1UOGA

Deacetoxycephalosporin c synthase complexed with deacetoxycephalosporin c
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
309
structure length
256
Chain Sequence
DTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDLVIDFFEHGSEAEKRAVTSPVPTMRRGFTGLSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFAPHYDLSMVTLIQQTLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVATSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIRRTSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHETASE
publication title The Structural Basis of Cephalosporin Formation in a Mononuclear Ferrous Enzyme
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Oxidoreductase
total genus 80
structure length 256
sequence length 309
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 2003-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1uogA00
1W2NA 1RXGA 3ZKUA 1HJGA 1BK0A 1W06A 2VAUA 4RGKA 1GP5A 1UZWA 1QJEA 5APAA 1W2AX 2CSGA 1E5IA 4XAEA 3OOXA 1QIQA 4BB3A 2BJSA 2JB4A 2BU9A 1HJFA 2DBNA 2VBDA 2VBBA 1HB3A 1ODNA 1HB4A 1HB2A 2WO7A 2VE1A 1QJFA 1GP4A 1GP6A 1ODMA 1E5SA 1HB1A 3ZKYA 5C3RA 1RXFA 1WA6X 1OBNA 3ON7A 1IPSA 1W05A 1UOFA 1UOGA 1E5RA 2VCMA 2IVJA 1UO9A 5C3PA 1W03A 1W9YA 1UNBA 3ZOIA 1W28A 2Y60A 2BRTA 2JB8A 1W04A 2VBPA 5C3QA 1E5HA 1BLZA 5C3SA 2DBIA 2IVIB 1UOBA 2Y6FA 5C3OA 1DCSA 1W2OA 1W3VA 1OC1A 1W3XA
chains in the Genus database with same CATH superfamily
1UN1A 4LBKA 2N7GA 3KF3A 3TEXA 3V56A 4QD2A 3U0ZA 5CADA 1LEDA 3N36A 5IJRA 3O1PA 3RYKA 3AFGA 4PLMA 4M3CB 1L7RA 2XHKA 3I3BA 3D4KA 2QTWB 2AH2A 2YC2A 4QX8A 4XXPA 1IGOA 1KDKA 1MZEA 4WVWA 5FXVA 4Q0PA 1OPMA 3I8TA 4CRQA 1VBC3 3WQ1A 1HQNA 1F35A 2QCSB 4GMP3 4L97A 3TWIA 4D7YA 2VH9A 4OHZA 2B45X 1UYXA 2TEPA 4FOQA 2RMU1 1OVPA 4XAEA 1QJU3 2Z69A 2JG8A 4XOGA 4ARXA 2FDFA 2GNBA 2R041 3O1UA 3BN6A 1XE8A 3ZN6A 4E2GA 1GZTA 1AYM3 1S0IA 3VKMA 2BU9A 2VJXA 1RUH2 1PMJX 4RQPA 5JAXA 5GALA 5FZIA 2PQQA 1UY0A 2JECA 5FFOC 4L99A 2Y64A 3R4UA 2JJ6A 3U07A 2YBPA 2OIIA 1F31A 4M3CE 2A7AA 1KGYA 3OG2A 4UI9L 5AC91 3VBUC 3I2HA 4C1WA 3W5NA 1POV0 2FBEA 1QQP2 5HXMA 2EAAA 3S30A 1WUVA 2W68A 4PDWA 1FNYA 2B9UA 4PI0A 3KLSA 1NOVA 4QDSA 1YLLA 4UFHA 2BQPA 3AZVA 1BEV3 4XBNA 1BBT1 3IKWA 5H9RA 1YQ2A 2XVGA 4JZRA 5LB6A 2JG8B 3FUOA 1QWRA 4XTMA 3SEEA 1W8OA 2XUMA 4IQPA 4QX7A 3ZN6B 4H7MA 4RQPB 2CU5A 4RD7A 4Z07A 1G9BA 2BERA 1UOFA 3OEAA 1UOGA 3CZJA 3OY8A 5FZMA 3H8OA 3KMHA 4OVEA 5AFEA 4LITA 4DXZA 1BJQA 1OQ1A 2NP0A 1VRH2 5FZCA 1AX0A 1AL0G 4HANA 2BWAA 2JICA 2ORZA 3ORJA 2A6ZA 3KT4A 1IQAA 3MDPA 5JMCA 3AL5A 2WNOA 2QQVA 3AM2A 4P9IA 4D0QA 5FKCA 5JWPA 1ZBA1 3ACIA 1U0AA 3GJAA 3OB8A 4PDWB 1XE7A 4B29A 4BLJA 1FX5A 2UURA 2HWE3 1SLCA 3TN92 1EP0A 2VBPA 4QB2A 4IEPA 3WDWA 2W2IA 4WZFA 4YFZA 3EQEA 2EIGA 3JQWA 5A6QA 1CONA 5C3SA 5FYUA 2VQ0A 4CDUA 4AK3A 1JUHA 4AQTA 2GU9A 2V4VA 1JU4A 3NJZA 4UFLA 2WO3A 1PGSA 1ZX5A 4M3CF 1OA2A 2ZKNA 4NRMA 3ZXJA 1GQGA 4R4XA 3N9MA 1AX2A 3O1TA 1MS3A 4AFBA 4XF1A 2HEVF 1H1IA 3WUDA 2H0BA 2JDPA 4KNCA 5IK4A 5FUPA 3VKFC 2DCJA 2E26A 4JTNA 1GBGA 3D6EA 3MYXA 1O59A 2C4XA 5EQUA 2WC2A 5LBBA 4OZXA 3PUQA 2PHRA 3WDTA 3GBFA 1D0GA 2BYVE 3P5BA 3WY6A 3M3EA 1LOGA 1J84A 4LLFA 2Q1ZB 5EJ3A 1D2QA 2GMMA 3LIGA 3QCWA 4HK8A 5F3EA 5F1RA 5HV0A 5CVRA 4Q1PA 4CDUB 1PK6A 5K0UA 1SHWB 1PHMA 4MXWA 4AQ2A 5A3NA 1D2SA 2QBXA 3LZZA 4BCUA 2AUYA 3HQUA 1RUH3 4NRPA 3WW4A 4NO4A 4JV4A 5FO8B 3WW1A 2PYTA 2WIIB 2R0FA 3OGSA 4QKBA 2RMU2 4QPGA 4MGSA 3WCRA 4BQWA 4BXFA 2YY1A 1ALYA 4EN8B 5K7PA 2NLRA 4GJZA 2R042 4URAA 1SBFA 5GJ6A 1UPIA 3VHOA 1OXCA 2RG4A 4EJRA 1QQP3 4ZPIA 1WLDA 5E6HA 2P6CA 2VUAA 3NMBA 2W08A 1MVQA 2YXSA 1WMDA 3IIAA 5A7QA 4BM8A 2D3RA 4XFHA 3QH6A 4D7SA 3CMGA 4AVTA 4R4ZA 1POV3 2DCKA 1GUIA 4LK7A 5AC92 1AR91 1YUDA 4IEYA 5F3CA 1PK6B 1NUKA 2DU1A 2VE1A 2WQ8A 5E89A 5FPZA 4ARYA 4IETA 4DNYA 3VN4A 3H8RA 1A3KA 2HEWF 2W47A 2G4IA 3R05A 2RS32 5A6XA 4S2HA 4GIQA 5SV5A 2Z5WA 1J3QA 3V65A 1NX9A 4AFAA 2KXLA 2ZGKA 5F2SA 3UT0A 1BBT2 4ZZ5A 3CHXA 4CDXA 4ISQA 3EMRA 2DFCA 2ZGPA 4DXTA 3MW2A 2Z2SB 4FOWA 4GQ7A 3MLKA 4LORA 4FXGB 2Y8KA 3M3QA 1C4RA 5J96B 1RC6A 1OQEA 2JDHA 5LBFA 4BA6A 4CP9A 2WZR1 4LUKA 4QQHA 3B3QE 3AXEA 3TN93 1TE1B 1DQ2A 3ZSKA 1XXNA 4L8QA 2Q8EA 1UX7A 3I2GA 1VBD1 4XUPA 1GZCA 2X05A 2V09A 1CIYA 2NN8A 1J59A 1YEWA 4A44A 4H7LA 1UIKA 1XRUA 1Y9GA 2QQJA 3PMEA 1ZBA2 1JZ3A 5F5CA 4AVSA 5FPVA 4QPIB 4GULA 1R091 4A6OA 5C9AA 1JYTA 5K8SA 5C71A 4CP1A 1A8DA 2DVFA 2WZEA 4AI0A 2IXCA 2RHPA 4CDXB 3ZYBA 3TOJA 1DLCA 5C3OA 3BTXA 2MNGA 1EYBA 1CPMA 5F37A 1VPHA 2VNGA 4IV3A 5IHRA 4JVAA 4EE2A 2VQAA 3E5QA 3ZSEA 3WG2A 3SNMA 3ZYRA 1C8M1 4XCAA 4CPBD 5FZ9A 4CP9B 3JQXA 1LGNA 1W3VA 1IPKA 2OX0A 1I9RA 1UKGA 4QX5A 4ZU7A 5DAQA 1VRBA 1WWYA 1W6NA 3MIFA 1JOJA 4RSUA 2VU9A 2EXHA 2XVLA 1DYKA 2LS6A 3UJQA 4UFMA 3L2HA 1PVXA 5T50A 4X8PA 3MIEA 3IAQA 4LBNA 4ES8A 4FTEA 4BXSV 1WGPA 5C9AB 5K9YA 1APNA 2DCZA 2O8QA 3I3DA 5M0TA 3T0DA 2WQ4A 5JDBA 2HYXA 5LY2A 2BGCA 1JYXA 4JTOA 4QX2A 4CU8A 1OPOA 3MHZA 5IVEA 4FTSA 2DF7A 2CSGA 2RJKA 2RMU3 4MOAA 2Y0IA 1Y43B 4IV3B 1X8EA 2A70A 1UMIA 4D6QA 1OF3A 3OOXA 3INAA 2JE8A 3MF9A 3ZYIB 1R1A2 4AQSA 4EN9B 4Q0UA 4Y3OA 3CZUA 1AUYA 1OA3A 4IL7A 1VB4A 5FXZA 1ZVFA 3I54A 5GLZA 1R64A 2V72A 5BUVA 1OD3A 4Y1UA 1W6NB 2DCTA 2C0ZA 2J1UA 2WQZC 3KS7A 3OCPA 5FK7A 3ZXFA 1XYOA 2ZX4A 4U36A 5KR7A 2XVKA 1N3QA 2ZEWA 3H1YA 4QHBA 3T30A 5AC93 5FYZA 3WHUA 2DTWA 3POBA 1W90A 4LUMA 2D5HA 2RS33 2JWPA 4F83A 4BZ4A 3MW3A 1K42A 4CA9A 2Z4FA 1VAMA 2R6QA 4JDMA 4PQ9A 5I93A 1D4M1 2VCBA 2WFF2 2GC2A 3PJQA 1BBT3 5LY1A 1AR92 3LQCA 4BQ2A 3IPVA 4RS5A 2XMLA 4KU7A 5GLVA 3FWEA 4PBOA 2LTNA 2BV4A 1VAVA 2CYFA 4A7KA 1UX6A 2BNOA 4FAGA 4BU2A 5JSPA 3KCYA 3RZLA 3U75A 3A4UA 4RHV1 5I8YA 4Q4Y3 4FP3A 5IVYA 5J48A 1RJ8A 1MEC1 4CP2A 3NAPA 4LHSA 3T0AA 2CV6A 3H3LA 5A7PA 3OD4A 5DPNA 4DXSA 2VMDA 1S0CA 3D8CA 3KM5A 3HBZA 2BOJA 4KH9A 4XJZA 1QY4A 1XNKA 2H6BA 1V6NA 5GLTA 2ZHNA 2ARCA 1NCQA 4H2AA 2BVBA 3D0SA 4N90A 3ITQA 4TN7A 5FBZA 2ARAA 5CAZA 4WBBA 4FSJA 1RGSA 4NHXA 5HCFA 3T4HB 4L9BA 2YHJA 5F5AA 1ZBA3 4QM8A 4MGTA 3N9PA 5KXEA 2IFRA 2WJSA 2WZR2 3E5UA 1OH4A 3AVRA 5K0UC 1UAIA 2WT1A 3AL6A 2RDNA 3ACLA 3O0WA 3PMSA 1QXJA 3IPVB 4RS5B 1VBD2 4JC1A 3KQRA 2R1DA 4PLNA 4MUVA 3WVJA 3JB8A 3ZFFC 4YVWB 1F5JA 3H8UA 3ZM8A 1JYIA 3ABZA 3USUB 2BZDA 1EAH2 1X9PA 1CIWA 4BQ3A 4QPGC 1LU2A 1R092 1XPWA 3NAPB 1UOBA 3U78A 1NCRA 3BIWE 1TZOA 4FQ4A 1TNRA 5L7OC 3ATGA 2ZX0A 1ASJ1 1NCQB 4XF0A 5CU1A 2FHRA 5FZ4A 5JVVA 3MI8A 3PU8A 5IAXA 5BNOC 1ENXA 3L2YA 1CX4A 3NL1A 4LA2A 1SLIA 2QQUA 2VL4A 4HZFA 1C8M2 3H42B 2CGPA 1RUJ1 2ZPXA 1DHKB 1YQCA 2J1AA 2YC4A 4IGOA 3TEYA 3A7QA 2ARBA 3S7IA 4AI8A 3POSA 4JGYA 4Y22A 4CCKA 1KD7A 5FQ0A 1AHSA 3EBRA 4RGKA 2WA4A 1RUD1 3DV8A 3WZ1A 1CPNA 3AKPA 4HOOA 2VPVA 1J58A 3PHMA 5GZDA 3WINE 1R1A3 4CDXC 2G9FA 1NCRB 2ERFA 3NJVA 2FDIA 1JXNA 1JOPA 4XUOA 1AJOA 2BOIA 4FPOB 4DRVA 2Y6HA 4NIDA 4Q26A 4AZZA 1QF3A 4BB3A 3DL3A 5AFBA 4COVA 4NAMA 1QOSA 3AKSA 2XUEA 3PVBB 5H9PA 1H1AA 1TG7A 2ZGLA 3MUZ1 4CCOA 4H14A 1UYPA 1VMHA 3FHQA 1PX3A 2VBDA 3PL0A 4ZONA 4YZ2A 3RDIA 1DU3D 2VBBA 1HN1A 3C2UA 2XB6C 4OHWA 3VBSB 4YW4A 1DG6A 4NIAA 1HLCA 1LRHA 1K45A 4XJ8A 2WRAA 4MLOA 2WFF3 4JGYB 4Y22B 1HB4A 5IVJA 1AR93 1SBDA 4AGGA 5CFCC 1S0GA 2X8KA 3P3PA 4MXVA 5FZ6A 4XBQA 5LEKA 1QJFA 3D5OA 3ZMOA 1BHGA 2TUNA 2YGLA 5C3RA 3O0XA 1QDCA 3ZYFA 5E88A 1OT5A 4AI1A 4AHWA 5F8PA 3UNPA 1D4M2 3J26N 3JD71 2PAKA 2NPIA 2XOMA 5L36A 1V70A 3H7JA 1OBNA 3N35A 4N53A 1RUOA 3NNLA 3FMGA 2Q4SA 4QT6A 3LA2A 5FR3A 2VZVA 1CN1A 3JUUA 1YQ6A 3GBGA 2OA2A 4RHV2 3OPWA 4NVPA 3J9SA 4XJ9A 2J7MA 1MEC2 1S55A 4M00A 1OD5A 5D2AA 1CAUA 2W91A 2WZR3 5A3TA 2YU2A 5FMBA 2QKDA 3PVOA 1FNZA 1O4TA 1VBD3 3ME2A 1LCLA 3CU7A 2GP5A 3CQOA 4IEVA 2DWRA 3B69A 3H3ZA 4K1YA 4P9XA 4CSWA 1V6KA 2JB8A 1EAH3 2XHNA 3H1WA 4LKSA 4XURA 2WNVA 1OUXA 2WNUC 3ZVXA 4F3JA 4YGCA 4FQZA 3RZJA 4WZCA 3WQBA 1UWWA 1OLQA 5KXBA 3UKVA 3WCSA 3ZX7A 1J3RA 2B9VA 4JKMA 4AVCA 2VOKA 1JYNA 3GGLA 3QOPA 1ZZ6A 5FZFA 5SV8A 2JG9A 1W0PA 4AEKA 2MEV3 2A3WA 2BW8A 1D4VB 2A75A 4D7TA 5L9RA 1C8M3 1C1LA 1VP6A 1J3PA 2RS11 1CAUB 2FZ1A 4Y1VA 5FLHA 4A6SA 4E9KA 3J8F1 3AMNA 4JRAA 1O8SA 1LHOA 1IS4A 3HIFA 4GAZA 5C33A 2GN7A 3GJBA 1ASJ2 1OC1A 3AB0A 3M3IA 4LBJA 4UXAA 1W3XA 3WP4A 2W46A 3WT3A 5LK5A 3VD9A 5EZWA 5HCBA 1VE0A 1AJKA 2ADEA 1JYWA 3HAGA 1MS9A 2ZGQA 3FC0A 3ZIXA 2BWCA 2WNVB 5C8WA 3UL2A 5JR2A 1LTEA 1RUJ2 1QH7A 3DYOA 1H2KA 4OMCA 4Q4V1 2WNEA 1XQNA 4QB1A 4AVBA 2WWUA 1IKPA 3I59A 2D43A 4W6YA 1HQWA 1UXZA 4IESA 2DVAA 2IXKA 3NKTA 2QE3A 2VZOA 1ND2C 5IVVA 1C3HA 4BQ1A 3NAPC 4XABA 4P5YA 1RUD2 2PHXA 3U1XA 2GNDA 2P1BA 3SKVA 5CKMA 5JZGC 3DECA 3K4DA 4IXLA 4Y1XA 4P9JA 5JIUA 1O8PA 1NCQC 2VY0A 3VZOA 1GQPA 2PA7A 4I0AA 1YFXA 2WDBA 4FBFA 4NAOA 2ES3A 2JB4A 1UF2C 3K48A 3GZEA 2OQ6A 3DEMA 3RVHA 1IOAA 2P3KA 2OQ7A 1DZQA 1VBE1 3NRUA 