1UPHA

Hiv-1 myristoylated matrix
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Entropic Switch Regulates Myristate Exposure in the HIV-1 Matrix Protein
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (clone 12)
molecule tags Virus/viral protein
molecule keywords GAG POLYPROTEIN
total genus 37
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1uphA00
4ICAA 1HIWA 1ECWA 2H3IA 2H3FA 1ED1A 2HMXA 2K4IA 2LYBA 2H3VA 2H3ZA 1TAMA 4IC9A 2GOLA 2JMGA 2LYAA 2K4HA 1L6NA 2N1RA 1HEKA 2H3QA 2NV3A 1A6SA 4JMUA 1UPHA 2K4EA
chains in the Genus database with same CATH superfamily
3RB0A 5C0YA 2EZXA 4RZRA 4EYIB 1X9WA 4MFFA 5KFHA 3G6VA 3PW4A 2WF8A 4PGXA 1PVPA 1XU4A 2W8KA 5DQGA 4FS1A 5ALZA 1P7DA 3PO4A 7ICTA 1S97A 3RF9A 3LWLA 5ALTA 3UMGA 1KBUA 4JV1A 4QZGA 2F77X 7ICOA 3L3FX 4RT2A 3I1YA 1J2NA 5EE0A 2PFQA 4OJ5A 3H7IA 2LHTA 4R66A 1FFUA 5KG2A 4F4KA 3RH6A 4DSLA 4Y2YA 3UXNA 2XY6A 4GLXA 5FP0A 5DG8A 3OJUA 2BDPA 1QSYA 4C80A 4MF2A 1BNOA 5KAIU 1QQ5A 1ZQOA 4RQ8A 5AI6A 4ELTA 1ZOLA 4I28A 4UQGA 2ZG6A 1JALA 2KJ5A 4TUPA 4TURA 2K4IA 3OHBA 3OSNA 4PL1A 3C2KA 2PFPA 2HHXA 4QIWF 5AKEA 2Y1IA 5DDYA 3OJSA 2KD1A 4RNOA 4YD1A 2W9BA 4QZ8A 1B4FA 5IIOA 2E8OA 4ED3A 1TK5A 3H8MA 3NVVA 4YVZA 3C2MA 2ZTEA 4ECTA 8ICHA 3BQTA 4ECXA 5KT5A 1KKXA 2A1JB 3RJGA 8ICQA 4BX9C 4C7ZA 1ZQNA 8ICIA 1PK1B 2P35A 3LVWA 3V72A 4JMUA 2WF9A 5J0XA 4DQRA 4PPXA 7ICKA 3C2LA 4J03A 1U4BA 5ALWA 3F2BA 2KSOA 4UAWA 1YT3A 2GLEA 3IG8A 5J2JA 5F3XB 4UB2A 4UBCA 5KFAA 3G6YA 1QTMA 1TV9A 2H5XA 1COKA 5KFPA 4PH5A 4Q8EA 5J0PA 2RHFA 3MFHA 3V7LA 3RB3A 3PW7A 2H3FA 2KEYA 3B9JA 4UB1A 2F3NA 2IOFA 2EQYA 4UB4A 2BCVA 4F72A 4M9NA 4ECWA 1HJPA 3TI0A 4I2EA 5J0WA 3TFRA 4O5CA 4F4WA 5DG9A 1KFSA 4KLEA 4JWNA 2M0NA 3OSPA 2R8KA 2HBKA 3MGHA 1ED1A 2HMXA 2BGWA 1RXWA 1ZQYA 2BPGA 3NTUA 1SL0A 4QZFA 3RB4A 4WJ3B 1ZQLA 3BQ2A 3WK5A 5JUMA 2AQ0A 4DCCA 3Q8SB 2VJ4A 5ALXA 2PI5A 4KN7A 5AKGA 1L3VA 1F5SA 1QQ6A 4I2JA 1SKWA 3EW9A 1V85A 4R63A 1TAUA 2IMWP 5ALVA 2ZIXB 3QEAZ 7ICRA 1NJYA 2Y0SF 2HOIA 1ZD5A 2JEFA 4QZEA 1NKEA 2WAQC 2JEJA 1K5OA 2A1JA 3K75D 8ICUA 2ZTCA 4DL5A 3T79A 4E0DA 1XNSA 2UVUA 1SL2A 1D8LA 3G6XA 4GXIA 8ICJA 1Q3VA 4J9RA 1H38A 1PUZA 1PK1A 2BDUA 3KHLA 4I2HA 3BS5A 4QZBA 2KZZA 4GIBA 4O0IA 5KG0A 3NS1A 3C1ZA 1BVSA 5EE9A 4Z6CA 2BPFA 3GQCA 3UQ0A 2K89A 4F71A 4O5EA 2F76X 1RXVA 2BCUA 1F44A 2A19A 2KSOB 4Q44A 1SL1A 1L8LA 2W03A 4NV0A 2YMMA 3TFSA 1RYUA 3ED5A 4YMNA 3AL0B 3ICXA 4OO1J 2W3RA 1DK2A 3JPTA 5EOZA 1JIHA 1NJXA 5HHHA 2CN1A 2XGQA 4DSEA 1X9MA 1N5WA 9ICHA 4K4IA 2XC9A 2GH1A 2KJ8A 3ISCA 4O3NA 4R8UB 1JXEA 2Q4TA 4KLQA 3LWMA 2W9CB 1SWWA 4IC9A 3TANA 2VA8A 1X66A 2KN7A 4YP3A 1L6NA 1Z3EB 4I2BA 4QZIA 3ORYA 4PJ0U 5B66U 2ODGA 1KSPA 2F8KA 3M6ZA 4M9LA 2KZMA 3RFAA 3E2EA 1RM6C 4PHDA 4DQSA 2K8CB 4IR9A 1KLNA 4U6PA 1XS9D 9ICIA 3JPOA 2QKQA 4RQ1A 9ICVA 3KKAA 3PX0A 5EWEA 4DQIA 3GILA 2FPMA 2ASJA 7ICHA 1N2XA 1Z1VA 2KTQA 4USAA 4DO9A 9ICRA 4F93B 2MUTA 5C5JA 2HHUA 1ZQTA 4FBTA 2C28A 5J0UA 3CW2C 3MABA 2VA2A 3GIMA 5K4LA 1NK7A 4P0PB 5IIMA 4QW8A 3DDHA 2ZIUA 1GO3F 4FZNA 1RPLA 3ZDCA 3PR4A 4DWIA 4Y2PA 8ICXA 4ED2A 2KKVA 1S8OA 5KG5A 3AU2A 4DQPA 2Y1JA 4UAYA 3RJFA 3UMCA 1F0MA 3KZIU 4F50A 4F91B 1S0NA 2CXYA 2ZIVB 5J2CA 4GXJA 2W3SA 2J6TA 5KFBA 3N7SC 4I29A 3RH5A 2HSZA 4IRDA 2NV3A 5AIBA 3QNMA 3PNCA 5B5EU 5TISU 5IIJA 1C20A 4OCZA 1L5UA 4B9UA 5KFKA 4KLHA 4CRXA 2JV3A 4FBUA 3RAXA 5J2DA 4IS7A 3PSPA 1T94A 2NRTA 4KLSA 2RP5A 5DLFA 4O3MA 2JH7A 2RDJA 4DL2A 1N48A 4NY8A 4BXOB 2WF6A 4K4GA 1T4GA 2F1HA 9ICMA 2WAQF 4Y2VA 2HI0A 3PX4A 1MC8A 5J2FA 4RQ6A 1ZQSA 4C0ZA 4F2SA 3LK9A 4G3IA 3RBEA 4JV0A 2WB1C 1SV4A 3D2QA 5AHXA 3D6JA 4KTQA 2KIVA 3RJIA 4C8KA 3H4BA 3SV4A 5KT4A 4Y2RA 2KK0A 4F8RA 3N7PD 2B6GA 4UASA 5ALHA 2HCFA 5ALFA 5ALEA 5AM2A 1A76A 4J9OA 2YQEA 2G0AA 3MFIA 3M9OB 4TUQA 2MSNA 4UAZA 5G5HA 4YFKA 4C8MA 4ZOHC 5ALDA 2DKXA 4KMUA 2JHDA 2JZBA 4K4HA 3N28A 2EDUA 4C8NA 3FM9A 1U9LA 4UARA 3CNHA 4GFJA 5KFJA 4QNLA 2FLLA 3V6JA 1KDHA 1ZQPA 2W43A 2BKEA 4DOCA 2K4PA 1U45A 3KTQA 3UXOA 2XCAA 2DQNB 5KTQA 3RH4A 1KFDA 3PY8A 3PW5A 1S5LU 2CRXA 4F2RA 5ALSA 1QLNA 4J9MA 2HW3A 1KW4A 4NLNA 3IDWA 1ZQXA 2DL0A 5KFWA 3KHHA 4KMOB 4M9JA 4EEYA 3OPXA 1J97A 1DOQA 5AI8A 1URJA 3C29A 2NRWA 4LZGA 4O9MA 1FFVA 2FMPA 5IILA 5L1KA 3AM9A 3SV3A 2JRZA 3VCBA 1ZQZA 1VJ5A 1Z00B 3UXPA 5DBAA 