1UPHA

Hiv-1 myristoylated matrix
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN
publication title Entropic Switch Regulates Myristate Exposure in the HIV-1 Matrix Protein
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (clone 12)
molecule tags Virus/viral protein
total genus 37
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1uphA00
2H3IA 1ED1A 1HEKA 2K4HA 1TAMA 2H3ZA 2N1RA 2H3FA 2JMGA 4ICAA 2K4EA 2K4IA 4IC9A 2LYAA 1UPHA 2NV3A 2H3QA 1ECWA 2LYBA 2HMXA 1HIWA 1A6SA 1L6NA 2GOLA 2H3VA 4JMUA
chains in the Genus database with same CATH superfamily
5EE9A 1Y88A 1SIJA 3V7LA 4RQ2A 2LKYA 1ZD2P 8ICEA 3SENA 5B66U 5DB9A 1K1QA 5AK6A 3QZ7A 3RH4A 4YMOA 1B22A 4PHPA 3B0YA 5DBAA 3Q8SB 4C8NA 4KLOA 2YY6A 2PMZC 1D8YA 2K8CB 4YR0A 1UT5A 5CR0A 4ECQA 2JEJA 2BPGA 4DFDA 4C8LA 1IXRA 1TVAA 5DG7A 2F77X 1VDVA 3AUOA 5F9LA 2WAQC 1KFSA 4B9SA 4KLSA 3PSTA 2HHSA 1SL1A 2EANA 3S6JA 3UXOA 3GIIA 4EBEA 2LI6A 4EZ6A 1Z1BA 4NJ8A 5J8YC 3ISBA 3PZPA 4DS4A 1N63A 2K4PA 3OSPA 3TFSA 4DLGA 1JROA 3KD3A 4QZIA 4F3OA 1BPEA 4UAYA 7ICUA 5C5JA 2EAMA 3MR5A 4F71A 4EZ9A 1ZRMA 5AIAA 3QEAZ 2FE9A 3R9KA 4F4YA 3GDXA 3PW4A 1BNPA 2RDJA 1ZQTA 2E8PA 1FIQA 1PK3A 1RM6C 1KL9A 2W9MA 3DEEA 2K4HA 3MR6A 4HYKA 3SD7A 4QWEA 2KZZA 3HT3A 7ICJA 3G6YA 1U45A 3Q8KA 4GXKA 2K89A 3BDPA 1KFDA 4YXJA 3ZI4A 4ELVA 3MGHA 2EH9A 4YN4A 4DL3A 9ICOA 2F3NA 4C4RA 8ICMA 2F1JA 1PK1A 5KFSA 3LVWA 3F5AA 4RNMA 1ZQGA 4J9OA 2E8MA 1SKWA 1QQ5A 2ZTCA 3V6KA 4K4IA 3V6JA 3WKBA 9ICSA 3ZDAA 1FO4A 2B21A 2IA6A 4PGXA 4I2CA 1S8OA 9ICEA 5AM0A 1QLNA 4ECWA 5ALRA 4QNLA 4RQ0A 5HMLA 1SXDA 1NK8A 8ICTA 2R8GA 4GC6A 1Z4NA 2ASDA 5DQIA 2NRWA 5KFFA 2KJ5A 4J03A 2JH1A 1A6SA 1LVHA 4KLUA 1N61A 5ALVA 1ZQUA 2M0NA 2W3SA 4X5VA 4LZDA 3LWMA 3C29A 2H3FA 4KLMA 1N5XA 2WFAA 1LB2B 3EUB2 2JEGA 5ALHA 4RQMA 3H7IA 3IRUA 2BDUA 3RAQA 3FM9A 3C2LA 3QU2A 4LZGA 1PK1B 4Y2PA 1NZBA 2IBKA 3J81j 4Y2YA 5J8YA 2Y1IA 1IG6A 1ZQNA 1RQNA 2FLPA 1U9LA 2W04A 5TISU 7ICNA 2KFZA 3F2DA 3C23A 3SV4A 4FZNA 2DPIA 1NNLA 3FC4A 2W7OA 2WB1F 1NKCA 4F4XA 1MN8A 3F53A 3JPTA 5KG7A 4KLTA 3M8RA 4Y2RA 3WKEA 3BQ2A 5EE3A 4BWJA 4K4HA 1DOQA 5AKEA 1KBUA 3QUCA 4M2YA 3Q8QB 2R8IA 3RB4A 7ICFA 3AM9A 3MGVA 4QWBA 1LKYA 5J0YA 2KE7A 2VJ5A 2KVSA 2KTQA 5AIBA 1ZQQA 2WF6A 3OSNA 1KLNA 4KX5A 2MUTA 2IOHA 1ZQZA 4E0DA 3QU4A 3OJSA 3KHRA 4UASA 2OYYA 4FFDA 3SAHA 3UQ0A 3CP8A 3JPPA 2KNJA 4OO1J 4UB6U 8ICAA 4IS7A 1XSLA 4C7YA 2LYAA 5KFBA 1X6JA 2FJ6A 4AP9A 4FE3A 3N97B 4OJLA 2J6TA 4EYHB 4YFKA 2AGQA 4BX9C 2ZIUA 3KTQA 3EPIA 9ICIA 4KX3A 4I28A 3RB0A 3GIMA 4DQRA 5ALQA 2PI5A 5D4BA 2HBJA 5EWFA 4GIBA 5ALTA 4GFJA 3V72A 2JV3A 5KFLA 2ZUBA 5DBBA 3AU2A 4PL2A 5J2KA 5HR6A 1H38A 3ISCA 3MDCA 2B0CA 5KFZA 4JUZA 1T3NA 2GOLA 4CNQA 1Z00A 5IINA 1LKYB 4I2FA 5KL1B 4Y2XA 4UAVA 1ZQVA 3SAFA 2LBOA 4QZEA 2MUTB 3GV7B 3OGUA 1BGXT 5DBCA 1SB3C 4R63A 1FEZA 4M04A 1RQLA 4PPXA 4B9NA 3WKDA 1DRGA 1L7PA 4YG2A 1L5UA 3SZ2A 3PW7A 3E58A 3MR3A 4USAA 2OEHA 3UM9A 2I9GA 4QZDA 1S0NA 3MBYA 2P35A 2ZIUB 4IRCA 2H5XA 3KHGA 5KG0A 5KFJA 5CJ7A 2DF4B 3VC8A 3QZ8A 1NZPA 4P0PA 4B9TA 1Z19A 1TAMA 1V85A 4C7ZA 2A19A 4QZGA 4F2RA 2E3TA 1ZOLA 1WWUA 4F91B 2VA3A 3A0BU 2ZJAA 3SMVA 4F5QA 1V97A 3HWTA 2HHVA 4QJFB 5AI9A 4U6PA 1MQ2A 3UXNA 1KQQA 4Y2SA 9ICHA 2E5SA 3K1RB 3DDHA 1ZD4A 9ICXA 4QZ9A 2XY5A 3AEVA 4ICAA 2W9CA 5DB7A 2XCAA 3M9MB 4RQ3A 3QYPA 2XIDA 8ICRA 2ZXHA 4R64A 4MF2A 5KFPA 5L1IA 4K4GA 4NY8A 3KKAC 3EPGA 3TAQA 2GWSA 4EENA 1SL0A 2AXTU 4ELTA 1N2XA 2OHFA 2IMWP 9ICCA 3BS5A 2KZMA 5ALMA 4PJ0U 3B9JA 1KKXA 1ZD3A 3E0FA 1ZQJA 2ZUCA 3EW9A 2HHTA 4F5PA 4QWCA 1JX4A 4MEYA 3OJUA 4DSEA 2UVRA 9ICGA 2Y9UA 1RXWA 3GV5B 4DFMA 9ICTA 1ZYQA 5IIIA 2HOQA 4O3MA 1TFRA 3ZD8A 2KN7A 1S10A 1NI3A 1OXJA 2W9CB 4DFJA 1ZETA 3I28A 1KDHA 2XY6A 1ZQSA 2NRTA 2W03A 5J2AA 1SZPA 1DGSA 2KZ3A 3H8WA 4OJOA 5KFAA 2M9NA 2YMPA 3SV3A 5AKKA 4B9MA 2P66A 2XGPA 1XSPA 3MABA 5AKJA 2WB1C 1T8EA 2JHDA 1ZQKA 3BS5B 3PNCA 4KLDA 3D2SA 4NM2A 5CWRA 2BCRA 4OCZA 2ODGA 3M1YA 1ZQMA 4M9HA 4QZ8A 5DG8A 1IV8A 5CRXA 8ICOA 1XNSA 3OTQA 1YZ6A 2BR0A 5AI0A 1ZQBA 2NRVA 1PVQA 5J2HA 2CPRA 4DL2A 3K4GA 5KFOA 3RRHA 4MFFA 3AU6A 3BZKA 3DV9A 4IL6U 4IRKA 3BQ0A 5J2BA 3NVVA 3ICXA 3PMNA 3PX0A 5J0PA 4R65A 5HP4A 1JRPA 3OHAA 4Z6FA 4F72A 2YMMA 2F44A 4I2JA 4DOAA 4UB1A 5KFXA 1D8BA 4NWIA 3KKAA 2QLTA 3D2NA 3MR2A 1ED1A 