1SLTA 4K9SA 1WMFA 4I0BA 3VBHA 2A6YA 4FFFA 3AFKA 5B2GB 5C6CA 1GU3A 4K8RB 2OVUA 3UESA 2RDSA 2EALA 3KT1A 1MR5A 4D94A 1OLMA 2V5YA 3I59B 1FPN1 3HMYA 2J22A 3HT1A 4AVVA 1JZ7A 3AMMA 1D4M3 1EV11 4HVQA 4G4FA 5FLJA 2QQPA 2VUCA 2NYYA 4DUWA 1PX4A 4OUMA 1YI9A 5IFTA 3VBRA 1NCRC 4FOYA 1XNDA 4CDWA 4O61A 1AR61 5FZLA 3T0BA 3VGIA 1ZRIA 4RHV3 1CESA 1FI2A 1OI6A 3N9OA 4TLGA 1MEC3 4R8HA 1JS9A 5A1LA 3WD5A 3JD72 3I4IA 1YI7A 3HN1A 1IKQA 5J1XA 2ZGUA 4FCAA 5A6YA 3KHCA 5CYYA 4Q29A 4A7ZA 1V6OA 1SQ4A 1W6PA 5T5LA 4S2GA 4AXOA 2P5BA 3VBOC 2VVEA 2Q8CA 3BIEA 3VBHB 3IDAA 2P3YA 1ZZ8A 4COUA 2P17A 1CZSA 5H9QA 1S0FA 1HXS1 2W1UA 4JGYC 5FY4A 3AMQA 4IUGA 2XBO1 1WW4A 3ZOIA 4YFWA 4C1XA 1YQ8A 2XL7A 1S0JA 1HN0A 4XDPA 3K3OA 3VBRB 2EA7A 4KGQA 1XNAA 4QPWA 4CDWB 5LW9A 4HFSA 1W6OA 1Y7BA 3HQXA 5EFUA 5FPBA 3U4XA 2VZQA 4YW6A 3G6JB 1CAXA 2WT0A 1W0NA 4AFDA 3PIGA 5CEHA 4ISRA 1W6PB 2VZUA 3DKQA 1W2OA 1ASJ3 3BPSA 3USSA 1H8VA 3RG0A 4FPLA 5F7UA 5IFPA 4P9WA 1T6BX 5ANQA 2WO2A 4X6QB 1OLME 1GV9A 1BK0A 2QUOA 1RUJ3 2RS12 3MF6A 5J7MA 5FWEA 1NE6A 2QFEA 3J8F2 5FMOL 4HMZA 4EZHA 5J3UA 2FD8A 1Q8OA 4HK9A 1J1TA 2QQLA 1JH5A 2SBAA 4AFCA 4XACA 4NHLA 5DUUA 3AP6A 1DYOA 2ZZJA 5A1AA 2QQWA 1K3IA 1I5PA 1ULDA 1YNAA 3ZXDA 3ZPOA 4A42A 1J83A 2C9KA 4L11A 1FT9A 3AYEA 1W6OB 3WG1A 1HRV1 4QPYA 1C28A 1ENRA 1RUD3 2ZBJA 1S1AA 2VAUA 4INDA 4AAXA 4E8CA 2D6PA 3B7MA 4NOTA 4Q4V2 4CCMA 3UKNA 1CAXB 1U5ZA 4N53C 3KV4A 4WM7A 5JXJA 3WX5A 4DUXA 1DYPA 5DG2A 2D6KA 4KGGA 4E27A 1YIFA 3TB0A 5KXDA 5EYXA 1H6YA 1DGWX 3WF2A 2WZ8A 2BDRA 5ACA1 4M4PA 1MZ6A 4NWWA 2E33A 2EF6A 5KBFA 1W8HA 1RUE1 2VMGA 2VMFA 1I6XA 4XQ4A 4DIQA 2UY8A 2NZ9A 4OUEA 4XFBA 1H9PA 1UY4A 4FP2A 3S5QA 2PFWA 5BNQA 2WNVC 1G8WA 1VBE2 5GZFA 4JKLA 1YFYA 3LE0A 1NAEA 4ES9A 2ENRA 2NMOA 1H30A 2BNMA 3KT7A 1GP4A 3LB9A 1GP6A 1ODMA 1XYPA 3MUY1 3K77A 4WM7B 3SCFA 1FPN2 5F6LB 2JG9C 1W8NA 2F4LA 2Q8DA 3FX3A 3LEKA 3C3VA 3JD73 4JQTA 1RXFA 4L92A 1EV12 2EICA 1AL23 2GSYA 1ULOA 1RITA 2JD4A 4DO0A 4D3WA 1GZ9A 3LA7A 1C5HA 1DQ6A 1MS5A 2W95A 2VW2A 4MZUA 1HRI3 4N8MA 1AR62 2OS2A 1KFXL 5T52A 4P9YA 2YU1A 5FPLA 2RR11 2EIDA 4CPBA 2PHUA 3ZYJB 1NG0A 3R6SA 5JCTA 2VOVA 4Y1ZA 2VD7A 5F5QA 5FZ1A 2GDFA 2E63A 1X9TA 1N1YA 4LE3A 2RS31 2ARXA 2HWB2 5D1IA 2R061 1OFNA 3LEGA 2YV8A 3BTAA 1V6MA 4M01A 1HXS2 2JDZA 3O14A 2XBO2 1QJY1 2LM3A 4GWNA 3VBFA 4GWMA 3Q9OA 5F6KA 1QDOA 4QQ2A 5DXDA 2PLV3 3AP9A 3CNAA 2D7FA 3ZXGA 4Q4Y1 1E5HA 3LDKA 2JKBA 3VD4A 1OOPA 5LATA 2F6BA 2IZWA 2SLIA 3WF0A 1FXZA 2YZ4A 5FY7A 5A3LA 2HYKA 4MHUA 5CBLA 2RS13 1RVF1 4K1ZA 3LIHA 1CQ9A 3ZYGA 3O1SA 1UY3A 3HN3A 3NNGA 2HEYF 3J8F3 4MVTA 2AEYA 4BK4A 4AEDA 1SLLA 3VBHC 4AWDA 1DLLA 2WFPA 4OQ8A 4ATFA 1H2NA 1L3JA 2QDRA 3GDBA 1VIWB 1LOFC 4YM2A 3EJKA 4LKDA 1ZRDA 1V6IA 2CDPA 2VXJA 3R4DB 4YWAA 4BOWA 1QHDA 4Q4V3 5FOBB 3VBFB 3I3MA 1HJGA 2Q1FA 1KS5A 2O0OA 3SKJE 3LAGA 3VBRC 4OULA 2H0VA 2VM9A 4CDWC 4IEUA 2ZTNA 3ZXLA 2YC0A 4KI5M 1W2UA 4LULA 4LIVA 3AYCA 3PTYA 3ILFA 3VDBA 3T2QA 1HRV2 1OOPB 3OY8B 3A23A 4XF4A 1NY71 3HT2A 2IWGB 5FP7A 4Q4X1 2XJRA 3IMNA 4U2AA 1COV1 4YM1A 3IT8A 4YG3A 3FN9A 5EP9A 2KR2A 1JHJA 2CNAA 2AC1A 2UWCA 2FDKA 3VL8A 1JTZX 2EIBA 1QJX3 2JDKA 3B9CA 3IZOA 1WCDJ 2WSUA 1W9TA 4GD4A 4UT5A 3NQHA 5G05L 2D3SA 3TEWA 1WMEA 1ZBE1 1VBE3 3T2TA 5I8SA 5ACA2 4QB6A 1RUE2 2C26A 1O3TA 4HVRA 4LR4A 5ANNA 3WG4A 4F8AA 3O12A 1HB3A 4B1MA 1QEXA 5KHHA 3M70A 1FPN3 2XH6A 2WLQA 4OUSA 3UGFA 1DZRA 3M3CA 2PHTA 1YC61 1EV13 4FFIA 2ZGRA 4K8FA 1LENA 2BUKA 5AVAA 1BYHA 1R1A1 3ZFFA 3C8XA 4G3YC 1URXA 2Y6GA 1AR63 5EV7A 1VAKA 3WG3A 3CEWA 1JZ5A 4KWUA 2K0GA 1JZ4A 4QHZA 4I3GA 3ALQA 5FMDA 3DPRA 2ID4A 1BVVA 1RIRA 3QACA 5T3NA 1B35C 4OHYA 2R071 5L7OA 1AR71 4HKLA 3VB9A 3PLQA 2X09A 1XU1A 2GAUA 4OYUA 4IE4A 5BNOA 1RHI1 2HWB3 5JR7B 2Q30A 5D8AA 1XYNA 2VCMA 4FPFA 3T1LA 1UO9A 4XUNA 2WFF1 4J6GA 2RR12 3FZ3A 3D0JA 5C3PA 3MO4A 1HXS3 1OFSA 5A32A 4ZU4A 1DIWA 2LALA 2XBO3 5K0UB 1CZTA 2PN5A 2ZMKA 2NM1A 5HPOA 4RGGA 4XJWA 5LZ6A 4MXWB 3ZFFB 4N7IA 1WA4A 4JCKA 4LE4A 1W8FA 2R062 2CTVA 2ZX1A 3MICA 4WM7C 2GMPA 5GLWA 5BXXA 2F4PA 3C7GA 4XJAA 4HN0A 1YFUA 4XTPA 4M0NA 5FZ8A 4QPGB 2FCTA 3SH5A 2ZEZA 1KJLA 1QJY2 5BPXA 3GBWA 1I1EA 3DPRB 3HR9A 3KF5A 2IVIB 3S57A 1WW7A 4MO3M 5L7OB 4I02A 5FLIA 1DCSA 1O5LA 4ZKTB 3POYA 3WDUA 4Q4Y2 2R7EB 4L2NA 1LOAA 3PUIA 5BNOB 4LTAA 1R081 3AVSA 4NPRA 5D8AB 2VOWA 3RNSA 2YROA 1DGLA 5BNPA 2UU8A 5G04L 3ELNA 2UYAA 2WN2A 4YW5A 1RVF2 3QBQA 4DY3A 1UYYA 4URTA 2NQYA 5JIAA 2AYHA 2Y0OA 3AMHA 3KGZA 4J1XA 4W65A 1BQPA 1EAH1 4LKEA 1C1FA 1PVC3 1NLSA 3PJYA 3ZLIA 1O6UA 1S4CA 5FIXA 4OI2A 4DEVA 5CFCA 5J37A 1IS6A 4Q1RA 3RZMA 1HRV3 4WV8A 3NKGA 4QKFA 2I45A 3DUIA 5DUXA 4HBNA 5IYYA 3SQOA 3AJZA 5FPAA 3N7JA 2C24A 2RS51 3THTA 2MEV1 5JXGA 5DMYA 5F32A 4NWVA 1YIPA 2HH9A 3LGRA 2J1TA 3MLLA 4Y24A 5DDJ1 4Q27A 2ZCWA 1HIXA 5KHJA 1WW5A 1Q3EA 1NY72 1VBB1 5ACA3 5BNPB 4IW3A 4Q4X2 4CU6A 4QAWA 1COV2 2W9XA 2DUOA 1RUE3 2C1FA 4B7KA 5CKNA 1S2EA 4AR2A 5F3IA 4ASLA 1VMFA 4Z8BA 1PMHX 3KWVA 4KWLA 1V00A 2E6VA 5FP4A 3RGBA 5JUVA 4XAAA 1GOFA 2VO5A 2ZGTA 5IVCA 1HV0A 4OQ9A 1L7QA 4K6BA 1KITA 1ZBE2 4MGKE 3EO6A 4MGZE 4QKDA 5DAWA 5FBJA 2RDQA 5DAXA 4EN0A 5CFCB 3VBFC 1J1LA 1AYN1 1LOBA 3PVNA 3WUCA 3W5MA 4IEWA 3CF6E 4JRLA 2WNUA 2VTXA 4PT6A 1HB1A 3RI9A 4CCNA 3VKLA 1YYNA 3RWNA 4HONA 1RUI1 3FFZA 1OOPC 1T6GC 2ZEXA 3NV2A 2V4AA 4LXLA 1S2KA 5JOYA 2YYOA 1IS3A 3J4UH 1BKZA 4OI0A 2EXIA 2B4KA 5FRAA 3URFA 4AEJA 5I0SA 3O1RA 1JI6A 4AEDC 1D0HA 3WDXA 3VZMA 1OURA 2RR13 2XJSA 2B39A 3E97A 4EN6B 2OXBA 1MQTC 2R072 1AR72 4GA9A 4DPNA 4NE9A 3OD0A 3CBNA 4UAPA 5CIRA 1N3OA 4NROA 4ATEA 2HBUA 1RHI2 5CNAA 3A21A 2R063 1FMD1 3KQ4B 1O5UA 5JXIA 3V64A 2D6LX 3H7YA 3OEBA 3LA3A 2WNUB 4SBVA 1W6QA 4R9CA 3LDRA 4NIHA 1TNFA 1QJY3 2YPDA 5IK7A 2A6VA 4IE6A 2J1SA 1OSGA 3WSOA 1QMJA 1ZZBA 2HJIA 2PHFA 2VCCA 4ASKA 5C5TA 5LK7B 1RUF1 4FXKB 1RUNA 1UU5A 2LROA 3ZO0B 5ERLA 1ND2A 3UGHA 3POIA 1X7NA 1UXXX 3MIDA 1PNFA 3AZZA 4XZUG 5A3MA 5CFDA 2ATFA 4YRDA 5JZGA 3BTYA 1DQ1A 1EPWA 1RVF3 5LA2A 2WBKA 2YBKA 4QU1A 3RYRA 4RFRB 4IE7A 2WR9A 1LODA 3Q8EA 5A7SA 5FYBA 1GNYA 1R082 2RJ2A 3THCA 5E16A 2DURA 5FDBA 3PIJA 4LQRA 1QOTA 3GCWA 2VZ1A 4LBQA 3LSEA 4DOUA 2G1MA 3EXUA 3CJIA 3IWZA 1K5JA 3ZPYA 1W8UA 1SG3A 4ZS3A 3ZSJA 5JMOA 4XFFA 2EXJA 1F2NA 3OUIA 1SEFA 4Z82A 2CDOA 4W6WA 1F9KA 3P1IA 2P34A 3SH3A 1JOBA 1ND2B 1UZVA 4LNVA 5F5IA 4FO9A 4W6XA 1BXHA 4QXBA 4JQRA 4W8JA 4AI9A 1ZZCA 4B4QA 3DPRC 5CFDB 4Y20A 5JZGB 3PUAA 1XSQA 4Q4X3 1JBCA 4QXHA 1COV3 3GM8A 4Q2FA 4GWIA 1LAJA 3POFA 3WQ7A 3JXSA 1RYYA 5LA9A 1L7LA 4RYDA 4K21A 3KVBA 2RS52 4CDQA 2MEV2 3OGJA 5I0RA 5D8AC 3OF1A 4JHTA 5DDJ2 1W99A 3FLPA 3I49A 1DQ5A 4RFT0 5LRRA 3T4VA 1ZBE3 1VBB2 4P5HA 3ZDVA 3VBOA 3BB6A 4NUBA 3LPFA 4Z2AA 3CJIB 4FPYA 5IAVA 1N1TA 3M4FA 4HPKA 2W94A 3Q8FA 1H8TA 3ZSLA 4HT1T 5FPXA 2IXHA 2CAUA 4YZ5A 1JU3A 2GN3A 4ZU5A 4CCCA 1MS0A 2ZJCA 4GB31 1AYN2 2I07B 3I3EA 5FXXA 3KZ4C 2VCAA 4Y20B 3VZLA 5C8CA 1SDWA 2VTXJ 1CGPA 3KV9A 4ONUA 1RUG1 5T5PA 1HDKA 1RUI2 4CDQB 3DGTA 1PO11 4QU2A 4UW4A 5I8TA 4E4ZA 3N7KA 4IV1A 1H4GA 5BNPC 1RMU1 1LEMA 2R073 1AR73 1ZZ7A 3HPNA 3OPTA 3P6BA 4P14A 4QXKA 4RR3A 4DINB 3VBOB 1F4AA 2XLAA 4KL1A 2GALA 3MZHA 1RHI3 2PHLA 3RJ2X 2OW4A 3N7LA 5JSRA 1GYKA 3CLPA 1W2TA 3IDEA 4Q0VA 4FOVA 1LESA 1A6CA 4HPKB 4B3NA 1LHUA 5FQ0B 1H8TB 1SLBA 3BYWA 3ZFEC 4WVVA 1LR5A 2FDJA 4BISA 5JPMB 3ZN4A 2ZHMA 1PNGA 1UNBA 2ZKLA 2GC1A 4NPMA 2FMDA 2VMIA 1FMD2 4GALA 5BV6A 3O7OA 2DTYA 1AL21 4LOTA 4N43A 2EXKA 2FDGA 4FPEA 4JGZA 4ZXEA 3ILNA 4AGRA 5L73A 1WD3A 1ZA4A 3PVEA 1HRI1 1RUF2 3HJRA 3NV1A 1LU1A 3JCIA 5T55A 4C0BA 3AZYA 3LD8A 1R083 5JOZA 1GOGA 2AR6A 3LPGA 2VMCA 1OH3A 3H9AA 2HBTA 2R30A 2PHDA 3KHBA 1M06G 4UFIA 4Z1VA 1NXMA 4NRQA 3AZWA 4PI2A 4XZPA 3KV5A 3OGRA 4NN0A 4YM3A 4MGQA 3WF4A 2DVGA 1Z0HA 4PLOA 1Y4WA 1EY2A 1W2NA 1ULGA 3EB7A 2Z79A 3VD3A 2DYCA 1PZ8A 1MS4A 2Q1MA 4WM8A 4BK5A 1TMF1 4E8DA 4N43B 2BPA2 2PLV1 4ITCA 3W58A 4BDVB 2HKXA 2W92A 4N53B 3ZSMA 1KQRA 2WA3A 2YGMA 1XOYA 1ULCA 2R16A 2Y6JA 2R0HA 5T5OA 1NKGA 2RS53 4YGDA 1LHNA 1W2AX 5DDJ3 5FOJB 1XNBA 2ZGSA 1E5IA 1C5IA 1ST8A 3PURA 4QGNA 4BHPA 3V0BB 1O3SA 1VBB3 2KA3A 3TAYA 4QQPA 5DAVA 1N1SA 1W39A 4D69A 2W39A 4DUVA 5ISLA 1DQ0A 5ABJA 1NA1A 4FI9A 4QDRA 1AXYA 2DBNA 1UPSA 1V9U1 4YPJA 5JPNB 4KWJA 1W8ZA 3RPQA 2E7TA 4CEWA 1ULEA 2ILMA 4NHYA 2WS93 1AYN3 1JW6A 1KFUL 5FXWA 3RI8A 1S0BA 2VNVA 1U5IA 4BPZA 2X5IC 2CY6A 3LEIA 3THPA 2JG9B 3AKQA 3T1MA 4AFMA 4EYUA 4XF9A 1RUI3 3O5SA 3WQ0A 4BMEA 1SLAA 1WD4A 4JDOA 5FZBA 3ZDSA 3JZVA 1NLQA 3ZMNA 5CFDC 1POQA 3GALA 3ES1A 1C57A 3DXUA 5FZ0A 4GB32 3GZAA 1GQHA 3VLBB 4LK6A 4CTEA 3KVAA 4A7YA 2B46X 1WA6X 1WLTA 1QJX1 3QH7A 4XFAA 5GZGA 1RUG2 1PZ9A 3ON7A 1RUC2 1XBFA 3SEPA 1PO12 2D40A 4TSVA 1NA1B 3T08A 4XVHA 2HWD3 4LBQD 4PHZA 1W05A 1K5MC 1RMU2 1ZNPA 4CXWA 1UY2A 1JYCA 2OUHA 5EXOA 3DCQA 3CJIC 2IVJA 1TVGA 4FPKA 