4A8EA 5KL1B 3V6HA 1ZQJA 4ICAA 3ISBA 5IIKA 3PSTA 7ICIA 3GU3A 3Q8PB 1T3NA 5IINA 9ICUA 1FEZA 2EAPA 4TQRA 4JV2A 5KFZA 2W9AA 3UMBA 1DK3A 4P4MA 1L3SA 2AXTU 5ALNA 3QU9A 3MBYA 1WCNA 4DOAA 1ZRMA 3R9KA 2P6RA 5KFCA 3SI8A 4F5QA 4DOBA 2ZTDA 2LI6A 3F53A 3ZDDA 3H8WA 5DDMA 4KITB 3RAQA 3BQ7A 2HBJA 7ICVA 4NLCA 2KIWA 1RYSA 2PMZC 4NXZA 3MGVA 2NO5A 2ZUDA 2XICA 7ICPA 3LVVA 2ISOA 2DFLA 5F9NA 1OUQA 8ICBA 4QW9A 2PFNA 1X6JA 4AP9A 3PR5B 4IQVA 2ZXIA 9ICPA 5J0SA 2BHNA 3HPOA 2YMPA 3S6JA 4RU9A 2XO7A 1NJWA 2PFOA 3C23A 5JU5A 2DUYA 3C28A 4P0QA 3CP8A 2W11A 4US9A 1DGJA 5KFYA 8ICLA 4GC7A 1TE2A 4NL9C 1RYRA 2UVRA 1SB3C 7ICSA 1KEJA 1BPYA 4I2CA 5J2KA 4O3QA 4PHAA 3WK4A 5DQHA 4ECQA 5AKYA 5KFIA 5J2EA 2VIXA 5CEHA 2WHEA 3TADC 1PK3A 3MDCA 4IL6U 2EH9A 1K1QA 1ZQBA 3TKAA 2FLPA 5BOMA 3JPPA 4DLEA 3HJEA 8ICTA 4EZ6A 5HP4A 9ICFA 3SZ2A 2QLTA 9ICXA 4QWDA 1C7YA 3E58A 3ZD9A 1U49A 8ICAA 3MGIA 2BR0A 4CDGA 2JEGA 2QB1A 4YD2A 1B0XA 2AH5A 3Q8KA 5CWRA 5DB9A 3M9MB 4CF5A 4Z6EA 4M47A 2H3QA 1BPXA 3TQ1A 1XO1A 2XGPA 3QZ7A 2D3DA 3WKAA 1BGXT 5EE3A 4FO6A 4DL3A 3IV6A 1ZQDA 4F4YA 2FI1A 9ICQA 4FZLA 1RQNA 3Q8MA 4JWMA 1X9XA 3RJEA 3SD7A 2YB1A 2F8LA 2Z7JA 3QUQA 3B0YA 1T3QA 3MC1A 5T14A 2KVCA 8ICRA 4P0PA 3PMNA 4O3OA 3AMZA 2ZIWB 1CI4A 4NLZA 3H8JA 5HMMA 4Y2JA 1ZJNA 1HUOA 3ETLA 5AI0A 1Q3UA 9ICNA 2RLTA 1L7NA 2E8PA 4LJXA 3KHRA 5L1IA 2OYYA 3QX7A 3MR6A 4Y2SA 4I2FA 4IQWA 3IN5A 3GV8B 3JPSA 4PHEA 3BDPA 3K4GA 4NM1A 4XA5A 4DEZA 4EZ9A 1KL9A 2G08A 2WF5A 2ALZA 4DL4A 5KT6A 2I1QA 5KG4A 2YX8A 2G09A 8ICWA 3HILA 4NLGA 3F2DA 3D2SA 1DGSA 2W04A 2JXJA 4P2HA 5KFXA 1XO0A 2P66A 5EE1A 4KLLA 2W8LA 5KFNA 2CPRA 4YG2A 3WK7A 3IP4B 1V38A 4QWCA 1VDVA 1T7PA 5J0RA 3GFKB 5DB6A 4M04A 3HT3A 2LM1A 4F4XA 5L1JA 3T3FA 2HHSA 4Y2QA 2HHWA 3MR3A 4R65A 4B9VA 1B43A 2KFZA 3RRHA 4KLTA 2QARB 5L1LA 1QSSA 2XY5A 2PI4A 1DRGA 5CR0A 4J9KA 3IRUA 3T5JA 2XCPA 8ICNA 4YN4A 2F1JA 1SV0C 5ALYA 4QWBA 4O3SA 3N7RC 3M8RA 2ZUCA 1S10A 4QWAA 9ICKA 7ICQA 9ICCA 5HR7A 4Q43A 1T8EA 4ED8A 5KFSA 4BJQA 5J8YA 4US8A 1COOA 1X2IA 2EANA 3TARA 5KFUA 5DQIA 2YN4A 5H2FU 5DB8A 3DEEA 3WKEA 1ZQMA 4QZ9A 3NVYA 1SWVA 2G06A 4UAUA 1TK0A 2HBMA 2AJQA 2GO7A 1S0MA 1ZQFA 1NNLA 2JGAA 4M0AA 2KMDA 3QU2A 4EX6A 5DBBA 2ZJAA 2V4QA 5GTIU 1Z00A 4KN4A 1HEKA 1O03A 2ZIUB 7ICJA 2W7OA 2G5HB 7ICLA 4JUZA 4BWMA 1ECWA 2FMQA 5AKIA 3RBDA 5CJ7A 4C4SA 3HW8A 1U47A 5KG6A 1S0OA 1ZYQA 2ZJ8A 2LMRA 3SAHA 3SQIA 8ICOA 1NK5A 4QZDA 2IOFK 5J2IA 3BQ1A 4F5OA 2YB4A 5D49A 2WB1F 1UT5A 8ICPA 4UB5A 3U26A 5KT2A 2MU2A 4UB8U 1KTQA 2LYBA 1N60A 3N97B 8ICFA 3SAFA 2V4RA 2V9WA 2F2AB 2FJ6A 4Q8FA 4EENA 2MRLA 5HNKA 3SAGA 1FO4A 4B6JA 4IQTA 4I27A 3DV9A 4F5RA 3VC8A 8ICMA 2BQUA 2FMSA 1V9PA 2JZBB 2LBOA 3GZFA 3GIKA 2NRVA 5D4BA 5AM1A 2XVTA 1A77A 2C2DA 3J81j 4U7CA 3PO5A 4PZOA 2YY6A 5ALQA 2BPCA 2XI9A 5HMLA 4XRHA 3THVA 3RJHA 5KFEA 2KKPA 1A6SA 2VKQA 5CRXA 1SXDA 4NLBA 3EUB2 4RPYA 1SZPA 3I28A 4BWJA 1LVHA 1MN8A 3M1YA 7ICEA 2R18A 2KV2A 4KLIA 1DXSA 3BJYA 3ONNA 4B9NA 3WK9A 1OXJA 1JN3A 1X40A 2EZYA 1RG6A 1N5XA 4IRCA 3GV5B 4MFAA 3IM1A 3V7KA 4ED7A 2H3VA 2HVHA 1ZQHA 2AGOA 4RUCA 5KG7A 3FAHA 1TFRA 3HKZF 5KFDA 4DFMA 1L7MA 4DL7A 1UA0A 9ICSA 9ICGA 3Q8QB 4O5KA 3BZCA 1N63A 1IM4A 5KL8B 8ICEA 2QB0A 3E0FA 1WG8A 4B9TA 3QU5A 3ISDA 1D8BA 4NWIA 1UHUA 1ZXIA 5ALIA 2HOFA 1QQ7A 9ICBA 5AM0A 2VJ5A 3AQFA 1UCVA 2RRDA 3RR8A 5AI4A 3HP6A 4J9NA 1X9SA 4M2YA 5KAFU 1ZETA 1NOMA 5KFQA 2ESEA 2E1EA 1QCKA 5IIIA 5CHGA 4DSKA 5AKJA 3SYZA 3F5AA 4BXOA 4KLFA 8ICKA 3ZDEA 2HOQA 3KD3A 3NASA 1S77D 3QYPA 3HRDD 5ALOA 1MQ2A 5AIAA 3C21A 4OJLA 3WKBA 3FC4A 5AK5A 3QUTA 1AROP 3KHGA 3HX0A 2KOBA 4ELUA 2Y9TA 4RNMA 5KFVA 4AYBF 2ISPA 2OCEA 3O0FA 4BDPA 2G5IB 5AKKA 4CF4A 5CA7A 3SR6A 1ZQCA 4RQ7A 2AGQA 4NJ8A 1ZQIA 1EXNA 5CP2A 2LKYA 5E79U 1IIPA 1X6IA 4RPZA 2IOHA 2HHVA 4Y2XA 3PX6A 2KHVA 4KLOA 3H8SA 4JK1A 4UB3A 2AGPA 4ELVA 1WYGA 2PXIA 4QWEA 4EBEA 5L9XA 2Y0SC 3B0XA 2H3ZA 4M9GA 1Z19A 3ZI4A 3SENA 2B0CA 4YR3A 4RQ4A 1ZQVA 4EBCA 3F5EA 4I2DA 2YMQA 4NL9A 4IRKA 7ICFA 3M6KA 5KFRA 2E8NA 1Q8KA 1ZQQA 3UM9A 1SIJA 3PW2A 1KN5A 2ZUBA 4YXJA 4QJFB 5D46A 2BZFA 5ALUA 5DB7A 4F3OA 8ICZA 3ZDBA 3KKAC 2KNJA 2JMGA 1L3TA 4I2IA 3EYZA 3KOOA 5ALPA 2KJ9A 3AU6A 5KFGA 2ZXHA 4KLDA 1ZD4A 4KX5A 3RJKA 4F92B 5J0TA 2ASDA 4BGDA 2M9NA 4O3RA 3RRGA 1K1SA 2I6XA 1NK9A 2I9GA 4FS2A 5J0OA 5BOLA 4DS5A 2GOLA 