1UPGA

Crystal structure of the quorum-sensing protein tram from agrobacterium tumefaciens
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
90
structure length
90
Chain Sequence
VELRPLIGLTRGLPPTDLETITIDAIRTHRRLVEKADELFQALPETYKTGQACGGPQHIRYIEASIEMHAQMSALNTLYSILGFIPKVVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Quorum-Sensing Protein Tram and its Interaction with the Transcriptional Regulator Trar
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Transcription repressor
molecule keywords TRANSCRIPTIONAL REPRESSOR TRAM
total genus 31
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09228 Prok-TraM Prokaryotic Transcriptional repressor TraM
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.160 Mainly Alpha Orthogonal Bundle Helix Hairpins HR1 repeat 1upgA00
1URFA 4IGGA 1CXZB 2HJDA 1UPGA 1RFYA 1US6A 2Q0OC 4DYLA 2RMKB 4NKGB 4NB5A
chains in the Genus database with same CATH superfamily
2X0LA 1PP9H 4RO2A 3K5LA 4X20B 4JI8O 4LF9O 5K1PA 1S76D 3U11A 2WSSG 2XAQA 3P30A 2D3OW 1YSCA 1WP7A 4I5SA 3UQ8A 3T4DA 4BIUA 2DYSB 4HZ3A 2LJ2A 4DRXA 2PY5A 4JAUA 4GYCB 3ZMVA 1H38A 3ZRSA 3CMEV 1GO3F 1GH6A 4NXNB 5JH7B 4CH6A 3N2GB 5C93A 2XT9A 4ICGA 4EFBA 1Q43A 3F5WC 3CYOA 1FXKB 4Q6GA 2X6AA 5B1OA 3SPHA 5L3EA 2WLIB 1IBKO 3SJBC 1YDXA 5IYZB 1OCCC 3I5DA 4PDMA 2UXDO 2ZR2A 3G4SV 3LSSA 2KG7B 3UO3A 5JVDA 2JDIG 2Q67A 4DV4B 3UM7A 4BAYA 1K9MW 3BRCA 1ZL8B 3L74H 1AP6A 3N2KA 2QJ1A 1NR7A 3ETEA 4X65O 2ATKC 1AI6A 4P9OA 4UCUA 1WAZA 2P06A 5GTHZ 2ZDIA 1VQNV 4MTGA 4DR1B 2X7RB 1VEWA 4QPKA 1BL8A 2DYRC 4JV5B 3WB0A 5KHGA 1K3EA 3T4ZA 2P6JA 4KUMA 1NTMH 4PA3A 3VQYA 4NYKA 2EIKC 4NTXA 1YI2V 3FKSG 1WLEA 3L71H 5H5NA 1KECA 1BQ0A 1YIJV 3CEIA 1JFFB 2LFSA 4UCSA 3JSNA 3JALB 3J7AU 3K5OA 4DUYO 4QGPA 1JVMA 3K5NA 2UU9B 2N04A 1H2MA 3ABUA 2UXCO 4L8JA 1N33O 1XMOO 4QPJA 4J9YB 1PL0A 4UCTA 2YUAA 2XHBA 3U0ZA 4FLWA 2PF4E 1XOUA 4TOIA 4UVBA 4LF8B 1F51A 3ZHRA 1PNKA 1EZVH 3P3NA 1GN3A 3N2GA 2FL4A 3H1HH 1V54B 1GRJA 3ASOC 4LFCO 1R6KA 5CB4B 1RFYA 4X64B 3HKDB 3ZMSA 2HKOA 3CJHB 3RYCA 5KAIZ 3ETDA 3ZHSA 3ZRWB 4DR5O 4X1IB 4WFAV 4YJ2A 2QWNB 1OCRB 1QLNA 3HKEB 2HJDA 4LR3A 5FPRA 1AJNA 2M6YA 4UCRA 2VWJA 2OYQA 4DRXB 3E8FA 1RPRA 2H3OA 4JI6O 3CMAV 5GW7A 1M56C 2KKWA 4TV8B 1FXVA 4QJFB 5J9PC 3ABKC 2CTPA 4YY3B 1DGSA 4AQYO 3E22A 2HHHB 3ASOB 1S5LZ 2QWRB 4O2AA 4X9QA 2BCCH 4JI3B 2ZT9B 4FK5C 3K59A 4R50A 3ABLB 1X59A 4UV8A 1H2KA 2GUZA 4X8AA 1P7BA 3FB7C 5LYJA 2DJVA 4DR7B 1ZX3A 4GZRB 4PD4F 3UT5B 5LGTA 4PA6A 2ADPA 2P7TC 1MG1A 4PHZA 2AHYA 2UUAB 4B3SO 1MSDA 4LF7O 1D5AA 4DV5O 3CRRA 5KAFZ 1HW7A 2OCHA 4G2KA 2DYRB 1ZSPA 1YJ9V 2P5OA 1KBHA 2YEVB 4WFFA 4JI4O 3LSQA 2EILB 1N32B 1QR8A 2AW9A 2BTQB 1KMIZ 3LNNA 3U10A 1VQ6V 4DV2O 5L3BA 5FLXN 4MVQA 5DM6V 3IJ4A 4MW3A 1K4CC 2Q68A 1PPJH 3CRAA 5FNVB 4LCUC 1F4MA 5C8YA 3B8MA 4F6RA 1XILA 4IT5A 4QE9A 2Q7EA 4X66B 3H9VA 3W7TA 2F4VB 2CGOA 4MVUA 4XDKA 4AQYB 4K3AA 1GM8A 4JI2B 4PV1B 1V55C 1JR9A 5E79Z 1E1RG 1FS0G 5LXTA 2DYSC 4DUZO 5CN0A 1XMQB 2N05A 2OTLV 5JQGA 3G6EV 1NT2B 1XHZA 3FB8C 2YXYA 3THOA 2CAZC 4AILC 5LBQA 3D8CA 1GN6A 1HP8A 1SQFA 1XQ8A 1SESA 3BCCH 3M8AA 1ORQC 4YIOA 3RW0A 3M7MX 2BE3A 2QKSA 2P22C 4JI1B 4MVSA 2KSDA 3RN4A 5IDJA 3CRMA 1XNRO 4IYIA 3O65A 5IJ0A 4UVAA 2IH1C 2X6CA 4LP8A 1E1QG 1P49A 4FM1A 1WPBA 5KX5A 1FAFA 3JATB 4B3TB 2QDOA 1WA8A 1VF6C 3MHHC 3BABA 5IYBO 1P4RA 2HHHO 3NR7A 2UXBB 2JRIA 4DUYB 1VQPV 4YJ3A 4LF5O 1XHXA 2K1EA 3JASA 3APOA 3SYAA 2E75B 3CS5A 3OFNG 2EZPA 2IBZH 2R9IA 4E4EA 4O4LA 5CA0B 3FYIB 2ZR3A 4UV9A 3SYPA 1G8MA 2CH7B 3A0BZ 1COWG 1FFXA 2ETNA 4MW8A 1NVPD 2DN9A 3ZJZA 5IY5B 4DV7B 3HB3B 3HKEA 3CP1A 4QIWF 4R7CA 2YXLA 3OTOO 4JI7O 4D7TA 4JYAO 3G6BA 5JCOA 5IYDO 2UXDB 2QSAA 2R9RB 4GUNA 4YY3O 4JF3A 1H8EG 4PDRA 4UXNA 3T2MA 3CCRV 3VQWA 1WNSA 5LMUO 5LOVA 1H8HG 1P7GA 1GMGA 3L75H 1HNXB 1SQVH 2LGWA 4ZOLB 1RM1C 3MAQA 1Y4MA 2E74B 4LFAO 