3A0NA 1FMD3 1LOFA 4RN5A 5JLVA 1FOD1 4LMFA 5DN2A 5AVPA 4YSFA 5FTTC 5L9BA 3FHIB 2FDHA 1DDLA 1S0DA 1CAVA 1LOCA 4LO4B 4J25A 1W28A 3SCHA 1STMA 2AREA 4LOSA 1IS5A 5FJHA 4XUQA 1QXRA 1SCSA 3LOBA 1KJRA 2FCVA 5T54A 1JZ6A 4FAHA 4YARA 3HWJA 4YNIA 3W59A 5IK8A 1RUF3 3U37A 1CJPA 3HVDA 4ZXKA 5KHKA 3BPZA 3GHNA 4BQ4A 1TEIA 2H6CA 4CDQC 4LT5A 4PCRA 1AL22 4LHLA 2FMYA 3MPPG 4BMBA 2ZACA 2ORXA 5FAXA 1MZFA 2XJPA 3HEIA 3OUHA 4PQQA 2HWB1 2B42B 1HRI2 5FZGA 5LA1A 3NNMA 4AEDB 4LJHA 1G9CA 1UD1A 3CL1A 2XGXA 1G7YA 1A8MA 1NE4A 2W1WA 1DGRN 4X6RB 1H8TC 1HKDA 1SPPA 1VBA1 1GOHA 2CGOA 2K9ZA 2QQOA 3BCWA 4V2WA 1CAVB 3N4MA 2OYZA 3UYJA 2IC1A 3MIHA 3CKHA 1GMMA 2PMWB 4I0WB 1H2LA 3D3AA 4Q4W2 3VKNA 4O9GA 4QM9A 2A6WA 3ST7A 5DABA 1SMVA 1YQ5A 3J7LA 3M2MA 5EJZB 5JI7A 2JXAA 3OSDA 5C8CC 4CUCA 1NT0A 3BVCA 4CP0A 4Y4YA 1VR3A 1TMF2 3AC0A 3NJYA 4XPVA 3RS6A 5FYTA 5IT6A 4MGIE 2PLV2 5FY9A 2ZHLA 4IV1C 1DF0A 1SFPA 1H0BA 1OQDA 1X36A 4HVOA 5A7WA 2PELA 3KCCA 4RR3C 1S0EA 4TYSA 4BLIA 2RJLA 4BWOA 3R4SA 4E4SA 3WLUA 4LIUA 2C6SA 1G9AA 1BMV1 4K40A 4B7EA 2CGNA 1Z78A 1B35A 2GNTA 2QQIA 3IDCB 5FYSA 5J98B 2GC0A 2JE7A 2XR4A 1WLWA 1SPPB 1H9WA 3POJA 4S2FA 1IPJA 2VOTA 4IE5A 5GZEA 2YMZA 4A2UA 1LGBA 2DVDA 3C7EA 1PVC1 3AXDA 1REFA 4A4AA 3VHRA 1ZYBA 3GF6A 3T09A 3OGGA 1X50A 4QX1A 1V9U2 1EPZA 4BJ0A 4BQYA 4NIGA 4YYOA 3WDVA 3IDBB 4N43C 4AYUA 1LJ7A 2GZWA 4MADA 3AK0A 4JGZC 4GB33 2QDNA 1AZDA 1XE0A 1WZXA 2VMHA 2ZXQA 3ZR6A 2VVFA 4XJUA 3ZXEA 4OMDA 4TLFA 2YUEA 1UZYA 1RUG3 2QQMA 1ZRRA 1WBFA 4FPHA 2JDMA 1RUC3 5FWJA 1PO13 5A3OA 5FZKA 4QQOA 1B35B 3FFQA 4HSLA 4GXLA 5F2WA 4B8EA 3ZR5A 1RMU3 2BTVC 4Q8LA 5FP8A 1A78A 5FYCA 1I3HA 1QJX2 4XMAA 5FY5A 2JDAA 4XHBA 2D3PA 1HW5A 1KDMA 3VDDC 3GZUC 3M7AA 5A33A 3M1HA 3K75B 3ACHA 2DUQA 3M8LA 4D6SA 4WM8C 4XBLA 5FP3A 1O7FA 1UYZA 2ZX3A 3POGA 3AP4A 3N9QA 4A45A 3P3NA 4MG2A 2JENA 3PDQA 3PUSA 1FOD2 1XNTA 2F17A 3N7MA 1GWMA 2BRTA 4LO5B 5KC6A 1E57A 5A1FA 2PXJA 4LA3A 5FZHA 5IVBA 4QDQA 4R9DA 3K3NA 2Y34A 1G86A 4LO8A 1H6XA 2E51A 2G9ZA 4H55A 1WMXA 4XW3A 4LBLA 3S7EA 1GWKA 3WNKA 3I2KA 3OTFA 2Y6FA 4XDQA 1AR82 5ABJC 1NA1C 1ZA7A 3RRDA 3SISA 1JZ8A 4GH4C 3AP5A 3GNEA 4SLIA 4XC9A 2QZ3A 5A33B 5HBAA 1LOEA 1ND3A 2ADDA 1EUTA 5FP9A 3WNPA 4CEWC 5HCAA 3JU9A 5A7NA 1UCXA 4CCDA 4EROA 5LBCA 4Q4W3 2X29A 3FBYA 1H2MA 4N7UA 4QHOA 3UETA 2BGPA 3NJXA 2BBVA 1RXGA 2D6OX 1UW8A 3FJSA 1VBA2 1TMF3 2BFUS 1GANA 2XONA 4IEOA 3ZKUA 5C5UA 1R1ZA 4IDZA 2W1QA 3W21A 1CD3G 3FLRA 2LW8A 1QOOA 5EPAA 4IEZA 2WABA 1YFWA 2NMNA 2Y26A 5FY0A 5HI0A 5FK8A 4E2QA 2IXLA 2VQUA 2D6NA 4C0HA 2EAKA 5KHGA 4COWA 5FY1A 4BIOA 2XG3A 3THDA 5IW0A 4UW5A 3SHRA 4QKNA 1CR7A 1DBNA 1F5FA 1W8WA 2K46A 1YXWA 4G9SB 4IERA 2WINB 4YW2A 3TNQA 3O1MA 3JBG1 2CWMA 3AYAA 3WW3A 1WCQA 3BOWA 4O7XA 4EV0A 1ND3B 4MH0E 1WKYA 2J42A 4MX3A 3AMPA 4UBGA 3SH4A 3RSJA 4QGMA 4XQWA 2GH8A 1BMV2 4HN1A 4Z2WA 4HETA 1MQTA 1V9U3 5J09A 2WYFA 4NJ4A 2OT7A 4DB5A 1SBEA 2XL9A 4XE9A 3RMXA 3FLTA 2AEZA 4WVMA 2PQSA 1ODNA 2A73B 1PVC2 5JOXA 1GICA 3IN9A 4N9HA 1C8NA 3ETPA 4UWDA 4AHXA 1Y3TA 2E31A 3LSDA 2JEMA 4DRRA 4HKWA 4UF0A 5BNNA 3TEZA 4E4HA 1AF9A 3BALA 3PUHA 2DU0A 2LUWA 3O0VA 3SCGA 4P9LA 4PBPA 3HQRA 4AOCA 4MHRA 3X29B 3GZTB 2VNRA 4NHKA 5CB7A 2PAMA 3SC7X 4FFHA 3WP3A 3AP7A 5J36A 1BK1A 4FPCA 1W0OA 1WCUA 2W52A 4PIYA 3SITA 2ET1A 2YB7A 5GLUA 3VL9A 3WNXA 5EJ1B 1LNSA 1MQTB 1PM4A 2B7YA 4DEQA 3RQ0A 4JX0A 5F3GA 3U4SA 1JZ2A 4YLZA 2A6XA 4BQXA 5FY8A 5FZAA 3H0OA 4WVMB 1ACCA 4QGLA 5FMCA 4GKYA 1FOD3 2YBSA 1GZWA 5LBEA 3V0BA 3POWA 3WW2A 2YG0A 1UQXA 2QZ2A 1IHMA 3MBWA 4UF0B 1K12A 5BNNB 1VALA 3IBMA 1Q8QA 1GSLA 2DCYA 2QJVA 3PU3A 3GCXA 3HNYM 4YVSA 2V73A 3I2IA 4CCEA 3ZYHA 3WP5A 1DP0A 5FJKA 4TTGA 4D8MA 1ONAA 4I09A 5F9TA 2QQKA 2RM21 4N9IA 1GKBA 3W9AA 4V1PA 5C3QA 2OPWA 2R49A 1AR83 3QLQA 5FZ7A 1NQDA 1Y9MA 3VD7A 2IXJA 3TBDA 3VZKA 2DV9A 3R0RA 2BFUL 1SDDB 4XFGA 4AQ6A 3J7MA 1UOJA 4XXAA 5FYIA 3WNNA 4BQ5A 1RJ7A 1Q5OA 2CHHA 3IM0A 2BP6A 3ROUA 1P8JA 1QXPA 4HXCA 3UKTA 1RTVA 4K20A 3A22A 1N3PA 4L0PA 4UFJA 1GZWB 5JOWA 4YW3A 1VBA3 2D98A 3B93A 4YW1A 3VUOA 3I7DA 3GHMA 3AX4A 2XJUA 1HX6A 2YFUA 4YGEA 3N9LA 2O14A 3FE5A 5FZDA 3OBTA 5HCHA 3ZFGC 5DG1A 4YVSB 1WCSA 4ZZ8A 2WZPP 5D21A 3N3HA 2EVXA 4ET7A 4S2DA 1OKQA 2BBAA 5DUVA 2ZHKA 1W06A 2W1SA 4GJYA 2GNMA 2WO1A 2XLGA 1F15A 2WN3A 3BKZA 2ZMNA 5IK5A 2V5DA 1NYWA 4Q0SA 5KWRA 1UIJA 2C9AA 3MGUA 2ZX2A 1NQJA 1IZ3A 2JIGA 2O1QA 3WF3A 2VZPA 5DUWA 4OI4A 4PF1A 4XFIA 5C7GA 1UMZA 4FPGA 5A32B 1QIQA 2XQRA 4GZ9A 4QPIA 4P00B 3T2PA 3JBG2 1PIV1 1OHFA 1Q8VA 2ZAAA 4RL7A 4UW3A 5GKAC 3IAPA 3T2OA 1TQ5A 4Q8KA 2ZOEB 4OFGA 1X33A 4O65A 5JI9A 1VRH3 3U11A 3NWKA 4LBMA 2HWC1 3GYDA 4YM0A 4I01A 4Y4RA 3ZFEA 3BU0A 5TSWA 3I97A 5CZKA 4ZS2A 2VECA 5FYHA 2I74A 4CYDA 2G19A 2WO7A 3DYMA 4YZ4A 4META 3MFCA 4XQDA 4NR1A 4XHXA 2GMEA 3VD5A 5EIYB 4RGAA 2OZJA 1ENQA 1T2XA 2PAEA 1GFF2 3E6BA 3DYPA 2R32A 3WOGA 3NNFA 4LHKA 3F95A 3ZIWA 3LWCA 1U5YA 2JIJA 2OUJA 2X53S 2B8MA 3OBRA 4XYXA 3LDBA 1ND3C 1REDA 1ZRCA 1OLRA 1W9WA 5A3PA 1YCIA 2JG8C 4D6RA 3KGLA 3UGGA 1GWLA 3WDYA 3S5AA 3HNBM 3C7HA 1VMJA 2XLFA 4CXYA 4ASMB 1ZZ9A 2LRPA 4RQPC 2WS91 4HG6B 3RYPA 3ZFEB 3DXTA 1W03A 2TNFA 3WNMA 4UBHA 2UY9A 4JDNA 4KU8A 3QD6A 3AKTA 1LHVA 3MEPA 3BTZA 2XPJA 4HLTA 3LF7A 2JDNA 3I3QA 4UYBA 4OI1A 4GWJA 4PDWC 2MPFA 2J1RA 3HBKA 2CL2A 1OKOA 3UV9A 1JYVA 2RE9A 3DKWA 2B5HA 3E6DA 3KV6A 2QVSB 4EZ4A 2P3JA 4YG0A 3B94A 2RM22 4V2VA 4E4DX 2GP3A 3FHAA 1AVBA 3NO8A 5LEJA 2HLEA 3POEA 3LOIA 4R9BA 1O3RA 2HWD1 1Q56A 2ZEYA 1LB2A 4QWNA 3BODA 2GH2A 5FPUA 4H3WA 2AENA 3IB3A 3UK9A 2WYSA 5H9SA 2VC9A 3K2OA 3AZXA 3VDAA 2R043 1NZIA 5K4LA 4ZHNA 2OZ6A 3B5LB 2YDEA 2A1XA 4AF9A 4FFGA 1YJLA 3PTRB 1Y9QA 5HV4A 4F7ZA 3GXUA 2WAAA 4WVZA 2O8OA 3VHNA 3AYDA 2BVVA 5BNNC 5A7OA 1HV1A 4CU9A 2XWBB 5A3UA 1N1VA 2AGSA 5DZGA 2X5IA 1Z7S1 4HSJA 3S0MA 2A3XA 1XJAA 2ZGMA 3C7FA 3CJXA 3ENRA 2WWJA 4DMIA 1OUSA 4GKXA 4XETA 1QJEA 2AZ5A 2X10A 4MV2A 5FREA 5CG9A 1PO21 2KM2A 1H4HA 4K7JA 2A3YA 2WLPA 2Q0AA 3JBG3 4CDUC 4XCBA 1YO8A 4LO6B 4J1WA 1W6MA 3MFAA 1KS4A 1O4YA 4UOJA 4QX3A 5I0TA 4DY5A 4LO7A 4YVWA 5EHDA 3A0KA 4XF3A 4UFKA 1G9DA 3MIGA 4KMQA 1K5MA 2VULA 2XDVA 5A3WA 1WBLA 4LKFA 3USUA 1W6QB 5DZFA 3MV01 4YW7A 2XKOA 2ZGNA 1CJDA 1WCKA 1PIV2 1W9FA 3NV3A 4BIFA 1US2A 1ULPA 4AHYA 2W5FA 5GM0A 5DQ0A 4YVSC 2X5IB 4XILA 4IEXA 2HWC2 3RZGA 1AXKA 3BUCA 1UZZA 4JHZA 5KHIA 2YPJA 4TXWA 4Y33A 2P4EA 3ZKYA 5BY5A 4NIIA 1WW6A 2ZAHA 2HWF1 5LRSA 3B02A 2FZ2A 4AGVA 1QH6A 4FT8A 1BVP1 4AI3A 3OUJA 5FO7B 1D7PM 1PK6C 4KWKA 1SACA 3ES4A 4HL0A 1W6MB 3W20A 4A41A 5CG8A 3VDCA 5IVFA 4OCTA 3OJBA 3MV11 1NXD1 2ZABA 3PNAA 5FO9B 1PGW1 1K5MB 1DGRA 2PHWA 4LBQB 4MGYE 3EYPA 3TYJA 3ZXAC 1KXGA 1IPSA 2ZMLA 1G6NA 1XNCA 1Q8SA 4FPJA 3FL7A 3H1MA 1QGLA 3MW4A 4I3PA 4LBOA 3ASIA 3MPBA 4AEMA 4C90A 2Z42A 3IMMA 2VW1A 2XXZA 3KSCA 4LHNA 3BI3A 1N47A 2WS92 3OPZA 1W9YA 4COYA 3LFIA 4ZY9A 2UWAA 3VZJA 2JKXA 1TME1 1NZCA 4YZ1A 3AKRA 1W04A 2VZRA 2RM23 4XUTA 3NW4A 1RUC1 5FYVA 4AG4A 4I2OA 2VGDA 3VBSA 4AVAA 1XC6A 2ZS6B 4MSVA 3HD8B 4CVUA 2XWJB 2E53A 2WAOA 4QPIC 4B4PA 1YRZA 2P2KA 1PMIA 1EUUA 4DS0A 4CUBA 3JB4C 3E5XA 2VG9A 3FBMA 1GR3A 3CDZB 3H50A 1U5XA 2HWD2 2VXRA 3APBA 1CVNA 2E7QA 5B4NA 4FTBA 4AL9A 1OA4A 4Y5SA 4CEYA 2WWSA 4Y1YA 5F39A 2FQPA 1JUIA 4QMAA 1I5ZA 2Y6KA 2E7AA 1FAYA 3C7OA 2WUHA 4EN7B 1BZWA 3MIBA 5C8CB 5HXVA 4HKOA 3EHKA 1GNZA 1VJ2A 3UJOA 4P02B 1PGL1 2Y6LA 1H1MA 4Q5OA 2C5DA 2XJQA 1VB2A 2UWBA 4IV1B 3ZXKA 2J1EA 1S2BA 4FVVA 4RR3B 1F4HA 1A34A 1Z7S2 1GP5A 1UZWA 5L9VA 1VBC1 5C9AC 5FYYA 5APAA 5EYYA 2IXIA 4LLOA 2D5FA 1W9SA 4GMP1 1YHFA 2D44A 4YG6A 2JD9A 2VQTA 3F2ZA 4NPLA 2R1BA 4CCLA 4CCJA 3CIHA 5EWSA 1PO22 5I0DA 1CX1A 3HOBA 4KBZA 5JXHA 1QJU1 4CEYB 2QQNA 4IV3C 1PIV3 1V0AA 4Q4W1 1LHWA 1CZVA 1IG0A 2BJSA 1B09A 4M4RA 4COZA 1W8TA 1SFNA 3Q8AA 1AYM1 5I0UA 3VDDA 2XQXA 3WNOA 2CWSA 1YJKA 2W0XA 5CKQA 3M3OA 1MVEA 5C4WA 2HWC3 2P3IA 1UL9A 4KBBA 4OHXA 3WV6A 3TNPB 4AE2A 1PM7A 1AX1A 4JGZB 4QQLA 5IATA 5FUNA 2E32A 1F8VA 2JDYA 4TZDA 1HQLA 3IIIA 5IWFA 3J7NA 3K4AA 4Y5Z0 1E5SA 1QU0A 5FZOA 3KCXA 1Q43A 4W4ZA 2VUDA 1X8MA 3E1F1 3I2OA 5CISA 3Q8CA 1BEV1 4XMIA 2A5ZA 2HWF2 1SZBA 1R093 1DQ4A 2WT2A 3I2FA 1US3A 5DAPA 5CA6A 1G9FA 4GH4A 5BYNA 3VDDB 1CWPA 2OKXA 3ACFA 3CO2A 5C4WB 5LCWL 4WM8B 1PGW2 4I30A 4QXCA 5A80A 1E5RA 1JN2P 1QKQA 4XFCA 4XEZA 5IUQA 3I2JA 4DXRA 1XU2A 5I91A 4C91A 4DQAA 4RA0A 1FATA 3H8XA 1ZREA 2J1VA 4YZ3A 3OBAA 2IFWA 1LKNA 3K46A 4IEQA 3WNLA 1MPXA 3K4ZA 2VZSA 1UY1A 1RINA 5FZOB 2VZTA 5FYMA 4OLLA 3RZHA 2A71A 2BGOA 2Y60A 3BGAA 3Q8BA 1O91A 4B4RA 3VBUA 1LECA 4R52A 2HWE1 3ZYPA 1TME2 1OMIA 3KD4A 2Y33A 5FZ3A 3KB5A 2Q8OA 3RZZA 4RS5C 4X8NA 3RMYA 4CZSA 4JAAA 1NLRA 4YVWC 5ABJB 2DBIA 2EIEA 3J7HA 4GH4B 3WHTA 3WP6A 1SCRA 3RFRA 4XIOA 4OZOA 1JMUB 3WR0A 3NV4A 4CUGA 4CEWB 4AHZA 4XIKA 4AI2A 2XJTA 3LEMA 2BNNA 5DZEA 5FMOS 3WEZA 4AW7A 