3O0FA 1L8OA 5KFDA 3BS7A 8ICGA 1O08A 2WF9A 3GZFA 4EEKA 4C8KA 2NO4A 5KG4A 2P6UA 1EXNA 2DPJA 5DDMA 4F4ZA 1ZQRA 4Q8EA 2JR5A 2HW3A 5KNIA 5ALKA 2JGAA 5IIJA 2ZIXA 1QQ6A 2QB0A 2KEYA 4M9LA 4ED6A 1VLBA 3BQ7A 4CDGA 2HDOA 3MFIA 4TUPA 1X9WA 5BOMA 2JZBA 2XY7A 1K5OA 4FBUA 4OJ5A 3G6XA 1ZJMA 1COKA 9ICWA 7ICTA 2E8OA 2AGPA 5DLGA 4U7CA 4UB4A 5KFNA 1ZQDA 2C28A 1OW5A 4YVZA 3TQ1A 3H4BA 2K4IA 4P4PA 3N28A 3SYZA 4DO9A 2FPMA 4NM1A 5G5HA 5KT2A 1COOA 2G06A 5ALFA 2HMXA 2JRZA 9ICPA 2PXIA 3TI0A 5D46A 1UA0A 4RNOA 5KFTA 4UAZA 3MDAA 3NS1A 4BDPA 4XA5A 1S97A 4DEZA 2JEIA 2WHEA 3C2KA 1CRXA 3RBEA 2KKVA 5ALIA 3RAXA 2HVHA 4IR1A 1L3VA 5HHHA 3LYSA 1TK5A 5AI4A 2BQUA 3NGDA 3GIKA 4JV2A 2KKPA 3CYMA 4TUSA 1X42A 2ZIXB 2QB0B 4FBTA 5KAIU 4EX7A 2V4QA 1ZXIA 2JZBB 2HHUA 3TAPA 1D9DA 9ICFA 4CRXA 4R66A 2GLEA 4RNNA 4ECZA 4RQ5A 1WG8A 4XQ8A 2XVTA 4QZAA 5H2FU 4J9RA 4BWMA 2C2RA 4Z6CA 2ISOA 2BPCA 1BPYA 1ZQAA 3JPRA 4GC7A 2XGQA 5KT4A 4O5EA 2HI0A 5DDYA 2Q4TA 4YD1A 5L1LA 2FMSA 5J0WA 2E1EA 1PZNA 4ED0A 1C20A 8ICJA 1QSLA 3FDSA 1N60A 1ZQWA 1WCNA 3EWAA 3K75D 8ICPA 1HUZA 9ICMA 3BQ1A 2O6KA 2I5HA 1V38A 8ICLA 7ICHA 1TE2A 1QCKA 3TANA 3JPQA 3QNMA 3NRZA 2OH2A 1QQ7A 1ZQ1C 3T5KA 4A8EA 1JMSA 3N4MB 3C5GA 4G9BA 4NLCA 1L6NA 4IQWA 2KG5A 2KHVA 3KHHA 4PZNA 2XCPA 7ICRA 1GO3F 1RYSA 3RJJA 2F1HA 1TK8A 4M0AA 1SV0A 5KFGA 3M7DA 5KFKA 4RT3A 2MA1A 5DG9A 1JALA 5AM4A 4Q8FA 2PKEA 5J0QA 1S76D 3Q8RB 3PSFA 4UB3A 4M9NA 2MAXA 9ICKA 3QUTA 1PVRA 3NVYA 1XSNA 3ONNA 1TAUA 4UAWA 1B43A 4Y2VA 1N62A 2KSOB 4QW8A 2BQRA 4R8UA 4ED8A 3WK7A 4EBDA 1SGGA 5J0RA 3M6ZA 2FLNA 2YTUA 5HNKA 4Z6DA 1T7PA 2H3QA 5EE0A 4C0ZA 2LYBA 1O03A 4JK1A 3H0LB 2KIWA 2XO7A 3RJKA 2Z7JA 2ZTEA 2H3ZA 5KFMA 5ALPA 4NL9C 1ZQLA 1D9FA 1MQ3A 5KFWA 2DKXA 1RXVA 5ALXA 5IIOA 1L7OA 5ALZA 1A77A 5ALLA 2GH1A 1L8LA 3NVZA 4KN4A 3NRWA 2XC9A 2QARA 2Y1JA 1KSPA 1F5SA 2LM4A 4OJPA 3RF9A 1DK2A 4JV1A 4YR3A 1L3UA 5KAFU 4I2HA 5J2JA 3AL0B 7ICKA 2KVCA 1YZ7A 5DKWA 2IOFK 3PVXA 2HOFA 4I2DA 4JB3A 2A1JA 2AJQA 4ELUA 4NLZA 4R8UB 3H8JA 3T5HA 3N7SC 3GQCA 3UQ2A 3AQFA 4J9PA 2DUYA 4NLBA 2DWQA 2ZTDA 1ZRNA 3IHQB 3TADC 4BXOA 2FPKA 4NLNA 4F5RA 2QKQA 4OJ6A 1SL2A 1JUDA 1S5LU 4Y2JA 2EZXA 2PFOA 5BPCA 3E2EA 1VJ5A 3HILA 2QARB 1ZQHA 1ZQEA 3PO4A 4GXIA 1L7NA 3UMGA 2JXJA 2F8LA 5J2CA 2MU2A 2Y0SF 3KBBA 5KL8B 1Q8KA 1S77D 3RTVA 5AKYA 2KMDA 5KG3A 2DQNB 1TV9A 3RR7A 1X6IA 3B0XA 3RRGA 2OM6A 1WWVA 2A1JB 2PFQA 4YMMA 2KJ8A 3WK5A 7ICIA 2DBYA 1X9SA 1NK9A 3NASA 3ETLA 5AICA 4NL9A 2G5IB 5E79U 3HP6A 4M9GA 4MHVA 1M6YA 3GV8B 3V6HA 2F2AB 2I1QA 2BZFA 4O5CA 1JIHA 8ICNA 4BXOB 3H0MB 3Q8PB 2W9AA 2ZJ5A 4QZFA 7ICVA 1L3SA 4RPXA 2BCSA 2BHNA 4CF4A 4DLEA 2BCVA 4BUGA 8ICHA 1JN3A 2NRXA 4NLKA 4F5OA 5J0XA 3V7JA 2F1IA 3ZDDA 5IIKA 4NV0A 3AMZA 4IRDA 3WK6A 1U4BA 3GU3A 4J9NA 2NV3A 7ICPA 2ZIWA 1KEJA 4P4MA 4DQQA 3ETRA 1XWLA 2BDPA 1YT3A 3T3FA 5GTIU 3Q8LA 2H3IA 3GIJA 2CN1A 3CW2C 3LWLA 2W9BA 5KG6A 1JI7A 5TZVA 3RJFA 5DLFA 2PI4A 3ED5A 5JTIA 4DQPA 4MFAA 2ISPA 3I1YA 4FS1A 4F2SA 3QX7A 5CB1A 4YP3A 5ALGA 4I29A 2XI9A 3WKAA 3TADA 2KV2A 9ICUA 1X9XA 2OWOA 4AYBF 3RR8A 1J2NA 5J2FA 3JPOA 4M6WA 4NLGA 5CHGA 1U48A 4IR9A 1FFUA 1RYUA 3UPQA 3IDWA 3C2MA 5KG2A 4O3SA 1Q3UA 3A0HU 3M8SA 4O3QA 4QWDA 4ECVA 4GXJA 2ASLA 1SV4A 1N5WA 4UBBA 5DGBA 4DOBA 5CP2A 9ICJA 1A76A 2JEFA 4UBCA 2ZIWB 3RBDA 4KLGA 2KICA 3GFKB 3LDAA 4PZOA 1B0XA 4DL4A 3L4PA 2W9BB 5G5GA 3PX6A 4J9MA 3D6JA 3SI8A 3U26A 3C1ZA 3ORYA 5KT3A 2WTFA 4RPZA 4TQSA 5AI6A 1OUQA 2VA8A 1NJZA 4DSLA 3M9NB 2AQ4A 5GTHU 4KLFA 1BPXA 7ICSA 4OD0A 3C21A 1HJPA 1NK6A 4ED7A 4FZLA 4M6WB 4RUCA 4JWMA 2YMQA 2HBKA 4C4TA 3SQIA 1WUDA 5EWEA 8ICZA 4UAUA 4I2GA 3PSPA 2BPFA 2KFNA 5KFHA 4DL6A 2YQEA 4US8A 4TQRA 4UB5A 3RJIA 4EELA 2BGWA 4YD2A 4P0QA 4YQWA 2K60A 2HHWA 1ZD5A 4KMUA 1SKRA 4ZH4A 3F5EA 4C8OA 2AHOB 2BQ3A 5KFVA 4PGQA 1TAQA 4P2HA 3TFRA 5HMMA 4RPYA 4PL1A 5A0LA 4F4WA 5EWGA 1WCLA 4DQIA 1XU4A 2K8BB 4DSIA 4F92B 3RB3A 2ZIVA 2D3DA 4DWIA 4LVSA 4HAIA 4ECSA 3L5KA 5ALSA 4CF3A 3QE9Y 1HIWA 3ALRA 4RT2A 5ALDA 4J9KA 4RQ7A 4ECRA 3IM1A 2YB4A 1B4FA 2N1RA 3M6KA 4FO6A 1XS9D 1DK3A 5L1JA 2VIXA 3I76A 2RLTA 2IHMA 5KG1A 3TACB 4DQSA 3EZ5A 4FZMA 8ICBA 4J9SA 4YXMA 4QW9A 4ECTA 7ICQA 1T3QA 3T79A 2HCFA 5ALEA 4RQ8A 1HUOA 3H8MA 5ALUA 2W55A 3D2QA 1CI4A 4Q45A 2CRXA 2PFNA 2ZUDA 3FAHA 2RP5A 5KT6A 4P0QB 2R18A 2Y0SC 3PMLA 1SV0C 