1R73A 5KLVH 1CP9A 4B3RB 1IBLO 1TVKA 3EXAA 2ZD9A 2RNBA 4DW0A 4IYHA 1IXBA 1XNQB 4O2AB 3BAAA 1MABG 2LW1A 3D36C 1WJZA 2B9ZA 1JPXA 3T1YB 2MW2B 1I7FA 3JALA 3TCUA 2OCCB 3ZHTA 3K3WA 3RVZA 5CMUA 2VQFB 2X6BA 5B1BB 4BW5A 3JARA 2OCCC 1IDSA 1RSOA 2YIDA 1R3IC 3BVOA 3EVKA 1AB3A 4K35A 5JQGB 4PI0A 4DR1O 3OAAG 1NQTA 2FTKA 3HR0A 5EIBC 3JD4A 4P2ZA 5BMVB 2Q0AA 4KFMA 4MS2A 3K5MA 3AG1C 2L35A 1M9NA 2AXTZ 4H0LB 3T1CA 1K8AW 2WLLB 4YIPA 5KUMA 4AI8A 2FKXA 1PKXA 2WLJA 2C2AA 3E8HA 4TQDA 4JI2O 1OCZC 1XDCA 2HEPA 1E79G 3OM3B 3FAVA 1FXKC 1O9GA 1JFFA 4OXSA 4UUJC 1MNGA 1Q6IA 3CCQV 4LBEC 2W6JG 3HPLC 4Q20A 4EB6A 4B7EA 3ZEDA 3M99B 1KKCA 3CWBH 4DV2B 1US6A 3CD6V 4GT1A 2RQ6A 2F1MA 4DO2A 2YIBA 2CTRA 2YSUB 2RJZA 2H94A 2F66C 2HP8A 1SRYA 2QR4A 3T1YO 1KB9F 1WB7A 4PI2A 5KA6A 3KCYA 1J95A 4B7KA 5FPOA 3G71V 3ZBHA 3SDLA 2B1IA 3OR6C 1Q3EA 3CCVV 1R3KC 1G1XB 4LFAB 1N0JA 4FFBA 3QO8A 2N74A 2QTOA 5KHKA 5KHJA 3CCJV 3VQXA 2Q7GA 3JD0A 2QTSA 3FB6C 4CC5A 2ZNIA 4W4KA 4DXWA 2F93B 2W0FC 3K79A 3QO5A 5DEDA 1U96A 5LMNB 2CDYA 4DV1B 1FD9A 2WA3A 4A5UB 3FFQA 3HKCB 1TUBA 4DV7O 3E86A 4I0XB 3T1HO 1YCIA 3RYHA 1VQ9V 3TGUH 5LOVB 2Z0AA 1VQOV 2WLKA 3CJHA 2ZIMA 3BHPA 2HG5C 5GTIZ 5ITZB 4CH4A 4GX0A 5IJ9B 2QWOB 5IWAB 3ZN1A 3A0HZ 4ZI7B 4QE7A 2UXBO 4TT3G 5LHHA 2GSMB 1L0NH 3QVNA 2Y4TA 2Z3YA 1N8RW 4TWKA 4O4JA 5LP6B 1RPOA 1Q90D 4DV0O 4DR6O 3BY6A 3RGBA 5HFLA 2WPDG 4TSFG 3E89A 2B5UA 4DR4B 3AK2A 3K9SA 3JD2A 4IIJB 1IXMA 4MTFA 1TUEB 4FFKA 4ZIBA 2V4DA 3JCUZ 1ZLZA 3UKMA 5KHHA 1XMQO 2EULA 4RQFA 4CZZA 4I4TA 3OMAB 1YTFB 4G27B 4DV0B 3L73H 3ZRWA 1QHTA 4OPHA 5KHIA 4UCOA 5EK0A 4LNUA 4P30A 1TGOA 2PYJA 4PA9A 2JGDA 4JZ2A 4B3RO 1A32A 3W7WA 2Q0OC 4FMTA 2AZ0A 3SYCA 4DV6O 1D2DA 1MZFA 3TETA 4TQFA 2EJRA 1AR5A 3HKCA 4K0KO 1NH2B 1YVWA 1N0NA 1O9HA 1LUWA 3QNEA 1BSMA 1EN6A 3X2QC 1OZ0A 4FIPC 3OTFA 2RMKB 1MZEA 1M1KW 5FL7G 4FPPA 4NR1A 5KX5B 3AK1A 4RAIA 1NJIW 1M93A 3STLC 2JS5A 5DN6G 4DV1O 2W6IG 4GKKB 5IWAO 2BSKA 1B6QA 2Q5ZA 2EBOA 1AP5A 2NNUA 3ZS8C 1B06A 3LDEA 1F4NA 2EIMC 4N23A 1JQ0A 5B1AB 5K1XA 2OT5A 2Q69A 1HWYA 2RN9A 3Q4HA 5A9GA 3CCLV 4NXMO 4IHJB 3K0GA 4HYOA 3SYOA 4J41A 3LUTB 1NU1H 4DW1A 2E76B 4ZKIA 4RUEA 4NB5A 1SZTA 3ZCCA 5J2TA 2VQFO 3ABTA 3X2QB 1EFRG 4RWUA 3OMNB 2HVJC 2CUGA 1EBOA 3N2KB 2F23A 1J5EB 2Y0PA 1UJWB 4PA4A 3ZRVA 3AG2B 3JD1A 5GONB 2YC0A 4KXRA 4F6RB 1NR1A 3G67A 2WLMA 1GN2A 3AG2C 1Q8IA 5L3DA 1N34O 1VQ8V 3CHXA 4LF6O 2A0LA 5CBHA 1KUQA 3D3QA 3SYQA 3I55V 5LMUB 4LF9B 2FB5A 1NVPB 1PNLA 5HFMA 4BW9A 1FFTB 4CBCA 4BR6A 2GUZB 2O57A 1FXHA 4LFCB 4OGQB 1V9PA 1Y76A 2R9AA 1TA8A 2V1DA 5EBWC 4X1YA 4KL1A 3CE2A 2D2CB 5JWPA 3E8BA 5LP6A 3ASNC 4BWAA 2XTAA 1HNWO 1PL4A 3WG7C 3CRCA 4DR2O 4ABMA 5ITZA 2PI4A 3QF7A 2JEXA 1FYJA 4JI4B 3H1LH 2CK3G 2EJ7A 1GM7A 3A2FA 3KZIZ 4FLTA 1N4CA 2GTSA 4CC6A 3CB2A 3IC7A 2YICA 2GBOA 1QR9A 3S3XA 1D5NA 1U97A 1LNQA 3C90A 5EZYB 1HR0O 4FFBB 2F43G 2QM7A 4LH6A 4IIJA 5EC1C 3WB2A 4EFEA 5KMGA 4J9ZB 4DR2B 1F7YA 4LF4B 2Z5UA 1XNQO 1K97A 1W2BU 1OHHG 5JJNB 4LWSB 2ZCEA 1PD3A 4WCEV 4DYLA 1WA8B 1IBLB 3ZHQA 3QG5A 3IGAC 4MSWC 4H13B 1OCZB 1VQKV 1VQ5V 4CS2A 4TUYB 4TV9B 3FYEB 3RYFA 2ZM6O 1OCRC 3AG4C 1KP2A 3C3SA 1IBKB 2R72A 2JVDA 4U7OA 2LFRA 1N36O 4RQEA 1OCOC 1SS3A 2F95B 1W0KG 1SETA 5IE9A 1XUQA 2Q7HA 2XNDG 4K8ZA 2E5LB 2WLHA 3ICXA 3SR2C 1W59A 3B2EE 3STZC 2BTOA 3E83A 3BPZA 1HNXO 1ZL8A 3SPCA 3LNMB 3CSXA 4WFGA 3SPIA 1MA1A 4FZ1A 1AI7A 4HNAB 3B09A 5LGNA 2A9HA 5E1AC 2RDCA 3E8GA 3TXQA 3OMIB 4FM0A 1R1BA 1ZTEA 1EM1A 4JI7B 1NKDA 4J80A 4B08A 1YTFD 3CCUV 1AR1B 3QO7A 1WPXA 3D3IA 3KG2A 4YHHB 4X88A 3JAKB 3AG1B 4UFZA 2XAGA 2EIJC 4I7ZB 4MVOA 4DV5B 2ZE5A 2KG7A 4D6TH 4JTAB 2EIKB 3P32A 4JI0B 4GX1A 1J5EO 5IYZA 5B3SC 4QNHB 3APQA 1K73W 5BMVA 2K9PA 4LF5B 4TUYA 3FAVB 1Y6XA 1IVSA 1SF9A 1Y74B 3ABKB 2ZINA 4E2LA 3UT5A 5BR8O 4JAVA 1K4DC 3CX5F 2P90A 5H6RA 1CEZA 3RBZA 3R65A 3JARB 1FJGB 4H37A 2UUBB 2A7WA 1YZBA 2YIAA 5B1AC 4LFBO 