4OI2A 4RHV1 4PCRA 3I2HA 2K2SA 1WA6X 1S0JA 3WNLA 5FQ0A 1POV1 4LBKA 4IE5A 2QVSB 3AMNA 5J36A 2HEVF 2WZ8A 5SV5A 2XPJA 1GQPA 1ND3C 1UPSA 1EV12 1R1A3 4AHYA 1NX9A 1NE4A 1H8VA 1RIRA 5FP8A 1RVF2 2PHTA 5LW9A 4KU7A 1QJU1 3DKQA 4CDXB 5CIRA 4TLFA 3VL8A 2GC2A 1SFNA 2XJVA 2VOVA 4FPJA 5E1RA 4W4ZA 3ES4A 3NRUA 3KLSA 1W8ZA 5C3PA 1YHFA 3JBG2 2JG8A 4AQTA 3UKVA 2H6BA 4D94A 3V0BA 3CBNA 1NOVA 4XCAA 3ZO0B 2DUPA 1YYNA 2H0VA 2RM22 3J4UH 4JRLA 5KR7A 4WV8A 1ND2B 2VO5A 4CP9B 1W9WA 3TNPB 4CXYA 1LAJA 5DG2A 1UMIA 1UNBA 2D5FA 1AHSA 2ID4A 1AXKA 5CISA 4N43B 1HXS3 4L8QA 2B42B 2JG9B 3P5BA 5GJ6A 5FZFA 2GMEA 3RZLA 1X8EA 2WNOA 4CA9A 4XFFA 4DY3A 2QZ2A 3IM0A 1HIXA 4Q4X3 1HQNA 1UZZA 2HWC3 3N9OA 4AI8A 4QX7A 4S2GA 4DIQA 2XLGA 1S0BA 2ORZA 3OF1A 3HBKA 1CN1A 4OLLA 1W6QB 1F2NA 3ON7A 3PVNA 4IV3C 4QPGA 4ES9A 1GZWB 3OEBA 4NROA 3ELNA 3NAPB 1DIWA 1EAH1 1UU4A 3WV6A 1ASJ3 2QQKA 3U11A 3W21A 1VRH2 1W3XA 3AX4A 2IVJA 1OVSA 3IDCB 4PIZA 3SHRA 4LXLA 3O1VA 3AMQA 3OPZA 5AVAA 3UKTA 4URTA 1VB4A 3IKWA 1X7NA 1OA4A 1WUVA 2EIGA 3BB6A 4KBZA 4DY5A 4NPLA 4CEWA 4ARXA 1AR81 2ILMA 1JBCA 4WM8B 5F1RA 2RG4A 1BVP1 4RFRB 1CPNA 1QOOA 4Y24A 2BYVE 3JUUA 4K9SA 3POWA 5JR2A 1ZBA1 2VTXJ 2WLQA 3V0AA 1VAVA 2CYFA 1JZ3A 3PTYA 2NQYA 1AR72 3RG0A 4LK7A 4WVZA 1JOBA 2UU8A 4Z1VA 1O3SA 3IDAA 2GZWA 4RGGA 4OQ8A 2A3YA 1MR5A 5FXVA 5L9RA 2Q8OA 3POSA 2KM2A 3WF4A 5FBZA 3UJOA 4QQHA 3KGLA 1XNKA 5A33A 2YPDA 1BQPA 4GA9A 4ATEA 1BBT1 1YC61 1RL3A 3GZAA 3M1HA 5E16A 4BQ3A 4JV4A 1UCXA 2RS12 1AZDA 1RITA 2GH2A 4CU9A 4Q0SA 1S1AA 1REDA 5DZFA 1G9FA 2VMGA 2VM9A 4YVWB 2VNVA 3MUY1 3OY8B 3BIEA 4I0WB 4AVTA 1OI6A 5CFDC 2FZ2A 4Q4W3 4NRQA 2GNDA 2D7FA 4QX1A 2XONA 5H9RA 3HAGA 1J84A 2Y60A 3AL5A 4HZFA 4E9KA 2JG8B 3NL1A 4CDWA 1Y9MA 2XDVA 3JCIA 1MPXA 4QHZA 4QB6A 1AR92 1IZ3A 1OSGA 3PUAA 3SKJE 1VB2A 2Q1ZB 5C71A 4K8RB 2WNVB 3NVCA 2WNUA 3MYXA 4JGYC 4PIYA 5DABA 4ASKA 4B3NA 1RUG3 2J1VA 1OUSA 3MLJA 1P8JA 2DCKA 4DPNA 5FZ8A 2ZGQA 4XTMA 1OURA 2E51A 2DUQA 4COVA 1SLLA 1C3HA 4XZUG 1VRBA 1DYKA 1F15A 2XGXA 2YB7A 5FOBB 3WP6A 4XF0A 2C9AA 4JX0A 3RZHA 5IFPA 1SPPB 4CE8A 4LO6B 3AM2A 4G4FA 4YFZA 1OQ1A 1PO21 1XXNA 5DUVA 5JPMB 2VVDA 1GOHA 5I0RA 4AI3A 3GHNA 4BWOA 2J1SA 4NR1A 4A3ZA 1TZOA 1YEWA 1MS3A 2EIEA 3RZKA 1RUF3 4Q4V3 3WDXA 1OXCA 2UY8A 4DXRA 1YI7A 1STMA 3J7LA 4YW7A 2VNGA 3BGAA 4M0NA 1IKQA 2P3KA 1F8VA 4LORA 1CVNA 1XNTA 3U4XA 4IEWA 1ZZ9A 2RS31 1AYN2 4RGKA 3C7EA 5JAXA 2IWGB 2W1QA 3MO4A 5D21A 2RDQA 3WP5A 2D3SA 5CFCA 4Q1PA 1FMD3 2BFUS 3MPPG 1IS4A 3ORJA 5C3OA 5JOZA 3I8TA 1OLRA 1UY0A 4CCCA 3WINE 3QLQA 4L0PA 1H6YA 4N53C 2X05A 2VW2A 2VPVA 4K3UA 3ECQA 3F2ZA 3KVAA 3U4SA 2XBO3 2DTWA 2IC1A 4LBOA 4P9XA 5FMBA 2XVKA 2ETEA 4AEMA 1CX4A 2DBIA 4CSWA 4CDQB 3DUIA 4QGMA 3F95A 4BLJA 2ZXQA 1US3A 3V0AB 4HPKB 1COV3 2R063 1OHFA 1PM7A 4J6GA 4W6YA 1LHUA 1K5MC 1LODA 2IXKA 5K0UB 5FMCA 1D2QA 1TMF2 1W6MB 1XYNA 2GALA 4L99A 4P9JA 3WR0A 4OHVA 4B7KA 2WKKA 1AR83 4GWJA 1ENSA 3U07A 5FXWA 1R1A1 1GLHA 1W9YA 4M4RA 1PMHX 2HJIA 1W8TA 4TN7A 5L19A 4P9WA 3RWNA 3Q8AA 1OH3A 2IFWA 5H9SA 5C9AC 1HRV3 3ZXLA 2UYBA 3TN92 2WC2A 1I6XA 4Z07A 3LZZA 2DWRA 1NCRA 2JD9A 1V9U1 3HIFA 4HOOA 5FK8A 5I8TA 2GH8A 4AI1A 4P9LA 2YBPA 1KGYA 3UT0A 1DZRA 1US2A 4ZU4A 1LU1A 1GFF2 2VG9A 1WW4A 4PBPA 4YVWC 2ZMNA 1AJOA 3R05A 2VOKA 1JU4A 1OFNA 2OA2A 2ZX0A 4XJ8A 2J1AA 5JDBA 4BOWA 3G6JB 5JXIA 3LA7A 4PLOA 2W08A 3B5LB 1LOBA 3N9NA 4AW7A 4M01A 5GZCA 4YNIA 4MOAA 3NNMA 2VVEA 4AFBA 2JDYA 1G9CA 4Q4X1 3W9AA 1WMFA 3AP9A 1HV1A 4CDQA 1UZVA 1UKRA 4FPCA 3VD5A 4PLMA 3BVCA 4YPJA 4FP3A 4NPRA 2BERA 4NOTA 2XBO2 4A7YA 1VBC2 1ND2A 3VD9A 3ACHA 3VBUC 1QJY3 5JOYA 1V6IA 3GALA 2E7TA 2OXBA 3Q8CA 4JGYA 2LM3A 3VKFC 5BNPB 5BNPC 4JHTA 1AUYA 5LY1A 4DS0A 2JDKA 5IK8A 3E5XA 1D0GA 1VBA1 1NCRB 4KU8A 4X8PA 5A7WB 5B2GB 2ZACA 1C1FA 3THTA 1WW7A 1EP0A 2PAMA 3VHOA 4FFIA 4PDWA 4KGQA 2G1MA 2RS53 5FZLA 3ZSLA 2JKBA 1NLSA 3KMHA 3KV9A 4AEDC 2ZX1A 2HWE3 3AKPA 4DRRA 2VZOA 3ZYJB 4NWWA 1O3TA 4YM1A 4FPLA 3EJKA 4IQPA 5FYZA 2WIIB 1D0HA 5ANQA 1AYM1 4FTEA 2HWE1 4WZCA 4CCMA 5L9VA 3PIGA 5DQ0A 3AMMA 2IXHA 4LT5A 1LNSA 4DEQA 2RE9A 2HEWF 2WWUA 5FZCA 2CV6A 5JOWA 3M8LA 5I0TA 5EIYB 1W28A 1B35A 1RHI3 2R6QA 1W8NA 2JDZA 4XW3A 4AFMA 5BNNC 4JKMA 4TWTA 1QQP2 3ZPOA 1RUC1 3MW4A 1W3VA 4KGGA 3P3NA 2XXZA 2Q8CA 3W5NA 3LDKA 2D3PA 1ND2C 1ZVFA 3VZJA 3IMNA 2ZGKA 4ITCA 4FFGA 3JQWA 4E8CA 2GN3A 3OUJA 5BNOB 3ZXFA 2TBVA 5FZEA 4CCEA 4FT8A 1DGWA 2V72A 3POYA 5CFDA 1TME1 1ENXA 4XFIA 2DBNA 1VBC3 2BDRA 2G9ZA 2YU2A 3FLPA 5KHKA 2CU5A 1KS5A 3K77A 3PTRB 4JDOA 1VMHA 3HEIA 3T09A 4DUXA 4BMEA 5CKNA 4YGCA 4Y3OA 1F4AA 2EA7A 4P9YA 2NN8A 3U1XA 5AC91 4MGSA 2D43A 3LAGA 2P37A 3J26N 2BVBA 3ACIA 1DLCA 2VNOA 4LE3A 1OLME 3AL6A 5A33B 1XJAA 2DURA 4MZUA 4MH0E 4OI4A 2D5HA 5KC5A 3I2OA 3EXUA 2I2SA 4UF0A 1XNBA 2E7QA 2D6PA 4OMCA 4XBLA 3N9MA 2HWB1 1LR5A 4YW2A 1V9U3 3CZUA 3UGFA 1RXFA 5ABJA 5J3UA 4IEVA 5EHDA 3KM5A 1OUXA 3WNPA 3NAPC 3O1MA 4ZY9A 5IYYA 4AVAA 2FDGA 2VZ3A 2QQMA 3AZXA 1QJX3 1QDCA 4XE9A 2XVGA 1W9FA 3VBSC 2BGCA 5F5IA 4D7YA 1PZ9A 3E6BA 1GZWA 2ZHKA 4LLFA 5LA1A 5LATA 2Y8KA 4BXSV 4EJRA 4QPIA 5LBCA 1NE6A 1ULPA 4QQ2A 1PM4A 1FPN1 3VBUB 3CJIA 3KT4A 3RNSA 1MZ5A 3T2QA 3M3QA 1MQTA 3V65A 2ZX4A 4K6BA 1RINA 2DUOA 4MGYE 5IVEA 1NLRA 1PNGA 1NA1A 3JBG1 1G9BA 2ZGTA 4Y4YA 1X82A 3EQEA 2JENA 3AP5A 4LIVA 2RVAA 4PHZA 1DGLA 2IXIA 4X8NA 3O0XA 2YC4A 4N90A 3J8F2 4CDQC 1PVC2 3T0DA 1BEV2 5A7SA 2X8KA 5FXXA 4W6WA 2VAUA 2WO7A 4QU2A 4XJAA 3I54A 2FCUA 1C8NA 3MHZA 4LPLA 5BNPA 4A3XA 2X09A 3IB3A 2ZJCA 1TVGA 2D6LX 2BQPA 5EZWA 5FUNA 5C5TA 2XMLA 2BV4A 3OBAA 1KQRA 2DCJA 4IETA 3R0RA 1W39A 1YFXA 1N1YA 1HXS1 3CO2A 4G9SB 3ZDSA 1HQWA 1WW6A 2Y26A 1RYYA 4MXVA 3ZXKA 3WNXA 3DKWA 3H1MA 4QHOA 2HH9A 3JU9A 2HWF3 5F5AA 1VBB3 3I3MA 5AFBA 4Q4X2 2IXCA 1OFSA 1JYVA 1J3RA 3N7JA 4YVSB 3GZTB 3RI8A 3HNYM 1QOTA 4GULA 2GC0A 4CUBA 4B7EA 2HEYF 3DXUA 3AXDA 5DUXA 1ZBE2 3K2OA 1V70A 4QPIB 4AXOA 4ARYA 1ZBA3 3AZWA 2CDPA 1QU0A 5BPXA 5CU1A 3AKSA 4I09A 1YIPA 4M00A 1NQJA 1RXGA 4Y5Z0 5LK5A 4GB31 3KF3A 2D98A 3M3IA 3BIWE 4D8MA 5T3NA 2WYFA 1V0AA 5EWSA 2WFF1 4NIGA 1GICA 1L7LA 1PVXA 1WCDJ 1GOFA 2NYYA 4LR4A 3VBRA 1SBFA 3ZXEA 1CAVA 3H8OA 1RGSA 4LOSA 4MSVA 3T0BA 4FQZA 3TRSB 3UGGA 1GUIA 1ZZBA 2YUEA 3NO8A 2E63A 2DVAA 2PLV2 4WBBA 1WA4A 1LENA 2V5DA 4Y4RA 4ZS3A 1WLWA 5I91A 2VUJA 3LEMA 1I5ZA 4LBQA 3FBYA 4XHXA 2PXJA 5HCHA 1XE0A 4UFKA 4OMDA 4HKOA 1Q8VA 1BEV3 1DQ0A 3PMEA 4QB2A 5HCFA 2Q8DA 1XE7A 3SXWA 3WXPA 2P5BA 5DXDA 3ZFEC 2FHRA 2E6VA 3KHBA 3NV3A 4OFGA 4LK6A 2V4AA 4OZXA 4I30A 2QJVA 4QXBA 2YFUA 2MEV2 3L2YA 5FWEA 1V9U2 1FV3A 1JZ5A 5DUWA 4YW3A 3VBFA 2PQQA 4KL1A 3ZN6A 1YWKA 2Q8EA 5L7OB 1LHVA 1L3JA 2EXIA 3RQ0A 5KHHA 1OQDA 1HRI3 2JDHA 1YCIA 2XWBB 3MI8A 4QU1A 2P3IA 1EYBA 1VBB2 2ZAAA 5GLWA 1Q43A 1QJEA 4QD2A 5FO7B 2Y6HA 4BA6A 4I0BA 3ZSKA 5A1AA 1IGOA 3LEGA 2YC0A 3AB0A 1KFXL 5GZEA 1S0CA 1DDLA 4B4PA 5E8AA 4B4QA 5BNQA 3U0ZA 4CEWB 1ZBA2 1W2UA 3B94A 4HKLA 2PHLA 4Q4W2 4AEJA 1XNCA 5FLIA 3HN3A 3WUCA 4N8MA 1GWKA 5FZ4A 1IPSA 4K1YA 5JVVA 3WD5A 5HPOA 1JTZX 5K0UC 1U5ZA 1NT0A 4LHLA 3EO6A 2Y0IA 3KZ4C 2SLIA 4EN8B 1J83A 3BPZA 3BTZA 2J1TA 2XJSA 4D6QA 1PGW2 4K8FA 3IDBB 3JB8A 4OQ9A 1LOAA 5T5LA 2QDNA 1X36A 4H55A 4LITA 1FX5A 1H9PA 1NXMA 4JDNA 1WLCA 3PVEA 4UYBA 4D7SA 5D2AA 5C8CC 2PAEA 1TME2 1XSQA 3I3EA 1W2AX 3VKLA 1GNZA 4GB32 2W1SA 3AP7A 2VE1A 3LFMA 1T6BX 3PUHA 5JWPA 4IEOA 1ST8A 5FLJA 3T2OA 1H2KA 1AR61 1QJZA 2XKOA 3CF6E 4UI9L 4CVUA 4B4RA 5JZGB 1H4HA 4OZOA 4YVWA 1B35C 1OA3A 1XPWA 2QTWB 4V2VA 5ABJC 3B00A 5EXOA 2HWC1 1YLLA 2WNEA 4CCKA 1QKQA 5F7UA 2VQAA 3K3OA 4NMIA 3MZHA 2JDMA 3WNOA 1ZREA 1R081 4YW1A 5CAZA 3CZJA 2C26A 3N7LA 5FXZA 4JQRA 1GP5A 5IWFA 3ZMNA 2XBO1 5FK7A 2WFPA 4A45A 1Q8OA 2BNNA 2Y6KA 2VMDA 5CEHA 2RS11 