4TWTA 1CAWA 3V0AA 5LWBA 1XB9A 2DVBA 2KD7A 3LFMA 1Q8PA 4M0HA 1FYUA 5C70A 1V6LA 4DZGA 1RB8G 1ZRFA 1BCXA 2JDUA 2QNKA 3ETQA 2ZA9A 1JHNA 4KQ7A 3RZKA 1XSRA 2ZZQA 3ZN5A 4AAPA 1YWKA 4W50A 3ACGA 3VBUB 5E1RA 1Z7S3 1DZTA 3VZNA 2Y38A 3LKJA 4Y26A 4P08A 2IUWA 3E6CC 2D97A 1AR81 4B1LA 5JSOA 3WF1A 2WL1A 1PGL2 4Z92B 1PO23 4IGQA 3O1OA 3I2DA 3OYWA 4A3ZA 4GMP0 2FCUA 1O3QA 4O9EA 2BEOA 2DDUA 2E9QA 3NNJA 3K51A 3HNMA 3SLIA 4IGPA 1REEA 1VBC2 4CXXA 4R9AA 1UMHA 1DFQA 1WLCA 1GLHA 1RL3A 1RUH1 5FCCA 1CAWB 2D93A 3V0AB 1FV2A 2D6MA 3NSTA 4BYYA 3DN7A 2RDRA 2ETEA 2PTMA 4EQVA 4CUAA 1QJU2 5LA0A 1HJFA 4MYEA 2JX9A 1MS1A 2CAVA 2RV9A 3FUQA 1M4WA 2K2SA 3SXWA 1AYM2 1ENSA 3TRSB 3VKOA 1QQP1 1LULA 5FZEA 5T5JA 5L19A 3U14A 3OBZA 1KEXA 3RJRA 1MS8A 1HB2A 3B01A 1GNHA 4IE0A 3VBSC 1UZ0A 1VLNA 3U10A 1POV1 3T3YA 3DF0A 3D82A 5A6ZA 4CE8A 3OYWB 2HWF3 4OHVA 2WKKA 1UKRA 2VVDA 5B4XA 3RWKX 1QJZA 2JE9A 3OGVA 3ECQA 2XJVA 4Q0QA 3SMHA 2UYBA 4Y5TA 1X82A 4NMIA 1IQDC 2YFZA 2WSVA 1IG3A 1QNWA 3BOPA 4PJYA 1BEV2 4LPLA 3S6PA 1FV3A 4XDOA 1SFYA 4CEYC 5A70A 2OPKA 3L9JT 1V6JA 2XKPA 1JODA 3O1VA 1VRH1 5E8AA 4A3XA 5FV3A 2DFBA 4CU7A 4K3UA 5FUIA 4ORFA 4PIZA 2TBVA 4EWEA 1KRIA 1MZ5A 2ET7A 3B00A 5FKBA 5KC5A 1UU4A 1O4ZA 1UU6A 1LGCA 1ZM1A 2G9GA 2P37A 4BE3A 1QNYA 2MHFA 3ZFGA 2W87A 5A7WB 1TME3 3TN91 1OF4A 2VR4A 4C8DA 1MACA 1AXZA 3ILRA 2Q5TA 4NHMA 4EWAA 4M3CA 2VUJA 2ZGOA 3VHPA 2VW0A 4BH9A 2RVAA 2L9LA 4KG0A 2VOXA 3N9NA 3G7DA 2HWE2 1BLZA 1U12A 4LEJA 4P9GA 2AACA 5GZCA 2VTFA 4KG8A 4PF5A 3WXPA 2GC3A 1PZ7A 4YGBA 5C4WC 2W3JA 2VMEA 3MLJA 2P6HA 4QX0A 3B9IA 4JKKA 4E2SA 2I2SA 5KXCA 2VZ3A 4UW6A 4PIXA 3AJYA 4DFSA 2VNOA 3H3UA 5LASA 1OVSA 3VV1A 3BU7A 3LCPA 2DUPA 4EWDA 1ULFA 1DGWA 3NVCA 3ZFGB
chains in the Genus database with same CATH topology
1W2NA 1RXGA 3ZKUA 1HJGA 1BK0A 1W06A 2VAUA 4RGKA 1GP5A 1UZWA 1QJEA 5APAA 1W2AX 2CSGA 1E5IA 4XAEA 3OOXA 1QIQA 4BB3A 2BJSA 2JB4A 2BU9A 1HJFA 2DBNA 2VBDA 2VBBA 1HB3A 1ODNA 1HB4A 1HB2A 2WO7A 2VE1A 1QJFA 1GP4A 1GP6A 1ODMA 1E5SA 1HB1A 3ZKYA 5C3RA 1RXFA 1WA6X 1OBNA 3ON7A 1IPSA 1W05A 1UOFA 1UOGA 1E5RA 2VCMA 2IVJA 1UO9A 5C3PA 1W03A 1W9YA 1UNBA 3ZOIA 1W28A 2Y60A 2BRTA 2JB8A 1W04A 2VBPA 5C3QA 1E5HA 1BLZA 5C3SA 2DBIA 2IVIB 1UOBA 2Y6FA 5C3OA 1DCSA 1W2OA 1W3VA 1OC1A 1W3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2N A;  1RXG A;  3ZKU A;  1HJG A;  1BK0 A;  1W06 A;  2VAU A;  4RGK A;  1GP5 A;  1UZW A;  1QJE A;  5APA A;  1W2A X;  2CSG A;  1E5I A;  4XAE A;  3OOX A;  1QIQ A;  4BB3 A;  2BJS A;  2JB4 A;  2BU9 A;  1HJF A;  2DBN A;  2VBD A;  2VBB A;  1HB3 A;  1ODN A;  1HB4 A;  1HB2 A;  2WO7 A;  2VE1 A;  1QJF A;  1GP4 A;  1GP6 A;  1ODM A;  1E5S A;  1HB1 A;  3ZKY A;  5C3R A;  1RXF A;  1WA6 X;  1OBN A;  3ON7 A;  1IPS A;  1W05 A;  1UOF A;  1UOG A;  1E5R A;  2VCM A;  2IVJ A;  1UO9 A;  5C3P A;  1W03 A;  1W9Y A;  1UNB A;  3ZOI A;  1W28 A;  2Y60 A;  2BRT A;  2JB8 A;  1W04 A;  2VBP A;  5C3Q A;  1E5H A;  1BLZ A;  5C3S A;  2DBI A;  2IVI B;  1UOB A;  2Y6F A;  5C3O A;  1DCS A;  1W2O A;  1W3V A;  1OC1 A;  1W3X A; 
#chains in the Genus database with same CATH topology
 1UN1 A;  4LBK A;  2N7G A;  3KF3 A;  3TEX A;  3V56 A;  4QD2 A;  3U0Z A;  5CAD A;  1LED A;  3N36 A;  5IJR A;  3O1P A;  3RYK A;  3AFG A;  4PLM A;  4M3C B;  1L7R A;  2XHK A;  3I3B A;  3D4K A;  2QTW B;  2AH2 A;  2YC2 A;  4QX8 A;  4XXP A;  1IGO A;  1KDK A;  1MZE A;  4WVW A;  5FXV A;  4Q0P A;  1OPM A;  3I8T A;  4CRQ A;  1VBC 3;  3WQ1 A;  1HQN A;  1F35 A;  2QCS B;  4GMP 3;  4L97 A;  3TWI A;  4D7Y A;  2VH9 A;  4OHZ A;  2B45 X;  1UYX A;  2TEP A;  4FOQ A;  2RMU 1;  1OVP A;  4XAE A;  1QJU 3;  2Z69 A;  2JG8 A;  4XOG A;  4ARX A;  2FDF A;  2GNB A;  2R04 1;  3O1U A;  3BN6 A;  1XE8 A;  3ZN6 A;  4E2G A;  1GZT A;  1AYM 3;  1S0I A;  3VKM A;  2BU9 A;  2VJX A;  1RUH 2;  1PMJ X;  4RQP A;  5JAX A;  5GAL A;  5FZI A;  2PQQ A;  1UY0 A;  2JEC A;  5FFO C;  4L99 A;  2Y64 A;  3R4U A;  2JJ6 A;  3U07 A;  2YBP A;  2OII A;  1F31 A;  4M3C E;  2A7A A;  1KGY A;  3OG2 A;  4UI9 L;  5AC9 1;  3VBU C;  3I2H A;  4C1W A;  3W5N A;  1POV 0;  2FBE A;  1QQP 2;  5HXM A;  2EAA A;  3S30 A;  1WUV A;  2W68 A;  4PDW A;  1FNY A;  2B9U A;  4PI0 A;  3KLS A;  1NOV A;  4QDS A;  1YLL A;  4UFH A;  2BQP A;  3AZV A;  1BEV 3;  4XBN A;  1BBT 1;  3IKW A;  5H9R A;  1YQ2 A;  2XVG A;  4JZR A;  5LB6 A;  2JG8 B;  3FUO A;  1QWR A;  4XTM A;  3SEE A;  1W8O A;  2XUM A;  4IQP A;  4QX7 A;  3ZN6 B;  4H7M A;  4RQP B;  2CU5 A;  4RD7 A;  4Z07 A;  1G9B A;  2BER A;  1UOF A;  3OEA A;  1UOG A;  3CZJ A;  3OY8 A;  5FZM A;  3H8O A;  3KMH A;  4OVE A;  5AFE A;  4LIT A;  4DXZ A;  1BJQ A;  1OQ1 A;  2NP0 A;  1VRH 2;  5FZC A;  1AX0 A;  1AL0 G;  4HAN A;  2BWA A;  2JIC A;  2ORZ A;  3ORJ A;  2A6Z A;  3KT4 A;  1IQA A;  3MDP A;  5JMC A;  3AL5 A;  2WNO A;  2QQV A;  3AM2 A;  4P9I A;  4D0Q A;  5FKC A;  5JWP A;  1ZBA 1;  3ACI A;  1U0A A;  3GJA A;  3OB8 A;  4PDW B;  1XE7 A;  4B29 A;  4BLJ A;  1FX5 A;  2UUR A;  2HWE 3;  1SLC A;  3TN9 2;  1EP0 A;  2VBP A;  4QB2 A;  4IEP A;  3WDW A;  2W2I A;  4WZF A;  4YFZ A;  3EQE A;  2EIG A;  3JQW A;  5A6Q A;  1CON A;  5C3S A;  5FYU A;  2VQ0 A;  4CDU A;  4AK3 A;  1JUH A;  4AQT A;  2GU9 A;  2V4V A;  1JU4 A;  3NJZ A;  4UFL A;  2WO3 A;  1PGS A;  1ZX5 A;  4M3C F;  1OA2 A;  2ZKN A;  4NRM A;  3ZXJ A;  1GQG A;  4R4X A;  3N9M A;  1AX2 A;  3O1T A;  1MS3 A;  4AFB A;  4XF1 A;  2HEV F;  1H1I A;  3WUD A;  2H0B A;  2JDP A;  4KNC A;  5IK4 A;  5FUP A;  3VKF C;  2DCJ A;  2E26 A;  4JTN A;  1GBG A;  3D6E A;  3MYX A;  1O59 A;  2C4X A;  5EQU A;  2WC2 A;  5LBB A;  4OZX A;  3PUQ A;  2PHR A;  3WDT A;  3GBF A;  1D0G A;  2BYV E;  3P5B A;  3WY6 A;  3M3E A;  1LOG A;  1J84 A;  4LLF A;  2Q1Z B;  5EJ3 A;  1D2Q A;  2GMM A;  3LIG A;  3QCW A;  4HK8 A;  5F3E A;  5F1R A;  5HV0 A;  5CVR A;  4Q1P A;  4CDU B;  1PK6 A;  5K0U A;  1SHW B;  1PHM A;  4MXW A;  4AQ2 A;  5A3N A;  1D2S A;  2QBX A;  3LZZ A;  4BCU A;  2AUY A;  3HQU A;  1RUH 3;  4NRP A;  3WW4 A;  4NO4 A;  4JV4 A;  5FO8 B;  3WW1 A;  2PYT A;  2WII B;  2R0F A;  3OGS A;  4QKB A;  2RMU 2;  4QPG A;  4MGS A;  3WCR A;  4BQW A;  4BXF A;  2YY1 A;  1ALY A;  4EN8 B;  5K7P A;  2NLR A;  4GJZ A;  2R04 2;  4URA A;  1SBF A;  5GJ6 A;  1UPI A;  3VHO A;  1OXC A;  2RG4 A;  4EJR A;  1QQP 3;  4ZPI A;  1WLD A;  5E6H A;  2P6C A;  2VUA A;  3NMB A;  2W08 A;  1MVQ A;  2YXS A;  1WMD A;  3IIA A;  5A7Q A;  4BM8 A;  2D3R A;  4XFH A;  3QH6 A;  4D7S A;  3CMG A;  4AVT A;  4R4Z A;  1POV 3;  2DCK A;  1GUI A;  4LK7 A;  5AC9 2;  1AR9 1;  1YUD A;  4IEY A;  5F3C A;  1PK6 B;  1NUK A;  2DU1 A;  2VE1 A;  2WQ8 A;  5E89 A;  5FPZ A;  4ARY A;  4IET A;  4DNY A;  3VN4 A;  3H8R A;  1A3K A;  2HEW F;  2W47 A;  2G4I A;  3R05 A;  2RS3 2;  5A6X A;  4S2H A;  4GIQ A;  5SV5 A;  2Z5W A;  1J3Q A;  3V65 A;  1NX9 A;  4AFA A;  2KXL A;  2ZGK A;  5F2S A;  3UT0 A;  1BBT 2;  4ZZ5 A;  3CHX A;  4CDX A;  4ISQ A;  3EMR A;  2DFC A;  2ZGP A;  4DXT A;  3MW2 A;  2Z2S B;  4FOW A;  4GQ7 A;  3MLK A;  4LOR A;  4FXG B;  2Y8K A;  3M3Q A;  1C4R A;  5J96 B;  1RC6 A;  1OQE A;  2JDH A;  5LBF A;  4BA6 A;  4CP9 A;  2WZR 1;  4LUK A;  4QQH A;  3B3Q E;  3AXE A;  3TN9 3;  1TE1 B;  1DQ2 A;  3ZSK A;  1XXN A;  4L8Q A;  2Q8E A;  1UX7 A;  3I2G A;  1VBD 1;  4XUP A;  1GZC A;  2X05 A;  2V09 A;  1CIY A;  2NN8 A;  1J59 A;  1YEW A;  4A44 A;  4H7L A;  1UIK A;  1XRU A;  1Y9G A;  2QQJ A;  3PME A;  1ZBA 2;  1JZ3 A;  5F5C A;  4AVS A;  5FPV A;  4QPI B;  4GUL A;  1R09 1;  4A6O A;  5C9A A;  1JYT A;  5K8S A;  5C71 A;  4CP1 A;  1A8D A;  2DVF A;  2WZE A;  4AI0 A;  2IXC A;  2RHP A;  4CDX B;  3ZYB A;  3TOJ A;  1DLC A;  5C3O A;  3BTX A;  2MNG A;  1EYB A;  1CPM A;  5F37 A;  1VPH A;  2VNG A;  4IV3 A;  5IHR A;  4JVA A;  4EE2 A;  2VQA A;  3E5Q A;  3ZSE A;  3WG2 A;  3SNM A;  3ZYR A;  1C8M 1;  4XCA A;  4CPB D;  5FZ9 A;  4CP9 B;  3JQX A;  1LGN A;  1W3V A;  1IPK A;  2OX0 A;  1I9R A;  1UKG A;  4QX5 A;  4ZU7 A;  5DAQ A;  1VRB A;  1WWY A;  1W6N A;  3MIF A;  1JOJ A;  4RSU A;  2VU9 A;  2EXH A;  2XVL A;  1DYK A;  2LS6 A;  3UJQ A;  4UFM A;  3L2H A;  1PVX A;  5T50 A;  4X8P A;  3MIE A;  3IAQ A;  4LBN A;  4ES8 A;  4FTE A;  4BXS V;  1WGP A;  5C9A B;  5K9Y A;  1APN A;  2DCZ A;  2O8Q A;  3I3D A;  5M0T A;  3T0D A;  2WQ4 A;  5JDB A;  2HYX A;  5LY2 A;  2BGC A;  1JYX A;  4JTO A;  4QX2 A;  4CU8 A;  1OPO A;  3MHZ A;  5IVE A;  4FTS A;  2DF7 A;  2CSG A;  2RJK A;  2RMU 3;  4MOA A;  2Y0I A;  1Y43 B;  4IV3 B;  1X8E A;  2A70 A;  1UMI A;  4D6Q A;  1OF3 A;  3OOX A;  3INA A;  2JE8 A;  3MF9 A;  3ZYI B;  1R1A 2;  4AQS A;  4EN9 B;  4Q0U A;  4Y3O A;  3CZU A;  1AUY A;  1OA3 A;  4IL7 A;  1VB4 A;  5FXZ A;  1ZVF A;  3I54 A;  5GLZ A;  1R64 A;  2V72 A;  5BUV A;  1OD3 A;  4Y1U