1UPHA

Hiv-1 myristoylated matrix
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
131
structure length
131
Chain Sequence
GARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAADTGNNSQVSQNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN
publication title Entropic Switch Regulates Myristate Exposure in the HIV-1 Matrix Protein
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (clone 12)
molecule tags Virus/viral protein
total genus 37
structure length 131
sequence length 131
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2003-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1uphA00
2H3ZA 4ICAA 2K4EA 2HMXA 1A6SA 2JMGA 2H3QA 2GOLA 1UPHA 2NV3A 2N1RA 2LYAA 1HEKA 2K4HA 2H3FA 1TAMA 2H3IA 4IC9A 1ED1A 1HIWA 2H3VA 1L6NA 4JMUA 1ECWA 2K4IA 2LYBA
chains in the Genus database with same CATH superfamily
1RXVA 2BR0A 2K4EA 3L5KA 2ISOA 3C2LA 1N60A 1X6JA 1K5OA 3MDAA 1HUOA 3QUQA 3SZ2A 5KFNA 3IG8A 2C2EA 2DKXA 4Y2XA 3JPTA 4QIWF 4I2BA 5KT6A 5AM2A 1V9PA 2VA8A 1SV4A 3N7SC 4A8EA 8ICRA 8ICAA 5KFDA 5AM3A 2UVVA 4U6PA 5DBCA 3KZIU 2Y0SF 3Q8LA 8ICXA 2GOLA 1KLNA 2KHQA 5C0YA 4QZHA 4KLUA 1NJXA 7ICQA 8ICGA 3NS1A 4DL2A 3WKCA 2WHEA 8ICPA 3KTQA 2JGAA 5HMMA 3PMNA 4MF2A 2E1FA 1QSYA 2WAQC 4I2DA 2LYHA 5J2DA 4J9RA 1FO4A 5ALIA 2FDRA 3RTVA 2D6FC 4ELVA 5KFBA 2CXYA 4R8UA 8ICYA 2ZIVA 4DCCA 4QZIA 4ED2A 2LYAA 5J2GA 4J9KA 4TQRA 4UASA 2C22A 3Q8SB 4O3SA 1COKA 5J0PA 5KAIU 3TACB 1ZRNA 1S5LU 1NNLA 3BDPA 2W11A 2FPLA 4FS2A 4M0AA 9ICVA 3TADC 3RB6A 7ICLA 2F1HA 1UT8A 4P0QB 1T8EA 4I2GA 2WB1C 3SR6A 1KEJA 4BJQA 1X9MA 2I5HA 3UXNA 2AU0A 4M2YA 2ZIXA 3D2QA 3C28A 1JRPA 3OJSA 5C5JA 2LYBA 3I28A 2AJQA 3MABA 3UPQA 1TV9A 8ICSA 2LM1A 4ECTA 1WWVA 2E8MA 3IDWA 2A3VA 4KMOB 5ALFA 2JEJA 