4FPFA 1OH4A 1WD4A 2E9QA 2VOTA 5FYYA 4YZ2A 5FP7A 4DB5A 5A3NA 4HXCA 3RYPA 1EUUA 1KDKA 3T30A 1O7FA 4ZU7A 4NAMA 4FTBA 1YRZA 1W2NA 2OPWA 2CDOA 1UKGA 1ULEA 2J1EA 2ZPXA 4IGPA 4A6OA 2WZR2 4GH4B 4P5HA 3CQOA 4R9DA 3T1LA 4JCKA 5BXXA 3JBG3 1K5MA 5EP9A 3ZIXA 5FZAA 1SLAA 3BU0A 2EF6A 2VZUA 4BXFA 2YBKA 2B7YA 5H9PA 5T54A 3BODA 2QKDA 4P14A 3H1YA 4BDVB 3HQRA 1UY4A 2AZ5A 4IEZA 5IVJA 5C4WB 2VXRA 3CDZB 1O5LA 1EY2A 4CUAA 1RTVA 4LHKA 1N3OA 2RJ2A 5M0TA 4MXWB 3QCWA 1OQEA 1MACA 3GBGA 1W03A 3HMYA 4GB33 4XIKA 3ZX7A 5C5UA 4HKWA 4O9GA 1CQ9A 4KI5M 3GM8A 2QCSB 5FLHA 2WUHA 3PDQA 5T50A 1C8M2 2ZABA 3ILNA 3OGRA 5BUVA 4LO7A 3VKMA 2W0XA 1NZCA 1GU3A 2ZMKA 2WINB 4DQAA 2EAAA 5JCTA 5FTTC 1DQ6A 1VBE2 5FYCA 2JG8C 5HXMA 3OUIA 2VMFA 2EXJA 1ZRIA 5JLVA 3AK0A 5F3EA 1LEMA 2R16A 2Y6LA 3T4HB 2GMPA 1S0DA 5C8CA 5EYXA 1VRH1 3AVSA 5FFOC 4NHKA 4DINB 4FAGA 1JUHA 1GQHA 4JRAA 4UFHA 3FFZA 1KD7A 3VV1A 2GDFA 2PTMA 1N1TA 1XB9A 3PJYA 1UYYA 3RJ2X 4Q4Y1 2B45X 3GXUA 4LBQD 4META 1TEIA 1J59A 4MGIE 2BOIA 4NJ4A 2WAOA 2ZGUA 2QQWA 4JGZA 4EROA 4BK5A 2VH9A 3AKQA 4YZ1A 5FMDA 5HV0A 1HKDA 1H6XA 4XC9A 5CNAA 3VD7A 1DGWX 3ZYIB 2GP3A 4I01A 1UU6A 2FQPA 5JZGA 4LHNA 1OA2A 2Y6GA 4RYDA 3RZMA 1Q3EA 1GANA 3LGRA 4RA0A 5HCAA 2B4KA 1DBNA 1ODNA 2D40A 1LGBA 3RYKA 3I2GA 1AX0A 4BIFA 4EE2A 3ZSEA 3I3DA 4BQ2A 3NAPA 3WF0A 4FFHA 5CFCC 2HWD1 4J25A 3RMYA 1H0BA 2E33A 1GP6A 1W6OA 1FOD1 1W6PA 2GC3A 4Y5TA 3LSEA 5A3WA 4CP1A 5JI9A 1F31A 2BNMA 2JKXA 2AENA 3E6CC 3FFQA 4E2GA 2I07B 3FJSA 2D6OX 1UOBA 4C90A 4XCBA 1UN1A 2GN7A 3WF1A 2CNAA 3C2UA 2HWB2 3NJZA 5A6ZA 3VBOB 3ZXJA 1WCUA 3ZPYA 3E97A 4AQSA 3ZKYA 1O6UA 5JXHA 1PO22 3BTXA 3I3QA 1ENQA 2YGMA 3RSJA 1PK6B 4Q4W1 2RJLA 4JHZA 1BVVA 4YM2A 1Y43B 5LWBA 1WD3A 4RHV2 4XMAA 3TBDA 3MLKA 1GMMA 2QQVA 2VJXA 3URFA 5KXEA 4GXLA 3H42B 1BKZA 1NYWA 2WS91 3DN7A 2VR4A 4GMP1 4W65A 4AI2A 2B46X 1VPHA 2RS52 2ZGLA 1VBC1 1NLQA 3FWEA 4JGZC 1A3KA 1OC1A 2DYCA 3JQXA 2A7AA 4TTGA 2HYKA 2IUWA 2Q5TA 3K51A 3JD71 4UXAA 3PUIA 1XC6A 5D8AC 4DNYA 3ZN6B 1GBGA 5L73A 1JYTA 4QX5A 1LB2A 2R072 5EFUA 5FZHA 1ZYBA 2RS13 1CAXB 1H8TC 3NNLA 1PO12 2A3XA 4UBHA 1UX7A 3PNAA 4HVRA 2CL2A 5APAA 1SCSA 5FKBA 3RI9A 3VDDA 3OBRA 1D4VB 1JHNA 3WP4A 5A3LA 2R30A 2VMCA 1VBD3 1WBLA 1FXZA 2TUNA 4QKBA 5DN2A 4X6RB 1PIV1 2R043 2JB8A 2XL9A 3P6BA 1TG7A 1IG3A 1B35B 1RJ7A 1CONA 2Z42A 3HT1A 5FY0A 4YW5A 4AOCA 1H4GA 1XYOA 1YQ6A 1DYOA 3HNMA 4OHZA 4P08A 3W58A 2E26A 3KQ4B 4EV0A 2C5DA 4QB1A 4XUPA 1HV0A 2OW4A 2Q1FA 3PUSA 2HBTA 2FMDA 1NUKA 2P17A 2WNUB 2VZPA 3D8CA 3WG2A 3JXSA 2VCBA 4AGGA 3KSCA 3O0WA 4ZS2A 4AE2A 2W39A 4HN0A 4WVVA 2ET7A 2UWCA 4XPVA 3ZXAC 4C0BA 2RHPA 4CEYB 2Z79A 5B4NA 2C4XA 4UFIA 4Y33A 1W99A 1EAH3 4CP2A 1SMVA 1MVEA 3I7DA 4DMIA 3LDRA 3VZLA 3FBMA 4XFHA 4COUA 5A3MA 3M4FA 4AFDA 3MGUA 1V6JA 4XF1A 3LF7A 3H7YA 3NJVA 2WQ8A 3O0VA 5D1IA 3LPFA 4GIQA 1GKBA 3ALQA 4MHUA 5J48A 1UMHA 2XB6C 3AYAA 1V6NA 3WW3A 1H1MA 3X29B 2HKXA 4IL7A 4OHWA 4UW5A 5BV6A 1U12A 2WA3A 4P5YA 2QQIA 1MZFA 2PHDA 5F5CA 3TN93 4RR3C 1UU5A 1DQ4A 2JDAA 2W46A 5FP3A 1NCQB 2BFUL 1ZZ7A 4E4ZA 1QHDA 2P2KA 1SLIA 2WSUA 2WQZC 1S0FA 4GD4A 4HVQA 4XUOA 1CR7A 2ENRA 2A6XA 3ZR5A 1E5HA 4UW6A 2YYOA 1UO9A 5FOJB 1R082 2GU9A 4CU8A 2QUOA 3DXTA 1WMXA 2AREA 5K4LA 4LOTA 2J42A 2ZHMA 1VMFA 3IAPA 5GZFA 5L36A 4QX3A 3UV9A 2PAKA 3VBOC 1BEV1 4EYUA 5A32B 5I0UA 4H7MA 5DAVA 1ALYA 3SEPA 1OOPC 2BNOA 4CP0A 3S30A 3J8F3 3ZKUA 1PK6A 3MIBA 3VDAA 1CAUA 1YQCA 2BJSA 2W87A 1CZSA 1MQTB 5JSOA 3OBTA 1H9WA 3M7AA 2P1BA 4ZONA 3WG4A 1XBFA 1NA1B 1O4TA 2JX9A 1MS8A 2JDPA 4YW6A 2JDNA 4HVOA 2RS32 3POFA 3TB0A 2R1DA 2BUKA 5FJHA 4DUVA 4UT5A 3O1RA 3AFKA 4CXWA 4YGBA 5C4WA 4I3GA 3BPSA 1W06A 1FNYA 4FP2A 1RUE2 5FUPA 4Y20B 5DG1A 3J8F1 3ZFEA 2QDRA 5J96B 3SLIA 5IVYA 4EWDA 5FZ7A 1RUI2 2RMU3 5IAXA 1LJ7A 1R093 2DCTA 1E5IA 2R49A 5A6YA 1XSRA 4XURA 3T2TA 5HCBA 1XRUA 1ODMA 5LBEA 4HT1T 2WLPA 4RFT0 3RGBA 3ZYPA 3M70A 3VZNA 1LGCA 2A6WA 3OG2A 2OZ6A 4QDQA 1YJLA 3KF5A 4KNCA 5LBFA 3VZMA 4GMP0 4YSFA 5C33A 1UYZA 4PBOA 3ZMOA 2D97A 4XJ9A 4MVTA 3LSDA 5KHIA 1UW8A 1ZZ6A 3NNJA 4XUQA 4DZGA 1AYM2 1R083 4FBFA 1ZRCA 2B39A 3KQRA 4RQPB 4FPGA 1IPJA 1MS5A 3D3AA 5LA9A 5A7QA 1UOGA 5FY8A 2AEYA 2ZX2A 5F5QA 1SDWA 4UW4A 4E4SA 1H2NA 3KB5A 4B29A 1RUJ3 5FZKA 2AUYA 3WDUA 3SH3A 4AHWA 2BRTA 3WEZA 3CJIB 5FYVA 1RUC3 5FZ6A 4HMZA 3NV1A 5IVBA 1J58A 4RS5C 3VN4A 1QNWA 2XUEA 3IMMA 2VZVA 4IGOA 3S7EA 5A3UA 5DMYA 4HLTA 3ME2A 4QT6A 5BYNA 1NAEA 2HYXA 4Y1ZA 3RZGA 5C4WC 3T3YA 2Z69A 2MEV3 4LBQB 1H8TA 5B4XA 2E31A 1WGPA 4D6SA 1QJX1 2JE7A 2ZGNA 5FZOA 4KBBA 1CWPA 5FPAA 1R1ZA 4OUMA 4QKNA 5D8AA 2WRAA 1Y3TA 4QPGC 3O1UA 2A75A 2X10A 1HQLA 4NPMA 4Q1RA 4AAPA 5JXGA 5DDJ2 4HFSA 2QQUA 4A7KA 2XJTA 5JR7B 3VHPA 5FZ0A 2ZHNA 4AGRA 1VLNA 2VBDA 5FY9A 2MEV1 3WX5A 2YROA 2VW1A 5FYBA 2GNTA 1COV1 5LBBA 4AAXA 2ZGOA 4M3CE 1LOFC 5F3GA 5FY4A 3LE0A 1UMZA 4RQPA 2G4IA 2TNFA 1GP4A 1DZQA 3IIAA 3CL1A 3POJA 4URAA 2ARCA 4Z92B 1L7QA 5F3IA 2EAKA 5GLZA 3VZOA 2HWF1 3WF2A 5FR3A 1M06G 4ASMB 4DXZA 3S57A 4HSJA 1VBB1 3ILFA 1K5JA 3NSTA 1ASJ2 1NZIA 1LHNA 2P6HA 2P34A 3O1PA 1VMJA 1CPMA 2RS33 1GV9A 3LIGA 4N7UA 3C8XA 5ANNA 3MW2A 1NQDA 4BJ0A 4Z2AA 1DZTA 1SQ4A 3WP3A 3AZYA 1HB3A 1DU3D 4YLZA 2VZRA 1QIQA 1J1TA 2ZA9A 5FYUA 1LHWA 1VBE1 4GWIA 3WY6A 4AK3A 4GKXA 3WLUA 1UZ0A 1RUD2 5DZEA 3FHQA 3NJYA 5JSRA 3S6PA 4PF5A 3HVDA 1KS4A 1YFYA 2DFBA 1V00A 2WO3A 2O8QA 1Q8QA 4XDPA 2LW8A 2W3JA 1G8WA 3K4AA 4GJYA 1U5XA 4Y20A 1SFPA 3M3OA 4JAAA 2B8MA 4EN0A 3RRDA 1ULGA 1AXZA 5LASA 1VAMA 4KWUA 5FQ0B 4OHYA 1UAIA 2RJKA 1UWWA 2DVFA 3KV4A 1HB2A 4Y22A 2A70A 5KC6A 1Q8PA 1BJQA 5FP4A 4LMFA 1JOJA 5CZKA 3ZDVA 5FZBA 5LZ6A 4MADA 4S2FA 1ND3B 3HPNA 4LKDA 2RS51 3FE5A 4AR2A 4AF9A 2VULA 3C7GA 1Z7S1 3FHIB 2RR12 5FPVA 2I74A 5FPXA 2UY9A 1SFYA 3T4VA 2BPA2 4LKEA 3FUQA 1BK1A 2D6KA 2WZR3 1GNYA 1WBFA 3NV2A 3SEEA 1KXGA 2Y6JA 4PLNA 1JYNA 1A78A 4CU6A 2EALA 2WT2A 4LBNA 4MO3M 1W6MA 1ZA4A 1PVC3 4HN1A 1U5YA 5F6KA 5CG8A 3GZUC 1K5MB 3ZLIA 1OD5A 4AFCA 2BEOA 2DTYA 4O65A 5AC92 2OVUA 2WN2A 3MIEA 1WKYA 2PHRA 5FPBA 5GLUA 1PGL1 5SV8A 1QGLA 5K7PA 4GWNA 4IEUA 1MEC3 4XQ4A 2YPJA 1VAKA 5EJZB 4R52A 2FCTA 1HRI1 1IS6A 4DUWA 2W52A 2Z4FA 3H50A 2HWF2 1H2LA 2WJSA 2JEMA 1SEFA 1PZ7A 3T0AA 3MIDA 4AFAA 5IHRA 2F17A 3N3HA 3TOJA 3IPVA 2WT1A 3ZFFA 4UW3A 1LEDA 1ZBE3 2WO2A 1ULCA 4MYEA 4QM9A 4XTPA 1PMIA 1RUI1 2EIDA 3OGJA 4NN0A 3ZXDA 4BHPA 3WG1A 1VR3A 4N9HA 1R64A 2XJRA 1HB1A 2J1UA 2O8OA 3D5OA 3VZKA 1HRI2 5FCCA 1A8DA 1H2MA 3AZVA 5FZDA 3VBHB 4XHBA 3BKZA 1AYN3 1HLCA 3SH4A 1MS0A 3ZXGA 2MHFA 3B3QE 3APBA 3GJBA 3JD72 2W94A 2WO1A 2ZAHA 3VBSB 1K12A 1PGW1 3K48A 5F32A 2ADDA 3RMXA 3I97A 3THPA 4Q0UA 1X33A 5CKMA 2RDSA 4YFWA 1Y4WA 2W9XA 1APNA 1G86A 1QJFA 4RQPC 1D2SA 4NIHA 3AP4A 2A5ZA 3HR9A 3HN1A 4Y5SA 3M2MA 5KWRA 1X9PA 2HWB3 1GNHA 5GLTA 4V2WA 4QQLA 1F5JA 2ZEYA 5AC93 3AC0A 1AR71 3MIGA 4N7IA 1IOAA 1SCRA 5IK7A 5A80A 4FSJA 2PMWB 4S2HA 3MFAA 4BU2A 2J1RA 5DDJ1 2MPFA 2G19A 3RDIA 5K9YA 4Y1UA 1RUF2 3NKGA 3T1MA 3VBFB 5F3CA 3R6SA 1FPN2 2XWJB 3VBFC 2L9LA 1CESA 2R071 3IDEA 4JGZB 2HWD2 1J3PA 3ZFFC 3JB4C 4IDZA 1TME3 4OI0A 2D3RA 3CHXA 4ZPIA 5A3TA 4AVVA 1I9RA 1RMU2 2W2IA 4PT6A 4BMBA 3O1SA 1OLMA 1PO13 4OUEA 1X9TA 5DAPA 2IXLA 5F6LB 3ROUA 2WA4A 1GYKA 4O61A 5L7OA 2W47A 3EYPA 1QQP1 3GF6A 5LRRA 2WQ4A 1KFUL 1YJKA 3I3BA 4ISQA 4A6SA 1VBD2 4CZSA 5ACA3 4NWVA 1QJU3 3K4ZA 4CTEA 3D0SA 5BNNB 4YVSC 1ULDA 2VQUA 2JIJA 4BM8A 2VZTA 1SG3A 3A4UA 3DYOA 4IV3A 4R8HA 1ND3A 3UKNA 4Q0QA 3VBOA 5EJ3A 4DOUA 2XLFA 4M3CB 2ZGPA 5FMOS 2D6NA 5IAVA 1QY4A 2QQPA 2ET1A 3HT2A 1BXHA 4FOWA 4QKDA 4CDWB 1N1SA 2K46A 1N47A 4YWAA 3MBWA 1PHMA 2VD7A 2XG3A 4MGZE 3WW4A 1UYXA 2ZEWA 2FDKA 1UYPA 4WM7A 2JG9C 5FBJA 1CIWA 3I4IA 4DXSA 3K3NA 3H3ZA 3KT1A 3FMGA 5FIXA 1ASJ1 