1UOTP

Human cd55 domains 3 & 4
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
125
structure length
125
Chain Sequence
KSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT DECAY-ACCELERATING FACTOR
publication title Mapping Cd55 Function. The Structure of Two Pathogen-Binding Domains at 1.7 A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Regulator of complement pathway
total genus 16
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2003-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1uotP02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1uotP01
1ZJKA 1OJYA 1GHQB 1H03P 4J38B 5JPMG 1UOTP 4WJG2 1QO6A 1SRZA 4LOSA 1G4FA 2CG6A 1NWVA 1O9AA 3OP8A 2MCZA 5HZPB 4K12A 1Z92B 2WIIC 3IU3I 3NFPI 4YNXA 3T5OA 5I0QB 1GKGA 1OK3A 1HCCA 5FO8C 1SS2A 1MD7A 3RJ3D 3ZRZA 1OJWA 3IX0A 5HYTB 1VVDA 2LOJA 2JGXA 3L89M 4FXGG 2RKZA 4DJZA 2KMSA 3GOVA 4PZ5A 3M7PA 2XWBF 2JGWA 1H2PP 4F4OC 1CKLA 4KKDA 4AYEA 2G7IA 2UWNA 1Q3XA 2CKUA 2MCYA 3EJHA 1HFIA 1VVCA 1G4GA 4ZH1D 3OEDC 1HFHA 2RKYA 4AYDA 3KXVA 3OXUD 2W81A 1TPMA 1TPNA 1H2QP 2B5ID 3MQLA 2XRDA 1FBRA 2IZ3A 1E88A 1OK9A 2KRIA 2RLQA 2V8EA 2YRAA 2EHFA 2XRBA 1H04P 4AYIA 1ELVA 3O8EB 2EC3A 4MUCA 1GPZA 3SW0X 3ERBA 3TVJA 3R62A 2IZ4A 2XWJI 1U5MA 3KZJA 3ZD2A 4A5WB 3INBC 4C16A 4CSYA 1OK1A 1OJVA 2ERJA 2QY0A 4AYMA 1E5GA 5HYUB 2CG7A 2RL0A 2YBYA 3CALA 2O39C 4JHSA 4B2RA 4ONTD 2RLPA 1PPQA 4IGDA 2JRAA 2A55A 4LOTA 1QGBA 4B2SA 1E8BA 1LY2A 1GKNA 2XQWC 5HYPA 1OK2A 1MD8A 1TPGA 1C1ZA 1QUBA 2BZMA 2W80A 3ZD1A 3GXEA
chains in the Genus database with same CATH superfamily
1ZJKA 1OJYA 1GHQB 1H03P 4J38B 5JPMG 1UOTP 4WJG2 1QO6A 1SRZA 4LOSA 4APLA 2CG6A 1G4FA 1NWVA 1O9AA 3OP8A 2MCZA 5HZPB 3VWOA 4K12A 2I2LA 1Z92B 2WIIC 2Y8RA 3IU3I 3NFPI 4YNXA 3T5OA 5I0QB 1GKGA 1OK3A 1HCCA 4N7EA 5FO8C 1SS2A 1MD7A 3RJ3D 3ZRZA 2Y8TA 1OJWA 3IX0A 5HYTB 1VVDA 2LOJA 2JGXA 3L89M 4FXGG 2RKZA 4DJZA 2KMSA 3GOVA 4PZ5A 3M7PA 2XWBF 2Y8SA 2JGWA 1H2PP 5DN5A 4F4OC 1CKLA 4KKDA 4AYEA 2G7IA 2UWNA 1Q3XA 2CKUA 2MCYA 3EJHA 1HFIA 1VVCA 1G4GA 4ZH1D 3OEDC 