5AM3A 3MR2A 2LYAA 2K60A 1ZQAA 5G5GA 8ICYA 2AQ4A 4DSJA 2ZIWA 4UBBA 4FZMA 4RPXA 4ED0A 3UQ2A 1D9FA 2FDRA 3V6KA 1PVQA 4YR0A 5A0LA 5AM4A 4C4TA 2DPIA 2C2EA 3QE9Y 3NGDA 2W9BB 1PVRA 3NUQA 3TACB 4BUGA 3TADA 2QARA 5ALRA 5AI5A 2R8HA 1SGGA 9ICLA 2QB0B 4CE6A 2LPEA 5AK3A 2FPKA 3TAQA 2HDOA 5EWFA 3NVWA 2OEHA 3KBBA 1BNPA 1XWLA 5DKWA 2AU0A 1N61A 5GTHU 2W7PA 1TVAA 3SEIA 2LYHA 3PW0A 3EWAA 2H3IA 2G07A 2R8GA 2NYVA 2EAOA 2OHFA 4QZAA 1BPZA 2IHNA 4I2GA 3M7DA 2IA6A 1ZQGA 2LM4A 2KICA 1IG6A 2W55A 4OJPA 2J6UA 2R8JA 1BPEA 4DFDA 4HYKA 3OTQA 2WF7A 3K1ZA 4Z6DA 5KFMA 4ZH4A 4ECYA 1CRXA 4ECRA 4CGZA 3ZD8A 5J2AA 5J2BA 1J2MA 4MEYA 2D6FC 4B9SA 9ICJA 1RDFA 3QUBA 1ZJMA 1D9DA 2Y9UA 1O08A 1QH9A 2MAXA 2AHOB 2XIDA 2OWOA 1TKDA 8ICGA 1L7PA 4OJ6A 1WWUA 5AKZA 1SXEA 1CUKA 3HWTA 4MHVA 3A0HU 4EEKA 4DFJA 3QEBZ 5KFLA 1N62A 2FE9A 4M6WA 4DS4A 1OW5A 1IXRA 1WWVA 3H40A 5J2GA 9ICTA 2DKZA 1BPDA 5HHIA 4Q45A 4Z6FA 2YMLA 2ES6A 4YXMA 1HIWA 2W54A 3JPNA 3QXGA 4UB6U 4YQWA 5ALKA 1XSLA 3BS7A 4DSFA 4MEXA 1Q46A 3OHAA 3GIIA 2OXOA 2HBLA 2KVSA 1ZQUA 3QZ8A 4RQ3A 4C7YA 2MA1A 2NRZA 2DPJA 3A0BU 2RDIA 1NKBA 4DFKA 2DF4B 4F5NA 3EPGA 4KLJA 3RJJA 4DF8A 5TZVA 1Z4NA 5AICA 3H4DA 2R8IA 4F5PA 4DF4A 2EAMA 2DGZA 2ZIVA 1SV0A 5HR6A 2I5HA 2MUTB 2XY7A 4PL2A 2P6UA 4C8LA 4CF3A 2ZJ5A 3TAPA 5JTIA 3RB6A 1ZQEA 1Z4OA 1L7OA 1D8YA 2JEIA 1NK0A 3C5FA 4ED1A 2BCRA 8ICSA 3AUOA 9ICEA 3H0MB 3V7JA 1Y88A 3NRWA 3NRZA 3EZ5A 4DSIA 5AM5A 1TAMA 2KG5A 5ALLA 2BCQA 3RR7A 4GXKA 5KT3A 2ATLA 1UT8A 2WTFA 4IQUA 1NKCA 5KFOA 3PV8A 4B9LA 1UPHA 1HUZA 1ZQWA 4F4ZA 5BPCA 1WCLA 1ZRNA 4AYBC 4LVSA 4P0QB 3AN1A 1BPBA 2E5SA 3AQEA 2O6KA 2EZZA 4QIWC 4EELA 1RZTA 4X5VA 1B22A 2IBKA 4Y2UA 2OH2A 2UVVA 7ICMA 3ALRA 3JPQA 4YMMA 4IR1A 3IHQB 4TQSA 1TAQA 1JUDA 3IG5A 2HHTA 2IHMA 5J29A 1S9FA 3Q8RB 1YZ7A 2JH1A 1ZQKA 1MQ3A 2E1FA 4C8OA 7ICUA 4P4OA 5KNIA 5AKLA 1UA1A 3HKZC 1CEZA 2A1AA 4J9QA 5KG3A 4KLMA 1A0PA 4C4RA 4KLUA 1FIQA 1NK4A 1UQVA 1JRPA 2FPLA 7ICGA 1XSPA 3PVXA 4Y2TA 3F2CA 4FFDA 5ALGA 4MF8A 3FYHA 2DBYA 1Z1BA 2PKEA 3L5KA 1QSLA 9ICWA 4PHPA 3T5HA 4CCHA 2KZ3A 2PMZF 4ED6A 3ETRA 4ECUA 4GC6A 2NRXA 3EPIA 2W9MA 3PMLA 2FLNA 4PGYA 1NJZA 4PGQA 3KZXA 2RQ5A 4OD0A 3GIJA 4EX7A 3C1YA 4TUSA 3QUCA 3Q8LA 1NK8A 1LV5A 1TK8A 3LYSA 4J9PA 2KP7A 5KT7A 2K4HA 3CRXA 3LDAA 4M9HA 5L1MA 4DLGA 1M6YA 4NM2A 3T5KA 2B21A 4KLGA 1YZ6A 3H0LB 5DG7A 5J0QA 4ECZA 4OJOA 4DFPA 2BQRA 2W9CA 2A3VA 2E8MA 1LKYA 1N56A 1JI7A 4R8UA 4RQ2A 3AEVA 5J8YC 2K8BB 2D8CA 2DWQA 4B9MA 3BZKA 3K1RB 8ICCA 2WFAA 4HAIA 3ZDAA 4EYHB 1KQQA 2F1IA 3QU7A 5EWGA 4LZDA 4O3PA 4MFCA 3CYMA 4YCXA 1AQ6A 4RNNA 3NVZA 2L5YA 4QZHA 4I2AA 3H0RB 1SZHA 1VLBA 1WUDA 2YTUA 2C2RA 5ALMA 9ICAA 3WK6A 1JROA 1XSNA 3BS5B 5F9LA 2HVIA 1JMSA 4YR2A 2N1RA 1IV8A 1SKRA 2OM6A 3BQ0A 2HHQA 4ECVA 3PZPA 2GWSA 4RT3A 4JB3A 1NZBA 2E3TA 3WK8A 5AKXA 4UW9A 2BQ3A 4DL6A 4J9SA 1ZD2P 3WU2U 2JR5A 4EBDA 2C22A 8ICVA 4NLKA 4M6WB 1NZPA 1LKYB 3QU4A 2ZIXA 2K8AA 5DGBA 4FE3A 1S76D 4G9BA 1MA7A 3SMVA 1KRPA 1JXLA 1L8OA 3M9NB 5DGAA 1MSWD 3L4PA 4RQ5A 2VA3A 4RQMA 5AK6A 5ALJA 3UPQA 4DQQA 5DBCA 2UVWA 4UAVA 4RQNA 4KX3A 5CB1A 1X42A 4YMOA 5J0YA 2J6SA 2BCSA 2K4EA 5KFFA 2NO4A 3PSFA 1ZQRA 1NI3A 3WKCA 2VANA 1RQLA 3N4MB 4QZCA 3FDSA 3T5LA 4PZNA 1L3UA 1KFTA 3I76A 1JX4A 1XC9A 3MDAA 1PZNA 1U48A 4ECSA 1ZD3A 1ZQ1C 5AK4A 3D2NA 2ASLA 9ICOA 5KFTA 3RTVA 2Q0ZX 4XUSA 4ACOA 4UATA 5DLGA 4RQ0A 5KG1A 7ICNA 3WKDA 4CNQA 3M8SA 3JPRA 4J9LA 1SKSA 4R64A 3GDXA 2KFNA 3KFUF 2KE7A 4XQ8A 1S0VA 2F44A 4RUAA 1LB2B 3MR5A 1NK6A 5J2HA 1V97A 3PSIA 3OGUA 2KHQA 5AI9A 5JRTA 3GV7B 4P4PA 3C5GA 5AKHA
chains in the Genus database with same CATH topology
4KX5A 3OPXA 1CRXA 2ZXIA 3T79A 3PZPA 1XNSA 2LBOA 5C0YA 4P0PA 3GZFA 4CGZA 2WAQF 1NZBA 2ZIWB 3KZXA 3H0MB 2XVTA 1Q3VA 3NRWA 3C28A 2E1EA 2D6FC 3N7RC 4P0QA 4C0ZA 3F2BA 1PVPA 1YT3A 2BDUA 3CP8A 1URJA 3C29A 3IG8A 4U7CA 1P7DA 2WB1C 3F5AA 1TAMA 5HR7A 3D2QA 2XI9A 3LYSA 2HOQA 2GOLA 4BJQA 2XIDA 2LYAA 2K4HA 3RF9A 1Q3UA 3VCBA 3CRXA 2KKPA 1A6SA 2VKQA 4OJ6A 1KBUA 2OYYA 2ZIXA 4OJLA 1UPHA 2K8AA 4A8EA 2K89A 5KL1B 5CRXA 2F77X 4P0PB 3L3FX 3IN5A 4FE3A 4ICAA 4NLBA 2F76X 2ZIWA 4OJ5A 1MA7A 3DEEA 2KOBA 2LHTA 2RHFA 3N7PD 3PSTA 4FZMA 3SMVA 2ZIUA 4AYBC 1F44A 2H3FA 4P0QB 2KEYA 3H0LB 4AYBF 2R18A 2W03A 3GU3A 3O0FA 4NV0A 1GO3F 4FZNA 2G08A 2KV2A 2G06A 2VIXA 2E5SA 