3C7HA 4IEYA 2UURA 3BYWA 2AACA 2C9KA 1XNAA 3C3VA 3A23A 4BH9A 4FFFA 4HANA 2DCZA 3LFIA 1LKNA 1D4M1 3D0JA 4BQXA 1AL22 2NZ9A 5CB7A 1VBA2 3AMHA 1RB8G 5DAQA 4O7XA 2XOMA 2QQOA 5C3RA 2BZDA 4LKFA 4U36A 5T5JA 5A70A 3RJRA 4L92A 2C0ZA 1PIV2 2VVFA 1Z78A 3D4KA 1IQAA 5ABJB 3S5AA 4EQVA 1C8M1 4XF9A 3ACLA 4AQ6A 3KV6A 1WCKA 4XFCA 2RDRA 4UF0B 3ITQA 4JKLA 3VL9A 5ACA1 1S2EA 4Q4Y3 1C5HA 3AP6A 3ACGA 4LA2A 4HETA 5IVCA 5LEKA 5BNNA 3QH7A 4R4ZA 4A4AA 4COWA 4F7ZA 4W50A 1ZA7A 1VRH3 4XDOA 4QX8A 3N35A 3ES1A 4XVHA 3IBMA 1G9DA 2ZOEB 3OD4A 4QXKA 4P02B 5HV4A 1MZEA 4GZ9A 1C8M3 1W8UA 4QX2A 5JPNB 1I1EA 3PVBB 4FXKB 4LUKA 4YGDA 2NM1A 4CXXA 2YG0A 1ONAA 1NKGA 1W9SA 4KWKA 5JUVA 3ZOIA 1NXD1 1DCSA 4RS5B 2QNKA 3DYPA 2LRPA 5LB6A 3L2HA 1LOGA 4OHXA 1O59A 1OF4A 2JE8A 1FATA 3V56A 1W8HA 2WZR1 4NHLA 2OX0A 4XABA 4XETA 4F3JA 1JYXA 3OPWA 3N4MA 1A6CA 2VZQA 1VIWB 2B9UA 3PMSA 1JYIA 4FPHA 4QX0A 3KVBA 3SISA 2GMMA 2YDEA 3U10A 4AVSA 1Q5OA 1GWMA 4WM7B 4GQ7A 4BB3A 1CAWA 1JMUB 1QXRA 3LEKA 4AHZA 4LUMA 4AEDA 4AI9A 2W1WA 1X8MA 2WFF3 1IPKA 4AVBA 3J7HA 4MGKE 2HWE2 2ZTNA 1XQNA 1AVBA 3I2FA 4RGAA 2WN3A 2VCMA 5LY2A 3H0OA 1BYHA 4AVCA 3SKVA 4J1XA 1NY72 5I0SA 5FYSA 4YVSA 2W5FA 2XHNA 4Y1VA 4PIXA 3SCGA 4AZZA 1W6NA 4ZKTB 3VHRA 1CAXA 1ZNPA 4NHYA 3FLTA 3H8UA 5I8YA 4Q4V2 1V6OA 4PI2A 5F39A 5GM0A 3WDTA 4XZPA 1JHJA 2ZKLA 1WW5A 4IGQA 3UJQA 1IG0A 3VLBB 2R061 5C3SA 4B1MA 2AH2A 4CUGA 2EICA 4YZ4A 4Q8KA 3A22A 3B7MA 5IVVA 5KHJA 1W6QA 3MIFA 2KXLA 1E57A 3I2IA 3OBZA 3UETA 5JMCA 1MS9A 2GNMA 3R4UA 4XDQA 4CU7A 5FYMA 4EZHA 1FMD2 4JTNA 4BQWA 3H7JA 3GZEA 5LRSA 1E5RA 4WVMB 5DPNA 2W1UA 3WQ1A 2OIIA 2WS92 2DU0A 3MIHA 2VTXA 4COYA 3H9AA 4XQWA 4AWDA 3NMBA 1RUH1 3O1OA 2FDJA 1A8MA 3H1WA 2YXSA 3OGSA 4BQ5A 1GZ9A 4GMP3 1RUF1 4QXCA 4NRPA 2R062 2JICA 3DPRC 4WM8C 5J1XA 4SBVA 5FY5A 2LS6A 4IV1B 3O5SA 4H3WA 3ZFEB 5A3PA 2OZJA 1DQ1A 2ZCWA 1RUNA 4ET7A 2RMU2 3RZJA 5A6XA 1JZ6A 4Y1XA 3B02A 4YG0A 4M3CF 2EIBA 4AEDB 3NV4A 5DAWA 2D44A 5KXDA 5C9AA 1W6NB 4IE4A 5FY1A 4QXHA 1BCXA 1O8PA 4PDWB 5JOXA 2PELA 1GWLA 3JZVA 4WZFA 2NPIA 3TNQA 2C1FA 4L11A 3SMHA 3VB9A 1S0GA 3BU7A 1NCQC 1HJFA 1POV3 1YNAA 3WDVA 3I2JA 3B9IA 4FO9A 3O14A 5JSPA 1PGL2 5E6HA 1ZM1A 3EMRA 1O8SA 1YI9A 5F9TA 4W8JA 1I3HA 3W5MA 2V4VA 1XU2A 3E5QA 3V64A 1XYPA 2VOXA 4Z2WA 3IWZA 1OKOA 3VBSA 4IEXA 5I0DA 1JU3A 1IS5A 2OKXA 1LU2A 3UK9A 3B93A 1RUJ2 5FO9B 2H6CA 3CEWA 2YGLA 3FLRA 5G05L 5T55A 2E7AA 4QPIC 3BOWA 1S0IA 2MNGA 4H2AA 1GOGA 3I2KA 3U37A 1VBD1 1XNDA 2VC9A 4MV2A 1IHMA 4R9CA 5I93A 4NHMA 1DQ5A 3WCRA 4IE6A 4CDUA 4IESA 4Q27A 4TYSA 1OOPB 2BGOA 1AR82 1TQ5A 2V09A 5JXJA 3DCQA 4N9IA 4Z8BA 2O14A 2P4EA 3UGHA 3QH6A 4Q26A 1HRV2 2E32A 1EUTA 2WNVC 3KCXA 4P9IA 5BNOA 4JKKA 5C8CB 1FOD2 4PJYA 4D0QA 2XLAA 3USUA 4CCJA 5CFDB 2PYTA 1L7RA 5L9BA 1EAH2 3BOPA 4HL0A 3RS6A 4C8DA 3O1TA 1AF9A 1Q56A 1Q8SA 3THDA 4LNVA 3AKTA 2CWMA 4XAEA 5JZGC 1GZTA 3DECA 2PA7A 4TZDA 2ZEZA 2P6CA 3VD3A 3DEMA 1CIYA 3MV11 1F5FA 4CPBD 1KJRA 4XXPA 5F37A 2VTFA 1D4M3 3BUCA 2UYAA 5LA0A 4N53A 1HRV1 3I49A 4FOQA 1YO8A 2XUMA 3MLLA 5EPAA 2G9FA 1Z0HA 3Q8FA 3LA2A 5TSWA 1AL0G 4B8EA 1ZRFA 1S55A 1YUDA 2WR9A 2XQXA 3A0NA 4HONA 4B1LA 1TNRA 3LDBA 5J37A 1IS3A 2DF7A 1V6LA 4M3CA 2CSGA 1CJDA 2DFCA 3OPTA 5FP9A 5KXCA 4UOJA 2UWBA 2VQTA 1QXPA 2IXJA 1R1A2 3H3UA 3ETPA 4G3YC 5FPUA 4LIUA 1AR91 5K0UA 3BCWA 4OYUA 2VOWA 5GZDA 4UFMA 2LROA 2GNBA 3KT7A 4NO4A 1RUJ1 3SNMA 1RUD3 4IV1A 2AR6A 3QACA 4HPKA 3C7OA 4RD7A 3WOGA 4GH4A 2W95A 1SDDB 5CG9A 3WNNA 4EZ4A 4DEVA 3AJYA 3GGLA 2RM23 1KEXA 4JTOA 3LQCA 4TLGA 3ZYRA 4CP9A 4YGEA 1W05A 1RMU1 2R0FA 2VU9A 4XQDA 1FNZA 4YARA 4KG0A 3AMPA 5GALA 2HBUA 4XAAA 4ATFA 2VUAA 1JODA 3OEAA 2W92A 3ZN5A 1LESA 4XBNA 5A7NA 2Q1MA 3AVRA 3HJRA 4QKFA 4UAPA 4FQ4A 5A7PA 2BVVA 2OUHA 1REEA 4QQOA 4FTSA 3AJZA 4FPKA 1UF2C 5EJ1B 1NCQA 2FZ1A 4XILA 4INDA 4AI0A 5HI0A 1QF3A 1RHI1 1WLDA 1RHI2 3USSA 1TNFA 4IEQA 2VW0A 5C70A 5FDBA 1D4M2 3N9PA 4XMIA
chains in the Genus database with same CATH topology
1W06A 1OC1A 5C3RA 1W28A 1RXGA 1W3XA 2CSGA 2IVJA 1UOFA 2Y60A 1UOBA 1W2AX 4XAEA 1UOGA 2VCMA 1BK0A 2IVIB 1E5RA 2VBPA 1W3VA 2VE1A 2DBIA 1E5IA 2BU9A 1IPSA 1DCSA 1W2OA 5APAA 3ZKUA 3ZOIA 1QJFA 1W2NA 1W03A 2BRTA 5C3PA 1ODMA 1UZWA 2BJSA 2Y6FA 1HJFA 1ODNA 1RXFA 1BLZA 3ZKYA 5C3OA 1HB4A 1HJGA 3OOXA 1W04A 1HB2A 2VBDA 2DBNA 1HB3A 1E5HA 2VBBA 2JB8A 1QIQA 1UO9A 3ON7A 1W9YA 4RGKA 1WA6X 5C3SA 2VAUA 2WO7A 1QJEA 1UNBA 2JB4A 1GP6A 1GP5A 1HB1A 4BB3A 5C3QA 1GP4A 1E5SA 1OBNA 1W05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W06 A;  1OC1 A;  5C3R A;  1W28 A;  1RXG A;  1W3X A;  2CSG A;  2IVJ A;  1UOF A;  2Y60 A;  1UOB A;  1W2A X;  4XAE A;  1UOG A;  2VCM A;  1BK0 A;  2IVI B;  1E5R A;  2VBP A;  1W3V A;  2VE1 A;  2DBI A;  1E5I A;  2BU9 A;  1IPS A;  1DCS A;  1W2O A;  5APA A;  3ZKU A;  3ZOI A;  1QJF A;  1W2N A;  1W03 A;  2BRT A;  5C3P A;  1ODM A;  1UZW A;  2BJS A;  2Y6F A;  1HJF A;  1ODN A;  1RXF A;  1BLZ A;  3ZKY A;  5C3O A;  1HB4 A;  1HJG A;  3OOX A;  1W04 A;  1HB2 A;  2VBD A;  2DBN A;  1HB3 A;  1E5H A;  2VBB A;  2JB8 A;  1QIQ A;  1UO9 A;  3ON7 A;  1W9Y A;  4RGK A;  1WA6 X;  5C3S A;  2VAU A;  2WO7 A;  1QJE A;  1UNB A;  2JB4 A;  1GP6 A;  1GP5 A;  1HB1 A;  4BB3 A;  5C3Q A;  1GP4 A;  1E5S A;  1OBN A;  1W05 A; 
#chains in the Genus database with same CATH topology
 3S0M A;  2WBK A;  4FPY A;  1B09 A;  3NJX A;  1OMI A;  5EYY A;  3VBR B;  1MVQ A;  3ACF A;  2YFZ A;  1MQT C;  4FVV A;  2H0B A;  2WNV A;  5BNO C;  1AYM 3;  2YMZ A;  4A42 A;  1TE1 B;  1OPM A;  4BK4 A;  4MUV A;  2PHX A;  2Q4S A;  3CNA A;  2J22 A;  5IUQ A;  1GR3 A;  4DXT A;  2JXA A;  1FOD 3;  5E89 A;  2AYH A;  1OPO A;  1CAU B;  4CEY C;  5IK4 A;  2XR4 A;  1G9A A;  1GSL A;  3RYR A;  1MZ6 A;  5JMO A;  3WW2 A;  3PU3 A;  1A34 A;  4QDR A;  3AKR A;  4CDU C;  3N7K A;  1DFQ A;  2VUD A;  2WSV A;  4IV1 C;  4C1X A;  1O4Z A;  2DDU A;  3KGZ A;  3QBQ A;  4QWN A;  3FUO A;  3DPR B;  1NCR C;  4W6X A;  1NG0 A;  2HWC 2;  1ZZC A;  3USU B;  1LHO A;  2RV9 A;  3POB A;  2FMY A;  4A2U A;  3LOB A;  2GP5 A;  1URX A;  5C7G A;  3KWV A;  1UIJ A;  4PF1 A;  1PO1 1;  1NY7 1;  3I2D A;  1IKP A;  1GQG A;  3HNB M;  4XFA A;  5FRE A;  4PDW C;  4XAC A;  2D6M A;  4C0H A;  4KMQ A;  4DRV A;  2C24 A;  2VL4 A;  1QJX 2;  4NRM A;  3ZFF B;  5CFC B;  5G04 L;  4E27 A;  2NP0 A;  2SBA A;  2JIG A;  2ZX3 A;  3ETQ A;  3WDY A;  1O4Y A;  4KQ7 A;  3TEY A;  4A44 A;  2CWS A;  3C7F A;  4RN5 A;  4XFG A;  2ES3 A;  2RDN A;  5HBA A;  2YY1 A;  1LOE A;  1I5P A;  1JI6 A;  5ACA 2;  3PL0 A;  2ATF A;  2WAB A;  4GJZ A;  4E8D A;  1Z7S 3;  3QOP A;  4CCO A;  1PK6 C;  2CAU A;  3ZIW A;  3A0K A;  2A71 A;  2E53 A;  3BN6 A;  2V5Y A;  2WWS A;  2Y6F A;  2BOJ A;  4YG3 A;  4L97 A;  1BMV 2;  1HB4 A;  2DVD A;  4FPE A;  3PIJ A;  4P00 B;  1ZX5 A;  3BI3 A;  3Q8B A;  3KV5 A;  5A1F A;  4KWJ A;  5HXV A;  1ULO A;  1Y9Q A;  4HK8 A;  1XOY A;  2PLV 3;  3WSO A;  1K3I A;  1LRH A;  1VAL A;  2WAA A;  1W0O A;  5IFT A;  3LWC A;  2HWD 3;  4Y1Y A;  4CRQ A;  2N7G A;  1QEX A;  3PHM A;  1TMF 1;  2ZGS A;  1YQ8 A;  3ZR6 A;  5AFE A;  5CA6 A;  5KHG A;  1VBA 3;  1H8T B;  3M3E A;  1ZRD A;  3N9Q A;  1JYC A;  1ULF A;  2VMH A;  1W2O A;  4BQ4 A;  1AR6 2;  3LA3 A;  4XFB A;  5T5P A;  2ZGM A;  4GAZ A;  4UWD A;  2B9V A;  5F8P A;  1EV1 1;  3NWK A;  1RUE 1;  1CZT A;  1LUL A;  1DG6 A;  1QJU 2;  1S2K A;  3AYC A;  3LOI A;  2FDF A;  4HG6 B;  1UPI A;  3BTA A;  3FHA A;  4ZXK A;  3CKH A;  3VDC A;  1LTE A;  4ONU A;  3P3P A;  4Q4Y 2;  3UL2 A;  3ILR A;  4IV3 B;  2X5I C;  2VCA A;  3VBR C;  3GDB A;  3VBH C;  3DF0 A;  1BBT 2;  2XJQ A;  2X5I B;  4EWA A;  3MEP A;  4Q0P A;  1JZ2 A;  4PI0 A;  1H1A A;  1LGN A;  