A;  1W6N B;  2DCT A;  2C0Z A;  2J1U A;  2WQZ C;  3KS7 A;  3OCP A;  5FK7 A;  3ZXF A;  1XYO A;  2ZX4 A;  4U36 A;  5KR7 A;  2XVK A;  1N3Q A;  2ZEW A;  3H1Y A;  4QHB A;  3T30 A;  5AC9 3;  5FYZ A;  3WHU A;  2DTW A;  3POB A;  1W90 A;  4LUM A;  2D5H A;  2RS3 3;  2JWP A;  4F83 A;  4BZ4 A;  3MW3 A;  1K42 A;  4CA9 A;  2Z4F A;  1VAM A;  2R6Q A;  4JDM A;  4PQ9 A;  5I93 A;  1D4M 1;  2VCB A;  2WFF 2;  2GC2 A;  3PJQ A;  1BBT 3;  5LY1 A;  1AR9 2;  3LQC A;  4BQ2 A;  3IPV A;  4RS5 A;  2XML A;  4KU7 A;  5GLV A;  3FWE A;  4PBO A;  2LTN A;  2BV4 A;  1VAV A;  2CYF A;  4A7K A;  1UX6 A;  2BNO A;  4FAG A;  4BU2 A;  5JSP A;  3KCY A;  3RZL A;  3U75 A;  3A4U A;  4RHV 1;  5I8Y A;  4Q4Y 3;  4FP3 A;  5IVY A;  5J48 A;  1RJ8 A;  1MEC 1;  4CP2 A;  3NAP A;  4LHS A;  3T0A A;  2CV6 A;  3H3L A;  5A7P A;  3OD4 A;  5DPN A;  4DXS A;  2VMD A;  1S0C A;  3D8C A;  3KM5 A;  3HBZ A;  2BOJ A;  4KH9 A;  4XJZ A;  1QY4 A;  1XNK A;  2H6B A;  1V6N A;  5GLT A;  2ZHN A;  2ARC A;  1NCQ A;  4H2A A;  2BVB A;  3D0S A;  4N90 A;  3ITQ A;  4TN7 A;  5FBZ A;  2ARA A;  5CAZ A;  4WBB A;  4FSJ A;  1RGS A;  4NHX A;  5HCF A;  3T4H B;  4L9B A;  2YHJ A;  5F5A A;  1ZBA 3;  4QM8 A;  4MGT A;  3N9P A;  5KXE A;  2IFR A;  2WJS A;  2WZR 2;  3E5U A;  1OH4 A;  3AVR A;  5K0U C;  1UAI A;  2WT1 A;  3AL6 A;  2RDN A;  3ACL A;  3O0W A;  3PMS A;  1QXJ A;  3IPV B;  4RS5 B;  1VBD 2;  4JC1 A;  3KQR A;  2R1D A;  4PLN A;  4MUV A;  3WVJ A;  3JB8 A;  3ZFF C;  4YVW B;  1F5J A;  3H8U A;  3ZM8 A;  1JYI A;  3ABZ A;  3USU B;  2BZD A;  1EAH 2;  1X9P A;  1CIW A;  4BQ3 A;  4QPG C;  1LU2 A;  1R09 2;  1XPW A;  3NAP B;  1UOB A;  3U78 A;  1NCR A;  3BIW E;  1TZO A;  4FQ4 A;  1TNR A;  5L7O C;  3ATG A;  2ZX0 A;  1ASJ 1;  1NCQ B;  4XF0 A;  5CU1 A;  2FHR A;  5FZ4 A;  5JVV A;  3MI8 A;  3PU8 A;  5IAX A;  5BNO C;  1ENX A;  3L2Y A;  1CX4 A;  3NL1 A;  4LA2 A;  1SLI A;  2QQU A;  2VL4 A;  4HZF A;  1C8M 2;  3H42 B;  2CGP A;  1RUJ 1;  2ZPX A;  1DHK B;  1YQC A;  2J1A A;  2YC4 A;  4IGO A;  3TEY A;  3A7Q A;  2ARB A;  3S7I A;  4AI8 A;  3POS A;  4JGY A;  4Y22 A;  4CCK A;  1KD7 A;  5FQ0 A;  1AHS A;  3EBR A;  4RGK A;  2WA4 A;  1RUD 1;  3DV8 A;  3WZ1 A;  1CPN A;  3AKP A;  4HOO A;  2VPV A;  1J58 A;  3PHM A;  5GZD A;  3WIN E;  1R1A 3;  4CDX C;  2G9F A;  1NCR B;  2ERF A;  3NJV A;  2FDI A;  1JXN A;  1JOP A;  4XUO A;  1AJO A;  2BOI A;  4FPO B;  4DRV A;  2Y6H A;  4NID A;  4Q26 A;  4AZZ A;  1QF3 A;  4BB3 A;  3DL3 A;  5AFB A;  4COV A;  4NAM A;  1QOS A;  3AKS A;  2XUE A;  3PVB B;  5H9P A;  1H1A A;  1TG7 A;  2ZGL A;  3MUZ 1;  4CCO A;  4H14 A;  1UYP A;  1VMH A;  3FHQ A;  1PX3 A;  2VBD A;  3PL0 A;  4ZON A;  4YZ2 A;  3RDI A;  1DU3 D;  2VBB A;  1HN1 A;  3C2U A;  2XB6 C;  4OHW A;  3VBS B;  4YW4 A;  1DG6 A;  4NIA A;  1HLC A;  1LRH A;  1K45 A;  4XJ8 A;  2WRA A;  4MLO A;  2WFF 3;  4JGY B;  4Y22 B;  1HB4 A;  5IVJ A;  1AR9 3;  1SBD A;  4AGG A;  5CFC C;  1S0G A;  2X8K A;  3P3P A;  4MXV A;  5FZ6 A;  4XBQ A;  5LEK A;  1QJF A;  3D5O A;  3ZMO A;  1BHG A;  2TUN A;  2YGL A;  5C3R A;  3O0X A;  1QDC A;  3ZYF A;  5E88 A;  1OT5 A;  4AI1 A;  4AHW A;  5F8P A;  3UNP A;  1D4M 2;  3J26 N;  3JD7 1;  2PAK A;  2NPI A;  2XOM A;  5L36 A;  1V70 A;  3H7J A;  1OBN A;  3N35 A;  4N53 A;  1RUO A;  3NNL A;  3FMG A;  2Q4S A;  4QT6 A;  3LA2 A;  5FR3 A;  2VZV A;  1CN1 A;  3JUU A;  1YQ6 A;  3GBG A;  2OA2 A;  4RHV 2;  3OPW A;  4NVP A;  3J9S A;  4XJ9 A;  2J7M A;  1MEC 2;  1S55 A;  4M00 A;  1OD5 A;  5D2A A;  1CAU A;  2W91 A;  2WZR 3;  5A3T A;  2YU2 A;  5FMB A;  2QKD A;  3PVO A;  1FNZ A;  1O4T A;  1VBD 3;  3ME2 A;  1LCL A;  3CU7 A;  2GP5 A;  3CQO A;  4IEV A;  2DWR A;  3B69 A;  3H3Z A;  4K1Y A;  4P9X A;  4CSW A;  1V6K A;  2JB8 A;  1EAH 3;  2XHN A;  3H1W A;  4LKS A;  4XUR A;  2WNV A;  1OUX A;  2WNU C;  3ZVX A;  4F3J A;  4YGC A;  4FQZ A;  3RZJ A;  4WZC A;  3WQB A;  1UWW A;  1OLQ A;  5KXB A;  3UKV A;  3WCS A;  3ZX7 A;  1J3R A;  2B9V A;  4JKM A;  4AVC A;  2VOK A;  1JYN A;  3GGL A;  3QOP A;  1ZZ6 A;  5FZF A;  5SV8 A;  2JG9 A;  1W0P A;  4AEK A;  2MEV 3;  2A3W A;  2BW8 A;  1D4V B;  2A75 A;  4D7T A;  5L9R A;  1C8M 3;  1C1L A;  1VP6 A;  1J3P A;  2RS1 1;  1CAU B;  2FZ1 A;  4Y1V A;  5FLH A;  4A6S A;  4E9K A;  3J8F 1;  3AMN A;  4JRA A;  1O8S A;  1LHO A;  1IS4 A;  3HIF A;  4GAZ A;  5C33 A;  2GN7 A;  3GJB A;  1ASJ 2;  1OC1 A;  3AB0 A;  3M3I A;  4LBJ A;  4UXA A;  1W3X A;  3WP4 A;  2W46 A;  3WT3 A;  5LK5 A;  3VD9 A;  5EZW A;  5HCB A;  1VE0 A;  1AJK A;  2ADE A;  1JYW A;  3HAG A;  1MS9 A;  2ZGQ A;  3FC0 A;  3ZIX A;  2BWC A;  2WNV B;  5C8W A;  3UL2 A;  5JR2 A;  1LTE A;  1RUJ 2;  1QH7 A;  3DYO A;  1H2K A;  4OMC A;  4Q4V 1;  2WNE A;  1XQN A;  4QB1 A;  4AVB A;  2WWU A;  1IKP A;  3I59 A;  2D43 A;  4W6Y A;  1HQW A;  1UXZ A;  4IES A;  2DVA A;  2IXK A;  3NKT A;  2QE3 A;  2VZO A;  1ND2 C;  5IVV A;  1C3H A;  4BQ1 A;  3NAP C;  4XAB A;  4P5Y A;  1RUD 2;  2PHX A;  3U1X A;  2GND A;  2P1B A;  3SKV A;  5CKM A;  5JZG C;  3DEC A;  3K4D A;  4IXL A;  4Y1X A;  4P9J A;  5JIU A;  1O8P A;  1NCQ C;  2VY0 A;  3VZO A;  1GQP A;  2PA7 A;  4I0A A;  1YFX A;  2WDB A;  4FBF A;  4NAO A;  2ES3 A;  2JB4 A;  1UF2 C;  3K48 A;  3GZE A;  2OQ6 A;  3DEM A;  3RVH A;  1IOA A;  2P3K A;  2OQ7 A;  1DZQ A;  1VBE 1;  3NRU A;  1SLT A;  4K9S A;  1WMF A;  4I0B A;  3VBH A;  2A6Y A;  4FFF A;  3AFK A;  5B2G B;  5C6C A;  1GU3 A;  4K8R B;  2OVU A;  3UES A;  2RDS A;  2EAL A;  3KT1 A;  1MR5 A;  4D94 A;  1OLM A;  2V5Y A;  3I59 B;  1FPN 1;  3HMY A;  2J22 A;  3HT1 A;  4AVV A;  1JZ7 A;  3AMM A;  1D4M 3;  1EV1 1;  4HVQ A;  4G4F A;  5FLJ A;  2QQP A;  2VUC A;  2NYY A;  4DUW A;  1PX4 A;  4OUM A;  1YI9 A;  5IFT A;  3VBR A;  1NCR C;  4FOY A;  1XND A;  4CDW A;  4O61 A;  1AR6 1;  5FZL A;  3T0B A;  3VGI A;  1ZRI A;  4RHV 3;  1CES A;  1FI2 A;  1OI6 A;  3N9O A;  4TLG A;  1MEC 3;  4R8H A;  1JS9 A;  5A1L A;  3WD5 A;  3JD7 2;  3I4I A;  1YI7 A;  3HN1 A;  1IKQ A;  5J1X A;  2ZGU A;  4FCA A;  5A6Y A;  3KHC A;  5CYY A;  4Q29 A;  4A7Z A;  1V6O A;  1SQ4 A;  1W6P A;  5T5L A;  4S2G A;  4AXO A;  2P5B A;  3VBO C;  2VVE A;  2Q8C A;  3BIE A;  3VBH B;  3IDA A;  2P3Y A;  1ZZ8 A;  4COU A;  2P17 A;  1CZS A;  5H9Q A;  1S0F A;  1HXS 1;  2W1U A;  4JGY C;  5FY4 A;  3AMQ A;  4IUG A;  2XBO 1;  1WW4 A;  3ZOI A;  4YFW A;  4C1X A;  1YQ8 A;  2XL7 A;  1S0J A;  1HN0 A;  4XDP A;  3K3O A;  3VBR B;  2EA7 A;  4KGQ A;  1XNA A;  4QPW A;  4CDW B;  5LW9 A;  4HFS A;  1W6O A;  1Y7B A;  3HQX A;  5EFU A;  5FPB A;  3U4X A;  2VZQ A;  4YW6 A;  3G6J B;  1CAX A;  2WT0 A;  1W0N A;  4AFD A;  3PIG A;  5CEH A;  4ISR A;  1W6P B;  2VZU A;  3DKQ A;  1W2O A;  1ASJ 3;  3BPS A;  3USS A;  1H8V A;  3RG0 A;  4FPL A;  5F7U A;  5IFP A;  4P9W A;  1T6B X;  5ANQ A;  2WO2 A;  4X6Q B;  1OLM E;  1GV9 A;  1BK0 A;  2QUO A;  1RUJ 3;  2RS1 2;  3MF6 A;  5J7M A;  5FWE A;  1NE6 A;  2QFE A;  3J8F 2;  5FMO L;  4HMZ A;  4EZH A;  5J3U A;  2FD8 A;  1Q8O A;  4HK9 A;  1J1T A;  2QQL A;  1JH5 A;  2SBA A;  4AFC A;  4XAC A;  4NHL A;  5DUU A;  3AP6 A;  1DYO A;  2ZZJ A;  5A1A A;  2QQW A;  1K3I A;  1I5P A;  1ULD A;  1YNA A;  3ZXD A;  3ZPO A;  4A42 A;  1J83 A;  2C9K A;  4L11 A;  1FT9 A;  3AYE A;  1W6O B;  3WG1 A;  1HRV 1;  4QPY A;  1C28 A;  1ENR A;  1RUD 3;  2ZBJ A;  1S1A A;  2VAU A;  4IND A;  4AAX A;  4E8C A;  2D6P A;  3B7M A;  4NOT A;  4Q4V 2;  4CCM A;  3UKN A;  1CAX B;  1U5Z A;  4N53 C;  3KV4 A;  4WM7 A;  5JXJ A;  3WX5 A;  4DUX A;  1DYP A;  5DG2 A;  2D6K A;  4KGG A;  4E27 A;  1YIF A;  3TB0 A;  5KXD A;  5EYX A;  1H6Y A;  1DGW X;  3WF2 A;  2WZ8 A;  2BDR A;  5ACA 1;  4M4P A;  1MZ6 A;  4NWW A;  2E33 A;  2EF6 A;  5KBF A;  1W8H A;  1RUE 1;  2VMG A;  2VMF A;  1I6X A;  4XQ4 A;  4DIQ A;  2UY8 A;  2NZ9 A;  4OUE A;  4XFB A;  1H9P A;  1UY4 A;  4FP2 A;  3S5Q A;  2PFW A;  5BNQ A;  2WNV C;  1G8W A;  1VBE 2;  5GZF A;  4JKL A;  1YFY A;  3LE0 A;  1NAE A;  4ES9 A;  2ENR A;  2NMO A;  1H30 A;  2BNM A;  3KT7 A;  1GP4 A;  3LB9 A;  1GP6 A;  1ODM A;  1XYP A;  3MUY 1;  3K77 A;  4WM7 B;  3SCF A;  1FPN 2;  5F6L B;  2JG9 C;  1W8N A;  2F4L A;  2Q8D A;  3FX3 A;  3LEK A;  3C3V A;  3JD7 3;  4JQT A;  1RXF A;  4L92 A;  1EV1 2;  2EIC A;  1AL2 3;  2GSY A;  1ULO A;  1RIT A;  2JD4 A;  4DO0 A;  4D3W A;  1GZ9 A;  3LA7 A;  1C5H A;  1DQ6 A;  1MS5 A;  2W95 A;  2VW2 A;  4MZU A;  1HRI 3;  4N8M A;  1AR6 2;  2OS2 A;  1KFX L;  5T52 A;  4P9Y A;  2YU1 A;  5FPL A;  2RR1 1;  2EID A;  4CPB A;  2PHU A;  3ZYJ B;  1NG0 A;  3R6S A;  5JCT A;  2VOV A;  4Y1Z A;  2VD7 A;  5F5Q A;  5FZ1 A;  2GDF A;  2E63 A;  1X9T A;  1N1Y A;  4LE3 A;  2RS3 1;  2ARX A;  2HWB 2;  5D1I A;  2R06 1;  1OFN A;  3LEG A;  2YV8 A;  3BTA A;  1V6M A;  4M01 A;  1HXS 2;  2JDZ A;  3O14 