2GO7A 3KOOA 3LK9A 1V9PA 2J6UA 3WU2U 2ES6A 5IILA 3QU7A 4QZCA 2BCQA 4DCCA 4B6JA 4O3OA 3IV6A 2MSNA 5CEHA 2YN4A 3UMBA 1C7YA 2ZIVB 3TKAA 5ALYA 4RZRA 4CGZA 1MSWD 2A3VA 5KFCA 3QUBA 4IQTA 5L9XA 3C1YA 2VJ4A 3F2CA 1X66A 8ICSA 3AN1A 4ED1A 3HPOA 4Y2QA 1CEZA 4ECXA 2KK0A 1F44A 5DB6A 2ZG6A 4O3PA 1ZQXA 4DF4A 3HKZF 4ED3A 3THVA 1DGJA 2HHQA 1X2IA 2I6XA 2JMGA 5ALOA 3TARA 3WK4A 5AKZA 3UMCA 2EZYA 4JV0A 7ICLA 1UPHA 5KT7A 3PW0A 2DFLA 1S9FA 2WF7A 5J2IA 4DL7A 1RYRA 1AROP 4DSKA 4DSFA 3H4DA 3BJYA 3ZDCA 2E8NA 5J2DA 4C4SA 1ZQOA 1S0VA 4EEYA 9ICVA 1KRPA 2W7PA 5AKGA 4Q43A 5J2EA 1XO1A 2LYHA 2KSOA 2WF8A 1KFTA 4KN7A 5K4LA 5JU5A 4BJQA 3M9OB 1L7MA 1UA1A 5F9NA 2OXOA 4KLQA 1IIPA 3NVWA 4AYBC 1K1SA 1Q3VA 1MC8A 4RQ1A 1N56A 3JPSA 1RDFA 4ZOHC 4M47A 1N48A 8ICVA 4QIWF 1T4GA 7ICMA 1NJWA 2C22A 4Y2TA 1QSSA 4BGDA 7ICGA 1MA7A 4J9LA 1Q46A 3RJGA 3SAGA 1ZQPA 2AU0A 5J0OA 4B9LA 4MFCA 1BPZA 2W54A 3HJEA 2V9WA 3KHLA 3N7RC 3T5JA 8ICUA 5AKXA 5L1KA 5ALJA 2RDIA 4O5KA 3HX0A 4NXZA 3K1ZA 1JXLA 4YMNA 5J29A 3QU5A 3RH5A 4B9UA 2AQ0A 5KG5A 4KTQA 4O0IA 3PR4A 4CE6A 4DOCA 4G3IA 2ASJA 2EDUA 2HBMA 5DB8A 2W3RA 3CRXA 2HSZA 4DFPA 3WK9A 3H8SA 4IQVA 3AQEA 3WK8A 4I2BA 2EAPA 5AK4A 4LJXA 2VANA 1UHUA 4TUQA 1UT8A 1BPDA 1SWWA 2L5YA 1Z4OA 5AKLA 2R8HA 1ZQCA 1FFVA 1NJXA 2BKEA 3C5FA 2ZJ8A 2FPLA 2FMQA 3G6VA 4ECUA 1S0OA 1QH9A 2EQYA 1P7DA 2G5HB 1QSYA 1BNOA 4CCHA 5T14A 2LM1A 1CUKA 2HVIA 2RQ5A 4RQ6A 4RUAA 4JMUA 4F93B 1Z1VA 2LMRA 5KFEA 4O9MA 4DS5A 8ICFA 3KFUF 5AI5A 4ECYA 8ICYA 2HHXA 8ICKA 3RB6A 1U47A 1F0MA 3CNHA 1URJA 2MRLA 1A0PA 4KMOB 2W8LA 1NK4A 2Y9TA 2KHQA 3IG5A 4MEXA 3IP4B 1ZQFA 4XRHA 5ALWA 3ZDBA 3IN5A 5DGAA 8ICXA 2ALZA 4M9JA 5JUMA 5HR7A 5HHIA 7ICOA 3L3FX 4O3RA 1SZHA 5AKIA 5KFUA 3SR6A 1DXSA 3BQTA 4KITB 4F4KA 2JH7A 3N7PD 4QZBA 1ECWA 2NRZA 4IQUA 4B9VA 1UQVA 1AQ6A 1ZJNA 9ICRA 2EAOA 4UW9A 1NK5A 9ICLA 2KIVA 3PR5B 2W43A 1HEKA 5C0YA 1J97A 4KLJA 9ICAA 3LVVA 2PMZF 4Y2UA 4KLIA 5AHXA 2R8JA 2QB1A 4Q44A 2HBLA 3HW8A 9ICNA 4I2IA 1PUZA 1ZQYA 4O3NA 1SXEA 3WKCA 2EZZA 2WAQF 4UB8U 3VCBA 1RG6A 3HKZC 4F5NA 3KZIU 3RH6A 2K4EA 2YMLA 4KLLA 3MC1A 1KN5A 2Q0ZX 4ED2A 2CXYA 3PW2A 1NJYA 1J2MA 5J0UA 1TKDA 3F2BA 3MFHA 1LV5A 2J6SA 3QEBZ 3PSIA 5EOZA 4C8MA 2A1AA 4DFKA 2C2DA 1SKSA 2WF5A 4YCXA 2HOIA 1U49A 3OHBA 1NKBA 2IOFA 1Z00B 2K8AA 2IHNA 5KTQA 2KP7A 5AM3A 2W8KA 4F50A 1X40A 3QUQA 1WYGA 5J2GA 2VA2A 2UVUA 4DF8A 4CF5A 4YR2A 5JRTA 1D8LA 5KFQA 5F3XB 5AM5A 3PX4A 5KT5A 3UXPA 2KOBA 5J0SA 1SWVA 1X9MA 5IIMA 1S0MA 2P6RA 4UB2A 3SEIA 2UVWA 1PVPA 2G08A 5AKHA 4QWAA 4QIWC 2LHTA 2UVVA 3MGIA 2G09A 2YX8A 4I2EA 3QXGA 4P0PB 1KTQA 3ZDEA 2RHFA 4I27A 3V7KA 2FMPA 8ICWA 3H40A 3H0RB 2R8KA 2KD1A 3KZXA 3EYZA 3PW5A 4RU9A 1XO0A 8ICCA 4TURA 5BOLA 2G07A 5DQHA 2PFPA 2E1FA 1QTMA 5AM2A 4EYIB 2RRDA 3HRDD 3PO5A 1RZTA 4XUSA 2V4RA 4EX6A 3RFAA 2AH5A 4EBCA 5AI8A 1KW4A 4PHEA 4RQ4A 4ACOA 5AM1A 4WJ3B 2FI1A 5KFIA 4Z6EA 1Z3EB 1IM4A 2DL0A 5EE1A 5KFRA 2F8KA 3RJEA 5J0TA 4UATA 1XC9A 3IG8A 2LPEA 1RPLA 5DQGA 4J9QA 8ICIA 5B5EU 2AGOA 5AK3A 2ESEA 4RQNA 1BVSA 4MF8A 5CA7A 4JWNA 3PY8A 4F8RA 2XICA 2F76X 5ALNA 1NK0A 7ICEA 8ICQA 3FYHA 1TK0A 2FDRA 4IC9A 2YB1A 3NUQA 9ICBA 1UCVA 1JXEA 1L3TA 3Q8MA 4QZHA 1T94A 3QU9A 5D49A 4C80A 2BCUA 1BPBA 4KLHA 3BZCA 5FP0A 1NK7A 5AK5A 4PHAA 3NTUA 4PHDA 3ISDA 4KLEA 4P4OA 2G0AA 4US9A 2ATLA 3JPNA 4I2AA 2NO5A 4UARA 2D6FC 2D8CA 2B6GA 3C28A 4UQGA 4DL5A 3RJHA 2OCEA 4FS2A 2VKQA 1ZQIA 1NKEA 3ZD9A 2DGZA 9ICQA 2C2EA 3OPXA 2FLLA 2W11A 5KFYA 4PGYA 3PV8A 2DKZA 2ZXIA 2KJ9A 5L1MA 1NOMA 4DSJA 3GILA 2NYVA 3T5LA 4GLXA 4PH5A 2H3VA
chains in the Genus database with same CATH topology
2H3IA 3D2NA 3PSIA 1ED1A 2CN1A 3LVWA 2HBKA 3F5AA 3O0FA 4QIWF 1PVRA 3SQIA 4ACOA 3KFUF 2LKYA 4OJ6A 1KBUA 1WUDA 4WJ3B 3ONNA 3MGVA 2ZIVB 4CGZA 3GZFA 3PSPA 2A3VA 2HOIA 2VJ5A 1MA7A 2VJ4A 3F2CA 3SAGA 1URJA 2MRLA 2ZIUB 4CRXA 3M6ZA 1A0PA 2K8AA 4O3MA 2HOQA 2PMZC 4KMOB 2K8CB 4P0QA 1F44A 2H3QA 4C0ZA 3IG8A 2LYBA 2KHQA 2XI9A 2ZG6A 3IG5A 3H0LB 4KX5A 3IP4B 2DF4B 2XVTA 2KV2A 3F5EA 2KIWA 2F8LA 3HKZF 2OYYA 3N7RC 4QNLA 4P0PA 2Z7JA 4AYBF 3VC8A 2F77X 3SAHA 1Z19A 3CP8A 1TAMA 3K1ZA 2H3ZA 2KNJA 2Y0SF 4PL1A 5A0LA 2JGAA 3IN5A 2ZIXA 2JMGA 2W03A 2KEYA 2XICA 2WAQC 4OO1J 2F76X 4OJOA 5KL8B 4CDGA 5HR7A 2K8BB 3PSTA 2Q4TA 1Q3UA 3L3FX 2YB1A 2ZIVA 1SZHA 3NUQA 4IC9A 2LYAA 1UPHA 