1T6G C;  3EB7 A;  3IZO A;  1N1V A;  2VBP A;  4S2D A;  1RUG 2;  1MS1 A;  1YIF A;  2RR1 3;  3SCH A;  3VHN A;  4A7Z A;  4E2S A;  2BBA A;  3FN9 A;  3WDW A;  2FCV A;  4AEK A;  3GHM A;  3H3L A;  4CCD A;  5AVP A;  2LAL A;  3K75 B;  1R09 1;  5FYI A;  4BIS A;  1D7P M;  4CDU B;  3T2P A;  2K9Z A;  3OOX A;  3SC7 X;  1W04 A;  4NID A;  4Q4V 1;  5KXB A;  1AL2 3;  1COV 2;  3K46 A;  5FYH A;  2ZML A;  1PO2 3;  1W0P A;  2JB4 A;  2Q0A A;  3DPR A;  3SCF A;  1TMF 3;  3DGT A;  1RUD 1;  1VP6 A;  1OF3 A;  2YHJ A;  3SH5 A;  4JVA A;  2VMI A;  4RHV 3;  4AHX A;  4BLI A;  4RL7 A;  1VJ2 A;  3J9S A;  1YFU A;  3FZ3 A;  4XJU A;  4R9A A;  5A6Q A;  3MF6 A;  1EPZ A;  2XQR A;  2OQ6 A;  3KS7 A;  4KG8 A;  3WHT A;  4EN7 B;  1FAY A;  1POQ A;  1AYN 1;  1RUG 1;  5DUU A;  2BBV A;  2BU9 A;  1WLT A;  2G9G A;  1C1L A;  1F4H A;  2XL7 A;  3R4D B;  4MXW A;  4QPG B;  4PQQ A;  3WQ7 A;  1K45 A;  1QDO A;  1UY3 A;  2WYS A;  2Q30 A;  3OY8 A;  3P1I A;  3UNP A;  1XE8 A;  2PN5 A;  3HD8 B;  2VQ0 A;  5A3O A;  2XVL A;  4LBM A;  3PU8 A;  5FMO L;  5GZG A;  4BQ1 A;  1MS4 A;  3GBW A;  3VDD C;  1F35 A;  2R04 2;  2R04 1;  4BZ4 A;  5A32 A;  5ISL A;  2F4P A;  1Z7S 2;  3PVO A;  3VKO A;  1DF0 A;  5JI7 A;  1KRI A;  3KD4 A;  2JEC A;  4XXA A;  5FZ9 A;  2FDH A;  2VUC A;  4FXG B;  3TWI A;  3WW1 A;  4FCA A;  4QGL A;  4X6Q B;  3JD7 3;  4CDW C;  2QQJ A;  3VKN A;  5FPZ A;  1BZW A;  3MW3 A;  1FT9 A;  1QOS A;  2IFR A;  2YC2 A;  3M3C A;  1N3Q A;  1OLQ A;  1C5I A;  2IZW A;  1MEC 2;  4LE4 A;  1H1I A;  4SLI A;  1C57 A;  1POV 0;  1QNY A;  1Y7B A;  2VZ1 A;  2CY6 A;  2WS9 3;  3LD8 A;  3J7M A;  1OOP A;  5ERL A;  4NHX A;  4HSL A;  2R1B A;  2WFF 2;  3GBF A;  5IJR A;  1QJY 2;  1JZ4 A;  3GCW A;  4TSV A;  4YYO A;  1V6K A;  3III A;  5C3Q A;  3VD4 A;  4U2A A;  2AGS A;  2UWA A;  1UOJ A;  2LUW A;  1YFW A;  1AR7 3;  2WWJ A;  1HDK A;  4E4H A;  1FYU A;  5FJK A;  2P3Y A;  4Q29 A;  3RPQ A;  2A6Z A;  2R0H A;  3SIT A;  2JE9 A;  4MHR A;  2AC1 A;  2QBX A;  2VZS A;  4OUL A;  4P9G A;  4DO0 A;  3OGG A;  1G7Y A;  1FPN 3;  4NUB A;  4LBJ A;  3WZ1 A;  3ST7 A;  2VY0 A;  3NQH A;  4JDM A;  2KR2 A;  4RR3 B;  5I8S A;  4Q0V A;  1W6O B;  1W6P B;  4XF3 A;  2GC1 A;  3D6E A;  4CUC A;  1PMJ X;  3TEW A;  3A7Q A;  3POI A;  5FZI A;  4Y22 B;  4FOV A;  4K7J A;  1E5S A;  4F8A A;  3NW4 A;  4N53 B;  3OTF A;  3WT3 A;  1CGP A;  1V6M A;  1WZX A;  2V73 A;  2VNR A;  1UIK A;  1FV2 A;  4QMA A;  2CGP A;  3O7O A;  1F9K A;  3PUQ A;  4LUL A;  2XH6 A;  2EXK A;  1JYW A;  1S4C A;  3FL7 A;  1JN2 P;  5FZG A;  2NLR A;  1OVP A;  4CEW C;  4CYD A;  1YQ5 A;  2A3W A;  2ZZQ A;  3ZFG A;  1QWR A;  2JJ6 A;  5K8S A;  4C1W A;  3CLP A;  5KBF A;  1IQD C;  3CIH A;  5F2S A;  4JC1 A;  1DGR A;  1QQP 3;  4XJZ A;  1VBE 3;  3NNG A;  3MIC A;  4COZ A;  1UXX X;  2RR1 1;  4R9B A;  1RVF 1;  3Q8E A;  4RS5 A;  3CJX A;  2LTN A;  2JG9 A;  1AX1 A;  1HX6 A;  4Z82 A;  3WCS A;  4HBN A;  3MDP A;  2BWC A;  4D7T A;  3PUR A;  4E2Q A;  2YV8 A;  4MGT A;  5T52 A;  4AG4 A;  1RUH 2;  3E6D A;  4LJH A;  1JOP A;  4M4P A;  1MEC 1;  2ARX A;  3ATG A;  4V1P A;  3BTY A;  1UY1 A;  2WL1 A;  3WQB A;  1UOF A;  2RM2 1;  4N43 C;  1W8O A;  4HK9 A;  3EHK A;  1CZV A;  1RMU 3;  3DYM A;  4I3P A;  4JZR A;  1X50 A;  5FKC A;  1J1L A;  1RUE 3;  4IUG A;  4LO5 B;  4Y26 A;  4IEP A;  4QDS A;  2FD8 A;  4J1W A;  2C6S A;  2O0O A;  2ZS6 B;  1UZW A;  2EXH A;  2RMU 1;  1UXZ A;  2VGD A;  2YBS A;  2ADE A;  3LB9 A;  3U78 A;  3ZSJ A;  5FUI A;  3OYW B;  3HWJ A;  3B69 A;  3NKT A;  4K40 A;  3IAQ A;  3BAL A;  4RSU A;  5FZM A;  3Q9O A;  2YZ4 A;  4M0H A;  4OUS A;  3AZZ A;  1UZY A;  2NMO A;  1REF A;  4GAL A;  2R32 A;  3CU7 A;  4PQ9 A;  1YQ2 A;  2ZGR A;  1O91 A;  4CDX A;  2QQL A;  1UD1 A;  2ARA A;  1JS9 A;  1UL9 A;  4QAW A;  2Y0O A;  3VBU A;  4A41 A;  2Y64 A;  3N7M A;  3OGV A;  4QQP A;  1AR9 3;  4XUT A;  4YM3 A;  5J09 A;  2BP6 A;  5GKA C;  4YRD A;  3VBH A;  2GSY A;  1XU1 A;  1UX6 A;  4H7L A;  4MX3 A;  5DZG A;  3QD6 A;  3RFR A;  2WNU C;  2PFW A;  1SHW B;  3RWK X;  4CCL A;  3MF9 A;  3SQO A;  3ZVX A;  3ZN4 A;  4ASL A;  1OKQ A;  4H14 A;  1KJL A;  1JW6 A;  3W20 A;  4AYU A;  2A1X A;  3L9J T;  4R4X A;  5IW0 A;  2Y33 A;  3S5Q A;  1QH6 A;  1HN0 A;  3HBZ A;  1AXY A;  1H30 A;  1QXJ A;  2CGN A;  3ASI A;  3LEI A;  4LO4 B;  2FDI A;  3INA A;  1RUC 2;  5FRA A;  2WZP P;  4XF4 A;  1ZBE 1;  4ZHN A;  2X29 A;  2QE3 A;  3ZM8 A;  3VUO A;  1PIV 3;  1OBN A;  1RUI 3;  2OUJ A;  4BPZ A;  1AL2 1;  4D6R A;  1LOC A;  1QH7 A;  1R09 2;  2R7E B;  1RC6 A;  4N43 A;  5FWJ A;  5CYY A;  4YW4 A;  1RUH 3;  4BE3 A;  1UQX A;  2P3J A;  3B9C A;  3WNM A;  5C6C A;  3VDB A;  2IVI B;  2VME A;  4AGV A;  5FZ3 A;  1RJ8 A;  3HQX A;  4UFL A;  3MPB A;  3OYW A;  2CHH A;  4K1Z A;  3FC0 A;  1LCL A;  2R07 3;  1SBD A;  4BCU A;  1WWY A;  5IT6 A;  1FMD 1;  3I59 B;  3LIH A;  4K20 A;  2ZKN A;  2X5I A;  5DDJ 3;  4MGQ A;  4BIO A;  3KCC A;  2DVB A;  4LA3 A;  4IXL A;  2HLE A;  1DP0 A;  1DGR N;  2DVG A;  4AL9 A;  5CVR A;  4LBL A;  1W0N A;  5LK7 B;  1SBE A;  3AYD A;  2PHF A;  3WHU A;  3W59 A;  2Y38 A;  3KCY A;  3ZFG B;  1U0A A;  1ZRR A;  3H8X A;  1U5I A;  1JZ8 A;  3R4S A;  4OI1 A;  1CAV B;  3FX3 A;  4D69 A;  2QQN A;  2NMN A;  2A73 B;  1S2B A;  4YZ3 A;  1HN1 A;  1WCQ A;  1O3Q A;  4UBG A;  5IK5 A;  2A6Y A;  2ZBJ A;  1SZB A;  5IAT A;  5EV7 A;  3AFG A;  3B01 A;  4I02 A;  5EQU A;  1BHG A;  3TAY A;  1AX2 A;  4KH9 A;  3ZYG A;  2TEP A;  3LPG A;  4QHB A;  1PZ8 A;  3VGI A;  1NA1 C;  2J7M A;  3LKJ A;  3ZYB A;  4CCN A;  5A7W A;  5A7O A;  3U14 A;  3WQ0 A;  3O12 A;  5FYT A;  1UY2 A;  1SLC A;  2ARB A;  3OJB A;  3WG3 A;  2QFE A;  5LCW L;  2ZHL A;  2PHW A;  4EWE A;  4IW3 A;  5CBL A;  4ZXE A;  1PX3 A;  3KHC A;  3LCP A;  1BMV 1;  1DYP A;  1KIT A;  3GJA A;  1VE0 A;  3IPV B;  4LLO A;  2B5H A;  2EVX A;  2XJP A;  1K42 A;  4XUN A;  5FZ1 A;  3UES A;  1SLT A;  4QPY A;  1JUI A;  3AXE A;  4UFJ A;  3K4D A;  3G7D A;  1LOF A;  4ORF A;  3OD0 A;  4QM8 A;  3RZZ A;  1T2X A;  4WVW A;  2OYZ A;  5DAX A;  2BTV C;  2JWP A;  5FO8 B;  2Z2S B;  3PJQ A;  1RUO A;  4EN6 B;  2X53 S;  2KD7 A;  1PGS A;  2VCC A;  2ORX A;  3I59 A;  2OQ7 A;  2OT7 A;  1JZ7 A;  3TN9 1;  4IE0 A;  2AEZ A;  3CMG A;  1ACC A;  3DV8 A;  4ZU5 A;  3ZSM A;  2CAV A;  2KA3 A;  3U75 A;  1Y9G A;  2Y34 A;  3E1F 1;  2BWA A;  1OT5 A;  1ZZ8 A;  5A1L A;  4XYX A;  2WDB A;  3GYD A;  5BY5 A;  1EV1 3;  1WCS A;  1JH5 A;  1RVF 3;  3MV0 1;  3AYE A;  3CJI C;  3TEX A;  4MG2 A;  5GLV A;  2XJU A;  4CDX C;  2WT0 A;  4BQY A;  1HW5 A;  2A6V A;  1PNF A;  1QMJ A;  4YZ5 A;  3NNF A;  2XHK A;  5FY7 A;  3THC A;  4NIA A;  2VEC A;  3N36 A;  1W8W A;  1WMD A;  5CAD A;  1SPP A;  4GWM A;  1C4R A;  4FAH A;  5J98 B;  1O5U A;  3POE A;  2BGP A;  1LEC A;  4IER A;  2DU1 A;  5FZO B;  3J7N A;  3ABZ A;  5LA2 A;  1N3P A;  4NII A;  3N9L A;  3HQU A;  5C9A B;  1CAW B;  4JQT A;  2D93 A;  4L2N A;  1JXN A;  1M4W A;  2PLV 1;  4WM7 C;  3ZYF A;  4BYY A;  1SLB A;  3H8R A;  2BW8 A;  3WUD A;  1BK0 A;  3IT8 A;  1G6N A;  1GZC A;  2FBE A;  4AQ2 A;  4ES8 A;  4LEJ A;  5D8A B;  2OS2 A;  1PX4 A;  3OSD A;  1ENR A;  3PLQ A;  3TYJ A;  2Z5W A;  4MLO A;  1W90 A;  2ZZJ A;  3T08 A;  2JD4 A;  1J3Q A;  2XKP A;  3EBR A;  2W91 A;  3VDD B;  2PHU A;  2QZ3 A;  4LQR A;  5J7M A;  4TXW A;  1C28 A;  2VBB A;  5E88 A;  3GCX A;  2PQS A;  5FV3 A;  1CX1 A;  1W2T A;  2DV9 A;  2W68 A;  4ISR A;  3WVJ A;  4RR3 A;  3ZFG C;  3E5U A;  4IE7 A;  1W9T A;  4L9B A;  2OPK A;  3RVH A;  3WF3 A;  1CD3 G;  4QPW A;  1OD3 A;  5FPL A;  4D3W A;  3POG A;  4XOG A;  4EN9 B;  3TEZ A;  1KDM A;  4YM0 A;  4Q2F A;  4OCT A;  