2HBMA 3AQEA 4QIWC 1PVQA 2G5IB 2JGAA 4OJOA 5A0LA 3AL0B 2A3VA 3ICXA 4OO1J 3ONNA 4KX3A 2YX8A 2LKYA 2KKVA 1HEKA 1IIPA 2OH2A 2G0AA 1PVRA 2ZIUB 3NUQA 2K4EA 3PSFA 4BUGA 2K8BB 3ALRA 2G09A 2CN1A 2W7OA 2G5HB 2KHVA 2M0NA 1HIWA 3IG5A 1ECWA 2GH1A 3F2DA 2HBKA 2W04A 3D2SA 2KJ8A 1ED1A 2HMXA 2ZG6A 2KJ5A 4CDGA 2JH1A 2K4IA 2JHDA 2E1FA 4WJ3B 2Q4TA 2Y0SC 2ZIVB 3SAHA 2OXOA 4PL1A 1XO0A 2H3VA 2H3ZA 2HBLA 3F53A 4QIWF 3SQIA 1Z19A 4IC9A 2CPRA 3N7SC 3IP4B 1ZQ1C 3HKZC 2KD1A 1L6NA 3D2NA 3HKZF 1A0PA 2H3QA 2MA1A 3CYMA 2NV3A 4GFJA 2VJ4A 3F5EA 4QNLA 2HBJA 2W7PA 2DF4B 2YB4A 4ACOA 3M6KA 2WB1F 5KL8B 3F2CA 4NLCA 2KIWA 2H3IA 3H0RB 2PMZC 1SZHA 3E0FA 2G07A 3M6ZA 4QJFB 4CRXA 2ZIXB 1Z1BA 1WUDA 3RFAA 3MGVA 2DGZA 3PSPA 1T94A 2ZIVA 2XICA 2LYBA 3KFUF 4NWIA 2DQNB 5HR6A 1D8BA 4BX9C 3LVVA 3M7DA 2HOFA 3SAFA 2KICA 2Y0SF 4PL2A 2K8CB 2VJ5A 2HOIA 2F2AB 4FZLA 1OUQA 4U6PA 2KNJA 2RP5A 2JMGA 2RRDA 3AQFA 4OJPA 2CRXA 2PMZF 2MRLA 2YB1A 4O3MA 2N1RA 3PSIA 2F8LA 2JH7A 3LVWA 2Z7JA 2KJ9A 3SAGA 1DRGA 2KHQA 2WAQC 3K1ZA 4JMUA 2OM6A 5T14A 2ZXHA 3VC8A 4KMOB 2KVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ICA A;  1HIW A;  1ECW A;  2H3I A;  2H3F A;  1ED1 A;  2HMX A;  2K4I A;  2LYB A;  2H3V A;  2H3Z A;  1TAM A;  4IC9 A;  2GOL A;  2JMG A;  2LYA A;  2K4H A;  1L6N A;  2N1R A;  1HEK A;  2H3Q A;  2NV3 A;  1A6S A;  4JMU A;  1UPH A;  2K4E A; 
#chains in the Genus database with same CATH topology
 3RB0 A;  5C0Y A;  2EZX A;  4RZR A;  4EYI B;  1X9W A;  4MFF A;  5KFH A;  3G6V A;  3PW4 A;  2WF8 A;  4PGX A;  1PVP A;  1XU4 A;  2W8K A;  5DQG A;  4FS1 A;  5ALZ A;  1P7D A;  3PO4 A;  7ICT A;  1S97 A;  3RF9 A;  3LWL A;  5ALT A;  3UMG A;  1KBU A;  4JV1 A;  4QZG A;  2F77 X;  7ICO A;  3L3F X;  4RT2 A;  3I1Y A;  1J2N A;  5EE0 A;  2PFQ A;  4OJ5 A;  3H7I A;  2LHT A;  4R66 A;  1FFU A;  5KG2 A;  4F4K A;  3RH6 A;  4DSL A;  4Y2Y A;  3UXN A;  2XY6 A;  4GLX A;  5FP0 A;  5DG8 A;  3OJU A;  2BDP A;  1QSY A;  4C80 A;  4MF2 A;  1BNO A;  5KAI U;  1QQ5 A;  1ZQO A;  4RQ8 A;  5AI6 A;  4ELT A;  1ZOL A;  4I28 A;  4UQG A;  2ZG6 A;  1JAL A;  2KJ5 A;  4TUP A;  4TUR A;  2K4I A;  3OHB A;  3OSN A;  4PL1 A;  3C2K A;  2PFP A;  2HHX A;  4QIW F;  5AKE A;  2Y1I A;  5DDY A;  3OJS A;  2KD1 A;  4RNO A;  4YD1 A;  2W9B A;  4QZ8 A;  1B4F A;  5IIO A;  2E8O A;  4ED3 A;  1TK5 A;  3H8M A;  3NVV A;  4YVZ A;  3C2M A;  2ZTE A;  4ECT A;  8ICH A;  3BQT A;  4ECX A;  5KT5 A;  1KKX A;  2A1J B;  3RJG A;  8ICQ A;  4BX9 C;  4C7Z A;  1ZQN A;  8ICI A;  1PK1 B;  2P35 A;  3LVW A;  3V72 A;  4JMU A;  2WF9 A;  5J0X A;  4DQR A;  4PPX A;  7ICK A;  3C2L A;  4J03 A;  1U4B A;  5ALW A;  3F2B A;  2KSO A;  4UAW A;  1YT3 A;  2GLE A;  3IG8 A;  5J2J A;  5F3X B;  4UB2 A;  4UBC A;  5KFA A;  3G6Y A;  1QTM A;  1TV9 A;  2H5X A;  1COK A;  5KFP A;  4PH5 A;  4Q8E A;  5J0P A;  2RHF A;  3MFH A;  3V7L A;  3RB3 A;  3PW7 A;  2H3F A;  2KEY A;  3B9J A;  4UB1 A;  2F3N A;  2IOF A;  2EQY A;  4UB4 A;  2BCV A;  4F72 A;  4M9N A;  4ECW A;  1HJP A;  3TI0 A;  4I2E A;  5J0W A;  3TFR A;  4O5C A;  4F4W A;  5DG9 A;  1KFS A;  4KLE A;  4JWN A;  2M0N A;  3OSP A;  2R8K A;  2HBK A;  3MGH A;  1ED1 A;  2HMX A;  2BGW A;  1RXW A;  1ZQY A;  2BPG A;  3NTU A;  1SL0 A;  4QZF A;  3RB4 A;  4WJ3 B;  1ZQL A;  3BQ2 A;  3WK5 A;  5JUM A;  2AQ0 A;  4DCC A;  3Q8S B;  2VJ4 A;  5ALX A;  2PI5 A;  4KN7 A;  5AKG A;  1L3V A;  1F5S A;  1QQ6 A;  4I2J A;  1SKW A;  3EW9 A;  1V85 A;  4R63 A;  1TAU A;  2IMW P;  5ALV A;  2ZIX B;  3QEA Z;  7ICR A;  1NJY A;  2Y0S F;  2HOI A;  1ZD5 A;  2JEF A;  4QZE A;  1NKE A;  2WAQ C;  2JEJ A;  1K5O A;  2A1J A;  3K75 D;  8ICU A;  2ZTC A;  4DL5 A;  3T79 A;  4E0D A;  1XNS A;  2UVU A;  1SL2 A;  1D8L A;  3G6X A;  4GXI A;  8ICJ A;  1Q3V A;  4J9R A;  1H38 A;  1PUZ A;  1PK1 A;  2BDU A;  3KHL A;  4I2H A;  3BS5 A;  4QZB A;  2KZZ A;  4GIB A;  4O0I A;  5KG0 A;  3NS1 A;  3C1Z A;  1BVS A;  5EE9 A;  4Z6C A;  2BPF A;  3GQC A;  3UQ0 A;  2K89 A;  4F71 A;  4O5E A;  2F76 X;  1RXV A;  2BCU A;  1F44 A;  2A19 A;  2KSO B;  4Q44 A;  1SL1 A;  1L8L A;  2W03 A;  4NV0 A;  2YMM A;  3TFS A;  1RYU A;  3ED5 A;  4YMN A;  3AL0 B;  3ICX A;  4OO1 J;  2W3R A;  1DK2 A;  3JPT A;  5EOZ A;  1JIH A;  1NJX A;  5HHH A;  2CN1 A;  2XGQ A;  4DSE A;  1X9M A;  1N5W A;  9ICH