A;  2XBO 2;  1QJY 1;  2LM3 A;  4GWN A;  3VBF A;  4GWM A;  3Q9O A;  5F6K A;  1QDO A;  4QQ2 A;  5DXD A;  2PLV 3;  3AP9 A;  3CNA A;  2D7F A;  3ZXG A;  4Q4Y 1;  1E5H A;  3LDK A;  2JKB A;  3VD4 A;  1OOP A;  5LAT A;  2F6B A;  2IZW A;  2SLI A;  3WF0 A;  1FXZ A;  2YZ4 A;  5FY7 A;  5A3L A;  2HYK A;  4MHU A;  5CBL A;  2RS1 3;  1RVF 1;  4K1Z A;  3LIH A;  1CQ9 A;  3ZYG A;  3O1S A;  1UY3 A;  3HN3 A;  3NNG A;  2HEY F;  3J8F 3;  4MVT A;  2AEY A;  4BK4 A;  4AED A;  1SLL A;  3VBH C;  4AWD A;  1DLL A;  2WFP A;  4OQ8 A;  4ATF A;  1H2N A;  1L3J A;  2QDR A;  3GDB A;  1VIW B;  1LOF C;  4YM2 A;  3EJK A;  4LKD A;  1ZRD A;  1V6I A;  2CDP A;  2VXJ A;  3R4D B;  4YWA A;  4BOW A;  1QHD A;  4Q4V 3;  5FOB B;  3VBF B;  3I3M A;  1HJG A;  2Q1F A;  1KS5 A;  2O0O A;  3SKJ E;  3LAG A;  3VBR C;  4OUL A;  2H0V A;  2VM9 A;  4CDW C;  4IEU A;  2ZTN A;  3ZXL A;  2YC0 A;  4KI5 M;  1W2U A;  4LUL A;  4LIV A;  3AYC A;  3PTY A;  3ILF A;  3VDB A;  3T2Q A;  1HRV 2;  1OOP B;  3OY8 B;  3A23 A;  4XF4 A;  1NY7 1;  3HT2 A;  2IWG B;  5FP7 A;  4Q4X 1;  2XJR A;  3IMN A;  4U2A A;  1COV 1;  4YM1 A;  3IT8 A;  4YG3 A;  3FN9 A;  5EP9 A;  2KR2 A;  1JHJ A;  2CNA A;  2AC1 A;  2UWC A;  2FDK A;  3VL8 A;  1JTZ X;  2EIB A;  1QJX 3;  2JDK A;  3B9C A;  3IZO A;  1WCD J;  2WSU A;  1W9T A;  4GD4 A;  4UT5 A;  3NQH A;  5G05 L;  2D3S A;  3TEW A;  1WME A;  1ZBE 1;  1VBE 3;  3T2T A;  5I8S A;  5ACA 2;  4QB6 A;  1RUE 2;  2C26 A;  1O3T A;  4HVR A;  4LR4 A;  5ANN A;  3WG4 A;  4F8A A;  3O12 A;  1HB3 A;  4B1M A;  1QEX A;  5KHH A;  3M70 A;  1FPN 3;  2XH6 A;  2WLQ A;  4OUS A;  3UGF A;  1DZR A;  3M3C A;  2PHT A;  1YC6 1;  1EV1 3;  4FFI A;  2ZGR A;  4K8F A;  1LEN A;  2BUK A;  5AVA A;  1BYH A;  1R1A 1;  3ZFF A;  3C8X A;  4G3Y C;  1URX A;  2Y6G A;  1AR6 3;  5EV7 A;  1VAK A;  3WG3 A;  3CEW A;  1JZ5 A;  4KWU A;  2K0G A;  1JZ4 A;  4QHZ A;  4I3G A;  3ALQ A;  5FMD A;  3DPR A;  2ID4 A;  1BVV A;  1RIR A;  3QAC A;  5T3N A;  1B35 C;  4OHY A;  2R07 1;  5L7O A;  1AR7 1;  4HKL A;  3VB9 A;  3PLQ A;  2X09 A;  1XU1 A;  2GAU A;  4OYU A;  4IE4 A;  5BNO A;  1RHI 1;  2HWB 3;  5JR7 B;  2Q30 A;  5D8A A;  1XYN A;  2VCM A;  4FPF A;  3T1L A;  1UO9 A;  4XUN A;  2WFF 1;  4J6G A;  2RR1 2;  3FZ3 A;  3D0J A;  5C3P A;  3MO4 A;  1HXS 3;  1OFS A;  5A32 A;  4ZU4 A;  1DIW A;  2LAL A;  2XBO 3;  5K0U B;  1CZT A;  2PN5 A;  2ZMK A;  2NM1 A;  5HPO A;  4RGG A;  4XJW A;  5LZ6 A;  4MXW B;  3ZFF B;  4N7I A;  1WA4 A;  4JCK A;  4LE4 A;  1W8F A;  2R06 2;  2CTV A;  2ZX1 A;  3MIC A;  4WM7 C;  2GMP A;  5GLW A;  5BXX A;  2F4P A;  3C7G A;  4XJA A;  4HN0 A;  1YFU A;  4XTP A;  4M0N A;  5FZ8 A;  4QPG B;  2FCT A;  3SH5 A;  2ZEZ A;  1KJL A;  1QJY 2;  5BPX A;  3GBW A;  1I1E A;  3DPR B;  3HR9 A;  3KF5 A;  2IVI B;  3S57 A;  1WW7 A;  4MO3 M;  5L7O B;  4I02 A;  5FLI A;  1DCS A;  1O5L A;  4ZKT B;  3POY A;  3WDU A;  4Q4Y 2;  2R7E B;  4L2N A;  1LOA A;  3PUI A;  5BNO B;  4LTA A;  1R08 1;  3AVS A;  4NPR A;  5D8A B;  2VOW A;  3RNS A;  2YRO A;  1DGL A;  5BNP A;  2UU8 A;  5G04 L;  3ELN A;  2UYA A;  2WN2 A;  4YW5 A;  1RVF 2;  3QBQ A;  4DY3 A;  1UYY A;  4URT A;  2NQY A;  5JIA A;  2AYH A;  2Y0O A;  3AMH A;  3KGZ A;  4J1X A;  4W65 A;  1BQP A;  1EAH 1;  4LKE A;  1C1F A;  1PVC 3;  1NLS A;  3PJY A;  3ZLI A;  1O6U A;  1S4C A;  5FIX A;  4OI2 A;  4DEV A;  5CFC A;  5J37 A;  1IS6 A;  4Q1R A;  3RZM A;  1HRV 3;  4WV8 A;  3NKG A;  4QKF A;  2I45 A;  3DUI A;  5DUX A;  4HBN A;  5IYY A;  3SQO A;  3AJZ A;  5FPA A;  3N7J A;  2C24 A;  2RS5 1;  3THT A;  2MEV 1;  5JXG A;  5DMY A;  5F32 A;  4NWV A;  1YIP A;  2HH9 A;  3LGR A;  2J1T A;  3MLL A;  4Y24 A;  5DDJ 1;  4Q27 A;  2ZCW A;  1HIX A;  5KHJ A;  1WW5 A;  1Q3E A;  1NY7 2;  1VBB 1;  5ACA 3;  5BNP B;  4IW3 A;  4Q4X 2;  4CU6 A;  4QAW A;  1COV 2;  2W9X A;  2DUO A;  1RUE 3;  2C1F A;  4B7K A;  5CKN A;  1S2E A;  4AR2 A;  5F3I A;  4ASL A;  1VMF A;  4Z8B A;  1PMH X;  3KWV A;  4KWL A;  1V00 A;  2E6V A;  5FP4 A;  3RGB A;  5JUV A;  4XAA A;  1GOF A;  2VO5 A;  2ZGT A;  5IVC A;  1HV0 A;  4OQ9 A;  1L7Q A;  4K6B A;  1KIT A;  1ZBE 2;  4MGK E;  3EO6 A;  4MGZ E;  4QKD A;  5DAW A;  5FBJ A;  2RDQ A;  5DAX A;  4EN0 A;  5CFC B;  3VBF C;  1J1L A;  1AYN 1;  1LOB A;  3PVN A;  3WUC A;  3W5M A;  4IEW A;  3CF6 E;  4JRL A;  2WNU A;  2VTX A;  4PT6 A;  1HB1 A;  3RI9 A;  4CCN A;  3VKL A;  1YYN A;  3RWN A;  4HON A;  1RUI 1;  3FFZ A;  1OOP C;  1T6G C;  2ZEX A;  3NV2 A;  2V4A A;  4LXL A;  1S2K A;  5JOY A;  2YYO A;  1IS3 A;  3J4U H;  1BKZ A;  4OI0 A;  2EXI A;  2B4K A;  5FRA A;  3URF A;  4AEJ A;  5I0S A;  3O1R A;  1JI6 A;  4AED C;  1D0H A;  3WDX A;  3VZM A;  1OUR A;  2RR1 3;  2XJS A;  2B39 A;  3E97 A;  4EN6 B;  2OXB A;  1MQT C;  2R07 2;  1AR7 2;  4GA9 A;  4DPN A;  4NE9 A;  3OD0 A;  3CBN A;  4UAP A;  5CIR A;  1N3O A;  4NRO A;  4ATE A;  2HBU A;  1RHI 2;  5CNA A;  3A21 A;  2R06 3;  1FMD 1;  3KQ4 B;  1O5U A;  5JXI A;  3V64 A;  2D6L X;  3H7Y A;  3OEB A;  3LA3 A;  2WNU B;  4SBV A;  1W6Q A;  4R9C A;  3LDR A;  4NIH A;  1TNF A;  1QJY 3;  2YPD A;  5IK7 A;  2A6V A;  4IE6 A;  2J1S A;  1OSG A;  3WSO A;  1QMJ A;  1ZZB A;  2HJI A;  2PHF A;  2VCC A;  4ASK A;  5C5T A;  5LK7 B;  1RUF 1;  4FXK B;  1RUN A;  1UU5 A;  2LRO A;  3ZO0 B;  5ERL A;  1ND2 A;  3UGH A;  3POI A;  1X7N A;  1UXX X;  3MID A;  1PNF A;  3AZZ A;  4XZU G;  5A3M A;  5CFD A;  2ATF A;  4YRD A;  5JZG A;  3BTY A;  1DQ1 A;  1EPW A;  1RVF 3;  5LA2 A;  2WBK A;  2YBK A;  4QU1 A;  3RYR A;  4RFR B;  4IE7 A;  2WR9 A;  1LOD A;  3Q8E A;  5A7S A;  5FYB A;  1GNY A;  1R08 2;  2RJ2 A;  3THC A;  5E16 A;  2DUR A;  5FDB A;  3PIJ A;  4LQR A;  1QOT A;  3GCW A;  2VZ1 A;  4LBQ A;  3LSE A;  4DOU A;  2G1M A;  3EXU A;  3CJI A;  3IWZ A;  1K5J A;  3ZPY A;  1W8U A;  1SG3 A;  4ZS3 A;  3ZSJ A;  5JMO A;  4XFF A;  2EXJ A;  1F2N A;  3OUI A;  1SEF A;  4Z82 A;  2CDO A;  4W6W A;  1F9K A;  3P1I A;  2P34 A;  3SH3 A;  1JOB A;  1ND2 B;  1UZV A;  4LNV A;  5F5I A;  4FO9 A;  4W6X A;  1BXH A;  4QXB A;  4JQR A;  4W8J A;  4AI9 A;  1ZZC A;  4B4Q A;  3DPR C;  5CFD B;  4Y20 A;  5JZG B;  3PUA A;  1XSQ A;  4Q4X 3;  1JBC A;  4QXH A;  1COV 3;  3GM8 A;  4Q2F A;  4GWI A;  1LAJ A;  3POF A;  3WQ7 A;  3JXS A;  1RYY A;  5LA9 A;  1L7L A;  4RYD A;  4K21 A;  3KVB A;  2RS5 2;  4CDQ A;  2MEV 2;  3OGJ A;  5I0R A;  5D8A C;  3OF1 A;  4JHT A;  5DDJ 2;  1W99 A;  3FLP A;  3I49 A;  1DQ5 A;  4RFT 0;  5LRR A;  3T4V A;  1ZBE 3;  1VBB 2;  4P5H A;  3ZDV A;  3VBO A;  3BB6 A;  4NUB A;  3LPF A;  4Z2A A;  3CJI B;  4FPY A;  5IAV A;  1N1T A;  3M4F A;  4HPK A;  2W94 A;  3Q8F A;  1H8T A;  3ZSL A;  4HT1 T;  5FPX A;  2IXH A;  2CAU A;  4YZ5 A;  1JU3 A;  2GN3 A;  4ZU5 A;  4CCC A;  1MS0 A;  2ZJC A;  4GB3 1;  1AYN 2;  2I07 B;  3I3E A;  5FXX A;  3KZ4 C;  2VCA A;  4Y20 B;  3VZL A;  5C8C A;  1SDW A;  2VTX J;  1CGP A;  3KV9 A;  4ONU A;  1RUG 1;  5T5P A;  1HDK A;  1RUI 2;  4CDQ B;  3DGT A;  1PO1 1;  4QU2 A;  4UW4 A;  5I8T A;  4E4Z A;  3N7K A;  4IV1 A;  1H4G A;  5BNP C;  1RMU 1;  1LEM A;  2R07 3;  1AR7 3;  1ZZ7 A;  3HPN A;  3OPT A;  3P6B A;  4P14 A;  4QXK A;  4RR3 A;  4DIN B;  3VBO B;  1F4A A;  2XLA A;  4KL1 A;  2GAL A;  3MZH A;  1RHI 3;  2PHL A;  3RJ2 X;  2OW4 A;  3N7L A;  5JSR A;  1GYK A;  3CLP A;  1W2T A;  3IDE A;  4Q0V A;  4FOV A;  1LES A;  1A6C A;  4HPK B;  4B3N A;  1LHU A;  5FQ0 B;  1H8T B;  1SLB A;  3BYW A;  3ZFE C;  4WVV A;  1LR5 A;  2FDJ A;  4BIS A;  5JPM B;  3ZN4 A;  2ZHM A;  1PNG A;  1UNB A;  2ZKL A;  2GC1 A;  4NPM A;  2FMD A;  2VMI A;  1FMD 2;  4GAL A;  5BV6 A;  3O7O A;  2DTY A;  1AL2 1;  4LOT A;  4N43 A;  2EXK A;  2FDG A;  4FPE A;  4JGZ A;  4ZXE A;  3ILN A;  4AGR A;  5L73 A;  1WD3 A;  1ZA4 A;  3PVE A;  1HRI 1;  1RUF 2;  3HJR A;  3NV1 A;  1LU1 A;  3JCI A;  5T55 A;  4C0B A;  3AZY A;  3LD8 A;  1R08 3;  5JOZ A;  1GOG A;  2AR6 A;  3LPG A;  2VMC A;  1OH3 A;  3H9A A;  2HBT A;  2R30 A;  2PHD A;  3KHB A;  1M06 G;  4UFI A;  4Z1V A;  1NXM A;  4NRQ A;  3AZW A;  4PI2 A;  4XZP A;  3KV5 A;  3OGR A;  4NN0 A;  4YM3 A;  4MGQ A;  3WF4 A;  2DVG A;  1Z0H A;  4PLO A;  1Y4W A;  1EY2 A;  1W2N A;  1ULG A;  3EB7 A;  2Z79 A;  3VD3 A;  2DYC A;  1PZ8 A;  1MS4 A;  2Q1M A;  4WM8 A;  4BK5 A;  1TMF 1;  4E8D A;  4N43 B;  2BPA 2;  2PLV 1;  4ITC A;  3W58 A;  4BDV B;  2HKX A;  2W92 A;  4N53 B;  3ZSM A;  1KQR A;  2WA3 A;  2YGM A;  1XOY A;  1ULC A;  2R16 A;  2Y6J A;  2R0H A;  5T5O A;  1NKG A;  2RS5 3;  4YGD A;  1LHN A;  1W2A X;  5DDJ 3;  5FOJ B;  1XNB A;  2ZGS A;  1E5I A;  1C5I A;  1ST8 A;  3PUR A;  4QGN A;  4BHP A;  3V0B B;  1O3S A;  1VBB 3;  2KA3 A;  3TAY A;  4QQP A;  5DAV A;  1N1S A;  1W39 A;  4D69 A;  2W39 A;  4DUV A;  5ISL A;  1DQ0 A;  5ABJ A;  1NA1 A;  4FI9 A;  4QDR A;  