1HFHA 2RKYA 4AYDA 3KXVA 3OXUD 2W81A 1TPMA 3F6KA 1TPNA 4PO7A 1H2QP 2B5ID 3FGTA 3MQLA 3FGRA 2XRDA 1FBRA 2IZ3A 1E88A 1OK9A 2KRIA 2RLQA 2V8EA 3K3TA 2YRAA 2EHFA 2XRBA 1H04P 4AYIA 1ELVA 3O8EB 1RLHA 2EC3A 4MUCA 1GPZA 3SW0X 3ERBA 3TVJA 3CI0J 3R62A 2IZ4A 3NJAA 2XWJI 1U5MA 3KZJA 3ZD2A 4A5WB 3INBC 4C16A 4CSYA 1OK1A 1OJVA 2ERJA 2QY0A 4AYMA 3WSXA 1E5GA 5HYUB 2CG7A 2RL0A 2YBYA 3CALA 2O39C 4JHSA 4B2RA 4ONTD 2RLPA 4BWCA 4MSLA 1PPQA 4IGDA 2JRAA 3WSYA 5DN4A 3ZLEA 2A55A 4LOTA 2X2ZA 3ZLDA 1QGBA 4B2SA 1E8BA 1LY2A 1GKNA 2XQWC 5HYPA 1OK2A 1MD8A 2ZYCA 1TPGA 1C1ZA 1QUBA 2BZMA 4YIZA 2W80A 3ZD1A 3GXEA
chains in the Genus database with same CATH topology
1ZJKA 1OJYA 1GHQB 1H03P 4J38B 5JPMG 1UOTP 4WJG2 1QO6A 1SRZA 4LOSA 1G4FA 2CG6A 1NWVA 1O9AA 3OP8A 2MCZA 5HZPB 4K12A 1Z92B 2WIIC 3IU3I 3NFPI 4YNXA 3T5OA 5I0QB 1GKGA 1OK3A 1HCCA 5FO8C 1SS2A 1MD7A 3RJ3D 3ZRZA 1OJWA 3IX0A 5HYTB 1VVDA 2LOJA 2JGXA 3L89M 4FXGG 2RKZA 4DJZA 2KMSA 3GOVA 4PZ5A 3M7PA 2XWBF 2JGWA 1H2PP 4F4OC 1CKLA 4KKDA 4AYEA 2G7IA 2UWNA 1Q3XA 2CKUA 2MCYA 3EJHA 1HFIA 1VVCA 1G4GA 4ZH1D 3OEDC 1HFHA 2RKYA 4AYDA 3KXVA 3OXUD 2W81A 1TPMA 1TPNA 1H2QP 2B5ID 3MQLA 2XRDA 1FBRA 2IZ3A 1E88A 1OK9A 2KRIA 2RLQA 2V8EA 2YRAA 2EHFA 2XRBA 1H04P 4AYIA 1ELVA 3O8EB 2EC3A 4MUCA 1GPZA 3SW0X 3ERBA 3TVJA 3R62A 2IZ4A 2XWJI 1U5MA 3KZJA 3ZD2A 4A5WB 3INBC 4C16A 4CSYA 1OK1A 1OJVA 2ERJA 2QY0A 4AYMA 1E5GA 5HYUB 2CG7A 2RL0A 2YBYA 3CALA 2O39C 4JHSA 4B2RA 4ONTD 2RLPA 1PPQA 4IGDA 2JRAA 2A55A 4LOTA 1QGBA 4B2SA 1E8BA 1LY2A 1GKNA 2XQWC 5HYPA 1OK2A 1MD8A 1TPGA 1C1ZA 1QUBA 2BZMA 2W80A 3ZD1A 3GXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZJK A;  1OJY A;  1GHQ B;  1H03 P;  4J38 B;  5JPM G;  1UOT P;  4WJG 2;  1QO6 A;  1SRZ A;  4LOS A;  1G4F A;  2CG6 A;  1NWV A;  1O9A A;  3OP8 A;  2MCZ A;  5HZP B;  4K12 A;  1Z92 B;  2WII C;  3IU3 I;  3NFP I;  4YNX A;  3T5O A;  5I0Q B;  1GKG A;  1OK3 A;  1HCC A;  5FO8 C;  1SS2 A;  1MD7 A;  3RJ3 D;  3ZRZ A;  1OJW A;  3IX0 A;  5HYT B;  1VVD A;  2LOJ A;  2JGX A;  3L89 M;  4FXG G;  2RKZ A;  4DJZ A;  2KMS