A;  4K4I A;  2XC9 A;  2GH1 A;  2KJ8 A;  3ISC A;  4O3N A;  4R8U B;  1JXE A;  2Q4T A;  4KLQ A;  3LWM A;  2W9C B;  1SWW A;  4IC9 A;  3TAN A;  2VA8 A;  1X66 A;  2KN7 A;  4YP3 A;  1L6N A;  1Z3E B;  4I2B A;  4QZI A;  3ORY A;  4PJ0 U;  5B66 U;  2ODG A;  1KSP A;  2F8K A;  3M6Z A;  4M9L A;  2KZM A;  3RFA A;  3E2E A;  1RM6 C;  4PHD A;  4DQS A;  2K8C B;  4IR9 A;  1KLN A;  4U6P A;  1XS9 D;  9ICI A;  3JPO A;  2QKQ A;  4RQ1 A;  9ICV A;  3KKA A;  3PX0 A;  5EWE A;  4DQI A;  3GIL A;  2FPM A;  2ASJ A;  7ICH A;  1N2X A;  1Z1V A;  2KTQ A;  4USA A;  4DO9 A;  9ICR A;  4F93 B;  2MUT A;  5C5J A;  2HHU A;  1ZQT A;  4FBT A;  2C28 A;  5J0U A;  3CW2 C;  3MAB A;  2VA2 A;  3GIM A;  5K4L A;  1NK7 A;  4P0P B;  5IIM A;  4QW8 A;  3DDH A;  2ZIU A;  1GO3 F;  4FZN A;  1RPL A;  3ZDC A;  3PR4 A;  4DWI A;  4Y2P A;  8ICX A;  4ED2 A;  2KKV A;  1S8O A;  5KG5 A;  3AU2 A;  4DQP A;  2Y1J A;  4UAY A;  3RJF A;  3UMC A;  1F0M A;  3KZI U;  4F50 A;  4F91 B;  1S0N A;  2CXY A;  2ZIV B;  5J2C A;  4GXJ A;  2W3S A;  2J6T A;  5KFB A;  3N7S C;  4I29 A;  3RH5 A;  2HSZ A;  4IRD A;  2NV3 A;  5AIB A;  3QNM A;  3PNC A;  5B5E U;  5TIS U;  5IIJ A;  1C20 A;  4OCZ A;  1L5U A;  4B9U A;  5KFK A;  4KLH A;  4CRX A;  2JV3 A;  4FBU A;  3RAX A;  5J2D A;  4IS7 A;  3PSP A;  1T94 A;  2NRT A;  4KLS A;  2RP5 A;  5DLF A;  4O3M A;  2JH7 A;  2RDJ A;  4DL2 A;  1N48 A;  4NY8 A;  4BXO B;  2WF6 A;  4K4G A;  1T4G A;  2F1H A;  9ICM A;  2WAQ F;  4Y2V A;  2HI0 A;  3PX4 A;  1MC8 A;  5J2F A;  4RQ6 A;  1ZQS A;  4C0Z A;  4F2S A;  3LK9 A;  4G3I A;  3RBE A;  4JV0 A;  2WB1 C;  1SV4 A;  3D2Q A;  5AHX A;  3D6J A;  4KTQ A;  2KIV A;  3RJI A;  4C8K A;  3H4B A;  3SV4 A;  5KT4 A;  4Y2R A;  2KK0 A;  4F8R A;  3N7P D;  2B6G A;  4UAS A;  5ALH A;  2HCF A;  5ALF A;  5ALE A;  5AM2 A;  1A76 A;  4J9O A;  2YQE A;  2G0A A;  3MFI A;  3M9O B;  4TUQ A;  2MSN A;  4UAZ A;  5G5H A;  4YFK A;  4C8M A;  4ZOH C;  5ALD A;  2DKX A;  4KMU A;  2JHD A;  2JZB A;  4K4H A;  3N28 A;  2EDU A;  4C8N A;  3FM9 A;  1U9L A;  4UAR A;  3CNH A;  4GFJ A;  5KFJ A;  4QNL A;  2FLL A;  3V6J A;  1KDH A;  1ZQP A;  2W43 A;  2BKE A;  4DOC A;  2K4P A;  1U45 A;  3KTQ A;  3UXO A;  2XCA A;  2DQN B;  5KTQ A;  3RH4 A;  1KFD A;  3PY8 A;  3PW5 A;  1S5L U;  2CRX A;  4F2R A;  5ALS A;  1QLN A;  4J9M A;  2HW3 A;  1KW4 A;  4NLN A;  3IDW A;  1ZQX A;  2DL0 A;  5KFW A;  3KHH A;  4KMO B;  4M9J A;  4EEY A;  3OPX A;  1J97 A;  1DOQ A;  5AI8 A;  1URJ A;  3C29 A;  2NRW A;  4LZG A;  4O9M A;  1FFV A;  2FMP A;  5IIL A;  5L1K A;  3AM9 A;  3SV3 A;  2JRZ A;  3VCB A;  1ZQZ A;  1VJ5 A;  1Z00 B;  3UXP A;  5DBA A;  4A8E A;  5KL1 B;  3V6H A;  1ZQJ A;  4ICA A;  3ISB A;  5IIK A;  3PST A;  7ICI A;  3GU3 A;  3Q8P B;  1T3N A;  5IIN A;  9ICU A;  1FEZ A;  2EAP A;  4TQR A;  4JV2 A;  5KFZ A;  2W9A A;  3UMB A;  1DK3 A;  4P4M A;  1L3S A;  2AXT U;  5ALN A;  3QU9 A;  3MBY A;  1WCN A;  4DOA A;  1ZRM A;  3R9K A;  2P6R A;  5KFC A;  3SI8 A;  4F5Q A;  4DOB A;  2ZTD A;  2LI6 A;  3F53 A;  3ZDD A;  3H8W A;  5DDM A;  4KIT B;  3RAQ A;  3BQ7 A;  2HBJ A;  7ICV A;  4NLC A;  2KIW A;  1RYS A;  2PMZ C;  4NXZ A;  3MGV A;  2NO5 A;  2ZUD A;  2XIC A;  7ICP A;  3LVV A;  2ISO A;  2DFL A;  5F9N A;  1OUQ A;  8ICB A;  4QW9 A;  2PFN A;  1X6J A;  4AP9 A;  3PR5 B;  4IQV A;  2ZXI A;  9ICP A;  5J0S A;  2BHN A;  3HPO A;  2YMP A;  3S6J A;  4RU9 A;  2XO7 A;  1NJW A;  2PFO A;  3C23 A;  5JU5 A;  2DUY A;  3C28 A;  4P0Q A;  3CP8 A;  2W11 A;  4US9 A;  1DGJ A;  5KFY A;  8ICL A;  4GC7 A;  1TE2 A;  4NL9 C;  1RYR A;  2UVR A;  1SB3 C;  7ICS A;  1KEJ A;  1BPY A;  4I2C A;  5J2K A;  4O3Q A;  4PHA A;  3WK4 A;  5DQH A;  4ECQ A;  5AKY A;  5KFI A;  5J2E A;  2VIX A;  5CEH A;  2WHE A;  3TAD C;  1PK3 A;  3MDC A;  4IL6 U;  2EH9 A;  1K1Q A;  1ZQB A;  3TKA A;  2FLP A;  5BOM A;  3JPP A;  4DLE A;  3HJE A;  8ICT A;  4EZ6 A;  5HP4 A;  9ICF A;  3SZ2 A;  2QLT A;  9ICX A;  4QWD A;  1C7Y A;  3E58 A;  3ZD9 A;  1U49 A;  8ICA A;  3MGI A;  2BR0 A;  4CDG A;  2JEG A;  2QB1 A;  4YD2 A;  1B0X A;  2AH5 A;  3Q8K A;  5CWR A;  5DB9 A;  3M9M B;  4CF5 A;  4Z6E A;  4M47 A;  2H3Q A;  1BPX A;  3TQ1 A;  1XO1 A;  2XGP A;  3QZ7 A;  2D3D A;  3WKA A;  1BGX T;  5EE3 A;  4FO6 A;  4DL3 A;  3IV6 A;  1ZQD A;  4F4Y A;  2FI1 