2DQNB 4FE3A 2E1EA 4OJLA 2KJ5A 3SMVA 2KOBA 2GH1A 1T94A 2JH7A 4QJFB 2OM6A 3N7PD 3NRWA 1ECWA 4BX9C 2WB1C 1Z1BA 1HIWA 2HBMA 2JH1A 3ALRA 4OJ5A 3CRXA 2ZIUA 1A6SA 2KJ8A 3PZPA 4KX3A 4U6PA 2JHDA 2E5SA 2M0NA 2G0AA 4U7CA 1PVPA 1HEKA 2YB4A 4OJPA 3D2SA 3RF9A 3C29A 3AQEA 2N1RA 2H3FA 2HBJA 5C0YA 3M6KA 2G08A 2G5IB 2D6FC 4ICAA 4GFJA 4QIWC 3LVVA 2OH2A 2ZIWB 1ZQ1C 2VIXA 2PMZF 2BDUA 2LHTA 2W7PA 2K4IA 3C28A 5CRXA 2KICA 2G09A 2YX8A 1XNSA 2F2AB 2XIDA 4A8EA 3AL0B 2ZXHA 2KVCA 4PL2A 4P0PB 4FZMA 2HBLA 2RHFA 1NZBA 3H0MB 2G06A 5HR6A 3H0RB 2VKQA 2HMXA 2KD1A 3KZXA 1PVQA 2HOFA 4NLCA 3T79A 1L6NA 2CPRA 4BJQA 2GOLA 2KHVA 2DGZA 2WAQF 5KL1B 4BUGA 3D2QA 2W04A 2OXOA 3DEEA 2K4HA 1XO0A 1IIPA 3VCBA 1P7DA 1GO3F 2G5HB 3HKZC 3F2DA 2CRXA 2G07A 1OUQA 4AYBC 3OPXA 4NV0A 2RP5A 1CRXA 4FZNA 3N7SC 1Q3VA 2E1FA 2K4EA 4P0QB 2KKVA 2R18A 2Y0SC 3M7DA 3E0FA 2RRDA 3ICXA 2LBOA 3SAFA 2K89A 5T14A 2W7OA 2WB1F 2MA1A 3GU3A 2ZXIA 2KJ9A 2NV3A 3AQFA 2ZIWA 3F53A 4NLBA 3LYSA 3PSFA 3RFAA 2KKPA 4FZLA 3CYMA 1D8BA 1YT3A 4NWIA 3F2BA 2ZIXB 2H3VA 1DRGA 4JMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3I A;  1ED1 A;  1HEK A;  2K4H A;  1TAM A;  2H3Z A;  2N1R A;  2H3F A;  2JMG A;  4ICA A;  2K4E A;  2K4I A;  4IC9 A;  2LYA A;  1UPH A;  2NV3 A;  2H3Q A;  1ECW A;  2LYB A;  2HMX A;  1HIW A;  1A6S A;  1L6N A;  2GOL A;  2H3V A;  4JMU A; 
#chains in the Genus database with same CATH topology
 5EE9 A;  1Y88 A;  1SIJ A;  3V7L A;  4RQ2 A;  2LKY A;  1ZD2 P;  8ICE A;  3SEN A;  5B66 U;  5DB9 A;  1K1Q A;  5AK6 A;  3QZ7 A;  3RH4 A;  4YMO A;  1B22 A;  4PHP A;  3B0Y A;  5DBA A;  3Q8S B;  4C8N A;  4KLO A;  2YY6 A;  2PMZ C;  1D8Y A;  2K8C B;  4YR0 A;  1UT5 A;  5CR0 A;  4ECQ A;  2JEJ A;  2BPG A;  4DFD A;  4C8L A;  1IXR A;  1TVA A;  5DG7 A;  2F77 X;  1VDV A;  3AUO A;  5F9L A;  2WAQ C;  1KFS A;  4B9S A;  4KLS A;  3PST A;  2HHS A;  1SL1 A;  2EAN A;  3S6J A;  3UXO A;  3GII A;  4EBE A;  2LI6 A;  4EZ6 A;  1Z1B A;  4NJ8 A;  5J8Y C;  3ISB A;  3PZP A;  4DS4 A;  1N63 A;  2K4P A;  3OSP A;  3TFS A;  4DLG A;  1JRO A;  3KD3 A;  4QZI A;  4F3O A;  1BPE A;  4UAY A;  7ICU A;  5C5J A;  2EAM A;  3MR5 A;  4F71 A;  4EZ9 A;  1ZRM A;  5AIA A;  3QEA Z;  2FE9 A;  3R9K A;  4F4Y A;  3GDX A;  3PW4 A;  1BNP A;  2RDJ A;  1ZQT A;  2E8P A;  1FIQ A;  1PK3 A;  1RM6 C;  1KL9 A;  2W9M A;  3DEE A;  2K4H A;  3MR6 A;  4HYK A;  3SD7 A;  4QWE A;  2KZZ A;  3HT3 A;  7ICJ A;  3G6Y A;  1U45 A;  3Q8K A;  4GXK A;  2K89 A;  3BDP A;  1KFD A;  4YXJ A;  3ZI4 A;  4ELV A;  3MGH A;  2EH9 A;  4YN4 A;  4DL3 A;  9ICO A;  2F3N A;  4C4R A;  8ICM A;  2F1J A;  1PK1 A;  5KFS A;  3LVW A;  3F5A A;  4RNM A;  1ZQG A;  4J9O A;  2E8M A;  1SKW A;  1QQ5 A;  2ZTC A;  3V6K A;  4K4I A;  3V6J A;  3WKB A;  9ICS A;  3ZDA A;  1FO4 A;  2B21 A;  2IA6 A;  4PGX A;  4I2C A;  1S8O A;  9ICE A;  5AM0 A;  1QLN A;  4ECW A;  5ALR A;  4QNL A;  4RQ0 A;  5HML A;  1SXD A;  1NK8 A;  8ICT A;  2R8G A;  4GC6 A;  1Z4N A;  2ASD A;  5DQI A;  2NRW A;  5KFF A;  2KJ5 A;  4J03 A;  2JH1 A;  1A6S A;  1LVH A;  4KLU A;  1N61 A;  5ALV A;  1ZQU A;  2M0N A;  2W3S A;  4X5V A;  4LZD A;  3LWM A;  3C29 A;  2H3F A;  4KLM A;  1N5X A;  2WFA A;  1LB2 B;  3EUB 2;  2JEG A;  5ALH A;  4RQM A;  3H7I A;  3IRU A;  2BDU A;  3RAQ A;  3FM9 A;  3C2L A;  3QU2 A;  4LZG A;  1PK1 B;  4Y2P A;  1NZB A;  2IBK A;  3J81 j;  4Y2Y A;  5J8Y A;  2Y1I A;  1IG6 A;  1ZQN A;  1RQN A;  2FLP A;  1U9L A;  2W04 A;  5TIS U;  7ICN A;  2KFZ A;  3F2D A;  3C23 A;  3SV4 A;  4FZN A;  2DPI A;  1NNL A;  3FC4 A;  2W7O A;  2WB1 F;  1NKC A;  4F4X A;  1MN8 A;  3F53 A;  3JPT A;  5KG7 A;  4KLT A;  3M8R A;  4Y2R A;  3WKE A;  3BQ2 A;  5EE3 A;  4BWJ A;  4K4H A;  1DOQ A;  5AKE A;  1KBU A;  3QUC A;  4M2Y A;  3Q8Q B;  2R8I A;  3RB4 A;  7ICF A;  3AM9 A;  3MGV A;  4QWB A;  1LKY A;  5J0Y A;  2KE7 A;  2VJ5 A;  2KVS A;  2KTQ A;  5AIB A;  1ZQQ A;  2WF6 A;  3OSN A;  1KLN A;  4KX5 A;  2MUT A;  2IOH A;  1ZQZ A;  4E0D A;  3QU4 A;  3OJS A;  3KHR A;  4UAS A;  2OYY A;  4FFD A;  3SAH A;  3UQ0 A;  3CP8 A;  3JPP A;  2KNJ A;  4OO1 J;  4UB6 U;  8ICA A;  4IS7 A;  1XSL A;  4C7Y A;  2LYA A;  5KFB A;  1X6J A;  2FJ6 A;  4AP9 A;  4FE3 A;  3N97 B;  4OJL A;  2J6T A;  4EYH B;  4YFK A;  2AGQ A;  4BX9 C;  2ZIU A;  3KTQ A;  3EPI