1AXY A;  2DBN A;  1UPS A;  1V9U 1;  4YPJ A;  5JPN B;  4KWJ A;  1W8Z A;  3RPQ A;  2E7T A;  4CEW A;  1ULE A;  2ILM A;  4NHY A;  2WS9 3;  1AYN 3;  1JW6 A;  1KFU L;  5FXW A;  3RI8 A;  1S0B A;  2VNV A;  1U5I A;  4BPZ A;  2X5I C;  2CY6 A;  3LEI A;  3THP A;  2JG9 B;  3AKQ A;  3T1M A;  4AFM A;  4EYU A;  4XF9 A;  1RUI 3;  3O5S A;  3WQ0 A;  4BME A;  1SLA A;  1WD4 A;  4JDO A;  5FZB A;  3ZDS A;  3JZV A;  1NLQ A;  3ZMN A;  5CFD C;  1POQ A;  3GAL A;  3ES1 A;  1C57 A;  3DXU A;  5FZ0 A;  4GB3 2;  3GZA A;  1GQH A;  3VLB B;  4LK6 A;  4CTE A;  3KVA A;  4A7Y A;  2B46 X;  1WA6 X;  1WLT A;  1QJX 1;  3QH7 A;  4XFA A;  5GZG A;  1RUG 2;  1PZ9 A;  3ON7 A;  1RUC 2;  1XBF A;  3SEP A;  1PO1 2;  2D40 A;  4TSV A;  1NA1 B;  3T08 A;  4XVH A;  2HWD 3;  4LBQ D;  4PHZ A;  1W05 A;  1K5M C;  1RMU 2;  1ZNP A;  4CXW A;  1UY2 A;  1JYC A;  2OUH A;  5EXO A;  3DCQ A;  3CJI C;  2IVJ A;  1TVG A;  4FPK A;  3A0N A;  1FMD 3;  1LOF A;  4RN5 A;  5JLV A;  1FOD 1;  4LMF A;  5DN2 A;  5AVP A;  4YSF A;  5FTT C;  5L9B A;  3FHI B;  2FDH A;  1DDL A;  1S0D A;  1CAV A;  1LOC A;  4LO4 B;  4J25 A;  1W28 A;  3SCH A;  1STM A;  2ARE A;  4LOS A;  1IS5 A;  5FJH A;  4XUQ A;  1QXR A;  1SCS A;  3LOB A;  1KJR A;  2FCV A;  5T54 A;  1JZ6 A;  4FAH A;  4YAR A;  3HWJ A;  4YNI A;  3W59 A;  5IK8 A;  1RUF 3;  3U37 A;  1CJP A;  3HVD A;  4ZXK A;  5KHK A;  3BPZ A;  3GHN A;  4BQ4 A;  1TEI A;  2H6C A;  4CDQ C;  4LT5 A;  4PCR A;  1AL2 2;  4LHL A;  2FMY A;  3MPP G;  4BMB A;  2ZAC A;  2ORX A;  5FAX A;  1MZF A;  2XJP A;  3HEI A;  3OUH A;  4PQQ A;  2HWB 1;  2B42 B;  1HRI 2;  5FZG A;  5LA1 A;  3NNM A;  4AED B;  4LJH A;  1G9C A;  1UD1 A;  3CL1 A;  2XGX A;  1G7Y A;  1A8M A;  1NE4 A;  2W1W A;  1DGR N;  4X6R B;  1H8T C;  1HKD A;  1SPP A;  1VBA 1;  1GOH A;  2CGO A;  2K9Z A;  2QQO A;  3BCW A;  4V2W A;  1CAV B;  3N4M A;  2OYZ A;  3UYJ A;  2IC1 A;  3MIH A;  3CKH A;  1GMM A;  2PMW B;  4I0W B;  1H2L A;  3D3A A;  4Q4W 2;  3VKN A;  4O9G A;  4QM9 A;  2A6W A;  3ST7 A;  5DAB A;  1SMV A;  1YQ5 A;  3J7L A;  3M2M A;  5EJZ B;  5JI7 A;  2JXA A;  3OSD A;  5C8C C;  4CUC A;  1NT0 A;  3BVC A;  4CP0 A;  4Y4Y A;  1VR3 A;  1TMF 2;  3AC0 A;  3NJY A;  4XPV A;  3RS6 A;  5FYT A;  5IT6 A;  4MGI E;  2PLV 2;  5FY9 A;  2ZHL A;  4IV1 C;  1DF0 A;  1SFP A;  1H0B A;  1OQD A;  1X36 A;  4HVO A;  5A7W A;  2PEL A;  3KCC A;  4RR3 C;  1S0E A;  4TYS A;  4BLI A;  2RJL A;  4BWO A;  3R4S A;  4E4S A;  3WLU A;  4LIU A;  2C6S A;  1G9A A;  1BMV 1;  4K40 A;  4B7E A;  2CGN A;  1Z78 A;  1B35 A;  2GNT A;  2QQI A;  3IDC B;  5FYS A;  5J98 B;  2GC0 A;  2JE7 A;  2XR4 A;  1WLW A;  1SPP B;  1H9W A;  3POJ A;  4S2F A;  1IPJ A;  2VOT A;  4IE5 A;  5GZE A;  2YMZ A;  4A2U A;  1LGB A;  2DVD A;  3C7E A;  1PVC 1;  3AXD A;  1REF A;  4A4A A;  3VHR A;  1ZYB A;  3GF6 A;  3T09 A;  3OGG A;  1X50 A;  4QX1 A;  1V9U 2;  1EPZ A;  4BJ0 A;  4BQY A;  4NIG A;  4YYO A;  3WDV A;  3IDB B;  4N43 C;  4AYU A;  1LJ7 A;  2GZW A;  4MAD A;  3AK0 A;  4JGZ C;  4GB3 3;  2QDN A;  1AZD A;  1XE0 A;  1WZX A;  2VMH A;  2ZXQ A;  3ZR6 A;  2VVF A;  4XJU A;  3ZXE A;  4OMD A;  4TLF A;  2YUE A;  1UZY A;  1RUG 3;  2QQM A;  1ZRR A;  1WBF A;  4FPH A;  2JDM A;  1RUC 3;  5FWJ A;  1PO1 3;  5A3O A;  5FZK A;  4QQO A;  1B35 B;  3FFQ A;  4HSL A;  4GXL A;  5F2W A;  4B8E A;  3ZR5 A;  1RMU 3;  2BTV C;  4Q8L A;  5FP8 A;  1A78 A;  5FYC A;  1I3H A;  1QJX 2;  4XMA A;  5FY5 A;  2JDA A;  4XHB A;  2D3P A;  1HW5 A;  1KDM A;  3VDD C;  3GZU C;  3M7A A;  5A33 A;  3M1H A;  3K75 B;  3ACH A;  2DUQ A;  3M8L A;  4D6S A;  4WM8 C;  4XBL A;  5FP3 A;  1O7F A;  1UYZ A;  2ZX3 A;  3POG A;  3AP4 A;  3N9Q A;  4A45 A;  3P3N A;  4MG2 A;  2JEN A;  3PDQ A;  3PUS A;  1FOD 2;  1XNT A;  2F17 A;  3N7M A;  1GWM A;  2BRT A;  4LO5 B;  5KC6 A;  1E57 A;  5A1F A;  2PXJ A;  4LA3 A;  5FZH A;  5IVB A;  4QDQ A;  4R9D A;  3K3N A;  2Y34 A;  1G86 A;  4LO8 A;  1H6X A;  2E51 A;  2G9Z A;  4H55 A;  1WMX A;  4XW3 A;  4LBL A;  3S7E A;  1GWK A;  3WNK A;  3I2K A;  3OTF A;  2Y6F A;  4XDQ A;  1AR8 2;  5ABJ C;  1NA1 C;  1ZA7 A;  3RRD A;  3SIS A;  1JZ8 A;  4GH4 C;  3AP5 A;  3GNE A;  4SLI A;  4XC9 A;  2QZ3 A;  5A33 B;  5HBA A;  1LOE A;  1ND3 A;  2ADD A;  1EUT A;  5FP9 A;  3WNP A;  4CEW C;  5HCA A;  3JU9 A;  5A7N A;  1UCX A;  4CCD A;  4ERO A;  5LBC A;  4Q4W 3;  2X29 A;  3FBY A;  1H2M A;  4N7U A;  4QHO A;  3UET A;  2BGP A;  3NJX A;  2BBV A;  1RXG A;  2D6O X;  1UW8 A;  3FJS A;  1VBA 2;  1TMF 3;  2BFU S;  1GAN A;  2XON A;  4IEO A;  3ZKU A;  5C5U A;  1R1Z A;  4IDZ A;  2W1Q A;  3W21 A;  1CD3 G;  3FLR A;  2LW8 A;  1QOO A;  5EPA A;  4IEZ A;  2WAB A;  1YFW A;  2NMN A;  2Y26 A;  5FY0 A;  5HI0 A;  5FK8 A;  4E2Q A;  2IXL A;  2VQU A;  2D6N A;  4C0H A;  2EAK A;  5KHG A;  4COW A;  5FY1 A;  4BIO A;  2XG3 A;  3THD A;  5IW0 A;  4UW5 A;  3SHR A;  4QKN A;  1CR7 A;  1DBN A;  1F5F A;  1W8W A;  2K46 A;  1YXW A;  4G9S B;  4IER A;  2WIN B;  4YW2 A;  3TNQ A;  3O1M A;  3JBG 1;  2CWM A;  3AYA A;  3WW3 A;  1WCQ A;  3BOW A;  4O7X A;  4EV0 A;  1ND3 B;  4MH0 E;  1WKY A;  2J42 A;  4MX3 A;  3AMP A;  4UBG A;  3SH4 A;  3RSJ A;  4QGM A;  4XQW A;  2GH8 A;  1BMV 2;  4HN1 A;  4Z2W A;  4HET A;  1MQT A;  1V9U 3;  5J09 A;  2WYF A;  4NJ4 A;  2OT7 A;  4DB5 A;  1SBE A;  2XL9 A;  4XE9 A;  3RMX A;  3FLT A;  2AEZ A;  4WVM A;  2PQS A;  1ODN A;  2A73 B;  1PVC 2;  5JOX A;  1GIC A;  3IN9 A;  4N9H A;  1C8N A;  3ETP A;  4UWD A;  4AHX A;  1Y3T A;  2E31 A;  3LSD A;  2JEM A;  4DRR A;  4HKW A;  4UF0 A;  5BNN A;  3TEZ A;  4E4H A;  1AF9 A;  3BAL A;  3PUH A;  2DU0 A;  2LUW A;  3O0V A;  3SCG A;  4P9L A;  4PBP A;  3HQR A;  4AOC A;  4MHR A;  3X29 B;  3GZT B;  2VNR A;  4NHK A;  5CB7 A;  2PAM A;  3SC7 X;  4FFH A;  3WP3 A;  3AP7 A;  5J36 A;  1BK1 A;  4FPC A;  1W0O A;  1WCU A;  2W52 A;  4PIY A;  3SIT A;  2ET1 A;  2YB7 A;  5GLU A;  3VL9 A;  3WNX A;  5EJ1 B;  1LNS A;  1MQT B;  1PM4 A;  2B7Y A;  4DEQ A;  3RQ0 A;  4JX0 A;  5F3G A;  3U4S A;  1JZ2 A;  4YLZ A;  2A6X A;  4BQX A;  5FY8 A;  5FZA A;  3H0O A;  4WVM B;  1ACC A;  4QGL A;  5FMC A;  4GKY A;  1FOD 3;  2YBS A;  1GZW A;  5LBE A;  3V0B A;  3POW A;  3WW2 A;  2YG0 A;  1UQX A;  2QZ2 A;  1IHM A;  3MBW A;  4UF0 B;  1K12 A;  5BNN B;  1VAL A;  3IBM A;  1Q8Q A;  1GSL A;  2DCY A;  2QJV A;  3PU3 A;  3GCX A;  3HNY M;  4YVS A;  2V73 A;  3I2I A;  4CCE A;  3ZYH A;  3WP5 A;  1DP0 A;  5FJK A;  4TTG A;  4D8M A;  1ONA A;  4I09 A;  5F9T A;  2QQK A;  2RM2 1;  4N9I A;  1GKB A;  3W9A A;  4V1P A;  5C3Q A;  2OPW A;  2R49 A;  1AR8 3;  3QLQ A;  5FZ7 A;  1NQD A;  1Y9M A;  3VD7 A;  2IXJ A;  3TBD A;  3VZK A;  2DV9 A;  3R0R A;  2BFU L;  1SDD B;  4XFG A;  4AQ6 A;  3J7M A;  1UOJ A;  4XXA A;  5FYI A;  3WNN A;  4BQ5 A;  1RJ7 A;  1Q5O A;  2CHH A;  3IM0 A;  2BP6 A;  3ROU A;  1P8J A;  1QXP A;  4HXC A;  3UKT A;  1RTV A;  4K20 A;  3A22 A;  1N3P A;  4L0P A;  4UFJ A;  1GZW B;  5JOW A;  4YW3 A;  1VBA 3;  2D98 A;  3B93 A;  4YW1 A;  3VUO A;  3I7D A;  3GHM A;  3AX4 A;  2XJU A;  1HX6 A;  2YFU A;  4YGE A;  3N9L A;  2O14 A;  3FE5 A;  5FZD A;  3OBT A;  5HCH A;  3ZFG C;  5DG1 A;  4YVS B;  1WCS A;  4ZZ8 A;  2WZP P;  5D21 A;  3N3H A;  2EVX A;  4ET7 A;  4S2D A;  1OKQ A;  2BBA A;  5DUV A;  2ZHK A;  1W06 A;  2W1S A;  4GJY A;  2GNM A;  2WO1 A;  2XLG A;  1F15 A;  2WN3 A;  3BKZ A;  2ZMN A;  5IK5 A;  2V5D A;  1NYW A;  4Q0S A;  5KWR A;  1UIJ A;  2C9A A;  3MGU A;  2ZX2 A;  1NQJ A;  1IZ3 A;  2JIG A;  2O1Q A;  3WF3 A;  2VZP A;  5DUW A;  4OI4 A;  4PF1 A;  4XFI A;  5C7G A;  1UMZ A;  4FPG A;  5A32 B;  1QIQ A;  2XQR A;  4GZ9 A;  4QPI A;  4P00 B;  3T2P A;  3JBG 2;  1PIV 1;  1OHF A;  1Q8V A;  2ZAA A;  4RL7 A;  4UW3 A;  5GKA C;  3IAP A;  3T2O A;  1TQ5 A;  4Q8K A;  2ZOE B;  4OFG A;  1X33 A;  4O65 A;  5JI9 A;  1VRH 3;  3U11 A;  3NWK A;  4LBM A;  2HWC 1;  3GYD A;  4YM0 A;  4I01 A;  4Y4R A;  3ZFE A;  3BU0 A;  5TSW A;  3I97 A;  5CZK A;  4ZS2 A;  2VEC A;  5FYH A;  2I74 A;  4CYD A;  2G19 A;  2WO7 A;  3DYM A;  4YZ4 A;  4MET A;  3MFC A;  4XQD A;  4NR1 A;  4XHX A;  2GME A;  3VD5 A;  5EIY B;  4RGA A;  2OZJ A;  1ENQ A;  1T2X A;  2PAE A;  1GFF 2;  3E6B A;  3DYP A;  2R32 A;  3WOG A;  3NNF A;  4LHK A;  3F95 A;  3ZIW A;  3LWC A;  1U5Y A;  2JIJ A;  2OUJ A;  2X53 S;  2B8M A;  3OBR A;  4XYX A;  3LDB A;  1ND3 C;  1RED A;  1ZRC A;  1OLR A;  1W9W A;  5A3P A;  1YCI A;  2JG8 C;  4D6R A;  3KGL A;  3UGG A;  1GWL A;  3WDY A;  3S5A A;  3HNB M;  3C7H A;  1VMJ A;  2XLF A;  4CXY A;  4ASM B;  1ZZ9 A;  2LRP A;  4RQP C;  2WS9 1;  4HG6 B;  3RYP A;  3ZFE B;  3DXT A;  1W03 A;  2TNF A;  3WNM A;  4UBH A;  2UY9 A;  4JDN A;  4KU8 A;  3QD6 A;  3AKT A;  1LHV A;  3MEP A;  3BTZ A;  2XPJ A;  4HLT A;  3LF7 A;  2JDN A;  3I3Q A;  4UYB A;  