A;  9ICQ A;  4FZL A;  1RQN A;  3Q8M A;  4JWM A;  1X9X A;  3RJE A;  3SD7 A;  2YB1 A;  2F8L A;  2Z7J A;  3QUQ A;  3B0Y A;  1T3Q A;  3MC1 A;  5T14 A;  2KVC A;  8ICR A;  4P0P A;  3PMN A;  4O3O A;  3AMZ A;  2ZIW B;  1CI4 A;  4NLZ A;  3H8J A;  5HMM A;  4Y2J A;  1ZJN A;  1HUO A;  3ETL A;  5AI0 A;  1Q3U A;  9ICN A;  2RLT A;  1L7N A;  2E8P A;  4LJX A;  3KHR A;  5L1I A;  2OYY A;  3QX7 A;  3MR6 A;  4Y2S A;  4I2F A;  4IQW A;  3IN5 A;  3GV8 B;  3JPS A;  4PHE A;  3BDP A;  3K4G A;  4NM1 A;  4XA5 A;  4DEZ A;  4EZ9 A;  1KL9 A;  2G08 A;  2WF5 A;  2ALZ A;  4DL4 A;  5KT6 A;  2I1Q A;  5KG4 A;  2YX8 A;  2G09 A;  8ICW A;  3HIL A;  4NLG A;  3F2D A;  3D2S A;  1DGS A;  2W04 A;  2JXJ A;  4P2H A;  5KFX A;  1XO0 A;  2P66 A;  5EE1 A;  4KLL A;  2W8L A;  5KFN A;  2CPR A;  4YG2 A;  3WK7 A;  3IP4 B;  1V38 A;  4QWC A;  1VDV A;  1T7P A;  5J0R A;  3GFK B;  5DB6 A;  4M04 A;  3HT3 A;  2LM1 A;  4F4X A;  5L1J A;  3T3F A;  2HHS A;  4Y2Q A;  2HHW A;  3MR3 A;  4R65 A;  4B9V A;  1B43 A;  2KFZ A;  3RRH A;  4KLT A;  2QAR B;  5L1L A;  1QSS A;  2XY5 A;  2PI4 A;  1DRG A;  5CR0 A;  4J9K A;  3IRU A;  3T5J A;  2XCP A;  8ICN A;  4YN4 A;  2F1J A;  1SV0 C;  5ALY A;  4QWB A;  4O3S A;  3N7R C;  3M8R A;  2ZUC A;  1S10 A;  4QWA A;  9ICK A;  7ICQ A;  9ICC A;  5HR7 A;  4Q43 A;  1T8E A;  4ED8 A;  5KFS A;  4BJQ A;  5J8Y A;  4US8 A;  1COO A;  1X2I A;  2EAN A;  3TAR A;  5KFU A;  5DQI A;  2YN4 A;  5H2F U;  5DB8 A;  3DEE A;  3WKE A;  1ZQM A;  4QZ9 A;  3NVY A;  1SWV A;  2G06 A;  4UAU A;  1TK0 A;  2HBM A;  2AJQ A;  2GO7 A;  1S0M A;  1ZQF A;  1NNL A;  2JGA A;  4M0A A;  2KMD A;  3QU2 A;  4EX6 A;  5DBB A;  2ZJA A;  2V4Q A;  5GTI U;  1Z00 A;  4KN4 A;  1HEK A;  1O03 A;  2ZIU B;  7ICJ A;  2W7O A;  2G5H B;  7ICL A;  4JUZ A;  4BWM A;  1ECW A;  2FMQ A;  5AKI A;  3RBD A;  5CJ7 A;  4C4S A;  3HW8 A;  1U47 A;  5KG6 A;  1S0O A;  1ZYQ A;  2ZJ8 A;  2LMR A;  3SAH A;  3SQI A;  8ICO A;  1NK5 A;  4QZD A;  2IOF K;  5J2I A;  3BQ1 A;  4F5O A;  2YB4 A;  5D49 A;  2WB1 F;  1UT5 A;  8ICP A;  4UB5 A;  3U26 A;  5KT2 A;  2MU2 A;  4UB8 U;  1KTQ A;  2LYB A;  1N60 A;  3N97 B;  8ICF A;  3SAF A;  2V4R A;  2V9W A;  2F2A B;  2FJ6 A;  4Q8F A;  4EEN A;  2MRL A;  5HNK A;  3SAG A;  1FO4 A;  4B6J A;  4IQT A;  4I27 A;  3DV9 A;  4F5R A;  3VC8 A;  8ICM A;  2BQU A;  2FMS A;  1V9P A;  2JZB B;  2LBO A;  3GZF A;  3GIK A;  2NRV A;  5D4B A;  5AM1 A;  2XVT A;  1A77 A;  2C2D A;  3J81 j;  4U7C A;  3PO5 A;  4PZO A;  2YY6 A;  5ALQ A;  2BPC A;  2XI9 A;  5HML A;  4XRH A;  3THV A;  3RJH A;  5KFE A;  2KKP A;  1A6S A;  2VKQ A;  5CRX A;  1SXD A;  4NLB A;  3EUB 2;  4RPY A;  1SZP A;  3I28 A;  4BWJ A;  1LVH A;  1MN8 A;  3M1Y A;  7ICE A;  2R18 A;  2KV2 A;  4KLI A;  1DXS A;  3BJY A;  3ONN A;  4B9N A;  3WK9 A;  1OXJ A;  1JN3 A;  1X40 A;  2EZY A;  1RG6 A;  1N5X A;  4IRC A;  3GV5 B;  4MFA A;  3IM1 A;  3V7K A;  4ED7 A;  2H3V A;  2HVH A;  1ZQH A;  2AGO A;  4RUC A;  5KG7 A;  3FAH A;  1TFR A;  3HKZ F;  5KFD A;  4DFM A;  1L7M A;  4DL7 A;  1UA0 A;  9ICS A;  9ICG A;  3Q8Q B;  4O5K A;  3BZC A;  1N63 A;  1IM4 A;  5KL8 B;  8ICE A;  2QB0 A;  3E0F A;  1WG8 A;  4B9T A;  3QU5 A;  3ISD A;  1D8B A;  4NWI A;  1UHU A;  1ZXI A;  5ALI A;  2HOF A;  1QQ7 A;  9ICB A;  5AM0 A;  2VJ5 A;  3AQF A;  1UCV A;  2RRD A;  3RR8 A;  5AI4 A;  3HP6 A;  4J9N A;  1X9S A;  4M2Y A;  5KAF U;  1ZET A;  1NOM A;  5KFQ A;  2ESE A;  2E1E A;  1QCK A;  5III A;  5CHG A;  4DSK A;  5AKJ A;  3SYZ A;  3F5A A;  4BXO A;  4KLF A;  8ICK A;  3ZDE A;  2HOQ A;  3KD3 A;  3NAS A;  1S77 D;  3QYP A;  3HRD D;  5ALO A;  1MQ2 A;  5AIA A;  3C21 A;  4OJL A;  3WKB A;  3FC4 A;  5AK5 A;  3QUT A;  1ARO P;  3KHG A;  3HX0 A;  2KOB A;  4ELU A;  2Y9T A;  4RNM A;  5KFV A;  4AYB F;  2ISP A;  2OCE A;  3O0F A;  4BDP A;  2G5I B;  5AKK A;  4CF4 A;  5CA7 A;  3SR6 A;  1ZQC A;  4RQ7 A;  2AGQ A;  4NJ8 A;  1ZQI A;  1EXN A;  5CP2 A;  2LKY A;  5E79 U;  1IIP A;  1X6I A;  4RPZ A;  2IOH A;  2HHV A;  4Y2X A;  3PX6 A;  2KHV A;  4KLO A;  3H8S A;  4JK1 A;  4UB3 A;  2AGP A;  4ELV A;  1WYG A;  2PXI A;  4QWE A;  4EBE A;  5L9X A;  2Y0S C;  3B0X A;  2H3Z A;  4M9G A;  1Z19 A;  3ZI4 A;  3SEN A;  2B0C A;  4YR3 A;  4RQ4 A;  1ZQV A;  4EBC A;  3F5E A;  4I2D A;  2YMQ A;  4NL9 A;  4IRK