4CF4A 2FI1A 5KFJA 2JV3A 4ED6A 2JH7A 5AM1A 5DG7A 4C7YA 2HVHA 4QZ9A 4DLEA 1F0MA 4DQQA 4US8A 4F5QA 2FPMA 3SV3A 2YY6A 3RJGA 1KRPA 2W54A 2Q0ZX 3HWTA 5KNIA 4QZCA 3H8MA 4GC7A 3ETRA 2YX8A 3A0BU 4OJPA 2AH5A 5DQIA 4EX6A 4ED1A 7ICSA 1X2IA 3E2EA 5AK4A 4I2CA 4Q44A 3HJEA 3KKAA 4C8KA 5J2EA 3QZ8A 2G06A 4Y2QA 3RR8A 3E58A 4GFJA 4PHPA 3BJYA 4KLDA 1OUQA 2J6TA 4AYBC 5ALOA 5KFLA 5D46A 2PXIA 2R8JA 4PGYA 4RPYA 2LM4A 1OW5A 3BZCA 4NL9A 3G6XA 2VA3A 1XSNA 3J81j 4J9LA 4QIWC 3H0LB 3V6JA 2LHTA 5IIMA 3RAXA 1XSPA 5KG2A 2HHQA 1J97A 4NLGA 5HNKA 1SL0A 2NO5A 1D9FA 2ASJA 1Z4OA 3OSPA 2V4QA 4QZEA 3H8WA 2JZBA 1PK1A 2OHFA 3BS5B 1SKWA 1D8BA 3OHBA 4M9HA 7ICRA 8ICFA 4QWBA 3OSNA 4Q8FA 5CHGA 4DQSA 1F44A 1S0NA 4IQWA 1VDVA 3PW0A 2BCVA 5J0RA 2YB1A 3F5EA 4JB3A 3SENA 2K8BB 4ECSA 5AICA 1LB2B 2W55A 4KLOA 3NVVA 4C0ZA 2ZTDA 1Z3EB 4HAIA 3V72A 2F2AB 1C7YA 2K4PA 2KP7A 3N7RC 5ALNA 5J0YA 1EXNA 1N61A 7ICJA 1KFTA 2KVSA 3EPIA 1N5WA 2XCPA 4X5VA 4UARA 1ZQSA 1FFUA 4F5NA 5ALPA 1DK2A 3B9JA 2WFAA 5AI0A 1KKXA 3H0RB 1RPLA 3FDSA 3B0YA 4UB6U 3H8SA 2IBKA 2ZIWB 5DLFA 4J9NA 1Z1BA 4PHEA 4NV0A 5AM0A 2ZJAA 4DFKA 1QSLA 4O5EA 3DV9A 2JEGA 1TAMA 1MSWD 1ZQRA 3SD7A 1ZRMA 5CP2A 1RDFA 2YMPA 4DSLA 1IIPA 2BZFA 4J9PA 2KE7A 2ZIUA 5KFGA 3SV4A 3RH6A 4CRXA 1COOA 8ICEA 2KKVA 1LKYA 3JPQA 4RPZA 3ZI4A 5TISU 1SB3C 2JR5A 4NLCA 2BQUA 3PW4A 3GV8B 3RJIA 5KG6A 4K4GA 4G9BA 5AKKA 4YD2A 2F77X 1ECWA 4EX7A 2H3ZA 4M04A 2H3QA 2ZUBA 5EWFA 5KFWA 4YCXA 2WF6A 4LJXA 3QU2A 1ZJNA 3CP8A 4M47A 2BCRA 4ECVA 3UQ0A 3UXPA 4QZAA 4KLIA 4IS7A 4M9JA 4BX9C 2GO7A 1ZQHA 5KG1A 4DOBA 3EUB2 3GDXA 8ICTA 3MR2A 3ISBA 1ZETA 4M6WA 2FE9A 8ICUA 5ALUA 3SMVA 3FM9A 3A0HU 4UW9A 4QZ8A 1BPEA 3PMLA 4RT2A 4NJ8A 2JEFA 5G5HA 2MUTB 3TI0A 3SAFA 4I28A 5J2BA 4C8LA 2KFNA 4YR0A 2KIVA 5GTIU 