A;  3GOV A;  4PZ5 A;  3M7P A;  2XWB F;  2JGW A;  1H2P P;  4F4O C;  1CKL A;  4KKD A;  4AYE A;  2G7I A;  2UWN A;  1Q3X A;  2CKU A;  2MCY A;  3EJH A;  1HFI A;  1VVC A;  1G4G A;  4ZH1 D;  3OED C;  1HFH A;  2RKY A;  4AYD A;  3KXV A;  3OXU D;  2W81 A;  1TPM A;  1TPN A;  1H2Q P;  2B5I D;  3MQL A;  2XRD A;  1FBR A;  2IZ3 A;  1E88 A;  1OK9 A;  2KRI A;  2RLQ A;  2V8E A;  2YRA A;  2EHF A;  2XRB A;  1H04 P;  4AYI A;  1ELV A;  3O8E B;  2EC3 A;  4MUC A;  1GPZ A;  3SW0 X;  3ERB A;  3TVJ A;  3R62 A;  2IZ4 A;  2XWJ I;  1U5M A;  3KZJ A;  3ZD2 A;  4A5W B;  3INB C;  4C16 A;  4CSY A;  1OK1 A;  1OJV A;  2ERJ A;  2QY0 A;  4AYM A;  1E5G A;  5HYU B;  2CG7 A;  2RL0 A;  2YBY A;  3CAL A;  2O39 C;  4JHS A;  4B2R A;  4ONT D;  2RLP A;  1PPQ A;  4IGD A;  2JRA A;  2A55 A;  4LOT A;  1QGB A;  4B2S A;  1E8B A;  1LY2 A;  1GKN A;  2XQW C;  5HYP A;  1OK2 A;  1MD8 A;  1TPG A;  1C1Z A;  1QUB A;  2BZM A;  2W80 A;  3ZD1 A;  3GXE A; 
#chains in the Genus database with same CATH topology
 1ZJK A;  1OJY A;  1GHQ B;  1H03 P;  4J38 B;  5JPM G;  1UOT P;  4WJG 2;  1QO6 A;  1SRZ A;  4LOS A;  4APL A;  2CG6 A;  1G4F A;  1NWV A;  1O9A A;  3OP8 A;  2MCZ A;  5HZP B;  3VWO A;  4K12 A;  2I2L A;  1Z92 B;  2WII C;  2Y8R A;  3IU3 I;  3NFP I;  4YNX A;  3T5O A;  5I0Q B;  1GKG A;  1OK3 A;  1HCC A;  4N7E A;  5FO8 C;  1SS2 A;  1MD7 A;  3RJ3 D;  3ZRZ A;  2Y8T A;  1OJW A;  3IX0 A;  5HYT B;  1VVD A;  2LOJ A;  2JGX A;  3L89 M;  4FXG G;  2RKZ A;  4DJZ A;  2KMS A;  3GOV A;  4PZ5 A;  3M7P A;  2XWB F;  2Y8S A;  2JGW A;  1H2P P;  5DN5 A;  4F4O C;  1CKL A;  4KKD A;  4AYE A;  2G7I A;  2UWN A;  1Q3X A;  2CKU A;  2MCY A;  3EJH A;  1HFI A;  1VVC A;  1G4G A;  4ZH1 D;  3OED C;  1HFH A;  2RKY A;  4AYD A;  3KXV A;  3OXU D;  2W81 A;  1TPM A;  3F6K A;  1TPN A;  4PO7 A;  1H2Q P;  2B5I D;  3FGT A;  3MQL A;  3FGR A;  2XRD A;  1FBR A;  2IZ3 A;  1E88 A;  1OK9 A;  2KRI A;  2RLQ A;  2V8E A;  3K3T A;  2YRA A;  2EHF A;  2XRB A;  1H04 P;  4AYI A;  1ELV A;  3O8E B;  1RLH A;  2EC3 A;  4MUC A;  1GPZ A;  3SW0 X;  3ERB