A;  7ICF A;  3M6K A;  5KFR A;  2E8N A;  1Q8K A;  1ZQQ A;  3UM9 A;  1SIJ A;  3PW2 A;  1KN5 A;  2ZUB A;  4YXJ A;  4QJF B;  5D46 A;  2BZF A;  5ALU A;  5DB7 A;  4F3O A;  8ICZ A;  3ZDB A;  3KKA C;  2KNJ A;  2JMG A;  1L3T A;  4I2I A;  3EYZ A;  3KOO A;  5ALP A;  2KJ9 A;  3AU6 A;  5KFG A;  2ZXH A;  4KLD A;  1ZD4 A;  4KX5 A;  3RJK A;  4F92 B;  5J0T A;  2ASD A;  4BGD A;  2M9N A;  4O3R A;  3RRG A;  1K1S A;  2I6X A;  1NK9 A;  2I9G A;  4FS2 A;  5J0O A;  5BOL A;  4DS5 A;  2GOL A;  5AM3 A;  3MR2 A;  2LYA A;  2K60 A;  1ZQA A;  5G5G A;  8ICY A;  2AQ4 A;  4DSJ A;  2ZIW A;  4UBB A;  4FZM A;  4RPX A;  4ED0 A;  3UQ2 A;  1D9F A;  2FDR A;  3V6K A;  1PVQ A;  4YR0 A;  5A0L A;  5AM4 A;  4C4T A;  2DPI A;  2C2E A;  3QE9 Y;  3NGD A;  2W9B B;  1PVR A;  3NUQ A;  3TAC B;  4BUG A;  3TAD A;  2QAR A;  5ALR A;  5AI5 A;  2R8H A;  1SGG A;  9ICL A;  2QB0 B;  4CE6 A;  2LPE A;  5AK3 A;  2FPK A;  3TAQ A;  2HDO A;  5EWF A;  3NVW A;  2OEH A;  3KBB A;  1BNP A;  1XWL A;  5DKW A;  2AU0 A;  1N61 A;  5GTH U;  2W7P A;  1TVA A;  3SEI A;  2LYH A;  3PW0 A;  3EWA A;  2H3I A;  2G07 A;  2R8G A;  2NYV A;  2EAO A;  2OHF A;  4QZA A;  1BPZ A;  2IHN A;  4I2G A;  3M7D A;  2IA6 A;  1ZQG A;  2LM4 A;  2KIC A;  1IG6 A;  2W55 A;  4OJP A;  2J6U A;  2R8J A;  1BPE A;  4DFD A;  4HYK A;  3OTQ A;  2WF7 A;  3K1Z A;  4Z6D A;  5KFM A;  4ZH4 A;  4ECY A;  1CRX A;  4ECR A;  4CGZ A;  3ZD8 A;  5J2A A;  5J2B A;  1J2M A;  4MEY A;  2D6F C;  4B9S A;  9ICJ A;  1RDF A;  3QUB A;  1ZJM A;  1D9D A;  2Y9U A;  1O08 A;  1QH9 A;  2MAX A;  2AHO B;  2XID A;  2OWO A;  1TKD A;  8ICG A;  1L7P A;  4OJ6 A;  1WWU A;  5AKZ A;  1SXE A;  1CUK A;  3HWT A;  4MHV A;  3A0H U;  4EEK A;  4DFJ A;  3QEB Z;  5KFL A;  1N62 A;  2FE9 A;  4M6W A;  4DS4 A;  1OW5 A;  1IXR A;  1WWV A;  3H40 A;  5J2G A;  9ICT A;  2DKZ A;  1BPD A;  5HHI A;  4Q45 A;  4Z6F A;  2YML A;  2ES6 A;  4YXM A;  1HIW A;  2W54 A;  3JPN A;  3QXG A;  4UB6 U;  4YQW A;  5ALK A;  1XSL A;  3BS7 A;  4DSF A;  4MEX A;  1Q46 A;  3OHA A;  3GII A;  2OXO A;  2HBL A;  2KVS A;  1ZQU A;  3QZ8 A;  4RQ3 A;  4C7Y A;  2MA1 A;  2NRZ A;  2DPJ A;  3A0B U;  2RDI A;  1NKB A;  4DFK A;  2DF4 B;  4F5N A;  3EPG A;  4KLJ A;  3RJJ A;  4DF8 A;  5TZV A;  1Z4N A;  5AIC A;  3H4D A;  2R8I A;  4F5P A;  4DF4 A;  2EAM A;  2DGZ A;  2ZIV A;  1SV0 A;  5HR6 A;  2I5H A;  2MUT B;  2XY7 A;  4PL2 A;  2P6U A;  4C8L A;  4CF3 A;  2ZJ5 A;  3TAP A;  5JTI A;  3RB6 A;  1ZQE A;  1Z4O A;  1L7O A;  1D8Y A;  2JEI A;  1NK0 A;  3C5F A;  4ED1 A;  2BCR A;  8ICS A;  3AUO A;  9ICE A;  3H0M B;  3V7J A;  1Y88 A;  3NRW A;  3NRZ A;  3EZ5 A;  4DSI A;  5AM5 A;  1TAM A;  2KG5 A;  5ALL A;  2BCQ A;  3RR7 A;  4GXK A;  5KT3 A;  2ATL A;  1UT8 A;  2WTF A;  4IQU A;  1NKC A;  5KFO A;  3PV8 A;  4B9L A;  1UPH A;  1HUZ A;  1ZQW A;  4F4Z A;  5BPC A;  1WCL A;  1ZRN A;  4AYB C;  4LVS A;  4P0Q B;  3AN1 A;  1BPB A;  2E5S A;  3AQE A;  2O6K A;  2EZZ A;  4QIW C;  4EEL A;  1RZT A;  4X5V A;  1B22 A;  2IBK A;  4Y2U A;  2OH2 A;  2UVV A;  7ICM A;  3ALR A;  3JPQ A;  4YMM A;  4IR1 A;  3IHQ B;  4TQS A;  1TAQ A;  1JUD A;  3IG5 A;  2HHT A;  2IHM A;  5J29 A;  1S9F A;  3Q8R B;  1YZ7 A;  2JH1 A;  1ZQK A;  1MQ3 A;  2E1F A;  4C8O A;  7ICU A;  4P4O A;  5KNI A;  5AKL A;  1UA1 A;  3HKZ C;  1CEZ A;  2A1A A;  4J9Q A;  5KG3 A;  4KLM A;  1A0P A;  4C4R A;  4KLU A;  1FIQ A;  1NK4 A;  1UQV A;  1JRP A;  2FPL A;  7ICG A;  1XSP A;  3PVX A;  4Y2T A;  3F2C A;  4FFD A;  5ALG A;  4MF8 A;  3FYH A;  2DBY A;  1Z1B A;  2PKE A;  3L5K A;  1QSL A;  9ICW A;  4PHP A;  3T5H A;  4CCH A;  2KZ3 A;  2PMZ F;  4ED6 A;  3ETR A;  4ECU A;  4GC6 A;  2NRX A;  3EPI A;  2W9M A;  3PML A;  2FLN A;  4PGY A;  1NJZ A;  4PGQ A;  3KZX A;  2RQ5 A;  4OD0 A;  3GIJ A;  4EX7 A;  3C1Y A;  4TUS A;  3QUC A;  3Q8L A;  1NK8 A;  1LV5 A;  1TK8 A;  3LYS A;  4J9P A;  2KP7 A;  5KT7 A;  2K4H A;  3CRX A;  3LDA A;  4M9H A;  5L1M A;  4DLG A;  1M6Y A;  4NM2 A;  3T5K A;  2B21 A;  4KLG A;  1YZ6 A;  3H0L B;  5DG7 A;  5J0Q A;  4ECZ A;  4OJO A;  4DFP A;  2BQR A;  2W9C A;  2A3V A;  2E8M A;  1LKY A;  1N56 A;  1JI7 A;  4R8U A;  4RQ2 A;  3AEV A;  5J8Y C;  2K8B B;  2D8C A;  2DWQ A;  4B9M A;  3BZK A;  3K1R B;  8ICC A;  2WFA A;  4HAI A;  3ZDA A;  4EYH B;  1KQQ A;  2F1I