4LTA A;  5T5O A;  5C8W A;  2K0G A;  4NE9 A;  4OVE A;  1BBT 3;  4CPB A;  4C91 A;  1O3R A;  2VXJ A;  5JIU A;  1QJY 1;  3A21 A;  1S0E A;  3DL3 A;  5FAX A;  4LKS A;  3OCP A;  1FI2 A;  5CKQ A;  4ZZ8 A;  4JGY B;  1YXW A;  2WZE A;  4NAO A;  1DHK B;  4O9E A;  3MFC A;  3S7I A;  4XEZ A;  3MUZ 1;  4WVM A;  2YU1 A;  4ZZ5 A;  2CGO A;  1HJG A;  1AJK A;  4FI9 A;  2ZEX A;  1HXS 2;  1W8F A;  4I0A A;  4QGN A;  3IN9 A;  4GKY A;  3WNK A;  4LO8 A;  4FOY A;  4WM8 A;  2ERF A;  3V0B B;  1EPW A;  1DLL A;  4CEY A;  4GH4 C;  4NVP A;  3D82 A;  3OUH A;  1WME A;  1SAC A;  2DCY A;  5IVF A;  4KWL A;  2CTV A;  2GAU A;  4K21 A;  5LEJ A;  4Q8L A;  5F2W A;  1DQ2 A;  5JIA A;  4I2O A;  2I45 A;  1PVC 1;  2O1Q A;  3OB8 A;  4FPO B;  1AR6 3;  4YG6 A;  5H9Q A;  3GNE A;  3UYJ A;  2F4L A;  3HOB A;  4F83 A;  4LHS A;  4XJW A;  1BLZ A;  4E4D X;  5L7O C;  3ENR A;  3ZYH A;  2JDU A;  4XBQ A;  4XIO A;  4Q5O A;  2F6B A;  4DFS A;  1CJP A;  4OI2 A;  4RHV 1;  4PCR A;  3I2H A;  2K2S A;  1WA6 X;  1S0J A;  3WNL A;  5FQ0 A;  1POV 1;  4LBK A;  4IE5 A;  2QVS B;  3AMN A;  5J36 A;  2HEV F;  2WZ8 A;  5SV5 A;  2XPJ A;  1GQP A;  1ND3 C;  1UPS A;  1EV1 2;  1R1A 3;  4AHY A;  1NX9 A;  1NE4 A;  1H8V A;  1RIR A;  5FP8 A;  1RVF 2;  2PHT A;  5LW9 A;  4KU7 A;  1QJU 1;  3DKQ A;  4CDX B;  5CIR A;  4TLF A;  3VL8 A;  2GC2 A;  1SFN A;  2XJV A;  2VOV A;  4FPJ A;  5E1R A;  4W4Z A;  3ES4 A;  3NRU A;  3KLS A;  1W8Z A;  5C3P A;  1YHF A;  3JBG 2;  2JG8 A;  4AQT A;  3UKV A;  2H6B A;  4D94 A;  3V0B A;  3CBN A;  1NOV A;  4XCA A;  3ZO0 B;  2DUP A;  1YYN A;  2H0V A;  2RM2 2;  3J4U H;  4JRL A;  5KR7 A;  4WV8 A;  1ND2 B;  2VO5 A;  4CP9 B;  1W9W A;  3TNP B;  4CXY A;  1LAJ A;  5DG2 A;  1UMI A;  1UNB A;  2D5F A;  1AHS A;  2ID4 A;  1AXK A;  5CIS A;  4N43 B;  1HXS 3;  4L8Q A;  2B42 B;  2JG9 B;  3P5B A;  5GJ6 A;  5FZF A;  2GME A;  3RZL A;  1X8E A;  2WNO A;  4CA9 A;  4XFF A;  4DY3 A;  2QZ2 A;  3IM0 A;  1HIX A;  4Q4X 3;  1HQN A;  1UZZ A;  2HWC 3;  3N9O A;  4AI8 A;  4QX7 A;  4S2G A;  4DIQ A;  2XLG A;  1S0B A;  2ORZ A;  3OF1 A;  3HBK A;  1CN1 A;  4OLL A;  1W6Q B;  1F2N A;  3ON7 A;  3PVN A;  4IV3 C;  4QPG A;  4ES9 A;  1GZW B;  3OEB A;  4NRO A;  3ELN A;  3NAP B;  1DIW A;  1EAH 1;  1UU4 A;  3WV6 A;  1ASJ 3;  2QQK A;  3U11 A;  3W21 A;  1VRH 2;  1W3X A;  3AX4 A;  2IVJ A;  1OVS A;  3IDC B;  4PIZ A;  3SHR A;  4LXL A;  3O1V A;  3AMQ A;  3OPZ A;  5AVA A;  3UKT A;  4URT A;  1VB4 A;  3IKW A;  1X7N A;  1OA4 A;  1WUV A;  2EIG A;  3BB6 A;  4KBZ A;  4DY5 A;  4NPL A;  4CEW A;  4ARX A;  1AR8 1;  2ILM A;  1JBC A;  4WM8 B;  5F1R A;  2RG4 A;  1BVP 1;  4RFR B;  1CPN A;  1QOO A;  4Y24 A;  2BYV E;  3JUU A;  4K9S A;  3POW A;  5JR2 A;  1ZBA 1;  2VTX J;  2WLQ A;  3V0A A;  1VAV A;  2CYF A;  1JZ3 A;  3PTY A;  2NQY A;  1AR7 2;  3RG0 A;  4LK7 A;  4WVZ A;  1JOB A;  2UU8 A;  4Z1V A;  1O3S A;  3IDA A;  2GZW A;  4RGG A;  4OQ8 A;  2A3Y A;  1MR5 A;  5FXV A;  5L9R A;  2Q8O A;  3POS A;  2KM2 A;  3WF4 A;  5FBZ A;  3UJO A;  4QQH A;  3KGL A;  1XNK A;  5A33 A;  2YPD A;  1BQP A;  4GA9 A;  4ATE A;  1BBT 1;  1YC6 1;  1RL3 A;  3GZA A;  3M1H A;  5E16 A;  4BQ3 A;  4JV4 A;  1UCX A;  2RS1 2;  1AZD A;  1RIT A;  2GH2 A;  4CU9 A;  4Q0S A;  1S1A A;  1RED A;  5DZF A;  1G9F A;  2VMG A;  2VM9 A;  4YVW B;  2VNV A;  3MUY 1;  3OY8 B;  3BIE A;  4I0W B;  4AVT A;  1OI6 A;  5CFD C;  2FZ2 A;  4Q4W 3;  4NRQ A;  2GND A;  2D7F A;  4QX1 A;  2XON A;  5H9R A;  3HAG A;  1J84 A;  2Y60 A;  3AL5 A;  4HZF A;  4E9K A;  2JG8 B;  3NL1 A;  4CDW A;  1Y9M A;  2XDV A;  3JCI A;  1MPX A;  4QHZ A;  4QB6 A;  1AR9 2;  1IZ3 A;  1OSG A;  3PUA A;  3SKJ E;  1VB2 A;  2Q1Z B;  5C71 A;  4K8R B;  2WNV B;  3NVC A;  2WNU A;  3MYX A;  4JGY C;  4PIY A;  5DAB A;  4ASK A;  4B3N A;  1RUG 3;  2J1V A;  1OUS A;  3MLJ A;  1P8J A;  2DCK A;  4DPN A;  5FZ8 A;  2ZGQ A;  4XTM A;  1OUR A;  2E51 A;  2DUQ A;  4COV A;  1SLL A;  1C3H A;  4XZU G;  1VRB A;  1DYK A;  1F15 A;  2XGX A;  2YB7 A;  5FOB B;  3WP6 A;  4XF0 A;  2C9A A;  4JX0 A;  3RZH A;  5IFP A;  1SPP B;  4CE8 A;  4LO6 B;  3AM2 A;  4G4F A;  4YFZ A;  1OQ1 A;  1PO2 1;  1XXN A;  5DUV A;  5JPM B;  2VVD A;  1GOH A;  5I0R A;  4AI3 A;  3GHN A;  4BWO A;  2J1S A;  4NR1 A;  4A3Z A;  1TZO A;  1YEW A;  1MS3 A;  2EIE A;  3RZK A;  1RUF 3;  4Q4V 3;  3WDX A;  1OXC A;  2UY8 A;  4DXR A;  1YI7 A;  1STM A;  3J7L A;  4YW7 A;  2VNG A;  3BGA A;  4M0N A;  1IKQ A;  2P3K A;  1F8V A;  4LOR A;  1CVN A;  1XNT A;  3U4X A;  4IEW A;  1ZZ9 A;  2RS3 1;  1AYN 2;  4RGK A;  3C7E A;  5JAX A;  2IWG B;  2W1Q A;  3MO4 A;  5D21 A;  2RDQ A;  3WP5 A;  2D3S A;  5CFC A;  4Q1P A;  1FMD 3;  2BFU S;  3MPP G;  1IS4 A;  3ORJ A;  5C3O A;  5JOZ A;  3I8T A;  1OLR A;  1UY0 A;  4CCC A;  3WIN E;  3QLQ A;  4L0P A;  1H6Y A;  4N53 C;  2X05 A;  2VW2 A;  2VPV A;  4K3U A;  3ECQ A;  3F2Z A;  3KVA A;  3U4S A;  2XBO 3;  2DTW A;  2IC1 A;  4LBO A;  4P9X A;  5FMB A;  2XVK A;  2ETE A;  4AEM A;  1CX4 A;  2DBI A;  4CSW A;  4CDQ B;  3DUI A;  4QGM A;  3F95 A;  4BLJ A;  2ZXQ A;  1US3 A;  3V0A B;  4HPK B;  1COV 3;  2R06 3;  1OHF A;  1PM7 A;  4J6G A;  4W6Y A;  1LHU A;  1K5M C;  1LOD A;  2IXK A;  5K0U B;  5FMC A;  1D2Q A;  1TMF 2;  1W6M B;  1XYN A;  2GAL A;  4L99 A;  4P9J A;  3WR0 A;  4OHV A;  4B7K A;  2WKK A;  1AR8 3;  4GWJ A;  1ENS A;  3U07 A;  5FXW A;  1R1A 1;  1GLH A;  1W9Y A;  4M4R A;  1PMH X;  2HJI A;  1W8T A;  4TN7 A;  5L19 A;  4P9W A;  3RWN A;  3Q8A A;  1OH3 A;  2IFW A;  5H9S A;  5C9A C;  1HRV 3;  3ZXL A;  2UYB A;  3TN9 2;  2WC2 A;  1I6X A;  4Z07 A;  3LZZ A;  2DWR A;  1NCR A;  2JD9 A;  1V9U 1;  3HIF A;  4HOO A;  5FK8 A;  5I8T A;  2GH8 A;  4AI1 A;  4P9L A;  2YBP A;  1KGY A;  3UT0 A;  1DZR A;  1US2 A;  4ZU4 A;  1LU1 A;  1GFF 2;  2VG9 A;  1WW4 A;  4PBP A;  4YVW C;  2ZMN A;  1AJO A;  3R05 A;  2VOK A;  1JU4 A;  1OFN A;  2OA2 A;  2ZX0 A;  4XJ8 A;  2J1A A;  5JDB A;  4BOW A;  3G6J B;  5JXI A;  3LA7 A;  4PLO A;  2W08 A;  3B5L B;  1LOB A;  3N9N A;  4AW7 A;  4M01 A;  5GZC A;  4YNI A;  4MOA A;  3NNM A;  2VVE A;  4AFB A;  2JDY A;  1G9C A;  4Q4X 1;  3W9A A;  1WMF A;  3AP9 A;  1HV1 A;  4CDQ A;  1UZV A;  1UKR A;  4FPC A;  3VD5 A;  4PLM A;  3BVC A;  4YPJ A;  4FP3 A;  4NPR A;  2BER A;  4NOT A;  2XBO 2;  4A7Y A;  1VBC 2;  1ND2 A;  3VD9 A;  3ACH A;  3VBU C;  1QJY 3;  5JOY A;  1V6I A;  3GAL A;  2E7T A;  2OXB A;  3Q8C A;  4JGY A;  2LM3 A;  3VKF C;  5BNP B;  5BNP C;  4JHT A;  1AUY A;  5LY1 A;  4DS0 A;  2JDK A;  5IK8 A;  3E5X A;  1D0G A;  1VBA 1;  1NCR B;  4KU8 A;  4X8P A;  5A7W B;  5B2G B;  2ZAC A;  1C1F A;  3THT A;  1WW7 A;  1EP0 A;  2PAM A;  3VHO A;  4FFI A;  4PDW A;  4KGQ A;  2G1M A;  2RS5 3;  5FZL A;  3ZSL A;  2JKB A;  1NLS A;  3KMH A;  3KV9 A;  4AED C;  2ZX1 A;  2HWE 3;  3AKP A;  4DRR A;  2VZO A;  3ZYJ B;  4NWW A;  1O3T A;  4YM1 A;  4FPL A;  3EJK A;  4IQP A;  5FYZ A;  2WII B;  1D0H A;  5ANQ A;  1AYM 1;  4FTE A;  2HWE 1;  4WZC A;  4CCM A;  5L9V A;  3PIG A;  5DQ0 A;  3AMM A;  2IXH A;  4LT5 A;  1LNS A;  4DEQ A;  2RE9 A;  2HEW F;  2WWU A;  5FZC A;  2CV6 A;  5JOW A;  3M8L A;  5I0T A;  5EIY B;  1W28 A;  1B35 A;  1RHI 3;  2R6Q A;  1W8N A;  2JDZ A;  4XW3 A;  4AFM A;  5BNN C;  4JKM A;  4TWT A;  1QQP 2;  3ZPO A;  1RUC 1;  3MW4 A;  1W3V A;  4KGG A;  3P3N A;  2XXZ A;  2Q8C A;  3W5N A;  3LDK A;  2D3P A;  1ND2 C;  1ZVF A;  3VZJ A;  3IMN A;  2ZGK A;  4ITC A;  4FFG A;  3JQW A;  4E8C A;  2GN3 A;  3OUJ A;  5BNO B;  3ZXF A;  2TBV A;  5FZE A;  4CCE A;  4FT8 A;  1DGW A;  2V72 A;  3POY A;  5CFD A;  1TME 1;  1ENX A;  4XFI A;  2DBN A;  1VBC 3;  2BDR A;  2G9Z A;  2YU2 A;  3FLP A;  5KHK A;  2CU5 