A;  9ICI A;  4KX3 A;  4I28 A;  3RB0 A;  3GIM A;  4DQR A;  5ALQ A;  2PI5 A;  5D4B A;  2HBJ A;  5EWF A;  4GIB A;  5ALT A;  4GFJ A;  3V72 A;  2JV3 A;  5KFL A;  2ZUB A;  5DBB A;  3AU2 A;  4PL2 A;  5J2K A;  5HR6 A;  1H38 A;  3ISC A;  3MDC A;  2B0C A;  5KFZ A;  4JUZ A;  1T3N A;  2GOL A;  4CNQ A;  1Z00 A;  5IIN A;  1LKY B;  4I2F A;  5KL1 B;  4Y2X A;  4UAV A;  1ZQV A;  3SAF A;  2LBO A;  4QZE A;  2MUT B;  3GV7 B;  3OGU A;  1BGX T;  5DBC A;  1SB3 C;  4R63 A;  1FEZ A;  4M04 A;  1RQL A;  4PPX A;  4B9N A;  3WKD A;  1DRG A;  1L7P A;  4YG2 A;  1L5U A;  3SZ2 A;  3PW7 A;  3E58 A;  3MR3 A;  4USA A;  2OEH A;  3UM9 A;  2I9G A;  4QZD A;  1S0N A;  3MBY A;  2P35 A;  2ZIU B;  4IRC A;  2H5X A;  3KHG A;  5KG0 A;  5KFJ A;  5CJ7 A;  2DF4 B;  3VC8 A;  3QZ8 A;  1NZP A;  4P0P A;  4B9T A;  1Z19 A;  1TAM A;  1V85 A;  4C7Z A;  2A19 A;  4QZG A;  4F2R A;  2E3T A;  1ZOL A;  1WWU A;  4F91 B;  2VA3 A;  3A0B U;  2ZJA A;  3SMV A;  4F5Q A;  1V97 A;  3HWT A;  2HHV A;  4QJF B;  5AI9 A;  4U6P A;  1MQ2 A;  3UXN A;  1KQQ A;  4Y2S A;  9ICH A;  2E5S A;  3K1R B;  3DDH A;  1ZD4 A;  9ICX A;  4QZ9 A;  2XY5 A;  3AEV A;  4ICA A;  2W9C A;  5DB7 A;  2XCA A;  3M9M B;  4RQ3 A;  3QYP A;  2XID A;  8ICR A;  2ZXH A;  4R64 A;  4MF2 A;  5KFP A;  5L1I A;  4K4G A;  4NY8 A;  3KKA C;  3EPG A;  3TAQ A;  2GWS A;  4EEN A;  1SL0 A;  2AXT U;  4ELT A;  1N2X A;  2OHF A;  2IMW P;  9ICC A;  3BS5 A;  2KZM A;  5ALM A;  4PJ0 U;  3B9J A;  1KKX A;  1ZD3 A;  3E0F A;  1ZQJ A;  2ZUC A;  3EW9 A;  2HHT A;  4F5P A;  4QWC A;  1JX4 A;  4MEY A;  3OJU A;  4DSE A;  2UVR A;  9ICG A;  2Y9U A;  1RXW A;  3GV5 B;  4DFM A;  9ICT A;  1ZYQ A;  5III A;  2HOQ A;  4O3M A;  1TFR A;  3ZD8 A;  2KN7 A;  1S10 A;  1NI3 A;  1OXJ A;  2W9C B;  4DFJ A;  1ZET A;  3I28 A;  1KDH A;  2XY6 A;  1ZQS A;  2NRT A;  2W03 A;  5J2A A;  1SZP A;  1DGS A;  2KZ3 A;  3H8W A;  4OJO A;  5KFA A;  2M9N A;  2YMP A;  3SV3 A;  5AKK A;  4B9M A;  2P66 A;  2XGP A;  1XSP A;  3MAB A;  5AKJ A;  2WB1 C;  1T8E A;  2JHD A;  1ZQK A;  3BS5 B;  3PNC A;  4KLD A;  3D2S A;  4NM2 A;  5CWR A;  2BCR A;  4OCZ A;  2ODG A;  3M1Y A;  1ZQM A;  4M9H A;  4QZ8 A;  5DG8 A;  1IV8 A;  5CRX A;  8ICO A;  1XNS A;  3OTQ A;  1YZ6 A;  2BR0 A;  5AI0 A;  1ZQB A;  2NRV A;  1PVQ A;  5J2H A;  2CPR A;  4DL2 A;  3K4G A;  5KFO A;  3RRH A;  4MFF A;  3AU6 A;  3BZK A;  3DV9 A;  4IL6 U;  4IRK A;  3BQ0 A;  5J2B A;  3NVV A;  3ICX A;  3PMN A;  3PX0 A;  5J0P A;  4R65 A;  5HP4 A;  1JRP A;  3OHA A;  4Z6F A;  4F72 A;  2YMM A;  2F44 A;  4I2J A;  4DOA A;  4UB1 A;  5KFX A;  1D8B A;  4NWI A;  3KKA A;  2QLT A;  3D2N A;  3MR2 A;  1ED1 A;  3O0F A;  1L8O A;  5KFD A;  3BS7 A;  8ICG A;  1O08 A;  2WF9 A;  3GZF A;  4EEK A;  4C8K A;  2NO4 A;  5KG4 A;  2P6U A;  1EXN A;  2DPJ A;  5DDM A;  4F4Z A;  1ZQR A;  4Q8E A;  2JR5 A;  2HW3 A;  5KNI A;  5ALK A;  2JGA A;  5IIJ A;  2ZIX A;  1QQ6 A;  2QB0 A;  2KEY A;  4M9L A;  4ED6 A;  1VLB A;  3BQ7 A;  4CDG A;  2HDO A;  3MFI A;  4TUP A;  1X9W A;  5BOM A;  2JZB A;  2XY7 A;  1K5O A;  4FBU A;  4OJ5 A;  3G6X A;  1ZJM A;  1COK A;  9ICW A;  7ICT A;  2E8O A;  2AGP A;  5DLG A;  4U7C A;  4UB4 A;  5KFN A;  1ZQD A;  2C28 A;  1OW5 A;  4YVZ A;  3TQ1 A;  3H4B A;  2K4I A;  4P4P A;  3N28 A;  3SYZ A;  4DO9 A;  2FPM A;  4NM1 A;  5G5H A;  5KT2 A;  1COO A;  2G06 A;  5ALF A;  2HMX A;  2JRZ A;  9ICP A;  2PXI A;  3TI0 A;  5D46 A;  1UA0 A;  4RNO A;  5KFT A;  4UAZ A;  3MDA A;  3NS1 A;  4BDP A;  4XA5 A;  1S97 A;  4DEZ A;  2JEI A;  2WHE A;  3C2K A;  1CRX A;  3RBE A;  2KKV A;  5ALI A;  3RAX A;  2HVH A;  4IR1 A;  1L3V A;  5HHH A;  3LYS A;  1TK5 A;  5AI4 A;  2BQU A;  3NGD A;  3GIK A;  4JV2 A;  2KKP A;  3CYM A;  4TUS A;  1X42 A;  2ZIX B;  2QB0 B;  4FBT A;  5KAI U;  4EX7 A;  2V4Q A;  1ZXI A;  2JZB B;  2HHU A;  3TAP A;  1D9D A;  9ICF A;  4CRX A;  4R66 A;  2GLE A;  4RNN A;  4ECZ A;  4RQ5 A;  1WG8 A;  4XQ8 A;  2XVT A;  4QZA A;  5H2F U;  4J9R A;  4BWM A;  2C2R A;  4Z6C A;  2ISO A;  2BPC A;  1BPY A;  1ZQA A;  3JPR A;  4GC7 A;  2XGQ A;  5KT4 A;  4O5E A;  2HI0 A;  5DDY A;  2Q4T A;  4YD1 A;  5L1L A;  2FMS A;  5J0W A;  2E1E A;  1PZN A;  4ED0 A;  1C20 A;  8ICJ A;  1QSL A;  3FDS A;  1N60 A;  1ZQW A;  1WCN A;  3EWA A;  3K75 D;  8ICP A;  1HUZ A;  9ICM