A;  3QU7 A;  5EWG A;  4LZD A;  4O3P A;  4MFC A;  3CYM A;  4YCX A;  1AQ6 A;  4RNN A;  3NVZ A;  2L5Y A;  4QZH A;  4I2A A;  3H0R B;  1SZH A;  1VLB A;  1WUD A;  2YTU A;  2C2R A;  5ALM A;  9ICA A;  3WK6 A;  1JRO A;  1XSN A;  3BS5 B;  5F9L A;  2HVI A;  1JMS A;  4YR2 A;  2N1R A;  1IV8 A;  1SKR A;  2OM6 A;  3BQ0 A;  2HHQ A;  4ECV A;  3PZP A;  2GWS A;  4RT3 A;  4JB3 A;  1NZB A;  2E3T A;  3WK8 A;  5AKX A;  4UW9 A;  2BQ3 A;  4DL6 A;  4J9S A;  1ZD2 P;  3WU2 U;  2JR5 A;  4EBD A;  2C22 A;  8ICV A;  4NLK A;  4M6W B;  1NZP A;  1LKY B;  3QU4 A;  2ZIX A;  2K8A A;  5DGB A;  4FE3 A;  1S76 D;  4G9B A;  1MA7 A;  3SMV A;  1KRP A;  1JXL A;  1L8O A;  3M9N B;  5DGA A;  1MSW D;  3L4P A;  4RQ5 A;  2VA3 A;  4RQM A;  5AK6 A;  5ALJ A;  3UPQ A;  4DQQ A;  5DBC A;  2UVW A;  4UAV A;  4RQN A;  4KX3 A;  5CB1 A;  1X42 A;  4YMO A;  5J0Y A;  2J6S A;  2BCS A;  2K4E A;  5KFF A;  2NO4 A;  3PSF A;  1ZQR A;  1NI3 A;  3WKC A;  2VAN A;  1RQL A;  3N4M B;  4QZC A;  3FDS A;  3T5L A;  4PZN A;  1L3U A;  1KFT A;  3I76 A;  1JX4 A;  1XC9 A;  3MDA A;  1PZN A;  1U48 A;  4ECS A;  1ZD3 A;  1ZQ1 C;  5AK4 A;  3D2N A;  2ASL A;  9ICO A;  5KFT A;  3RTV A;  2Q0Z X;  4XUS A;  4ACO A;  4UAT A;  5DLG A;  4RQ0 A;  5KG1 A;  7ICN A;  3WKD A;  4CNQ A;  3M8S A;  3JPR A;  4J9L A;  1SKS A;  4R64 A;  3GDX A;  2KFN A;  3KFU F;  2KE7 A;  4XQ8 A;  1S0V A;  2F44 A;  4RUA A;  1LB2 B;  3MR5 A;  1NK6 A;  5J2H A;  1V97 A;  3PSI A;  3OGU A;  2KHQ A;  5AI9 A;  5JRT A;  3GV7 B;  4P4P A;  3C5G A;  5AKH A; 
#chains in the Genus database with same CATH homology
 4KX5 A;  3OPX A;  1CRX A;  2ZXI A;  3T79 A;  3PZP A;  1XNS A;  2LBO A;  5C0Y A;  4P0P A;  3GZF A;  4CGZ A;  2WAQ F;  1NZB A;  2ZIW B;  3KZX A;  3H0M B;  2XVT A;  1Q3V A;  3NRW A;  3C28 A;  2E1E A;  2D6F C;  3N7R C;  4P0Q A;  4C0Z A;  3F2B A;  1PVP A;  1YT3 A;  2BDU A;  3CP8 A;  1URJ A;  3C29 A;  3IG8 A;  4U7C A;  1P7D A;  2WB1 C;  3F5A A;  1TAM A;  5HR7 A;  3D2Q A;  2XI9 A;  3LYS A;  2HOQ A;  2GOL A;  4BJQ A;  2XID A;  2LYA A;  2K4H A;  3RF9 A;  1Q3U A;  3VCB A;  3CRX A;  2KKP A;  1A6S A;  2VKQ A;  4OJ6 A;  1KBU A;  2OYY A;  2ZIX A;  4OJL A;  1UPH A;  2K8A A;  4A8E A;  2K89 A;  5KL1 B;  5CRX A;  2F77 X;  4P0P B;  3L3F X;  3IN5 A;  4FE3 A;  4ICA A;  4NLB A;  2F76 X;  2ZIW A;  4OJ5 A;  1MA7 A;  3DEE A;  2KOB A;  2LHT A;  2RHF A;  3N7P D;  3PST A;  4FZM A;  3SMV A;  2ZIU A;  4AYB C;  1F44 A;  2H3F A;  4P0Q B;  2KEY A;  3H0L B;  4AYB F;  2R18 A;  2W03 A;  3GU3 A;  3O0F A;  4NV0 A;  1GO3 F;  4FZN A;  2G08 A;  2KV2 A;  2G06 A;  2VIX A;  2E5S A;  2HBM A;  3AQE A;  4QIW C;  1PVQ A;  2G5I B;  2JGA A;  4OJO A;  5A0L A;  3AL0 B;  2A3V A;  3ICX A;  4OO1 J;  3ONN A;  4KX3 A;  2YX8 A;  2LKY A;  2KKV A;  1HEK A;  1IIP A;  2OH2 A;  2G0A A;  1PVR A;  2ZIU B;  3NUQ A;  2K4E A;  3PSF A;  4BUG A;  2K8B B;  3ALR A;  2G09 A;  2CN1 A;  2W7O A;  2G5H B;  2KHV A;  2M0N A;  1HIW A;  3IG5 A;  1ECW A;  2GH1 A;  3F2D A;  2HBK A;  2W04 A;  3D2S A;  2KJ8 A;  1ED1 A;  2HMX A;  2ZG6 A;  2KJ5 A;  4CDG A;  2JH1 A;  2K4I A;  2JHD A;  2E1F A;  4WJ3 B;  2Q4T A;  2Y0S C;  2ZIV B;  3SAH A;  2OXO A;  4PL1 A;  1XO0 A;  2H3V A;  2H3Z A;  2HBL A;  3F53 A;  4QIW F;  3SQI A;  1Z19 A;  4IC9 A;  2CPR A;  3N7S C;  3IP4 B;  1ZQ1 C;  3HKZ C;  2KD1 A;  1L6N A;  3D2N A;  3HKZ F;  1A0P A;  2H3Q A;  2MA1 A;  3CYM A;  2NV3 A;  4GFJ A;  2VJ4 A;  3F5E A;  4QNL A;  2HBJ A;  2W7P A;  2DF4 B;  2YB4 A;  4ACO A;  3M6K A;  2WB1 F;  5KL8 B;  3F2C A;  4NLC A;  2KIW A;  2H3I A;  3H0R B;  2PMZ C;  1SZH A;  3E0F A;  2G07 A;  3M6Z A;  4QJF B;  4CRX A;  2ZIX B;  1Z1B A;  1WUD A;  3RFA A;  3MGV A;  2DGZ A;  3PSP A;  1T94 A;  2ZIV A;  2XIC A;  2LYB A;  3KFU F;  4NWI A;  2DQN B;  5HR6 A;  1D8B A;  4BX9 C;  3LVV A;  3M7D A;  2HOF A;  3SAF A;  2KIC A;  2Y0S F;  4PL2 A;  2K8C B;  2VJ5 A;  2HOI A;  2F2A B;  4FZL A;  1OUQ A;  4U6P A;  2KNJ A;  2RP5 A;  2JMG A;  2RRD A;  3AQF A;  4OJP A;  2CRX A;  2PMZ F;  2MRL A;  2YB1 A;  4O3M A;  2N1R A;  3PSI A;  2F8L A;  2JH7 A;  3LVW A;  2Z7J A;  2KJ9 A;  3SAG A;  1DRG A;  2KHQ A;  2WAQ C;  3K1Z A;  4JMU A;  2OM6 A;  5T14 A;  2ZXH A;  3VC8 A;  4KMO B;  2KVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...