A;  1KS5 A;  3K77 A;  3PTR B;  4JDO A;  1VMH A;  3HEI A;  3T09 A;  4DUX A;  4BME A;  5CKN A;  4YGC A;  4Y3O A;  1F4A A;  2EA7 A;  4P9Y A;  2NN8 A;  3U1X A;  5AC9 1;  4MGS A;  2D43 A;  3LAG A;  2P37 A;  3J26 N;  2BVB A;  3ACI A;  1DLC A;  2VNO A;  4LE3 A;  1OLM E;  3AL6 A;  5A33 B;  1XJA A;  2DUR A;  4MZU A;  4MH0 E;  4OI4 A;  2D5H A;  5KC5 A;  3I2O A;  3EXU A;  2I2S A;  4UF0 A;  1XNB A;  2E7Q A;  2D6P A;  4OMC A;  4XBL A;  3N9M A;  2HWB 1;  1LR5 A;  4YW2 A;  1V9U 3;  3CZU A;  3UGF A;  1RXF A;  5ABJ A;  5J3U A;  4IEV A;  5EHD A;  3KM5 A;  1OUX A;  3WNP A;  3NAP C;  3O1M A;  4ZY9 A;  5IYY A;  4AVA A;  2FDG A;  2VZ3 A;  2QQM A;  3AZX A;  1QJX 3;  1QDC A;  4XE9 A;  2XVG A;  1W9F A;  3VBS C;  2BGC A;  5F5I A;  4D7Y A;  1PZ9 A;  3E6B A;  1GZW A;  2ZHK A;  4LLF A;  5LA1 A;  5LAT A;  2Y8K A;  4BXS V;  4EJR A;  4QPI A;  5LBC A;  1NE6 A;  1ULP A;  4QQ2 A;  1PM4 A;  1FPN 1;  3VBU B;  3CJI A;  3KT4 A;  3RNS A;  1MZ5 A;  3T2Q A;  3M3Q A;  1MQT A;  3V65 A;  2ZX4 A;  4K6B A;  1RIN A;  2DUO A;  4MGY E;  5IVE A;  1NLR A;  1PNG A;  1NA1 A;  3JBG 1;  1G9B A;  2ZGT A;  4Y4Y A;  1X82 A;  3EQE A;  2JEN A;  3AP5 A;  4LIV A;  2RVA A;  4PHZ A;  1DGL A;  2IXI A;  4X8N A;  3O0X A;  2YC4 A;  4N90 A;  3J8F 2;  4CDQ C;  1PVC 2;  3T0D A;  1BEV 2;  5A7S A;  2X8K A;  5FXX A;  4W6W A;  2VAU A;  2WO7 A;  4QU2 A;  4XJA A;  3I54 A;  2FCU A;  1C8N A;  3MHZ A;  4LPL A;  5BNP A;  4A3X A;  2X09 A;  3IB3 A;  2ZJC A;  1TVG A;  2D6L X;  2BQP A;  5EZW A;  5FUN A;  5C5T A;  2XML A;  2BV4 A;  3OBA A;  1KQR A;  2DCJ A;  4IET A;  3R0R A;  1W39 A;  1YFX A;  1N1Y A;  1HXS 1;  3CO2 A;  4G9S B;  3ZDS A;  1HQW A;  1WW6 A;  2Y26 A;  1RYY A;  4MXV A;  3ZXK A;  3WNX A;  3DKW A;  3H1M A;  4QHO A;  2HH9 A;  3JU9 A;  2HWF 3;  5F5A A;  1VBB 3;  3I3M A;  5AFB A;  4Q4X 2;  2IXC A;  1OFS A;  1JYV A;  1J3R A;  3N7J A;  4YVS B;  3GZT B;  3RI8 A;  3HNY M;  1QOT A;  4GUL A;  2GC0 A;  4CUB A;  4B7E A;  2HEY F;  3DXU A;  3AXD A;  5DUX A;  1ZBE 2;  3K2O A;  1V70 A;  4QPI B;  4AXO A;  4ARY A;  1ZBA 3;  3AZW A;  2CDP A;  1QU0 A;  5BPX A;  5CU1 A;  3AKS A;  4I09 A;  1YIP A;  4M00 A;  1NQJ A;  1RXG A;  4Y5Z 0;  5LK5 A;  4GB3 1;  3KF3 A;  2D98 A;  3M3I A;  3BIW E;  4D8M A;  5T3N A;  2WYF A;  1V0A A;  5EWS A;  2WFF 1;  4NIG A;  1GIC A;  1L7L A;  1PVX A;  1WCD J;  1GOF A;  2NYY A;  4LR4 A;  3VBR A;  1SBF A;  3ZXE A;  1CAV A;  3H8O A;  1RGS A;  4LOS A;  4MSV A;  3T0B A;  4FQZ A;  3TRS B;  3UGG A;  1GUI A;  1ZZB A;  2YUE A;  3NO8 A;  2E63 A;  2DVA A;  2PLV 2;  4WBB A;  1WA4 A;  1LEN A;  2V5D A;  4Y4R A;  4ZS3 A;  1WLW A;  5I91 A;  2VUJ A;  3LEM A;  1I5Z A;  4LBQ A;  3FBY A;  4XHX A;  2PXJ A;  5HCH A;  1XE0 A;  4UFK A;  4OMD A;  4HKO A;  1Q8V A;  1BEV 3;  1DQ0 A;  3PME A;  4QB2 A;  5HCF A;  2Q8D A;  1XE7 A;  3SXW A;  3WXP A;  2P5B A;  5DXD A;  3ZFE C;  2FHR A;  2E6V A;  3KHB A;  3NV3 A;  4OFG A;  4LK6 A;  2V4A A;  4OZX A;  4I30 A;  2QJV A;  4QXB A;  2YFU A;  2MEV 2;  3L2Y A;  5FWE A;  1V9U 2;  1FV3 A;  1JZ5 A;  5DUW A;  4YW3 A;  3VBF A;  2PQQ A;  4KL1 A;  3ZN6 A;  1YWK A;  2Q8E A;  5L7O B;  1LHV A;  1L3J A;  2EXI A;  3RQ0 A;  5KHH A;  1OQD A;  1HRI 3;  2JDH A;  1YCI A;  2XWB B;  3MI8 A;  4QU1 A;  2P3I A;  1EYB A;  1VBB 2;  2ZAA A;  5GLW A;  1Q43 A;  1QJE A;  4QD2 A;  5FO7 B;  2Y6H A;  4BA6 A;  4I0B A;  3ZSK A;  5A1A A;  1IGO A;  3LEG A;  2YC0 A;  3AB0 A;  1KFX L;  5GZE A;  1S0C A;  1DDL A;  4B4P A;  5E8A A;  4B4Q A;  5BNQ A;  3U0Z A;  4CEW B;  1ZBA 2;  1W2U A;  3B94 A;  4HKL A;  2PHL A;  4Q4W 2;  4AEJ A;  1XNC A;  5FLI A;  3HN3 A;  3WUC A;  4N8M A;  1GWK A;  5FZ4 A;  1IPS A;  4K1Y A;  5JVV A;  3WD5 A;  5HPO A;  1JTZ X;  5K0U C;  1U5Z A;  1NT0 A;  4LHL A;  3EO6 A;  2Y0I A;  3KZ4 C;  2SLI A;  4EN8 B;  1J83 A;  3BPZ A;  3BTZ A;  2J1T A;  2XJS A;  4D6Q A;  1PGW 2;  4K8F A;  3IDB B;  3JB8 A;  4OQ9 A;  1LOA A;  5T5L A;  2QDN A;  1X36 A;  4H55 A;  4LIT A;  1FX5 A;  1H9P A;  1NXM A;  4JDN A;  1WLC A;  3PVE A;  4UYB A;  4D7S A;  5D2A A;  5C8C C;  2PAE A;  1TME 2;  1XSQ A;  3I3E A;  1W2A X;  3VKL A;  1GNZ A;  4GB3 2;  2W1S A;  3AP7 A;  2VE1 A;  3LFM A;  1T6B X;  3PUH A;  5JWP A;  4IEO A;  1ST8 A;  5FLJ A;  3T2O A;  1H2K A;  1AR6 1;  1QJZ A;  2XKO A;  3CF6 E;  4UI9 L;  4CVU A;  4B4R A;  5JZG B;  1H4H A;  4OZO A;  4YVW A;  1B35 C;  1OA3 A;  1XPW A;  2QTW B;  4V2V A;  5ABJ C;  3B00 A;  5EXO A;  2HWC 1;  1YLL A;  2WNE A;  4CCK A;  1QKQ A;  5F7U A;  2VQA A;  3K3O A;  4NMI A;  3MZH A;  2JDM A;  3WNO A;  1ZRE A;  1R08 1;  4YW1 A;  5CAZ A;  3CZJ A;  2C26 A;  3N7L A;  5FXZ A;  4JQR A;  1GP5 A;  5IWF A;  3ZMN A;  2XBO 1;  5FK7 A;  2WFP A;  4A45 A;  1Q8O A;  2BNN A;  2Y6K A;  2VMD A;  5CEH A;  2RS1 1;  4FPF A;  1OH4 A;  1WD4 A;  2E9Q A;  2VOT A;  5FYY A;  4YZ2 A;  5FP7 A;  4DB5 A;  5A3N A;  4HXC A;  3RYP A;  1EUU A;  1KDK A;  3T30 A;  1O7F A;  4ZU7 A;  4NAM A;  4FTB A;  1YRZ A;  1W2N A;  2OPW A;  2CDO A;  1UKG A;  1ULE A;  2J1E A;  2ZPX A;  4IGP A;  4A6O A;  2WZR 2;  4GH4 B;  4P5H A;  3CQO A;  4R9D A;  3T1L A;  4JCK A;  5BXX A;  3JBG 3;  1K5M A;  5EP9 A;  3ZIX A;  5FZA A;  1SLA A;  3BU0 A;  2EF6 A;  2VZU A;  4BXF A;  2YBK A;  2B7Y A;  5H9P A;  5T54 A;  3BOD A;  2QKD A;  4P14 A;  3H1Y A;  4BDV B;  3HQR A;  1UY4 A;  2AZ5 A;  4IEZ A;  5IVJ A;  5C4W B;  2VXR A;  3CDZ B;  1O5L A;  1EY2 A;  4CUA A;  1RTV A;  4LHK A;  1N3O A;  2RJ2 A;  5M0T A;  4MXW B;  3QCW A;  1OQE A;  1MAC A;  3GBG A;  1W03 A;  3HMY A;  4GB3 3;  4XIK A;  3ZX7 A;  5C5U A;  4HKW A;  4O9G A;  1CQ9 A;  4KI5 M;  3GM8 A;  2QCS B;  5FLH A;  2WUH A;  3PDQ A;  5T50 A;  1C8M 2;  2ZAB A;  3ILN A;  3OGR A;  5BUV A;  4LO7 A;  3VKM A;  2W0X A;  1NZC A;  1GU3 A;  2ZMK A;  2WIN B;  4DQA A;  2EAA A;  5JCT A;  5FTT C;  1DQ6 A;  1VBE 2;  5FYC A;  2JG8 C;  5HXM A;  3OUI A;  2VMF A;  2EXJ A;  1ZRI A;  5JLV A;  3AK0 A;  5F3E A;  1LEM A;  2R16 A;  2Y6L A;  3T4H B;  2GMP A;  1S0D A;  5C8C A;  5EYX A;  1VRH 1;  3AVS A;  5FFO C;  4NHK A;  4DIN B;  4FAG A;  1JUH A;  1GQH A;  4JRA A;  4UFH A;  3FFZ A;  1KD7 A;  3VV1 A;  2GDF A;  2PTM A;  1N1T A;  1XB9 A;  3PJY A;  1UYY A;  3RJ2 X;  4Q4Y 1;  2B45 X;  3GXU A;  4LBQ D;  4MET A;  1TEI A;  1J59 A;  4MGI E;  2BOI A;  4NJ4 A;  2WAO A;  2ZGU A;  2QQW A;  4JGZ A;  4ERO A;  4BK5 A;  2VH9 A;  3AKQ A;  4YZ1 A;  5FMD A;  5HV0 A;  1HKD A;  1H6X A;  4XC9 A;  5CNA A;  3VD7 A;  1DGW X;  3ZYI B;  2GP3 A;  4I01 A;  1UU6 A;  2FQP A;  5JZG A;  4LHN A;  1OA2 A;  2Y6G A;  4RYD A;  3RZM A;  1Q3E A;  1GAN A;  3LGR A;  4RA0 A;  5HCA A;  2B4K A;  1DBN A;  1ODN A;  2D40 A;  1LGB A;  3RYK A;  3I2G A;  1AX0 A;  4BIF A;  4EE2 A;  3ZSE A;  3I3D A;  4BQ2 A;  3NAP A;  3WF0 A;  4FFH A;  5CFC C;  2HWD 1;  4J25 A;  3RMY A;  1H0B A;  2E33 A;  1GP6 A;  1W6O A;  1FOD 1;  1W6P A;  2GC3 A;  4Y5T A;  3LSE A;  5A3W A;  4CP1 A;  5JI9 A;  1F31 A;  2BNM A;  2JKX A;  2AEN A;  3E6C C;  3FFQ A;  4E2G A;  2I07 B;  3FJS A;  2D6O X;  1UOB A;  4C90 A;  4XCB A;  1UN1 A;  2GN7 A;  3WF1 A;  2CNA A;  3C2U A;  2HWB 2;  3NJZ A;  5A6Z A;  3VBO B;  3ZXJ A;  1WCU A;  3ZPY A;  3E97 A;  4AQS A;  3ZKY A;  1O6U A;  5JXH A;  1PO2 2;  3BTX A;  3I3Q A;  1ENQ A;  2YGM A;  3RSJ A;  1PK6 B;  4Q4W 1;  2RJL A;  4JHZ A;  1BVV A;  4YM2 A;  1Y43 B;  5LWB A;  1WD3 A;  4RHV 2;  4XMA A;  3TBD A;  3MLK A;  1GMM A;  2QQV A;  2VJX A;  3URF A;  5KXE A;  4GXL A;  3H42 B;  1BKZ A;  1NYW A;  2WS9 1;  3DN7 A;  2VR4 A;  4GMP 1;  4W65 A;  4AI2 A;  2B46 X;  1VPH A;  2RS5 2;  2ZGL A;  1VBC 1;  1NLQ A;  3FWE A;  4JGZ C;  1A3K A;  1OC1 