4FVMA 2EZOA 1SQGA 4IL6Z 3CC7V 4DV6B 4J7ZA 3J80N 1JX9A 5EZYA 3E22B 5B3SB 1JOYA 3JAWB 2VQEO 2ZIOA 3A0RA 4Z2WA 1VQLV 4ZI7A 1URFA 4UVCA 3G80A 4N21A 2XAHA 4BIOA 3ZHVA 5CA1A 4NTWA 4Z1VA 2ZNJA 1Y66A 4O4IA 4DV3O 2HR3A 4NTYA 2XUMA 4LNUB 1BS3A 3RYHB 4JGSA 3CCEV 1KYOF 4H33A 1UPGA 4R6ZA 3WB1A 2F4VO 2OIEA 2ADQB 4X66O 2PZSA 5H9CA 4RUFA 2BOCC 1Z2GA 5BZBA 5L3CA 3B77A 4FLYA 2QE7G 4I4TB 5JJEB 4CS4A 4I50B 2JIZG 2Q9LA 4U3JA 1THZA 1NBMG 3HKBA 1I08A 2B1GA 4NXMB 2UUCO 2GDSA 1R3JC 5IJ9A 4WFHA 1KC8W 1K92A 2IJHA 3AG3B 4O4LB 4DR4O 5KA5A 1K5SA 3BA8A 4MVRA 2DWEC 2JJ2G 1VF5B 3S3WA 3IC9A 4Z1MG 4ZOLA 4B3SB 3LDDA 1VARA 4JYAB 3ETQA 1Y74A 2ITDC 3CXHF 4JYYA 4O4IB 1Q6HA 1GTOA 2VS0A 1YITV 4JI6B 5CA1B 5F2VO 5LA6B 1HNZO 1Q81W 4R8CA 3WU2Z 4WF9V 3WG7B 1H2SB 3K57A 1DK1A 4X1IA 3OEEG 4YJ2B 3ZHUA 2VRZA 1OCCB 3H1IH 3RYCB 4DR5B 1VMGA 1JMKC 5D5PA 1VF7A 2YXHA 1DF4A 1I5XA 5LP6C 4OX9B 2HVKC 2NLJC 2EINC 4MT8A 3F7YC 5J2UB 1L0LH 3ZMZA 2PGGA 4PDVA 1BHAA 1NZ6A 4YJ3B 2R70A 2OTJV 2GTAA 2XOKG 1PM9A 4JPRA 1G4YB 2UUCB 1M57C 3OR7C 4JI1O 5TISZ 2AHZA 1GM9A 4DV3B 1S77D 5LGUA 1N33B 3VBBA 2UXCB 4JASA 3WFVA 2XAFA 1FXKA 5GONA 2EILC 3CPWU 4I9QA 2IU0A 3ABLC 2DW4A 5L3GA 2QM8A 2FMLA 3RWRD 3RFRA 1H2LA 4MTXA 4H44B 5IYCO 1HDJA 2H8PC 3DXRB 1XEQA 2CGNA 3AG3C 4O2BB 1RP3B 2DMXA 4KP4A 3L72H 2BTQA 3AG7A 1XBLA 2A79B 4MVMA 4LFBB 4DUZB 1FJGO 1IX9A 1XMOB 4X89A 3OUSA 3MD0A 3OD4A 4WFBV 1JCHA 4GX5A 4PA7A 4J10A 1T5EA 3DGEA 2XASA 4LWSA 1QU7A 2ZE8A 3PJSK 1M4UA 5JCOC 2YI8A 4X1KB 4ZBMA 1BZKA 1SQQH 4X65B 1B04A 3H1KH 2ITCC 2EIMB 2HFEC 3P3PA 3B40A 4J7KA 2ARHA 5JJJB 3JYCA 5BXZA 3MDSA 4U3JB 4KHPO 3N27A 3PN1A 1QBZA 2JGUA 4JYCA 5BR8B 3DSQA 4TV8A 1R3LC 3ABMB 3CRQA 3KCXA 1AROP 2IJJA 5LA6A 1K7DA 3GWKC 1L1FA 4EEQA 4YHHO 1NTKH 4OPAA 1Y67A 1GAXA 1IBMB 2PYLA 1DLBA 2Y69C 1BE3H 1S3JA 4I0XA 1YXBA 3L9DA 2JGDB 1H2NA 1TUBB 4EKWA 3ZX6A 5BY1A 2FYUH 4WBNB 2VWKA 3OGIB 4NKGB 2M7WA 4GCZA 2Q73A 4GX2A 2KQXA 1P84F 1V54C 1I0HA 3ML0A 3JASB 3JAMN 4O4JB 2LW7A 3HKDA 2CH7A 2JEUA 2DE0X 3ZN0A 3L70H 1NS1A 2ZE6A 3MHSC 4NXNO 3OGCC 4L87A 4I55A 2ZDIC 4NVPA 1QQCA 2PUSA 4FLUA 1SA0B 3UO2A 3OEHG 4LC1A 2VQEB 2PTMA 1Q7YW 1V55B 1WB8A 3KKYA 1Q86W 3SJAC 5CA3A 4X1KA 3SPJA 5H6QA 1GN4A 4PDLA 3J81N 1H2GA 3VQVA 2LQTA 2YS8A 4LF4O 2Y48A 5EC2C 3NXSA 4X64O 2RCVA 4JI8B 3OTOB 3FX7A 2ZQMA 4JZGA 3OW2U 4B3TO 4EB6B 4JI0O 4W4LA 5KUKA 4DR3B 1K33A 4I9WA 1NTZH 3K9AA 1XNRB 1OCOB 5CB4A 4XBFA 1GKFA 4DK1A 1I5YA 4U3FH 3OUFA 1QVGU 2ODMA 3FD9A 1BHBA 2QGNA 2UXXA 1I94O 4G28B 2HLDG 4K8XA 1MOFA 1S5HC 3BFRA 3DC6A 3GVMA 1SQXH 3JCZA 2WLLA 3CC2V 1AILA 4CH5A 3B4SA 1HNWB 3C3TA 3GWOA 1LR1A 2LGQA 3TXSA 1MMMA 3EHBB 1YJNV 5J2UA 3K08A 5LL6Y 4JI5B 5LHIA 3DC5A 2WAMA 1SQBH 2YEVA 1BGYH 4F6EA 1EN5A 3LDCA 4XDLA 1AI5A 1N36B 4O4HA 1AVMA 3SJCC 2BSKB 3W7XA 3CCSV 1PV0A 1DTOA 2WLIA 1M90W 1GK9A 1AJQA 2XAJA 2W0XA 3TK1A 3SGIA 1Z5WA 3DXRA 1VF6A 3EFFK 4JAAA 1R6TA 3RYFB 5DECA 1DF5A 5LXTB 1R6NA 1JJOA 2NR5A 2G38A 1BCCH 3W7SA 3W7UA 1NI8A 2EX3A 4GKJO 1K34A 4LF6B 5JVDB 3FB5C 2IJIA 4BIZA 1IBMO 2A3QA 1EN4A 4UB6Z 4HBNA 1WP8A 4ZHQA 4LH7A 2BOBC 1VIBA 1XL4A 1F23A 3AK3A 4P9PA 4CS3A 3ZIAG 1XI1A 4XDJA 3CC4V 4LF7B 1ZWIC 2JJ1G 3GB7C 2UUAO 2MK3A 1YEWA 2QKCA 2Q6AA 2DOSA 1KQSU 1CXZB 2AZ2A 3HKBB 4ASUG 4FLXA 2QEXV 4DK0A 2ZXWB 2ZXWC 4J42A 3CXCU 1KD1W 1LUVA 1HR0B 4TV9A 4J7JA 2Q8VA 2GV9A 1VQ7V 3BA9A 1S72V 1RSOB 4JI3O 3IFXA 1K5QA 4F4LA 2DQ3A 3F7VC 5AG2A 4WBNA 2EINB 3RYIA 1AR4A 1KP3A 1KKDA 4GKJB 1VP7A 1QCEA 2WLNA 2YDEA 4MTOA 1AI4A 4X62B 3ZMTA 3K58A 2KB1A 5B66Z 2ILMA 1JJ2U 1JA8A 4K0KB 2QKAA 2ZE7A 1PNMA 2Y0IA 2QWQB 4PELA 4X20A 5CBGA 3JATA 4FM2A 2P67A 5LHGA 2WA4A 1SC5B 2DQ0A 4GKKO 3K06A 3JAWA 3VOUA 1FKAO 5B1BC 1EZJA 3IAYA 1ENVA 1ZAUA 5EIBD 3O9OA 2IU3A 2LP7A 3SJQC 3CCMV 1M56B 2E3CA 4X62O 2PI5A 2ZKOA 1UFIA 1OV9A 1YHQV 1QNMA 1NH2D 4D7SA 3H01A 4JI5O 2DWDC 1N34B 1XREA 1Z5VA 1KU9A 5A2QN 5H2FZ 1Y76B 