A;  3TVJ A;  3CI0 J;  3R62 A;  2IZ4 A;  3NJA A;  2XWJ I;  1U5M A;  3KZJ A;  3ZD2 A;  4A5W B;  3INB C;  4C16 A;  4CSY A;  1OK1 A;  1OJV A;  2ERJ A;  2QY0 A;  4AYM A;  3WSX A;  1E5G A;  5HYU B;  2CG7 A;  2RL0 A;  2YBY A;  3CAL A;  2O39 C;  4JHS A;  4B2R A;  4ONT D;  2RLP A;  4BWC A;  4MSL A;  1PPQ A;  4IGD A;  2JRA A;  3WSY A;  5DN4 A;  3ZLE A;  2A55 A;  4LOT A;  2X2Z A;  3ZLD A;  1QGB A;  4B2S A;  1E8B A;  1LY2 A;  1GKN A;  2XQW C;  5HYP A;  1OK2 A;  1MD8 A;  2ZYC A;  1TPG A;  1C1Z A;  1QUB A;  2BZM A;  4YIZ A;  2W80 A;  3ZD1 A;  3GXE A; 
#chains in the Genus database with same CATH homology
 1ZJK A;  1OJY A;  1GHQ B;  1H03 P;  4J38 B;  5JPM G;  1UOT P;  4WJG 2;  1QO6 A;  1SRZ A;  4LOS A;  1G4F A;  2CG6 A;  1NWV A;  1O9A A;  3OP8 A;  2MCZ A;  5HZP B;  4K12 A;  1Z92 B;  2WII C;  3IU3 I;  3NFP I;  4YNX A;  3T5O A;  5I0Q B;  1GKG A;  1OK3 A;  1HCC A;  5FO8 C;  1SS2 A;  1MD7 A;  3RJ3 D;  3ZRZ A;  1OJW A;  3IX0 A;  5HYT B;  1VVD A;  2LOJ A;  2JGX A;  3L89 M;  4FXG G;  2RKZ A;  4DJZ A;  2KMS A;  3GOV A;  4PZ5 A;  3M7P A;  2XWB F;  2JGW A;  1H2P P;  4F4O C;  1CKL A;  4KKD A;  4AYE A;  2G7I A;  2UWN A;  1Q3X A;  2CKU A;  2MCY A;  3EJH A;  1HFI A;  1VVC A;  1G4G A;  4ZH1 D;  3OED C;  1HFH A;  2RKY A;  4AYD A;  3KXV A;  3OXU D;  2W81 A;  1TPM A;  1TPN A;  1H2Q P;  2B5I D;  3MQL A;  2XRD A;  1FBR A;  2IZ3 A;  1E88 A;  1OK9 A;  2KRI A;  2RLQ A;  2V8E A;  2YRA A;  2EHF A;  2XRB A;  1H04 P;  4AYI A;  1ELV A;  3O8E B;  2EC3 A;  4MUC A;  1GPZ A;  3SW0 X;  3ERB A;  3TVJ A;  3R62 A;  2IZ4 A;  2XWJ I;  1U5M A;  3KZJ A;  3ZD2 A;  4A5W B;  3INB C;  4C16 A;  4CSY A;  1OK1 A;  1OJV A;  2ERJ A;  2QY0 A;  4AYM A;  1E5G A;  5HYU B;  2CG7 A;  2RL0 A;  2YBY A;  3CAL A;  2O39 C;  4JHS A;  4B2R A;  4ONT D;  2RLP A;  1PPQ A;  4IGD A;  2JRA A;  2A55 A;  4LOT A;  1QGB A;  4B2S A;  1E8B A;  1LY2 A;  1GKN A;  2XQW C;  5HYP A;  1OK2 A;  1MD8 A;  1TPG A;  1C1Z A;  1QUB A;  2BZM A;  2W80 A;  3ZD1 A;  3GXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...