A;  2DYC A;  3JQX A;  2A7A A;  4TTG A;  2HYK A;  2IUW A;  2Q5T A;  3K51 A;  3JD7 1;  4UXA A;  3PUI A;  1XC6 A;  5D8A C;  4DNY A;  3ZN6 B;  1GBG A;  5L73 A;  1JYT A;  4QX5 A;  1LB2 A;  2R07 2;  5EFU A;  5FZH A;  1ZYB A;  2RS1 3;  1CAX B;  1H8T C;  3NNL A;  1PO1 2;  2A3X A;  4UBH A;  1UX7 A;  3PNA A;  4HVR A;  2CL2 A;  5APA A;  1SCS A;  5FKB A;  3RI9 A;  3VDD A;  3OBR A;  1D4V B;  1JHN A;  3WP4 A;  5A3L A;  2R30 A;  2VMC A;  1VBD 3;  1WBL A;  1FXZ A;  2TUN A;  4QKB A;  5DN2 A;  4X6R B;  1PIV 1;  2R04 3;  2JB8 A;  2XL9 A;  3P6B A;  1TG7 A;  1IG3 A;  1B35 B;  1RJ7 A;  1CON A;  2Z42 A;  3HT1 A;  5FY0 A;  4YW5 A;  4AOC A;  1H4G A;  1XYO A;  1YQ6 A;  1DYO A;  3HNM A;  4OHZ A;  4P08 A;  3W58 A;  2E26 A;  3KQ4 B;  4EV0 A;  2C5D A;  4QB1 A;  4XUP A;  1HV0 A;  2OW4 A;  2Q1F A;  3PUS A;  2HBT A;  2FMD A;  1NUK A;  2P17 A;  2WNU B;  2VZP A;  3D8C A;  3WG2 A;  3JXS A;  2VCB A;  4AGG A;  3KSC A;  3O0W A;  4ZS2 A;  4AE2 A;  2W39 A;  4HN0 A;  4WVV A;  2ET7 A;  2UWC A;  4XPV A;  3ZXA C;  4C0B A;  2RHP A;  4CEY B;  2Z79 A;  5B4N A;  2C4X A;  4UFI A;  4Y33 A;  1W99 A;  1EAH 3;  4CP2 A;  1SMV A;  1MVE A;  3I7D A;  4DMI A;  3LDR A;  3VZL A;  3FBM A;  4XFH A;  4COU A;  5A3M A;  3M4F A;  4AFD A;  3MGU A;  1V6J A;  4XF1 A;  3LF7 A;  3H7Y A;  3NJV A;  2WQ8 A;  3O0V A;  5D1I A;  3LPF A;  4GIQ A;  1GKB A;  3ALQ A;  4MHU A;  5J48 A;  1UMH A;  2XB6 C;  3AYA A;  1V6N A;  3WW3 A;  1H1M A;  3X29 B;  2HKX A;  4IL7 A;  4OHW A;  4UW5 A;  5BV6 A;  1U12 A;  2WA3 A;  4P5Y A;  2QQI A;  1MZF A;  2PHD A;  5F5C A;  3TN9 3;  4RR3 C;  1UU5 A;  1DQ4 A;  2JDA A;  2W46 A;  5FP3 A;  1NCQ B;  2BFU L;  1ZZ7 A;  4E4Z A;  1QHD A;  2P2K A;  1SLI A;  2WSU A;  2WQZ C;  1S0F A;  4GD4 A;  4HVQ A;  4XUO A;  1CR7 A;  2ENR A;  2A6X A;  3ZR5 A;  1E5H A;  4UW6 A;  2YYO A;  1UO9 A;  5FOJ B;  1R08 2;  2GU9 A;  4CU8 A;  2QUO A;  3DXT A;  1WMX A;  2ARE A;  5K4L A;  4LOT A;  2J42 A;  2ZHM A;  1VMF A;  3IAP A;  5GZF A;  5L36 A;  4QX3 A;  3UV9 A;  2PAK A;  3VBO C;  1BEV 1;  4EYU A;  5A32 B;  5I0U A;  4H7M A;  5DAV A;  1ALY A;  3SEP A;  1OOP C;  2BNO A;  4CP0 A;  3S30 A;  3J8F 3;  3ZKU A;  1PK6 A;  3MIB A;  3VDA A;  1CAU A;  1YQC A;  2BJS A;  2W87 A;  1CZS A;  1MQT B;  5JSO A;  3OBT A;  1H9W A;  3M7A A;  2P1B A;  4ZON A;  3WG4 A;  1XBF A;  1NA1 B;  1O4T A;  2JX9 A;  1MS8 A;  2JDP A;  4YW6 A;  2JDN A;  4HVO A;  2RS3 2;  3POF A;  3TB0 A;  2R1D A;  2BUK A;  5FJH A;  4DUV A;  4UT5 A;  3O1R A;  3AFK A;  4CXW A;  4YGB A;  5C4W A;  4I3G A;  3BPS A;  1W06 A;  1FNY A;  4FP2 A;  1RUE 2;  5FUP A;  4Y20 B;  5DG1 A;  3J8F 1;  3ZFE A;  2QDR A;  5J96 B;  3SLI A;  5IVY A;  4EWD A;  5FZ7 A;  1RUI 2;  2RMU 3;  5IAX A;  1LJ7 A;  1R09 3;  2DCT A;  1E5I A;  2R49 A;  5A6Y A;  1XSR A;  4XUR A;  3T2T A;  5HCB A;  1XRU A;  1ODM A;  5LBE A;  4HT1 T;  2WLP A;  4RFT 0;  3RGB A;  3ZYP A;  3M70 A;  3VZN A;  1LGC A;  2A6W A;  3OG2 A;  2OZ6 A;  4QDQ A;  1YJL A;  3KF5 A;  4KNC A;  5LBF A;  3VZM A;  4GMP 0;  4YSF A;  5C33 A;  1UYZ A;  4PBO A;  3ZMO A;  2D97 A;  4XJ9 A;  4MVT A;  3LSD A;  5KHI A;  1UW8 A;  1ZZ6 A;  3NNJ A;  4XUQ A;  4DZG A;  1AYM 2;  1R08 3;  4FBF A;  1ZRC A;  2B39 A;  3KQR A;  4RQP B;  4FPG A;  1IPJ A;  1MS5 A;  3D3A A;  5LA9 A;  5A7Q A;  1UOG A;  5FY8 A;  2AEY A;  2ZX2 A;  5F5Q A;  1SDW A;  4UW4 A;  4E4S A;  1H2N A;  3KB5 A;  4B29 A;  1RUJ 3;  5FZK A;  2AUY A;  3WDU A;  3SH3 A;  4AHW A;  2BRT A;  3WEZ A;  3CJI B;  5FYV A;  1RUC 3;  5FZ6 A;  4HMZ A;  3NV1 A;  5IVB A;  1J58 A;  4RS5 C;  3VN4 A;  1QNW A;  2XUE A;  3IMM A;  2VZV A;  4IGO A;  3S7E A;  5A3U A;  5DMY A;  4HLT A;  3ME2 A;  4QT6 A;  5BYN A;  1NAE A;  2HYX A;  4Y1Z A;  3RZG A;  5C4W C;  3T3Y A;  2Z69 A;  2MEV 3;  4LBQ B;  1H8T A;  5B4X A;  2E31 A;  1WGP A;  4D6S A;  1QJX 1;  2JE7 A;  2ZGN A;  5FZO A;  4KBB A;  1CWP A;  5FPA A;  1R1Z A;  4OUM A;  4QKN A;  5D8A A;  2WRA A;  1Y3T A;  4QPG C;  3O1U A;  2A75 A;  2X10 A;  1HQL A;  4NPM A;  4Q1R A;  4AAP A;  5JXG A;  5DDJ 2;  4HFS A;  2QQU A;  4A7K A;  2XJT A;  5JR7 B;  3VHP A;  5FZ0 A;  2ZHN A;  4AGR A;  1VLN A;  2VBD A;  5FY9 A;  2MEV 1;  3WX5 A;  2YRO A;  2VW1 A;  5FYB A;  2GNT A;  1COV 1;  5LBB A;  4AAX A;  2ZGO A;  4M3C E;  1LOF C;  5F3G A;  5FY4 A;  3LE0 A;  1UMZ A;  4RQP A;  2G4I A;  2TNF A;  1GP4 A;  1DZQ A;  3IIA A;  3CL1 A;  3POJ A;  4URA A;  2ARC A;  4Z92 B;  1L7Q A;  5F3I A;  2EAK A;  5GLZ A;  3VZO A;  2HWF 1;  3WF2 A;  5FR3 A;  1M06 G;  4ASM B;  4DXZ A;  3S57 A;  4HSJ A;  1VBB 1;  3ILF A;  1K5J A;  3NST A;  1ASJ 2;  1NZI A;  1LHN A;  2P6H A;  2P34 A;  3O1P A;  1VMJ A;  1CPM A;  2RS3 3;  1GV9 A;  3LIG A;  4N7U A;  3C8X A;  5ANN A;  3MW2 A;  1NQD A;  4BJ0 A;  4Z2A A;  1DZT A;  1SQ4 A;  3WP3 A;  3AZY A;  1HB3 A;  1DU3 D;  4YLZ A;  2VZR A;  1QIQ A;  1J1T A;  2ZA9 A;  5FYU A;  1LHW A;  1VBE 1;  4GWI A;  3WY6 A;  4AK3 A;  4GKX A;  3WLU A;  1UZ0 A;  1RUD 2;  5DZE A;  3FHQ A;  3NJY A;  5JSR A;  3S6P A;  4PF5 A;  3HVD A;  1KS4 A;  1YFY A;  2DFB A;  1V00 A;  2WO3 A;  2O8Q A;  1Q8Q A;  4XDP A;  2LW8 A;  2W3J A;  1G8W A;  3K4A A;  4GJY A;  1U5X A;  4Y20 A;  1SFP A;  3M3O A;  4JAA A;  2B8M A;  4EN0 A;  3RRD A;  1ULG A;  1AXZ A;  5LAS A;  1VAM A;  4KWU A;  5FQ0 B;  4OHY A;  1UAI A;  2RJK A;  1UWW A;  2DVF A;  3KV4 A;  1HB2 A;  4Y22 A;  2A70 A;  5KC6 A;  1Q8P A;  1BJQ A;  5FP4 A;  4LMF A;  1JOJ A;  5CZK A;  3ZDV A;  5FZB A;  5LZ6 A;  4MAD A;  4S2F A;  1ND3 B;  3HPN A;  4LKD A;  2RS5 1;  3FE5 A;  4AR2 A;  4AF9 A;  2VUL A;  3C7G A;  1Z7S 1;  3FHI B;  2RR1 2;  5FPV A;  2I74 A;  5FPX A;  2UY9 A;  1SFY A;  3T4V A;  2BPA 2;  4LKE A;  3FUQ A;  1BK1 A;  2D6K A;  2WZR 3;  1GNY A;  1WBF A;  3NV2 A;  3SEE A;  1KXG A;  2Y6J A;  4PLN A;  1JYN A;  1A78 A;  4CU6 A;  2EAL A;  2WT2 A;  4LBN A;  4MO3 M;  1W6M A;  1ZA4 A;  1PVC 3;  4HN1 A;  1U5Y A;  5F6K A;  5CG8 A;  3GZU C;  1K5M B;  3ZLI A;  1OD5 A;  4AFC A;  2BEO A;  2DTY A;  4O65 A;  5AC9 2;  2OVU A;  2WN2 A;  3MIE A;  1WKY A;  2PHR A;  5FPB A;  5GLU A;  1PGL 1;  5SV8 A;  1QGL A;  5K7P A;  4GWN A;  4IEU A;  1MEC 3;  4XQ4 A;  2YPJ A;  1VAK A;  5EJZ B;  4R52 A;  2FCT A;  1HRI 1;  1IS6 A;  4DUW A;  2W52 A;  2Z4F A;  3H50 A;  2HWF 2;  1H2L A;  2WJS A;  2JEM A;  1SEF A;  1PZ7 A;  3T0A A;  3MID A;  4AFA A;  5IHR A;  2F17 A;  3N3H A;  3TOJ A;  3IPV A;  2WT1 A;  3ZFF A;  4UW3 A;  1LED A;  1ZBE 3;  2WO2 A;  1ULC A;  4MYE A;  4QM9 A;  4XTP A;  1PMI A;  1RUI 1;  2EID A;  3OGJ A;  4NN0 A;  3ZXD A;  4BHP A;  3WG1 A;  1VR3 A;  4N9H A;  1R64 A;  2XJR A;  1HB1 A;  2J1U A;  2O8O A;  3D5O A;  3VZK A;  1HRI 2;  5FCC A;  1A8D A;  1H2M A;  3AZV A;  5FZD A;  3VBH B;  4XHB A;  3BKZ A;  1AYN 3;  1HLC A;  3SH4 A;  1MS0 A;  3ZXG A;  2MHF A;  3B3Q E;  3APB A;  3GJB A;  3JD7 2;  2W94 A;  2WO1 A;  2ZAH A;  3VBS B;  1K12 A;  1PGW 1;  3K48 A;  5F32 A;  2ADD A;  3RMX A;  3I97 A;  3THP A;  4Q0U A;  1X33 A;  5CKM A;  2RDS A;  4YFW A;  1Y4W A;  2W9X A;  1APN A;  1G86 A;  1QJF A;  4RQP C;  1D2S A;  4NIH A;  3AP4 A;  2A5Z A;  3HR9 A;  3HN1 A;  4Y5S A;  3M2M A;  5KWR A;  1X9P A;  2HWB 3;  1GNH A;  5GLT A;  4V2W A;  4QQL A;  1F5J A;  2ZEY A;  5AC9 3;  3AC0 A;  1AR7 1;  3MIG A;  4N7I A;  1IOA A;  1SCR A;  5IK7 A;  5A80 A;  4FSJ A;  2PMW B;  4S2H A;  3MFA A;  4BU2 A;  2J1R A;  5DDJ 1;  2MPF A;  2G19 A;  3RDI A;  5K9Y A;  4Y1U A;  1RUF 2;  3NKG A;  3T1M A;  3VBF B;  5F3C A;  3R6S A;  1FPN 2;  2XWJ B;  3VBF C;  2L9L A;  1CES A;  2R07 1;  3IDE A;  4JGZ B;  2HWD 2;  1J3P A;  3ZFF C;  3JB4 C;  4IDZ A;  1TME 3;  4OI0 A;  