4LF8O 1W0JG 3OT7A 1Q5OA 4PJ0Z 4CH3A 5CBFA 5IY5C 2IJKA 2GHYA 4B3MO 3AEIA 3ZRXA 2UU9O 1XL6A 2JK5C 3JAKA 5L3FA 2CTQA 1N32O 1IZ3A 3ZMUA 3RT3C 5IJ0B 4FLVA 4DR7O 3Q4HB 4UCVA 4AHCA 2WWWA 4O4HB 4C7UA 4FLZA 3R66A 1HNZB 1BT8A 1ROPA 4ZHQB 1B3QA 4DR3O 2L6LA 3T1HB 5C8YB 1VQMV 5EYPB 2QWPB 1QLEC 3K0DA 1MSWD 3JD3A 1SERA 4IHJA 4OX9O 5EBLC 3ASNB 4MVZA 5EYPA 5LMNO 4O2BA 2YI9A 3A8TA 4JTCB 3B8NA 1FPOA 4HAMA 3ETGA 2A06H 2Y4UA 4GLXA 2IW5A 2IH3C 5FNVA 5J2TB 2UXNA 4FZ0A 1WN7A 1CPYA 2E5LO 1BMFG 4DV4O 1BQZA 1Q6UA 4WFEA 4U7NA 2HJFC 4IGGA 3UCSC 2ZM6B 3K04A 1RM1B 3RVYA 4J11A 4FJCC 1SA0A 3F5TA 3K03A 1IURA 1M57B 3D36A 1YF2A 3JSLA 4YXWG 1Q82W 1AJPA 1X4TA 4HNAA 4DR6B 1S5JA 1TVKB 4B3MB 5EBMC 1M5IA 5LYJB 3SPGA 2QA4V 4JTDB 4I50A 3E2EA 2NN4A 2EIJB 2Q4PA 1S0VA 3E35A 5D5QA 1I94B 2LO1A 3ABMC 3QTCA 1SKVA 1YJWV 1OJHA 2OWOA 2P4KA 1ZUQA 3H1JH 1VQ4V 1TAEA 4JYBA 3LSUA 5B5EZ 5JH7A 2JS3A 3OE7G 4KHPB 1QLEB 2Y69B 3I56V 2YIBD 3RYIB 1QVFU 4JV5O 5B1NA 4I55B 5IT9N 1SQPH 2CTWA 3BEHA 2V7QG 5KMGB 5CA0A 1SZXA 1L8DA 3DTUB 3TJTA 2P4VA 2QM4A 2IM9A 2OIGA 4UB8Z 3AG4B 2UUBO 1FFXB 2CE4A 4X1YB 2AGAA 1G6UA
chains in the Genus database with same CATH topology
1URFA 4IGGA 1CXZB 2HJDA 1UPGA 1RFYA 1US6A 2Q0OC 4DYLA 2RMKB 4NKGB 4NB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1URF A;  4IGG A;  1CXZ B;  2HJD A;  1UPG A;  1RFY A;  1US6 A;  2Q0O C;  4DYL A;  2RMK B;  4NKG B;  4NB5 A; 
#chains in the Genus database with same CATH topology
 2X0L A;  1PP9 H;  4RO2 A;  3K5L A;  4X20 B;  4JI8 O;  4LF9 O;  5K1P A;  1S76 D;  3U11 A;  2WSS G;  2XAQ A;  3P30 A;  2D3O W;  1YSC A;  1WP7 A;  4I5S A;  3UQ8 A;  3T4D A;  4BIU A;  2DYS B;  4HZ3 A;  2LJ2 A;  4DRX A;  2PY5 A;  4JAU A;  4GYC B;  3ZMV A;  1H38 A;  3ZRS A;  3CME V;  1GO3 F;  1GH6 A;  4NXN B;  5JH7 B;  4CH6 A;  3N2G B;  5C93 A;  2XT9 A;  4ICG A;  4EFB A;  1Q43 A;  3F5W C;  3CYO A;  1FXK B;  4Q6G A;  2X6A A;  5B1O A;  3SPH A;  5L3E A;  2WLI B;  1IBK O;  3SJB C;  1YDX A;  5IYZ B;  1OCC C;  3I5D A;  4PDM A;  2UXD O;  2ZR2 A;  3G4S V;  3LSS A;  2KG7 B;  3UO3 A;  5JVD A;  2JDI G;  2Q67 A;  4DV4 B;  3UM7 A;  4BAY A;  1K9M W;  3BRC A;  1ZL8 B;  3L74 H;  1AP6 A;  3N2K A;  2QJ1 A;  1NR7 A;  3ETE A;  4X65 O;  2ATK C;  1AI6 A;  4P9O A;  4UCU A;  1WAZ A;  2P06 A;  5GTH Z;  2ZDI A;  1VQN V;  4MTG A;  4DR1 B;  2X7R B;  1VEW A;  4QPK A;  1BL8 A;  2DYR C;  4JV5 B;  3WB0 A;  5KHG A;  1K3E A;  3T4Z A;  2P6J A;  4KUM A;  1NTM H;  4PA3 A;  3VQY A;  4NYK A;  2EIK C;  4NTX A;  1YI2 V;  3FKS G;  1WLE A;  3L71 H;  5H5N A;  1KEC A;  1BQ0 A;  1YIJ V;  3CEI A;  1JFF B;  2LFS A;  4UCS A;  3JSN A;  3JAL B;  3J7A U;  3K5O A;  4DUY O;  4QGP A;  1JVM A;  3K5N A;  2UU9 B;  2N04 A;  1H2M A;  3ABU A;  2UXC O;  4L8J A;  1N33 O;  1XMO O;  4QPJ A;  4J9Y B;  1PL0 A;  4UCT A;  2YUA A;  2XHB A;  3U0Z A;  4FLW A;  2PF4 E;  1XOU A;  4TOI A;  4UVB A;  4LF8 B;  1F51 A;  3ZHR A;  1PNK A;  1EZV H;  3P3N A;  1GN3 A;  3N2G A;  2FL4 A;  3H1H H;  1V54 B;  1GRJ A;  3ASO C;  4LFC O;  1R6K A;  5CB4 B;  1RFY A;  4X64 B;  3HKD B;  3ZMS A;  2HKO A;  3CJH B;  3RYC A;  5KAI Z;  3ETD A;  3ZHS A;  3ZRW B;  4DR5 O;  4X1I B;  4WFA V;  4YJ2 A;  2QWN B;  1OCR B;  1QLN A;  3HKE B;  2HJD A;  4LR3 A;  5FPR A;  1AJN A;  2M6Y A;  4UCR A;  2VWJ A;  2OYQ A;  4DRX B;  3E8F A;  1RPR A;  2H3O A;  4JI6 O;  3CMA V;  5GW7 A;  1M56 C;  2KKW A;  4TV8 B;  1FXV A;  4QJF B;  5J9P C;  3ABK C;  2CTP A;  4YY3 B;  1DGS A;  4AQY O;  3E22 A;  2HHH B;  3ASO B;  1S5L Z;  2QWR B;  4O2A A;  4X9Q A;  2BCC H;  4JI3 B;  2ZT9 B;  4FK5 C;  3K59 A;  4R50 A;  3ABL B;  1X59 A;  4UV8 A;  1H2K A;  2GUZ A;  4X8A A;  1P7B A;  3FB7 C;  5LYJ A;  2DJV A;  4DR7 B;  1ZX3 A;  4GZR B;  4PD4 F;  3UT5 B;  5LGT A;  4PA6 A;  2ADP A;  2P7T C;  1MG1 A;  4PHZ A;  2AHY A;  2UUA B;  4B3S O;  1MSD A;  4LF7 