A;  3BQ1 A;  2O6K A;  2I5H A;  1V38 A;  8ICL A;  7ICH A;  1TE2 A;  1QCK A;  3TAN A;  3JPQ A;  3QNM A;  3NRZ A;  2OH2 A;  1QQ7 A;  1ZQ1 C;  3T5K A;  4A8E A;  1JMS A;  3N4M B;  3C5G A;  4G9B A;  4NLC A;  1L6N A;  4IQW A;  2KG5 A;  2KHV A;  3KHH A;  4PZN A;  2XCP A;  7ICR A;  1GO3 F;  1RYS A;  3RJJ A;  2F1H A;  1TK8 A;  4M0A A;  1SV0 A;  5KFG A;  3M7D A;  5KFK A;  4RT3 A;  2MA1 A;  5DG9 A;  1JAL A;  5AM4 A;  4Q8F A;  2PKE A;  5J0Q A;  1S76 D;  3Q8R B;  3PSF A;  4UB3 A;  4M9N A;  2MAX A;  9ICK A;  3QUT A;  1PVR A;  3NVY A;  1XSN A;  3ONN A;  1TAU A;  4UAW A;  1B43 A;  4Y2V A;  1N62 A;  2KSO B;  4QW8 A;  2BQR A;  4R8U A;  4ED8 A;  3WK7 A;  4EBD A;  1SGG A;  5J0R A;  3M6Z A;  2FLN A;  2YTU A;  5HNK A;  4Z6D A;  1T7P A;  2H3Q A;  5EE0 A;  4C0Z A;  2LYB A;  1O03 A;  4JK1 A;  3H0L B;  2KIW A;  2XO7 A;  3RJK A;  2Z7J A;  2ZTE A;  2H3Z A;  5KFM A;  5ALP A;  4NL9 C;  1ZQL A;  1D9F A;  1MQ3 A;  5KFW A;  2DKX A;  1RXV A;  5ALX A;  5IIO A;  1L7O A;  5ALZ A;  1A77 A;  5ALL A;  2GH1 A;  1L8L A;  3NVZ A;  4KN4 A;  3NRW A;  2XC9 A;  2QAR A;  2Y1J A;  1KSP A;  1F5S A;  2LM4 A;  4OJP A;  3RF9 A;  1DK2 A;  4JV1 A;  4YR3 A;  1L3U A;  5KAF U;  4I2H A;  5J2J A;  3AL0 B;  7ICK A;  2KVC A;  1YZ7 A;  5DKW A;  2IOF K;  3PVX A;  2HOF A;  4I2D A;  4JB3 A;  2A1J A;  2AJQ A;  4ELU A;  4NLZ A;  4R8U B;  3H8J A;  3T5H A;  3N7S C;  3GQC A;  3UQ2 A;  3AQF A;  4J9P A;  2DUY A;  4NLB A;  2DWQ A;  2ZTD A;  1ZRN A;  3IHQ B;  3TAD C;  4BXO A;  2FPK A;  4NLN A;  4F5R A;  2QKQ A;  4OJ6 A;  1SL2 A;  1JUD A;  1S5L U;  4Y2J A;  2EZX A;  2PFO A;  5BPC A;  3E2E A;  1VJ5 A;  3HIL A;  2QAR B;  1ZQH A;  1ZQE A;  3PO4 A;  4GXI A;  1L7N A;  3UMG A;  2JXJ A;  2F8L A;  5J2C A;  2MU2 A;  2Y0S F;  3KBB A;  5KL8 B;  1Q8K A;  1S77 D;  3RTV A;  5AKY A;  2KMD A;  5KG3 A;  2DQN B;  1TV9 A;  3RR7 A;  1X6I A;  3B0X A;  3RRG A;  2OM6 A;  1WWV A;  2A1J B;  2PFQ A;  4YMM A;  2KJ8 A;  3WK5 A;  7ICI A;  2DBY A;  1X9S A;  1NK9 A;  3NAS A;  3ETL A;  5AIC A;  4NL9 A;  2G5I B;  5E79 U;  3HP6 A;  4M9G A;  4MHV A;  1M6Y A;  3GV8 B;  3V6H A;  2F2A B;  2I1Q A;  2BZF A;  4O5C A;  1JIH A;  8ICN A;  4BXO B;  3H0M B;  3Q8P B;  2W9A A;  2ZJ5 A;  4QZF A;  7ICV A;  1L3S A;  4RPX A;  2BCS A;  2BHN A;  4CF4 A;  4DLE A;  2BCV A;  4BUG A;  8ICH A;  1JN3 A;  2NRX A;  4NLK A;  4F5O A;  5J0X A;  3V7J A;  2F1I A;  3ZDD A;  5IIK A;  4NV0 A;  3AMZ A;  4IRD A;  3WK6 A;  1U4B A;  3GU3 A;  4J9N A;  2NV3 A;  7ICP A;  2ZIW A;  1KEJ A;  4P4M A;  4DQQ A;  3ETR A;  1XWL A;  2BDP A;  1YT3 A;  3T3F A;  5GTI U;  3Q8L A;  2H3I A;  3GIJ A;  2CN1 A;  3CW2 C;  3LWL A;  2W9B A;  5KG6 A;  1JI7 A;  5TZV A;  3RJF A;  5DLF A;  2PI4 A;  3ED5 A;  5JTI A;  4DQP A;  4MFA A;  2ISP A;  3I1Y A;  4FS1 A;  4F2S A;  3QX7 A;  5CB1 A;  4YP3 A;  5ALG A;  4I29 A;  2XI9 A;  3WKA A;  3TAD A;  2KV2 A;  9ICU A;  1X9X A;  2OWO A;  4AYB F;  3RR8 A;  1J2N A;  5J2F A;  3JPO A;  4M6W A;  4NLG A;  5CHG A;  1U48 A;  4IR9 A;  1FFU A;  1RYU A;  3UPQ A;  3IDW A;  3C2M A;  5KG2 A;  4O3S A;  1Q3U A;  3A0H U;  3M8S A;  4O3Q A;  4QWD A;  4ECV A;  4GXJ A;  2ASL A;  1SV4 A;  1N5W A;  4UBB A;  5DGB A;  4DOB A;  5CP2 A;  9ICJ A;  1A76 A;  2JEF A;  4UBC A;  2ZIW B;  3RBD A;  4KLG A;  2KIC A;  3GFK B;  3LDA A;  4PZO A;  1B0X A;  4DL4 A;  3L4P A;  2W9B B;  5G5G A;  3PX6 A;  4J9M A;  3D6J A;  3SI8 A;  3U26 A;  3C1Z A;  3ORY A;  5KT3 A;  2WTF A;  4RPZ A;  4TQS A;  5AI6 A;  1OUQ A;  2VA8 A;  1NJZ A;  4DSL A;  3M9N B;  2AQ4 A;  5GTH U;  4KLF A;  1BPX A;  7ICS A;  4OD0 A;  3C21 A;  1HJP A;  1NK6 A;  4ED7 A;  4FZL A;  4M6W B;  4RUC A;  4JWM A;  2YMQ A;  2HBK A;  4C4T A;  3SQI A;  1WUD A;  5EWE A;  8ICZ A;  4UAU A;  4I2G A;  3PSP A;  2BPF A;  2KFN A;  5KFH A;  4DL6 A;  2YQE A;  4US8 A;  4TQR A;  4UB5 A;  3RJI A;  4EEL A;  2BGW A;  4YD2 A;  4P0Q A;  4YQW A;  2K60 A;  2HHW A;  1ZD5 A;  4KMU A;  1SKR A;  4ZH4 A;  3F5E A;  4C8O A;  2AHO B;  2BQ3 A;  5KFV A;  4PGQ A;  1TAQ A;  4P2H A;  3TFR A;  5HMM A;  4RPY A;  4PL1 A;  5A0L A;  4F4W A;  5EWG A;  1WCL A;  4DQI A;  1XU4 A;  2K8B B;  4DSI A;  4F92 B;  3RB3 A;  2ZIV A;  2D3D A;  4DWI A;  4LVS A;  4HAI A;  4ECS A;  3L5K A;  5ALS A;  4CF3 A;  3QE9 Y;  