2D3R A;  3CHX A;  4ZPI A;  5A3T A;  4AVV A;  1I9R A;  1RMU 2;  2W2I A;  4PT6 A;  4BMB A;  3O1S A;  1OLM A;  1PO1 3;  4OUE A;  1X9T A;  5DAP A;  2IXL A;  5F6L B;  3ROU A;  2WA4 A;  1GYK A;  4O61 A;  5L7O A;  2W47 A;  3EYP A;  1QQP 1;  3GF6 A;  5LRR A;  2WQ4 A;  1KFU L;  1YJK A;  3I3B A;  4ISQ A;  4A6S A;  1VBD 2;  4CZS A;  5ACA 3;  4NWV A;  1QJU 3;  3K4Z A;  4CTE A;  3D0S A;  5BNN B;  4YVS C;  1ULD A;  2VQU A;  2JIJ A;  4BM8 A;  2VZT A;  1SG3 A;  3A4U A;  3DYO A;  4IV3 A;  4R8H A;  1ND3 A;  3UKN A;  4Q0Q A;  3VBO A;  5EJ3 A;  4DOU A;  2XLF A;  4M3C B;  2ZGP A;  5FMO S;  2D6N A;  5IAV A;  1QY4 A;  2QQP A;  2ET1 A;  3HT2 A;  1BXH A;  4FOW A;  4QKD A;  4CDW B;  1N1S A;  2K46 A;  1N47 A;  4YWA A;  3MBW A;  1PHM A;  2VD7 A;  2XG3 A;  4MGZ E;  3WW4 A;  1UYX A;  2ZEW A;  2FDK A;  1UYP A;  4WM7 A;  2JG9 C;  5FBJ A;  1CIW A;  3I4I A;  4DXS A;  3K3N A;  3H3Z A;  3KT1 A;  3FMG A;  5FIX A;  1ASJ 1;  3C7H A;  4IEY A;  2UUR A;  3BYW A;  2AAC A;  2C9K A;  1XNA A;  3C3V A;  3A23 A;  4BH9 A;  4FFF A;  4HAN A;  2DCZ A;  3LFI A;  1LKN A;  1D4M 1;  3D0J A;  4BQX A;  1AL2 2;  2NZ9 A;  5CB7 A;  1VBA 2;  3AMH A;  1RB8 G;  5DAQ A;  4O7X A;  2XOM A;  2QQO A;  5C3R A;  2BZD A;  4LKF A;  4U36 A;  5T5J A;  5A70 A;  3RJR A;  4L92 A;  2C0Z A;  1PIV 2;  2VVF A;  1Z78 A;  3D4K A;  1IQA A;  5ABJ B;  3S5A A;  4EQV A;  1C8M 1;  4XF9 A;  3ACL A;  4AQ6 A;  3KV6 A;  1WCK A;  4XFC A;  2RDR A;  4UF0 B;  3ITQ A;  4JKL A;  3VL9 A;  5ACA 1;  1S2E A;  4Q4Y 3;  1C5H A;  3AP6 A;  3ACG A;  4LA2 A;  4HET A;  5IVC A;  5LEK A;  5BNN A;  3QH7 A;  4R4Z A;  4A4A A;  4COW A;  4F7Z A;  4W50 A;  1ZA7 A;  1VRH 3;  4XDO A;  4QX8 A;  3N35 A;  3ES1 A;  4XVH A;  3IBM A;  1G9D A;  2ZOE B;  3OD4 A;  4QXK A;  4P02 B;  5HV4 A;  1MZE A;  4GZ9 A;  1C8M 3;  1W8U A;  4QX2 A;  5JPN B;  1I1E A;  3PVB B;  4FXK B;  4LUK A;  4YGD A;  2NM1 A;  4CXX A;  2YG0 A;  1ONA A;  1NKG A;  1W9S A;  4KWK A;  5JUV A;  3ZOI A;  1NXD 1;  1DCS A;  4RS5 B;  2QNK A;  3DYP A;  2LRP A;  5LB6 A;  3L2H A;  1LOG A;  4OHX A;  1O59 A;  1OF4 A;  2JE8 A;  1FAT A;  3V56 A;  1W8H A;  2WZR 1;  4NHL A;  2OX0 A;  4XAB A;  4XET A;  4F3J A;  1JYX A;  3OPW A;  3N4M A;  1A6C A;  2VZQ A;  1VIW B;  2B9U A;  3PMS A;  1JYI A;  4FPH A;  4QX0 A;  3KVB A;  3SIS A;  2GMM A;  2YDE A;  3U10 A;  4AVS A;  1Q5O A;  1GWM A;  4WM7 B;  4GQ7 A;  4BB3 A;  1CAW A;  1JMU B;  1QXR A;  3LEK A;  4AHZ A;  4LUM A;  4AED A;  4AI9 A;  2W1W A;  1X8M A;  2WFF 3;  1IPK A;  4AVB A;  3J7H A;  4MGK E;  2HWE 2;  2ZTN A;  1XQN A;  1AVB A;  3I2F A;  4RGA A;  2WN3 A;  2VCM A;  5LY2 A;  3H0O A;  1BYH A;  4AVC A;  3SKV A;  4J1X A;  1NY7 2;  5I0S A;  5FYS A;  4YVS A;  2W5F A;  2XHN A;  4Y1V A;  4PIX A;  3SCG A;  4AZZ A;  1W6N A;  4ZKT B;  3VHR A;  1CAX A;  1ZNP A;  4NHY A;  3FLT A;  3H8U A;  5I8Y A;  4Q4V 2;  1V6O A;  4PI2 A;  5F39 A;  5GM0 A;  3WDT A;  4XZP A;  1JHJ A;  2ZKL A;  1WW5 A;  4IGQ A;  3UJQ A;  1IG0 A;  3VLB B;  2R06 1;  5C3S A;  4B1M A;  2AH2 A;  4CUG A;  2EIC A;  4YZ4 A;  4Q8K A;  3A22 A;  3B7M A;  5IVV A;  5KHJ A;  1W6Q A;  3MIF A;  2KXL A;  1E57 A;  3I2I A;  3OBZ A;  3UET A;  5JMC A;  1MS9 A;  2GNM A;  3R4U A;  4XDQ A;  4CU7 A;  5FYM A;  4EZH A;  1FMD 2;  4JTN A;  4BQW A;  3H7J A;  3GZE A;  5LRS A;  1E5R A;  4WVM B;  5DPN A;  2W1U A;  3WQ1 A;  2OII A;  2WS9 2;  2DU0 A;  3MIH A;  2VTX A;  4COY A;  3H9A A;  4XQW A;  4AWD A;  3NMB A;  1RUH 1;  3O1O A;  2FDJ A;  1A8M A;  3H1W A;  2YXS A;  3OGS A;  4BQ5 A;  1GZ9 A;  4GMP 3;  1RUF 1;  4QXC A;  4NRP A;  2R06 2;  2JIC A;  3DPR C;  4WM8 C;  5J1X A;  4SBV A;  5FY5 A;  2LS6 A;  4IV1 B;  3O5S A;  4H3W A;  3ZFE B;  5A3P A;  2OZJ A;  1DQ1 A;  2ZCW A;  1RUN A;  4ET7 A;  2RMU 2;  3RZJ A;  5A6X A;  1JZ6 A;  4Y1X A;  3B02 A;  4YG0 A;  4M3C F;  2EIB A;  4AED B;  3NV4 A;  5DAW A;  2D44 A;  5KXD A;  5C9A A;  1W6N B;  4IE4 A;  5FY1 A;  4QXH A;  1BCX A;  1O8P A;  4PDW B;  5JOX A;  2PEL A;  1GWL A;  3JZV A;  4WZF A;  2NPI A;  3TNQ A;  2C1F A;  4L11 A;  3SMH A;  3VB9 A;  1S0G A;  3BU7 A;  1NCQ C;  1HJF A;  1POV 3;  1YNA A;  3WDV A;  3I2J A;  3B9I A;  4FO9 A;  3O14 A;  5JSP A;  1PGL 2;  5E6H A;  1ZM1 A;  3EMR A;  1O8S A;  1YI9 A;  5F9T A;  4W8J A;  1I3H A;  3W5M A;  2V4V A;  1XU2 A;  3E5Q A;  3V64 A;  1XYP A;  2VOX A;  4Z2W A;  3IWZ A;  1OKO A;  3VBS A;  4IEX A;  5I0D A;  1JU3 A;  1IS5 A;  2OKX A;  1LU2 A;  3UK9 A;  3B93 A;  1RUJ 2;  5FO9 B;  2H6C A;  3CEW A;  2YGL A;  3FLR A;  5G05 L;  5T55 A;  2E7A A;  4QPI C;  3BOW A;  1S0I A;  2MNG A;  4H2A A;  1GOG A;  3I2K A;  3U37 A;  1VBD 1;  1XND A;  2VC9 A;  4MV2 A;  1IHM A;  4R9C A;  5I93 A;  4NHM A;  1DQ5 A;  3WCR A;  4IE6 A;  4CDU A;  4IES A;  4Q27 A;  4TYS A;  1OOP B;  2BGO A;  1AR8 2;  1TQ5 A;  2V09 A;  5JXJ A;  3DCQ A;  4N9I A;  4Z8B A;  2O14 A;  2P4E A;  3UGH A;  3QH6 A;  4Q26 A;  1HRV 2;  2E32 A;  1EUT A;  2WNV C;  3KCX A;  4P9I A;  5BNO A;  4JKK A;  5C8C B;  1FOD 2;  4PJY A;  4D0Q A;  2XLA A;  3USU A;  4CCJ A;  5CFD B;  2PYT A;  1L7R A;  5L9B A;  1EAH 2;  3BOP A;  4HL0 A;  3RS6 A;  4C8D A;  3O1T A;  1AF9 A;  1Q56 A;  1Q8S A;  3THD A;  4LNV A;  3AKT A;  2CWM A;  4XAE A;  5JZG C;  1GZT A;  3DEC A;  2PA7 A;  4TZD A;  2ZEZ A;  2P6C A;  3VD3 A;  3DEM A;  1CIY A;  3MV1 1;  1F5F A;  4CPB D;  1KJR A;  4XXP A;  5F37 A;  2VTF A;  1D4M 3;  3BUC A;  2UYA A;  5LA0 A;  4N53 A;  1HRV 1;  3I49 A;  4FOQ A;  1YO8 A;  2XUM A;  3MLL A;  5EPA A;  2G9F A;  1Z0H A;  3Q8F A;  3LA2 A;  5TSW A;  1AL0 G;  4B8E A;  1ZRF A;  1S55 A;  1YUD A;  2WR9 A;  2XQX A;  3A0N A;  4HON A;  4B1L A;  1TNR A;  3LDB A;  5J37 A;  1IS3 A;  2DF7 A;  1V6L A;  4M3C A;  2CSG A;  1CJD A;  2DFC A;  3OPT A;  5FP9 A;  5KXC A;  4UOJ A;  2UWB A;  2VQT A;  1QXP A;  2IXJ A;  1R1A 2;  3H3U A;  3ETP A;  4G3Y C;  5FPU A;  4LIU A;  1AR9 1;  5K0U A;  3BCW A;  4OYU A;  2VOW A;  5GZD A;  4UFM A;  2LRO A;  2GNB A;  3KT7 A;  4NO4 A;  1RUJ 1;  3SNM A;  1RUD 3;  4IV1 A;  2AR6 A;  3QAC A;  4HPK A;  3C7O A;  4RD7 A;  3WOG A;  4GH4 A;  2W95 A;  1SDD B;  5CG9 A;  3WNN A;  4EZ4 A;  4DEV A;  3AJY A;  3GGL A;  2RM2 3;  1KEX A;  4JTO A;  3LQC A;  4TLG A;  3ZYR A;  4CP9 A;  4YGE A;  1W05 A;  1RMU 1;  2R0F A;  2VU9 A;  4XQD A;  1FNZ A;  4YAR A;  4KG0 A;  3AMP A;  5GAL A;  2HBU A;  4XAA A;  4ATF A;  2VUA A;  1JOD A;  3OEA A;  2W92 A;  3ZN5 A;  1LES A;  4XBN A;  5A7N A;  2Q1M A;  3AVR A;  3HJR A;  4QKF A;  4UAP A;  4FQ4 A;  5A7P A;  2BVV A;  2OUH A;  1REE A;  4QQO A;  4FTS A;  3AJZ A;  4FPK A;  1UF2 C;  5EJ1 B;  1NCQ A;  2FZ1 A;  4XIL A;  4IND A;  4AI0 A;  5HI0 A;  1QF3 A;  1RHI 1;  1WLD A;  1RHI 2;  3USS A;  1TNF A;  4IEQ A;  2VW0 A;  5C70 A;  5FDB A;  1D4M 2;  3N9P A;  4XMI A; 
#chains in the Genus database with same CATH homology
 1W06 A;  1OC1 A;  5C3R A;  1W28 A;  1RXG A;  1W3X A;  2CSG A;  2IVJ A;  1UOF A;  2Y60 A;  1UOB A;  1W2A X;  4XAE A;  1UOG A;  2VCM A;  1BK0 A;  2IVI B;  1E5R A;  2VBP A;  1W3V A;  2VE1 A;  2DBI A;  1E5I A;  2BU9 A;  1IPS A;  1DCS A;  1W2O A;  5APA A;  3ZKU A;  3ZOI A;  1QJF A;  1W2N A;  1W03 A;  2BRT A;  5C3P A;  1ODM A;  1UZW A;  2BJS A;  2Y6F A;  1HJF A;  1ODN A;  1RXF A;  1BLZ A;  3ZKY A;  5C3O A;  1HB4 A;  1HJG A;  3OOX A;  1W04 A;  1HB2 A;  2VBD A;  2DBN A;  1HB3 A;  1E5H A;  2VBB A;  2JB8 A;  1QIQ A;  1UO9 A;  3ON7 A;  1W9Y A;  4RGK A;  1WA6 X;  5C3S A;  2VAU A;  2WO7 A;  1QJE A;  1UNB A;  2JB4 A;  1GP6 A;  1GP5 A;  1HB1 A;  4BB3 A;  5C3Q A;  1GP4 A;  1E5S A;  1OBN A;  1W05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...