O;  1D5A A;  4DV5 O;  3CRR A;  5KAF Z;  1HW7 A;  2OCH A;  4G2K A;  2DYR B;  1ZSP A;  1YJ9 V;  2P5O A;  1KBH A;  2YEV B;  4WFF A;  4JI4 O;  3LSQ A;  2EIL B;  1N32 B;  1QR8 A;  2AW9 A;  2BTQ B;  1KMI Z;  3LNN A;  3U10 A;  1VQ6 V;  4DV2 O;  5L3B A;  5FLX N;  4MVQ A;  5DM6 V;  3IJ4 A;  4MW3 A;  1K4C C;  2Q68 A;  1PPJ H;  3CRA A;  5FNV B;  4LCU C;  1F4M A;  5C8Y A;  3B8M A;  4F6R A;  1XIL A;  4IT5 A;  4QE9 A;  2Q7E A;  4X66 B;  3H9V A;  3W7T A;  2F4V B;  2CGO A;  4MVU A;  4XDK A;  4AQY B;  4K3A A;  1GM8 A;  4JI2 B;  4PV1 B;  1V55 C;  1JR9 A;  5E79 Z;  1E1R G;  1FS0 G;  5LXT A;  2DYS C;  4DUZ O;  5CN0 A;  1XMQ B;  2N05 A;  2OTL V;  5JQG A;  3G6E V;  1NT2 B;  1XHZ A;  3FB8 C;  2YXY A;  3THO A;  2CAZ C;  4AIL C;  5LBQ A;  3D8C A;  1GN6 A;  1HP8 A;  1SQF A;  1XQ8 A;  1SES A;  3BCC H;  3M8A A;  1ORQ C;  4YIO A;  3RW0 A;  3M7M X;  2BE3 A;  2QKS A;  2P22 C;  4JI1 B;  4MVS A;  2KSD A;  3RN4 A;  5IDJ A;  3CRM A;  1XNR O;  4IYI A;  3O65 A;  5IJ0 A;  4UVA A;  2IH1 C;  2X6C A;  4LP8 A;  1E1Q G;  1P49 A;  4FM1 A;  1WPB A;  5KX5 A;  1FAF A;  3JAT B;  4B3T B;  2QDO A;  1WA8 A;  1VF6 C;  3MHH C;  3BAB A;  5IYB O;  1P4R A;  2HHH O;  3NR7 A;  2UXB B;  2JRI A;  4DUY B;  1VQP V;  4YJ3 A;  4LF5 O;  1XHX A;  2K1E A;  3JAS A;  3APO A;  3SYA A;  2E75 B;  3CS5 A;  3OFN G;  2EZP A;  2IBZ H;  2R9I A;  4E4E A;  4O4L A;  5CA0 B;  3FYI B;  2ZR3 A;  4UV9 A;  3SYP A;  1G8M A;  2CH7 B;  3A0B Z;  1COW G;  1FFX A;  2ETN A;  4MW8 A;  1NVP D;  2DN9 A;  3ZJZ A;  5IY5 B;  4DV7 B;  3HB3 B;  3HKE A;  3CP1 A;  4QIW F;  4R7C A;  2YXL A;  3OTO O;  4JI7 O;  4D7T A;  4JYA O;  3G6B A;  5JCO A;  5IYD O;  2UXD B;  2QSA A;  2R9R B;  4GUN A;  4YY3 O;  4JF3 A;  1H8E G;  4PDR A;  4UXN A;  3T2M A;  3CCR V;  3VQW A;  1WNS A;  5LMU O;  5LOV A;  1H8H G;  1P7G A;  1GMG A;  3L75 H;  1HNX B;  1SQV H;  2LGW A;  4ZOL B;  1RM1 C;  3MAQ A;  1Y4M A;  2E74 B;  4LFA O;  1R73 A;  5KLV H;  1CP9 A;  4B3R B;  1IBL O;  1TVK A;  3EXA A;  2ZD9 A;  2RNB A;  4DW0 A;  4IYH A;  1IXB A;  1XNQ B;  4O2A B;  3BAA A;  1MAB G;  2LW1 A;  3D36 C;  1WJZ A;  2B9Z A;  1JPX A;  3T1Y B;  2MW2 B;  1I7F A;  3JAL A;  3TCU A;  2OCC B;  3ZHT A;  3K3W A;  3RVZ A;  5CMU A;  2VQF B;  2X6B A;  5B1B B;  4BW5 A;  3JAR A;  2OCC C;  1IDS A;  1RSO A;  2YID A;  1R3I C;  3BVO A;  3EVK A;  1AB3 A;  4K35 A;  5JQG B;  4PI0 A;  4DR1 O;  3OAA G;  1NQT A;  2FTK A;  3HR0 A;  5EIB C;  3JD4 A;  4P2Z A;  5BMV B;  2Q0A A;  4KFM A;  4MS2 A;  3K5M A;  3AG1 C;  2L35 A;  1M9N A;  2AXT Z;  4H0L B;  3T1C A;  1K8A W;  2WLL B;  4YIP A;  5KUM A;  4AI8 A;  2FKX A;  1PKX A;  2WLJ A;  2C2A A;  3E8H A;  4TQD A;  4JI2 O;  1OCZ C;  1XDC A;  2HEP A;  1E79 G;  3OM3 B;  3FAV A;  1FXK C;  1O9G A;  1JFF A;  4OXS A;  4UUJ C;  1MNG A;  1Q6I A;  3CCQ V;  4LBE C;  2W6J G;  3HPL C;  4Q20 A;  4EB6 A;  4B7E A;  3ZED A;  3M99 B;  1KKC A;  3CWB H;  4DV2 B;  1US6 A;  3CD6 V;  4GT1 A;  2RQ6 A;  2F1M A;  4DO2 A;  2YIB A;  2CTR A;  2YSU B;  2RJZ A;  2H94 A;  2F66 C;  2HP8 A;  1SRY A;  2QR4 A;  3T1Y O;  1KB9 F;  1WB7 A;  4PI2 A;  5KA6 A;  3KCY A;  1J95 A;  4B7K A;  5FPO A;  3G71 V;  3ZBH A;  3SDL A;  2B1I A;  3OR6 C;  1Q3E A;  3CCV V;  1R3K C;  1G1X B;  4LFA B;  1N0J A;  4FFB A;  3QO8 A;  2N74 A;  2QTO A;  5KHK A;  5KHJ A;  3CCJ V;  3VQX A;  2Q7G A;  3JD0 A;  2QTS A;  3FB6 C;  4CC5 A;  2ZNI A;  4W4K A;  4DXW A;  2F93 B;  2W0F C;  3K79 A;  3QO5 A;  5DED A;  1U96 A;  5LMN B;  2CDY A;  4DV1 B;  1FD9 A;  2WA3 A;  4A5U B;  3FFQ A;  3HKC B;  1TUB A;  4DV7 O;  3E86 A;  4I0X B;  3T1H O;  1YCI A;  3RYH A;  1VQ9 V;  3TGU H;  5LOV B;  2Z0A A;  1VQO V;  2WLK A;  3CJH A;  2ZIM A;  3BHP A;  2HG5 C;  5GTI Z;  5ITZ B;  4CH4 A;  4GX0 A;  5IJ9 B;  2QWO B;  5IWA B;  3ZN1 A;  3A0H Z;  4ZI7 B;  4QE7 A;  2UXB O;  4TT3 G;  5LHH A;  2GSM