1HIW A;  3ALR A;  4RT2 A;  5ALD A;  4J9K A;  4RQ7 A;  4ECR A;  3IM1 A;  2YB4 A;  1B4F A;  2N1R A;  3M6K A;  4FO6 A;  1XS9 D;  1DK3 A;  5L1J A;  2VIX A;  3I76 A;  2RLT A;  2IHM A;  5KG1 A;  3TAC B;  4DQS A;  3EZ5 A;  4FZM A;  8ICB A;  4J9S A;  4YXM A;  4QW9 A;  4ECT A;  7ICQ A;  1T3Q A;  3T79 A;  2HCF A;  5ALE A;  4RQ8 A;  1HUO A;  3H8M A;  5ALU A;  2W55 A;  3D2Q A;  1CI4 A;  4Q45 A;  2CRX A;  2PFN A;  2ZUD A;  3FAH A;  2RP5 A;  5KT6 A;  4P0Q B;  2R18 A;  2Y0S C;  3PML A;  1SV0 C;  2GO7 A;  3KOO A;  3LK9 A;  1V9P A;  2J6U A;  3WU2 U;  2ES6 A;  5IIL A;  3QU7 A;  4QZC A;  2BCQ A;  4DCC A;  4B6J A;  4O3O A;  3IV6 A;  2MSN A;  5CEH A;  2YN4 A;  3UMB A;  1C7Y A;  2ZIV B;  3TKA A;  5ALY A;  4RZR A;  4CGZ A;  1MSW D;  2A3V A;  5KFC A;  3QUB A;  4IQT A;  5L9X A;  3C1Y A;  2VJ4 A;  3F2C A;  1X66 A;  8ICS A;  3AN1 A;  4ED1 A;  3HPO A;  4Y2Q A;  1CEZ A;  4ECX A;  2KK0 A;  1F44 A;  5DB6 A;  2ZG6 A;  4O3P A;  1ZQX A;  4DF4 A;  3HKZ F;  4ED3 A;  3THV A;  1DGJ A;  2HHQ A;  1X2I A;  2I6X A;  2JMG A;  5ALO A;  3TAR A;  3WK4 A;  5AKZ A;  3UMC A;  2EZY A;  4JV0 A;  7ICL A;  1UPH A;  5KT7 A;  3PW0 A;  2DFL A;  1S9F A;  2WF7 A;  5J2I A;  4DL7 A;  1RYR A;  1ARO P;  4DSK A;  4DSF A;  3H4D A;  3BJY A;  3ZDC A;  2E8N A;  5J2D A;  4C4S A;  1ZQO A;  1S0V A;  4EEY A;  9ICV A;  1KRP A;  2W7P A;  5AKG A;  4Q43 A;  5J2E A;  1XO1 A;  2LYH A;  2KSO A;  2WF8 A;  1KFT A;  4KN7 A;  5K4L A;  5JU5 A;  4BJQ A;  3M9O B;  1L7M A;  1UA1 A;  5F9N A;  2OXO A;  4KLQ A;  1IIP A;  3NVW A;  4AYB C;  1K1S A;  1Q3V A;  1MC8 A;  4RQ1 A;  1N56 A;  3JPS A;  1RDF A;  4ZOH C;  4M47 A;  1N48 A;  8ICV A;  4QIW F;  1T4G A;  7ICM A;  1NJW A;  2C22 A;  4Y2T A;  1QSS A;  4BGD A;  7ICG A;  1MA7 A;  4J9L A;  1Q46 A;  3RJG A;  3SAG A;  1ZQP A;  2AU0 A;  5J0O A;  4B9L A;  4MFC A;  1BPZ A;  2W54 A;  3HJE A;  2V9W A;  3KHL A;  3N7R C;  3T5J A;  8ICU A;  5AKX A;  5L1K A;  5ALJ A;  2RDI A;  4O5K A;  3HX0 A;  4NXZ A;  3K1Z A;  1JXL A;  4YMN A;  5J29 A;  3QU5 A;  3RH5 A;  4B9U A;  2AQ0 A;  5KG5 A;  4KTQ A;  4O0I A;  3PR4 A;  4CE6 A;  4DOC A;  4G3I A;  2ASJ A;  2EDU A;  2HBM A;  5DB8 A;  2W3R A;  3CRX A;  2HSZ A;  4DFP A;  3WK9 A;  3H8S A;  4IQV A;  3AQE A;  3WK8 A;  4I2B A;  2EAP A;  5AK4 A;  4LJX A;  2VAN A;  1UHU A;  4TUQ A;  1UT8 A;  1BPD A;  1SWW A;  2L5Y A;  1Z4O A;  5AKL A;  2R8H A;  1ZQC A;  1FFV A;  1NJX A;  2BKE A;  3C5F A;  2ZJ8 A;  2FPL A;  2FMQ A;  3G6V A;  4ECU A;  1S0O A;  1QH9 A;  2EQY A;  1P7D A;  2G5H B;  1QSY A;  1BNO A;  4CCH A;  5T14 A;  2LM1 A;  1CUK A;  2HVI A;  2RQ5 A;  4RQ6 A;  4RUA A;  4JMU A;  4F93 B;  1Z1V A;  2LMR A;  5KFE A;  4O9M A;  4DS5 A;  8ICF A;  3KFU F;  5AI5 A;  4ECY A;  8ICY A;  2HHX A;  8ICK A;  3RB6 A;  1U47 A;  1F0M A;  3CNH A;  1URJ A;  2MRL A;  1A0P A;  4KMO B;  2W8L A;  1NK4 A;  2Y9T A;  2KHQ A;  3IG5 A;  4MEX A;  3IP4 B;  1ZQF A;  4XRH A;  5ALW A;  3ZDB A;  3IN5 A;  5DGA A;  8ICX A;  2ALZ A;  4M9J A;  5JUM A;  5HR7 A;  5HHI A;  7ICO A;  3L3F X;  4O3R A;  1SZH A;  5AKI A;  5KFU A;  3SR6 A;  1DXS A;  3BQT A;  4KIT B;  4F4K A;  2JH7 A;  3N7P D;  4QZB A;  1ECW A;  2NRZ A;  4IQU A;  4B9V A;  1UQV A;  1AQ6 A;  1ZJN A;  9ICR A;  2EAO A;  4UW9 A;  1NK5 A;  9ICL A;  2KIV A;  3PR5 B;  2W43 A;  1HEK A;  5C0Y A;  1J97 A;  4KLJ A;  9ICA A;  3LVV A;  2PMZ F;  4Y2U A;  4KLI A;  5AHX A;  2R8J A;  2QB1 A;  4Q44 A;  2HBL A;  3HW8 A;  9ICN A;  4I2I A;  1PUZ A;  1ZQY A;  4O3N A;  1SXE A;  3WKC A;  2EZZ A;  2WAQ F;  4UB8 U;  3VCB A;  1RG6 A;  3HKZ C;  4F5N A;  3KZI U;  3RH6 A;  2K4E A;  2YML A;  4KLL A;  3MC1 A;  1KN5 A;  2Q0Z X;  4ED2 A;  2CXY A;  3PW2 A;  1NJY A;  1J2M A;  5J0U A;  1TKD A;  3F2B A;  3MFH A;  1LV5 A;  2J6S A;  3QEB Z;  3PSI A;  5EOZ A;  4C8M A;  2A1A A;  4DFK A;  2C2D A;  1SKS A;  2WF5 A;  4YCX A;  2HOI A;  1U49 A;  3OHB A;  1NKB A;  2IOF A;  1Z00 B;  2K8A A;  2IHN A;  5KTQ A;  2KP7 A;  5AM3 A;  2W8K A;  4F50 A;  1X40 A;  3QUQ A;  1WYG A;  5J2G A;  2VA2 A;  2UVU A;  4DF8 A;  4CF5 A;  4YR2 A;  5JRT A;  1D8L A;  5KFQ A;  5F3X B;  5AM5 A;  3PX4 A;  5KT5 A;  3UXP A;  2KOB A;  5J0S A;  1SWV A;  1X9M A;  5IIM A;  1S0M A;  2P6R A;  4UB2 A;  3SEI A;  2UVW A;  1PVP A;  2G08 A;  