4OI1 A;  4GWJ A;  4PDW C;  2MPF A;  2J1R A;  3HBK A;  2CL2 A;  1OKO A;  3UV9 A;  1JYV A;  2RE9 A;  3DKW A;  2B5H A;  3E6D A;  3KV6 A;  2QVS B;  4EZ4 A;  2P3J A;  4YG0 A;  3B94 A;  2RM2 2;  4V2V A;  4E4D X;  2GP3 A;  3FHA A;  1AVB A;  3NO8 A;  5LEJ A;  2HLE A;  3POE A;  3LOI A;  4R9B A;  1O3R A;  2HWD 1;  1Q56 A;  2ZEY A;  1LB2 A;  4QWN A;  3BOD A;  2GH2 A;  5FPU A;  4H3W A;  2AEN A;  3IB3 A;  3UK9 A;  2WYS A;  5H9S A;  2VC9 A;  3K2O A;  3AZX A;  3VDA A;  2R04 3;  1NZI A;  5K4L A;  4ZHN A;  2OZ6 A;  3B5L B;  2YDE A;  2A1X A;  4AF9 A;  4FFG A;  1YJL A;  3PTR B;  1Y9Q A;  5HV4 A;  4F7Z A;  3GXU A;  2WAA A;  4WVZ A;  2O8O A;  3VHN A;  3AYD A;  2BVV A;  5BNN C;  5A7O A;  1HV1 A;  4CU9 A;  2XWB B;  5A3U A;  1N1V A;  2AGS A;  5DZG A;  2X5I A;  1Z7S 1;  4HSJ A;  3S0M A;  2A3X A;  1XJA A;  2ZGM A;  3C7F A;  3CJX A;  3ENR A;  2WWJ A;  4DMI A;  1OUS A;  4GKX A;  4XET A;  1QJE A;  2AZ5 A;  2X10 A;  4MV2 A;  5FRE A;  5CG9 A;  1PO2 1;  2KM2 A;  1H4H A;  4K7J A;  2A3Y A;  2WLP A;  2Q0A A;  3JBG 3;  4CDU C;  4XCB A;  1YO8 A;  4LO6 B;  4J1W A;  1W6M A;  3MFA A;  1KS4 A;  1O4Y A;  4UOJ A;  4QX3 A;  5I0T A;  4DY5 A;  4LO7 A;  4YVW A;  5EHD A;  3A0K A;  4XF3 A;  4UFK A;  1G9D A;  3MIG A;  4KMQ A;  1K5M A;  2VUL A;  2XDV A;  5A3W A;  1WBL A;  4LKF A;  3USU A;  1W6Q B;  5DZF A;  3MV0 1;  4YW7 A;  2XKO A;  2ZGN A;  1CJD A;  1WCK A;  1PIV 2;  1W9F A;  3NV3 A;  4BIF A;  1US2 A;  1ULP A;  4AHY A;  2W5F A;  5GM0 A;  5DQ0 A;  4YVS C;  2X5I B;  4XIL A;  4IEX A;  2HWC 2;  3RZG A;  1AXK A;  3BUC A;  1UZZ A;  4JHZ A;  5KHI A;  2YPJ A;  4TXW A;  4Y33 A;  2P4E A;  3ZKY A;  5BY5 A;  4NII A;  1WW6 A;  2ZAH A;  2HWF 1;  5LRS A;  3B02 A;  2FZ2 A;  4AGV A;  1QH6 A;  4FT8 A;  1BVP 1;  4AI3 A;  3OUJ A;  5FO7 B;  1D7P M;  1PK6 C;  4KWK A;  1SAC A;  3ES4 A;  4HL0 A;  1W6M B;  3W20 A;  4A41 A;  5CG8 A;  3VDC A;  5IVF A;  4OCT A;  3OJB A;  3MV1 1;  1NXD 1;  2ZAB A;  3PNA A;  5FO9 B;  1PGW 1;  1K5M B;  1DGR A;  2PHW A;  4LBQ B;  4MGY E;  3EYP A;  3TYJ A;  3ZXA C;  1KXG A;  1IPS A;  2ZML A;  1G6N A;  1XNC A;  1Q8S A;  4FPJ A;  3FL7 A;  3H1M A;  1QGL A;  3MW4 A;  4I3P A;  4LBO A;  3ASI A;  3MPB A;  4AEM A;  4C90 A;  2Z42 A;  3IMM A;  2VW1 A;  2XXZ A;  3KSC A;  4LHN A;  3BI3 A;  1N47 A;  2WS9 2;  3OPZ A;  1W9Y A;  4COY A;  3LFI A;  4ZY9 A;  2UWA A;  3VZJ A;  2JKX A;  1TME 1;  1NZC A;  4YZ1 A;  3AKR A;  1W04 A;  2VZR A;  2RM2 3;  4XUT A;  3NW4 A;  1RUC 1;  5FYV A;  4AG4 A;  4I2O A;  2VGD A;  3VBS A;  4AVA A;  1XC6 A;  2ZS6 B;  4MSV A;  3HD8 B;  4CVU A;  2XWJ B;  2E53 A;  2WAO A;  4QPI C;  4B4P A;  1YRZ A;  2P2K A;  1PMI A;  1EUU A;  4DS0 A;  4CUB A;  3JB4 C;  3E5X A;  2VG9 A;  3FBM A;  1GR3 A;  3CDZ B;  3H50 A;  1U5X A;  2HWD 2;  2VXR A;  3APB A;  1CVN A;  2E7Q A;  5B4N A;  4FTB A;  4AL9 A;  1OA4 A;  4Y5S A;  4CEY A;  2WWS A;  4Y1Y A;  5F39 A;  2FQP A;  1JUI A;  4QMA A;  1I5Z A;  2Y6K A;  2E7A A;  1FAY A;  3C7O A;  2WUH A;  4EN7 B;  1BZW A;  3MIB A;  5C8C B;  5HXV A;  4HKO A;  3EHK A;  1GNZ A;  1VJ2 A;  3UJO A;  4P02 B;  1PGL 1;  2Y6L A;  1H1M A;  4Q5O A;  2C5D A;  2XJQ A;  1VB2 A;  2UWB A;  4IV1 B;  3ZXK A;  2J1E A;  1S2B A;  4FVV A;  4RR3 B;  1F4H A;  1A34 A;  1Z7S 2;  1GP5 A;  1UZW A;  5L9V A;  1VBC 1;  5C9A C;  5FYY A;  5APA A;  5EYY A;  2IXI A;  4LLO A;  2D5F A;  1W9S A;  4GMP 1;  1YHF A;  2D44 A;  4YG6 A;  2JD9 A;  2VQT A;  3F2Z A;  4NPL A;  2R1B A;  4CCL A;  4CCJ A;  3CIH A;  5EWS A;  1PO2 2;  5I0D A;  1CX1 A;  3HOB A;  4KBZ A;  5JXH A;  1QJU 1;  4CEY B;  2QQN A;  4IV3 C;  1PIV 3;  1V0A A;  4Q4W 1;  1LHW A;  1CZV A;  1IG0 A;  2BJS A;  1B09 A;  4M4R A;  4COZ A;  1W8T A;  1SFN A;  3Q8A A;  1AYM 1;  5I0U A;  3VDD A;  2XQX A;  3WNO A;  2CWS A;  1YJK A;  2W0X A;  5CKQ A;  3M3O A;  1MVE A;  5C4W A;  2HWC 3;  2P3I A;  1UL9 A;  4KBB A;  4OHX A;  3WV6 A;  3TNP B;  4AE2 A;  1PM7 A;  1AX1 A;  4JGZ B;  4QQL A;  5IAT A;  5FUN A;  2E32 A;  1F8V A;  2JDY A;  4TZD A;  1HQL A;  3III A;  5IWF A;  3J7N A;  3K4A A;  4Y5Z 0;  1E5S A;  1QU0 A;  5FZO A;  3KCX A;  1Q43 A;  4W4Z A;  2VUD A;  1X8M A;  3E1F 1;  3I2O A;  5CIS A;  3Q8C A;  1BEV 1;  4XMI A;  2A5Z A;  2HWF 2;  1SZB A;  1R09 3;  1DQ4 A;  2WT2 A;  3I2F A;  1US3 A;  5DAP A;  5CA6 A;  1G9F A;  4GH4 A;  5BYN A;  3VDD B;  1CWP A;  2OKX A;  3ACF A;  3CO2 A;  5C4W B;  5LCW L;  4WM8 B;  1PGW 2;  4I30 A;  4QXC A;  5A80 A;  1E5R A;  1JN2 P;  1QKQ A;  4XFC A;  4XEZ A;  5IUQ A;  3I2J A;  4DXR A;  1XU2 A;  5I91 A;  4C91 A;  4DQA A;  4RA0 A;  1FAT A;  3H8X A;  1ZRE A;  2J1V A;  4YZ3 A;  3OBA A;  2IFW A;  1LKN A;  3K46 A;  4IEQ A;  3WNL A;  1MPX A;  3K4Z A;  2VZS A;  1UY1 A;  1RIN A;  5FZO B;  2VZT A;  5FYM A;  4OLL A;  3RZH A;  2A71 A;  2BGO A;  2Y60 A;  3BGA A;  3Q8B A;  1O91 A;  4B4R A;  3VBU A;  1LEC A;  4R52 A;  2HWE 1;  3ZYP A;  1TME 2;  1OMI A;  3KD4 A;  2Y33 A;  5FZ3 A;  3KB5 A;  2Q8O A;  3RZZ A;  4RS5 C;  4X8N A;  3RMY A;  4CZS A;  4JAA A;  1NLR A;  4YVW C;  5ABJ B;  2DBI A;  2EIE A;  3J7H A;  4GH4 B;  3WHT A;  3WP6 A;  1SCR A;  3RFR A;  4XIO A;  4OZO A;  1JMU B;  3WR0 A;  3NV4 A;  4CUG A;  4CEW B;  4AHZ A;  4XIK A;  4AI2 A;  2XJT A;  3LEM A;  2BNN A;  5DZE A;  5FMO S;  3WEZ A;  4AW7 A;  4TWT A;  1CAW A;  3V0A A;  5LWB A;  1XB9 A;  2DVB A;  2KD7 A;  3LFM A;  1Q8P A;  4M0H A;  1FYU A;  5C70 A;  1V6L A;  4DZG A;  1RB8 G;  1ZRF A;  1BCX A;  2JDU A;  2QNK A;  3ETQ A;  2ZA9 A;  1JHN A;  4KQ7 A;  3RZK A;  1XSR A;  2ZZQ A;  3ZN5 A;  4AAP A;  1YWK A;  4W50 A;  3ACG A;  3VBU B;  5E1R A;  1Z7S 3;  1DZT A;  3VZN A;  2Y38 A;  3LKJ A;  4Y26 A;  4P08 A;  2IUW A;  3E6C C;  2D97 A;  1AR8 1;  4B1L A;  5JSO A;  3WF1 A;  2WL1 A;  1PGL 2;  4Z92 B;  1PO2 3;  4IGQ A;  3O1O A;  3I2D A;  3OYW A;  4A3Z A;  4GMP 0;  2FCU A;  1O3Q A;  4O9E A;  2BEO A;  2DDU A;  2E9Q A;  3NNJ A;  3K51 A;  3HNM A;  3SLI A;  4IGP A;  1REE A;  1VBC 2;  4CXX A;  4R9A A;  1UMH A;  1DFQ A;  1WLC A;  1GLH A;  1RL3 A;  1RUH 1;  5FCC A;  1CAW B;  2D93 A;  3V0A B;  1FV2 A;  2D6M A;  3NST A;  4BYY A;  3DN7 A;  2RDR A;  2ETE A;  2PTM A;  4EQV A;  4CUA A;  1QJU 2;  5LA0 A;  1HJF A;  4MYE A;  2JX9 A;  1MS1 A;  2CAV A;  2RV9 A;  3FUQ A;  1M4W A;  2K2S A;  3SXW A;  1AYM 2;  1ENS A;  3TRS B;  3VKO A;  1QQP 1;  1LUL A;  5FZE A;  5T5J A;  5L19 A;  3U14 A;  3OBZ A;  1KEX A;  3RJR A;  1MS8 A;  1HB2 A;  3B01 A;  1GNH A;  4IE0 A;  3VBS C;  1UZ0 A;  1VLN A;  3U10 A;  1POV 1;  3T3Y A;  3DF0 A;  3D82 A;  5A6Z A;  4CE8 A;  3OYW B;  2HWF 3;  4OHV A;  2WKK A;  1UKR A;  2VVD A;  5B4X A;  3RWK X;  1QJZ A;  2JE9 A;  3OGV A;  3ECQ A;  2XJV A;  4Q0Q A;  3SMH A;  2UYB A;  4Y5T A;  1X82 A;  4NMI A;  1IQD C;  2YFZ A;  2WSV A;  1IG3 A;  1QNW A;  3BOP A;  4PJY A;  1BEV 2;  4LPL A;  3S6P A;  1FV3 A;  4XDO A;  1SFY A;  4CEY C;  5A70 A;  2OPK A;  3L9J T;  1V6J A;  2XKP A;  1JOD A;  3O1V A;  1VRH 1;  5E8A A;  4A3X A;  5FV3 A;  2DFB A;  4CU7 A;  4K3U A;  5FUI A;  4ORF A;  4PIZ A;  2TBV A;  4EWE A;  1KRI A;  1MZ5 A;  2ET7 A;  3B00 A;  5FKB A;  5KC5 A;  1UU4 A;  1O4Z A;  1UU6 A;  1LGC A;  1ZM1 A;  2G9G A;  2P37 A;  4BE3 A;  1QNY A;  2MHF A;  3ZFG A;  2W87 A;  5A7W B;  1TME 3;  3TN9 1;  1OF4 A;  2VR4 A;  4C8D A;  1MAC A;  1AXZ A;  3ILR A;  2Q5T A;  4NHM A;  4EWA A;  4M3C A;  2VUJ A;  2ZGO A;  3VHP A;  2VW0 A;  4BH9 A;  2RVA A;  2L9L A;  4KG0 A;  2VOX A;  3N9N A;  3G7D A;  2HWE 2;  1BLZ A;  1U12 A;  4LEJ A;  4P9G A;  2AAC A;  5GZC A;  2VTF A;  4KG8 A;  4PF5 A;  3WXP A;  2GC3 A;  1PZ7 A;  4YGB A;  5C4W C;  2W3J A;  2VME A;  3MLJ A;  2P6H A;  4QX0 A;  3B9I A;  4JKK A;  4E2S A;  2I2S A;  5KXC A;  2VZ3 A;  4UW6 A;  4PIX A;  3AJY A;  4DFS A;  2VNO A;  3H3U A;  5LAS A;  1OVS A;  3VV1 A;  3BU7 A;  3LCP A;  2DUP A;  4EWD A;  1ULF A;  1DGW A;  3NVC A;  3ZFG B; 
#chains in the Genus database with same CATH homology
 1W2N A;  1RXG A;  3ZKU A;  1HJG A;  1BK0 A;  1W06 A;  2VAU A;  4RGK A;  1GP5 A;  1UZW A;  1QJE A;  5APA A;  1W2A X;  2CSG A;  1E5I A;  4XAE A;  3OOX A;  1QIQ A;  4BB3 A;  2BJS A;  2JB4 A;  2BU9 A;  1HJF A;  2DBN A;  2VBD A;  2VBB A;  1HB3 A;  1ODN A;  1HB4 A;  1HB2 A;  2WO7 A;  2VE1 A;  1QJF A;  1GP4 A;  1GP6 A;  1ODM A;  1E5S A;  1HB1 A;  3ZKY A;  5C3R A;  1RXF A;  1WA6 X;  1OBN A;  3ON7 A;  1IPS A;  1W05 A;  1UOF A;  1UOG A;  1E5R A;  2VCM A;  2IVJ A;  1UO9 A;  5C3P A;  1W03 A;  1W9Y A;  1UNB A;  3ZOI A;  1W28 A;  2Y60 A;  2BRT A;  2JB8 A;  1W04 A;  2VBP A;  5C3Q A;  1E5H A;  1BLZ A;  5C3S A;  2DBI A;  2IVI B;  1UOB A;  2Y6F A;  5C3O A;  1DCS A;  1W2O A;  1W3V A;  1OC1 A;  1W3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...