B;  1L0N H;  3QVN A;  2Y4T A;  2Z3Y A;  1N8R W;  4TWK A;  4O4J A;  5LP6 B;  1RPO A;  1Q90 D;  4DV0 O;  4DR6 O;  3BY6 A;  3RGB A;  5HFL A;  2WPD G;  4TSF G;  3E89 A;  2B5U A;  4DR4 B;  3AK2 A;  3K9S A;  3JD2 A;  4IIJ B;  1IXM A;  4MTF A;  1TUE B;  4FFK A;  4ZIB A;  2V4D A;  3JCU Z;  1ZLZ A;  3UKM A;  5KHH A;  1XMQ O;  2EUL A;  4RQF A;  4CZZ A;  4I4T A;  3OMA B;  1YTF B;  4G27 B;  4DV0 B;  3L73 H;  3ZRW A;  1QHT A;  4OPH A;  5KHI A;  4UCO A;  5EK0 A;  4LNU A;  4P30 A;  1TGO A;  2PYJ A;  4PA9 A;  2JGD A;  4JZ2 A;  4B3R O;  1A32 A;  3W7W A;  2Q0O C;  4FMT A;  2AZ0 A;  3SYC A;  4DV6 O;  1D2D A;  1MZF A;  3TET A;  4TQF A;  2EJR A;  1AR5 A;  3HKC A;  4K0K O;  1NH2 B;  1YVW A;  1N0N A;  1O9H A;  1LUW A;  3QNE A;  1BSM A;  1EN6 A;  3X2Q C;  1OZ0 A;  4FIP C;  3OTF A;  2RMK B;  1MZE A;  1M1K W;  5FL7 G;  4FPP A;  4NR1 A;  5KX5 B;  3AK1 A;  4RAI A;  1NJI W;  1M93 A;  3STL C;  2JS5 A;  5DN6 G;  4DV1 O;  2W6I G;  4GKK B;  5IWA O;  2BSK A;  1B6Q A;  2Q5Z A;  2EBO A;  1AP5 A;  2NNU A;  3ZS8 C;  1B06 A;  3LDE A;  1F4N A;  2EIM C;  4N23 A;  1JQ0 A;  5B1A B;  5K1X A;  2OT5 A;  2Q69 A;  1HWY A;  2RN9 A;  3Q4H A;  5A9G A;  3CCL V;  4NXM O;  4IHJ B;  3K0G A;  4HYO A;  3SYO A;  4J41 A;  3LUT B;  1NU1 H;  4DW1 A;  2E76 B;  4ZKI A;  4RUE A;  4NB5 A;  1SZT A;  3ZCC A;  5J2T A;  2VQF O;  3ABT A;  3X2Q B;  1EFR G;  4RWU A;  3OMN B;  2HVJ C;  2CUG A;  1EBO A;  3N2K B;  2F23 A;  1J5E B;  2Y0P A;  1UJW B;  4PA4 A;  3ZRV A;  3AG2 B;  3JD1 A;  5GON B;  2YC0 A;  4KXR A;  4F6R B;  1NR1 A;  3G67 A;  2WLM A;  1GN2 A;  3AG2 C;  1Q8I A;  5L3D A;  1N34 O;  1VQ8 V;  3CHX A;  4LF6 O;  2A0L A;  5CBH A;  1KUQ A;  3D3Q A;  3SYQ A;  3I55 V;  5LMU B;  4LF9 B;  2FB5 A;  1NVP B;  1PNL A;  5HFM A;  4BW9 A;  1FFT B;  4CBC A;  4BR6 A;  2GUZ B;  2O57 A;  1FXH A;  4LFC B;  4OGQ B;  1V9P A;  1Y76 A;  2R9A A;  1TA8 A;  2V1D A;  5EBW C;  4X1Y A;  4KL1 A;  3CE2 A;  2D2C B;  5JWP A;  3E8B A;  5LP6 A;  3ASN C;  4BWA A;  2XTA A;  1HNW O;  1PL4 A;  3WG7 C;  3CRC A;  4DR2 O;  4ABM A;  5ITZ A;  2PI4 A;  3QF7 A;  2JEX A;  1FYJ A;  4JI4 B;  3H1L H;  2CK3 G;  2EJ7 A;  1GM7 A;  3A2F A;  3KZI Z;  4FLT A;  1N4C A;  2GTS A;  4CC6 A;  3CB2 A;  3IC7 A;  2YIC A;  2GBO A;  1QR9 A;  3S3X A;  1D5N A;  1U97 A;  1LNQ A;  3C90 A;  5EZY B;  1HR0 O;  4FFB B;  2F43 G;  2QM7 A;  4LH6 A;  4IIJ A;  5EC1 C;  3WB2 A;  4EFE A;  5KMG A;  4J9Z B;  4DR2 B;  1F7Y A;  4LF4 B;  2Z5U A;  1XNQ O;  1K97 A;  1W2B U;  1OHH G;  5JJN B;  4LWS B;  2ZCE A;  1PD3 A;  4WCE V;  4DYL A;  1WA8 B;  1IBL B;  3ZHQ A;  3QG5 A;  3IGA C;  4MSW C;  4H13 B;  1OCZ B;  1VQK V;  1VQ5 V;  4CS2 A;  4TUY B;  4TV9 B;  3FYE B;  3RYF A;  2ZM6 O;  1OCR C;  3AG4 C;  1KP2 A;  3C3S A;  1IBK B;  2R72 A;  2JVD A;  4U7O A;  2LFR A;  1N36 O;  4RQE A;  1OCO C;  1SS3 A;  2F95 B;  1W0K G;  1SET A;  5IE9 A;  1XUQ A;  2Q7H A;  2XND G;  4K8Z A;  2E5L B;  2WLH A;  3ICX A;  3SR2 C;  1W59 A;  3B2E E;  3STZ C;  2BTO A;  3E83 A;  3BPZ A;  1HNX O;  1ZL8 A;  3SPC A;  3LNM B;  3CSX A;  4WFG A;  3SPI A;  1MA1 A;  4FZ1 A;  1AI7 A;  4HNA B;  3B09 A;  5LGN A;  2A9H A;  5E1A C;  2RDC A;  3E8G A;  3TXQ A;  3OMI B;  4FM0 A;  1R1B A;  1ZTE A;  1EM1 A;  4JI7 B;  1NKD A;  4J80 A;  4B08 A;  1YTF D;  3CCU V;  1AR1 B;  3QO7 A;  1WPX A;  3D3I A;  3KG2 A;  4YHH B;  4X88 A;  3JAK B;  3AG1 B;  4UFZ A;  2XAG A;  2EIJ C;  4I7Z B;  4MVO A;  4DV5 B;  2ZE5 A;  2KG7 A;  4D6T H;  4JTA B;  2EIK B;  3P32 A;  4JI0 B;  4GX1 A;  1J5E O;  5IYZ A;  5B3S C;  4QNH B;  3APQ A;  1K73 W;  5BMV A;  2K9P A;  4LF5 B;  4TUY A;  3FAV B;  1Y6X A;  1IVS A;  1SF9 A;  1Y74 B;  3ABK B;  2ZIN A;  4E2L A;  3UT5 A;  5BR8 O;  4JAV A;  1K4D C;  3CX5 F;  2P90 A;  5H6R A;  1CEZ A;  3RBZ A;  3R65 A;  3JAR B;  1FJG B;  4H37 A;  2UUB B;  2A7W A;  1YZB A;  2YIA A;  