9ICIA 3N4MB 5ALQA 2NYVA 2B0CA 3D2SA 2KD1A 2HDOA 1L7NA 2KEYA 2O6KA 2XC9A 5AI8A 4CCHA 1ZQXA 3AN1A 3MBYA 3RRGA 4YD1A 1U45A 3TQ1A 4DWIA 2QLTA 1ZYQA 4DL7A 1PVRA 2W9CB 9ICQA 4DO9A 3GU3A 4Z6DA 3RB4A 4BXOB 3AUOA 3C1ZA 3WU2U 3RJFA 5T14A 1UA0A 1RQLA 1ZQMA 4QW8A 3V7KA 3SAHA 2V4RA 5DB9A 5J8YA 1ZD3A 4MEYA 4YG2A 4QZDA 4QWDA 2WTFA 2IHNA 4I2JA 2QARA 2AQ0A 4ICAA 5ALRA 1S0OA 4KMUA 1L7OA 2WAQF 2EZZA 1JXLA 5KG5A 4XA5A 5DG8A 3GFKB 4ECZA 2R8IA 1PUZA 5JU5A 3E0FA 9ICAA 9ICTA 2BKEA 2LI6A 3NUQA 2H3IA 5KFPA 3C2KA 3QEAZ 3SAGA 1RG6A 5K4LA 4DLGA 2KSOB 3IP4B 1D9DA 4B9LA 1IV8A 3CRXA 2EZYA 2EAMA 3K75D 7ICUA 2ZIWA 1N2XA 3LVVA 1HEKA 3BQ1A 4IQVA 4Q43A 4UAWA 2J6SA 1ZQQA 1V38A 2WB1F 3H4BA 1NOMA 3N97B 5ALXA 4O9MA 4EEYA 5AM4A 8ICMA 1N56A 2GWSA 4R63A 1L3VA 2BCUA 7ICIA 4ACOA 2DPJA 4M9GA 2I6XA 1SKSA 3RH5A 7ICOA 1DOQA 4F3OA 1H38A 1SV0C 1RM6C 3KHLA 2HBKA 2IOFA 3PX4A 3QU4A 5DGBA 3Q8PB 4PL1A 4P2HA 4F2SA 5ALVA 5ALDA 1MQ3A 1UPHA 2IHMA 2ESEA 2UVRA 4YN4A 1BPBA 2KHVA 1QH9A 1L8OA 1S8OA 4C4TA 1B43A 3PO4A 3LWMA 3ALRA 5KG4A 1U9LA 2EH9A 3C23A 2K8AA 3H8JA 5AK3A 1CRXA 4O3PA 5J29A 4GXKA 1T94A 4DQPA 1BNPA 1TAQA 3F2BA 1ZQFA 8ICBA 3RH4A 3UMGA 1MQ2A 3V6HA 1QLNA 1NJWA 4YXJA 3R9KA 3AU2A 4KLFA 3QEBZ 2OH2A 4US9A 9ICKA 4Y2PA 2BHNA 2PFOA 3ISDA 4AYBF 4QWCA 1N63A 4QJFB 4TQSA 2G0AA 1ZOLA 4NM2A 4BWMA 3UQ2A 2RRDA 3F5AA 4DSFA 5ALWA 1ZQNA 2JRZA 2KIWA 2MUTA 4RNNA 4RQ2A 1L3UA 3M9MB 5D49A 5L1LA 7ICNA 1TAUA 3TFSA 5KFAA 4O3RA 9ICCA 3OJUA 5TZVA 8ICJA 2XGPA 3HX0A 5ALYA 3UXOA 3PVXA 1ZD2P 2K8CB 2G5IB 4F2RA 4KLHA 1DRGA 8ICCA 2OWOA 1DGSA 1SZHA 1TE2A 1BPZA 1X9XA 1UT5A 3BZKA 3MR6A 4CF3A 3PW2A 1L3SA 1RYRA 2PKEA 4EENA 3NVYA 2XVTA 3LK9A 3JPSA 4GIBA 8ICLA 3LWLA 4KLLA 3BQ7A 1DGJA 2R8KA 4B9MA 2H5XA 2I1QA 2WF8A 5ALJA 3T5LA 2E1EA 