5AKH A;  4QWA A;  4QIW C;  2LHT A;  2UVV A;  3MGI A;  2G09 A;  2YX8 A;  4I2E A;  3QXG A;  4P0P B;  1KTQ A;  3ZDE A;  2RHF A;  4I27 A;  3V7K A;  2FMP A;  8ICW A;  3H40 A;  3H0R B;  2R8K A;  2KD1 A;  3KZX A;  3EYZ A;  3PW5 A;  4RU9 A;  1XO0 A;  8ICC A;  4TUR A;  5BOL A;  2G07 A;  5DQH A;  2PFP A;  2E1F A;  1QTM A;  5AM2 A;  4EYI B;  2RRD A;  3HRD D;  3PO5 A;  1RZT A;  4XUS A;  2V4R A;  4EX6 A;  3RFA A;  2AH5 A;  4EBC A;  5AI8 A;  1KW4 A;  4PHE A;  4RQ4 A;  4ACO A;  5AM1 A;  4WJ3 B;  2FI1 A;  5KFI A;  4Z6E A;  1Z3E B;  1IM4 A;  2DL0 A;  5EE1 A;  5KFR A;  2F8K A;  3RJE A;  5J0T A;  4UAT A;  1XC9 A;  3IG8 A;  2LPE A;  1RPL A;  5DQG A;  4J9Q A;  8ICI A;  5B5E U;  2AGO A;  5AK3 A;  2ESE A;  4RQN A;  1BVS A;  4MF8 A;  5CA7 A;  4JWN A;  3PY8 A;  4F8R A;  2XIC A;  2F76 X;  5ALN A;  1NK0 A;  7ICE A;  8ICQ A;  3FYH A;  1TK0 A;  2FDR A;  4IC9 A;  2YB1 A;  3NUQ A;  9ICB A;  1UCV A;  1JXE A;  1L3T A;  3Q8M A;  4QZH A;  1T94 A;  3QU9 A;  5D49 A;  4C80 A;  2BCU A;  1BPB A;  4KLH A;  3BZC A;  5FP0 A;  1NK7 A;  5AK5 A;  4PHA A;  3NTU A;  4PHD A;  3ISD A;  4KLE A;  4P4O A;  2G0A A;  4US9 A;  2ATL A;  3JPN A;  4I2A A;  2NO5 A;  4UAR A;  2D6F C;  2D8C A;  2B6G A;  3C28 A;  4UQG A;  4DL5 A;  3RJH A;  2OCE A;  4FS2 A;  2VKQ A;  1ZQI A;  1NKE A;  3ZD9 A;  2DGZ A;  9ICQ A;  2C2E A;  3OPX A;  2FLL A;  2W11 A;  5KFY A;  4PGY A;  3PV8 A;  2DKZ A;  2ZXI A;  2KJ9 A;  5L1M A;  1NOM A;  4DSJ A;  3GIL A;  2NYV A;  3T5L A;  4GLX A;  4PH5 A;  2H3V A; 
#chains in the Genus database with same CATH homology
 2H3I A;  3D2N A;  3PSI A;  1ED1 A;  2CN1 A;  3LVW A;  2HBK A;  3F5A A;  3O0F A;  4QIW F;  1PVR A;  3SQI A;  4ACO A;  3KFU F;  2LKY A;  4OJ6 A;  1KBU A;  1WUD A;  4WJ3 B;  3ONN A;  3MGV A;  2ZIV B;  4CGZ A;  3GZF A;  3PSP A;  2A3V A;  2HOI A;  2VJ5 A;  1MA7 A;  2VJ4 A;  3F2C A;  3SAG A;  1URJ A;  2MRL A;  2ZIU B;  4CRX A;  3M6Z A;  1A0P A;  2K8A A;  4O3M A;  2HOQ A;  2PMZ C;  4KMO B;  2K8C B;  4P0Q A;  1F44 A;  2H3Q A;  4C0Z A;  3IG8 A;  2LYB A;  2KHQ A;  2XI9 A;  2ZG6 A;  3IG5 A;  3H0L B;  4KX5 A;  3IP4 B;  2DF4 B;  2XVT A;  2KV2 A;  3F5E A;  2KIW A;  2F8L A;  3HKZ F;  2OYY A;  3N7R C;  4QNL A;  4P0P A;  2Z7J A;  4AYB F;  3VC8 A;  2F77 X;  3SAH A;  1Z19 A;  3CP8 A;  1TAM A;  3K1Z A;  2H3Z A;  2KNJ A;  2Y0S F;  4PL1 A;  5A0L A;  2JGA A;  3IN5 A;  2ZIX A;  2JMG A;  2W03 A;  2KEY A;  2XIC A;  2WAQ C;  4OO1 J;  2F76 X;  4OJO A;  5KL8 B;  4CDG A;  5HR7 A;  2K8B B;  3PST A;  2Q4T A;  1Q3U A;  3L3F X;  2YB1 A;  2ZIV A;  1SZH A;  3NUQ A;  4IC9 A;  2LYA A;  1UPH A;  2DQN B;  4FE3 A;  2E1E A;  4OJL A;  2KJ5 A;  3SMV A;  2KOB A;  2GH1 A;  1T94 A;  2JH7 A;  4QJF B;  2OM6 A;  3N7P D;  3NRW A;  1ECW A;  4BX9 C;  2WB1 C;  1Z1B A;  1HIW A;  2HBM A;  2JH1 A;  3ALR A;  4OJ5 A;  3CRX A;  2ZIU A;  1A6S A;  2KJ8 A;  3PZP A;  4KX3 A;  4U6P A;  2JHD A;  2E5S A;  2M0N A;  2G0A A;  4U7C A;  1PVP A;  1HEK A;  2YB4 A;  4OJP A;  3D2S A;  3RF9 A;  3C29 A;  3AQE A;  2N1R A;  2H3F A;  2HBJ A;  5C0Y A;  3M6K A;  2G08 A;  2G5I B;  2D6F C;  4ICA A;  4GFJ A;  4QIW C;  3LVV A;  2OH2 A;  2ZIW B;  1ZQ1 C;  2VIX A;  2PMZ F;  2BDU A;  2LHT A;  2W7P A;  2K4I A;  3C28 A;  5CRX A;  2KIC A;  2G09 A;  2YX8 A;  1XNS A;  2F2A B;  2XID A;  4A8E A;  3AL0 B;  2ZXH A;  2KVC A;  4PL2 A;  4P0P B;  4FZM A;  2HBL A;  2RHF A;  1NZB A;  3H0M B;  2G06 A;  5HR6 A;  3H0R B;  2VKQ A;  2HMX A;  2KD1 A;  3KZX A;  1PVQ A;  2HOF A;  4NLC A;  3T79 A;  1L6N A;  2CPR A;  4BJQ A;  2GOL A;  2KHV A;  2DGZ A;  2WAQ F;  5KL1 B;  4BUG A;  3D2Q A;  2W04 A;  2OXO A;  3DEE A;  2K4H A;  1XO0 A;  1IIP A;  3VCB A;  1P7D A;  1GO3 F;  2G5H B;  3HKZ C;  3F2D A;  2CRX A;  2G07 A;  1OUQ A;  4AYB C;  3OPX A;  4NV0 A;  2RP5 A;  1CRX A;  4FZN A;  3N7S C;  1Q3V A;  2E1F A;  2K4E A;  4P0Q B;  2KKV A;  2R18 A;  2Y0S C;  3M7D A;  3E0F A;  2RRD A;  3ICX A;  2LBO A;  3SAF A;  2K89 A;  5T14 A;  2W7O A;  2WB1 F;  2MA1 A;  3GU3 A;  2ZXI A;  2KJ9 A;  2NV3 A;  3AQF A;  2ZIW A;  3F53 A;  4NLB A;  3LYS A;  3PSF A;  3RFA A;  2KKP A;  4FZL A;  3CYM A;  1D8B A;  1YT3 A;  4NWI A;  3F2B A;  2ZIX B;  2H3V A;  1DRG A;  4JMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...