5B1A C;  4LFB O;  4FVM A;  2EZO A;  1SQG A;  4IL6 Z;  3CC7 V;  4DV6 B;  4J7Z A;  3J80 N;  1JX9 A;  5EZY A;  3E22 B;  5B3S B;  1JOY A;  3JAW B;  2VQE O;  2ZIO A;  3A0R A;  4Z2W A;  1VQL V;  4ZI7 A;  1URF A;  4UVC A;  3G80 A;  4N21 A;  2XAH A;  4BIO A;  3ZHV A;  5CA1 A;  4NTW A;  4Z1V A;  2ZNJ A;  1Y66 A;  4O4I A;  4DV3 O;  2HR3 A;  4NTY A;  2XUM A;  4LNU B;  1BS3 A;  3RYH B;  4JGS A;  3CCE V;  1KYO F;  4H33 A;  1UPG A;  4R6Z A;  3WB1 A;  2F4V O;  2OIE A;  2ADQ B;  4X66 O;  2PZS A;  5H9C A;  4RUF A;  2BOC C;  1Z2G A;  5BZB A;  5L3C A;  3B77 A;  4FLY A;  2QE7 G;  4I4T B;  5JJE B;  4CS4 A;  4I50 B;  2JIZ G;  2Q9L A;  4U3J A;  1THZ A;  1NBM G;  3HKB A;  1I08 A;  2B1G A;  4NXM B;  2UUC O;  2GDS A;  1R3J C;  5IJ9 A;  4WFH A;  1KC8 W;  1K92 A;  2IJH A;  3AG3 B;  4O4L B;  4DR4 O;  5KA5 A;  1K5S A;  3BA8 A;  4MVR A;  2DWE C;  2JJ2 G;  1VF5 B;  3S3W A;  3IC9 A;  4Z1M G;  4ZOL A;  4B3S B;  3LDD A;  1VAR A;  4JYA B;  3ETQ A;  1Y74 A;  2ITD C;  3CXH F;  4JYY A;  4O4I B;  1Q6H A;  1GTO A;  2VS0 A;  1YIT V;  4JI6 B;  5CA1 B;  5F2V O;  5LA6 B;  1HNZ O;  1Q81 W;  4R8C A;  3WU2 Z;  4WF9 V;  3WG7 B;  1H2S B;  3K57 A;  1DK1 A;  4X1I A;  3OEE G;  4YJ2 B;  3ZHU A;  2VRZ A;  1OCC B;  3H1I H;  3RYC B;  4DR5 B;  1VMG A;  1JMK C;  5D5P A;  1VF7 A;  2YXH A;  1DF4 A;  1I5X A;  5LP6 C;  4OX9 B;  2HVK C;  2NLJ C;  2EIN C;  4MT8 A;  3F7Y C;  5J2U B;  1L0L H;  3ZMZ A;  2PGG A;  4PDV A;  1BHA A;  1NZ6 A;  4YJ3 B;  2R70 A;  2OTJ V;  2GTA A;  2XOK G;  1PM9 A;  4JPR A;  1G4Y B;  2UUC B;  1M57 C;  3OR7 C;  4JI1 O;  5TIS Z;  2AHZ A;  1GM9 A;  4DV3 B;  1S77 D;  5LGU A;  1N33 B;  3VBB A;  2UXC B;  4JAS A;  3WFV A;  2XAF A;  1FXK A;  5GON A;  2EIL C;  3CPW U;  4I9Q A;  2IU0 A;  3ABL C;  2DW4 A;  5L3G A;  2QM8 A;  2FML A;  3RWR D;  3RFR A;  1H2L A;  4MTX A;  4H44 B;  5IYC O;  1HDJ A;  2H8P C;  3DXR B;  1XEQ A;  2CGN A;  3AG3 C;  4O2B B;  1RP3 B;  2DMX A;  4KP4 A;  3L72 H;  2BTQ A;  3AG7 A;  1XBL A;  2A79 B;  4MVM A;  4LFB B;  4DUZ B;  1FJG O;  1IX9 A;  1XMO B;  4X89 A;  3OUS A;  3MD0 A;  3OD4 A;  4WFB V;  1JCH A;  4GX5 A;  4PA7 A;  4J10 A;  1T5E A;  3DGE A;  2XAS A;  4LWS A;  1QU7 A;  2ZE8 A;  3PJS K;  1M4U A;  5JCO C;  2YI8 A;  4X1K B;  4ZBM A;  1BZK A;  1SQQ H;  4X65 B;  1B04 A;  3H1K H;  2ITC C;  2EIM B;  2HFE C;  3P3P A;  3B40 A;  4J7K A;  2ARH A;  5JJJ B;  3JYC A;  5BXZ A;  3MDS A;  4U3J B;  4KHP O;  3N27 A;  3PN1 A;  1QBZ A;  2JGU A;  4JYC A;  5BR8 B;  3DSQ A;  4TV8 A;  1R3L C;  3ABM B;  3CRQ A;  3KCX A;  1ARO P;  2IJJ A;  5LA6 A;  1K7D A;  3GWK C;  1L1F A;  4EEQ A;  4YHH O;  1NTK H;  4OPA A;  1Y67 A;  1GAX A;  1IBM B;  2PYL A;  1DLB A;  2Y69 C;  1BE3 H;  1S3J A;  4I0X A;  1YXB A;  3L9D A;  2JGD B;  1H2N A;  1TUB B;  4EKW A;  3ZX6 A;  5BY1 A;  2FYU H;  4WBN B;  2VWK A;  3OGI B;  4NKG B;  2M7W A;  4GCZ A;  2Q73 A;  4GX2 A;  2KQX A;  1P84 F;  1V54 C;  1I0H A;  3ML0 A;  3JAS B;  3JAM N;  4O4J B;  2LW7 A;  3HKD A;  2CH7 A;  2JEU A;  2DE0 X;  3ZN0 A;  3L70 H;  1NS1 A;  2ZE6 A;  3MHS C;  4NXN O;  3OGC C;  4L87 A;  4I55 A;  2ZDI C;  4NVP A;  1QQC A;  2PUS A;  4FLU A;  1SA0 B;  3UO2 A;  3OEH G;  4LC1 A;  2VQE B;  2PTM A;  1Q7Y W;  1V55 B;  1WB8 A;  3KKY A;  1Q86 W;  3SJA C;  5CA3 A;  4X1K A;  3SPJ A;  5H6Q A;  1GN4 A;  4PDL A;  3J81 N;  1H2G A;  3VQV A;  2LQT A;  2YS8 A;  4LF4 O;  2Y48 A;  5EC2 C;  3NXS A;  4X64 O;  2RCV A;  4JI8 B;  3OTO B;  3FX7 A;  2ZQM A;  4JZG A;  3OW2 U;  4B3T O;  4EB6 B;  4JI0 O;  4W4L A;  5KUK A;  4DR3 B;  1K33 A;  4I9W A;  1NTZ H;  3K9A A;  1XNR B;  1OCO B;  5CB4 A;  4XBF A;  1GKF A;  4DK1 A;  1I5Y A;  4U3F H;  3OUF A;  1QVG U;  2ODM A;  3FD9 A;  1BHB A;  2QGN A;  2UXX A;  1I94 O;  4G28 B;  2HLD G;  4K8X A;  1MOF A;  1S5H C;  3BFR A;  3DC6 A;  3GVM A;  1SQX H;  3JCZ A;  2WLL A;  3CC2 V;  1AIL A;  4CH5 A;  3B4S A;  1HNW B;  3C3T A;  3GWO A;  1LR1 A;  2LGQ A;  3TXS A;  1MMM A;  3EHB B;  1YJN V;  5J2U A;  3K08 A;  5LL6 Y;  4JI5 B;  5LHI A;  3DC5 A;  2WAM A;  1SQB H;  2YEV A;  1BGY H;  4F6E A;  1EN5 A;  3LDC A;  4XDL A;  1AI5 A;  1N36 B;  4O4H A;  1AVM A;  3SJC C;  2BSK B;  3W7X A;  3CCS V;  1PV0 A;  1DTO A;  2WLI A;  1M90 W;  1GK9 A;  1AJQ A;  2XAJ A;  2W0X A;  3TK1 A;  3SGI A;  1Z5W A;  3DXR A;  1VF6 A;  3EFF K;  4JAA A;  1R6T A;  3RYF B;  5DEC A;  1DF5 A;  5LXT B;  1R6N A;  1JJO A;  2NR5 A;  2G38 A;  1BCC H;  3W7S A;  3W7U A;  1NI8 A;  2EX3 A;  4GKJ O;  1K34 A;  4LF6 B;  5JVD B;  3FB5 C;  2IJI A;  4BIZ A;  1IBM O;  2A3Q A;  1EN4 A;  4UB6 Z;  4HBN A;  1WP8 A;  4ZHQ A;  4LH7 A;  2BOB C;  1VIB A;  1XL4 A;  1F23 A;  3AK3 A;  4P9P A;  4CS3 A;  3ZIA G;  1XI1 A;  4XDJ A;  3CC4 V;  4LF7 B;  1ZWI C;  2JJ1 G;  3GB7 C;  2UUA O;  2MK3 A;  1YEW A;  2QKC A;  2Q6A A;  2DOS A;  1KQS U;  1CXZ B;  2AZ2 A;  3HKB B;  4ASU G;  4FLX A;  2QEX V;  4DK0 A;  2ZXW B;  2ZXW C;  4J42 A;  3CXC U;  1KD1 W;  1LUV A;  1HR0 B;  4TV9 A;  4J7J A;  2Q8V A;  2GV9 A;  1VQ7 V;  3BA9 A;  1S72 V;  1RSO B;  4JI3 O;  3IFX A;  1K5Q A;  4F4L A;  2DQ3 A;  3F7V C;  5AG2 A;  4WBN A;  2EIN B;  3RYI A;  1AR4 A;  1KP3 A;  1KKD A;  4GKJ B;  1VP7 A;  1QCE A;  2WLN A;  2YDE A;  4MTO A;  1AI4 A;  4X62 B;  3ZMT A;  3K58 A;  2KB1 A;  5B66 Z;  2ILM A;  1JJ2 U;  1JA8 A;  4K0K B;  2QKA A;  2ZE7 A;  1PNM A;  2Y0I A;  2QWQ B;  4PEL A;  4X20 A;  5CBG A;  3JAT A;  4FM2 A;  2P67 A;  5LHG A;  2WA4 A;  1SC5 B;  2DQ0 A;  4GKK O;  3K06 A;  3JAW A;  3VOU A;  1FKA O;  5B1B C;  1EZJ A;  3IAY A;  1ENV A;  1ZAU A;  5EIB D;  3O9O A;  2IU3 A;  2LP7 A;  3SJQ C;  3CCM V;  1M56 B;  2E3C A;  4X62 O;  2PI5 A;  2ZKO A;  1UFI A;  1OV9 A;  1YHQ V;  1QNM A;  1NH2 D;  4D7S A;  3H01 A;  4JI5 O;  2DWD C;  1N34 B;  1XRE A;  1Z5V A;  1KU9 A;  5A2Q N;  5H2F Z;  1Y76 B;  4LF8 O;  1W0J G;  3OT7 A;  1Q5O A;  4PJ0 Z;  4CH3 A;  5CBF A;  5IY5 C;  2IJK A;  2GHY A;  4B3M O;  3AEI A;  3ZRX A;  2UU9 O;  1XL6 A;  2JK5 C;  3JAK A;  5L3F A;  2CTQ A;  1N32 O;  1IZ3 A;  3ZMU A;  3RT3 C;  5IJ0 B;  4FLV A;  4DR7 O;  3Q4H B;  4UCV A;  4AHC A;  2WWW A;  4O4H B;  4C7U A;  4FLZ A;  3R66 A;  1HNZ B;  1BT8 A;  1ROP A;  4ZHQ B;  1B3Q A;  4DR3 O;  2L6L A;  3T1H B;  5C8Y B;  1VQM V;  5EYP B;  2QWP B;  1QLE C;  3K0D A;  1MSW D;  3JD3 A;  1SER A;  4IHJ A;  4OX9 O;  5EBL C;  3ASN B;  4MVZ A;  5EYP A;  5LMN O;  4O2B A;  2YI9 A;  3A8T A;  4JTC B;  3B8N A;  1FPO A;  4HAM A;  3ETG A;  2A06 H;  2Y4U A;  4GLX A;  2IW5 A;  2IH3 C;  5FNV A;  5J2T B;  2UXN A;  4FZ0 A;  1WN7 A;  1CPY A;  2E5L O;  1BMF G;  4DV4 O;  1BQZ A;  1Q6U A;  4WFE A;  4U7N A;  2HJF C;  4IGG A;  3UCS C;  2ZM6 B;  3K04 A;  1RM1 B;  3RVY A;  4J11 A;  4FJC C;  1SA0 A;  3F5T A;  3K03 A;  1IUR A;  1M57 B;  3D36 A;  1YF2 A;  3JSL A;  4YXW G;  1Q82 W;  1AJP A;  1X4T A;  4HNA A;  4DR6 B;  1S5J A;  1TVK B;  4B3M B;  5EBM C;  1M5I A;  5LYJ B;  3SPG A;  2QA4 V;  4JTD B;  4I50 A;  3E2E A;  2NN4 A;  2EIJ B;  2Q4P A;  1S0V A;  3E35 A;  5D5Q A;  1I94 B;  2LO1 A;  3ABM C;  3QTC A;  1SKV A;  1YJW V;  1OJH A;  2OWO A;  2P4K A;  1ZUQ A;  3H1J H;  1VQ4 V;  1TAE A;  4JYB A;  3LSU A;  5B5E Z;  5JH7 A;  2JS3 A;  3OE7 G;  4KHP B;  1QLE B;  2Y69 B;  3I56 V;  2YIB D;  3RYI B;  1QVF U;  4JV5 O;  5B1N A;  4I55 B;  5IT9 N;  1SQP H;  2CTW A;  3BEH A;  2V7Q G;  5KMG B;  5CA0 A;  1SZX A;  1L8D A;  3DTU B;  3TJT A;  2P4V A;  2QM4 A;  2IM9 A;  2OIG A;  4UB8 Z;  3AG4 B;  2UUB O;  1FFX B;  2CE4 A;  4X1Y B;  2AGA A;  1G6U A; 
#chains in the Genus database with same CATH homology
 1URF A;  4IGG A;  1CXZ B;  2HJD A;  1UPG A;  1RFY A;  1US6 A;  2Q0O C;  4DYL A;  2RMK B;  4NKG B;  4NB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...