3GQCA 4BWJA 3AQFA 1Z00B 3CYMA 1Y88A 2ZJ8A 3AQEA 5AKJA 2WF5A 3WKEA 5KFYA 5JRTA 2W3SA 4JK1A 2XY5A 4RUAA 2KSOA 1U48A 2Y1IA 4MEXA 1TVAA 4R64A 2A1JA 1MN8A 2G08A 4UB3A 4I2FA 2OCEA 2YN4A 5IIIA 5J2FA 4KLTA 2F8KA 2E8PA 2HBJA 2EANA 4F72A 5KT2A 2XY7A 1KW4A 2Y9UA 2NRXA 1NK0A 3HP6A 2HCFA 1HJPA 3ZDDA 3H4DA 2ES6A 3C5FA 2QB1A 4RPXA 4EYHB 5KG0A 3PNCA 2CN1A 4BDPA 3M8RA 3F2CA 3EPGA 4RUCA 4IL6U 2NRWA 7ICGA 3PSFA 5FP0A 2XICA 5JTIA 4P4OA 4F8RA 2BPFA 3F53A 1S77D 1YZ6A 3ORYA 3ZDAA 3WKAA 3TAQA 1ZJMA 2R8GA 1WYGA 3AM9A 1WCNA 2KVCA 5HHIA 4QW9A 3GILA 7ICEA 1L8LA 1IXRA 1CI4A 1SL1A 3C29A 4TUQA 2BDPA 2PI5A 3RJKA 4ECRA 3THVA 4DFDA 4EYIB 5DQHA 2L5YA 2F44A 2W9BB 5IIKA 3NTUA 1RYUA 3B0XA 4PZNA 2KK0A 5AI9A 2KNJA 2KJ9A 5KFFA 2ASDA 4RQ4A 4DQRA 4E0DA 1QQ6A 3IHQB 4NLKA 3IM1A 1LVHA 2DUYA 1ZQCA 4DEZA 3WK6A 2JHDA 4UB8U 3BQ0A 2FMSA 5CA7A 3K1RB 5KT3A 1K1QA 4DFMA 2RHFA 4FZNA 5KT7A 4DS4A 2W8KA 5IINA 5ALZA 3PX0A 3RR7A 3HPOA 3PSPA 4F71A 2EAPA 3MR5A 4KLJA 5J0TA 1X40A 4B9TA 1KFDA 5L1KA 2NRVA 3QYPA 5DB8A 9ICFA 1ZXIA 5IIOA 1ZQBA 4P0PB 2Y1JA 3K4GA 3RJJA 4JMUA 4I29A 4NLBA 2KZ3A 4XQ8A 9ICPA 4UBCA 5AI6A 1ZD4A 2E8NA 3Q8RB 3Q8QB 3PSTA 2FJ6A 5KL1B 4F91B 4ECWA 4OJLA 1QSSA 4KN4A 2CPRA 1SWWA 2NV3A 4F4KA 8ICZA 3H40A 3DDHA 1ZQ1C 4PHAA 3GV5B 4PJ0U 4C4RA 2FLPA 5AIAA 2ZUCA 4RQ8A 3QE9Y 1JALA 5KFCA 3CNHA 8ICKA 2ISPA 4RQ5A 1QQ5A 3EZ5A 9ICLA 3GIKA 3L4PA 3PV8A 1TK5A 2HVIA 1NK8A 4O3MA 1RYSA 4P0QA 3UMCA 2B21A 3PR4A 4G3IA 4NY8A 3JPNA 4F93B 3PZPA 1P7DA 2ZXIA 4QZFA 1WCLA 2HOQA 1AROP 5KFOA 5A0LA 5B66U 3NVZA 4Y2SA 4YMNA 2AHOB 3KHGA 1ZQTA 1BGXT 2UVUA 4EBCA 9ICMA 2R18A 2JXJA 2BQRA 1KL9A 5EE3A 2YMLA 4KLGA 2CRXA 1XO1A 4I2IA 4DOAA 5L9XA 1A6SA 3ZDBA 2F3NA 2ASLA 4RQ0A 4RZRA 5DBAA 4F4XA 2PI4A 4DL4A 5J0UA 5GTHU 2DL0A 4IQTA 4IR9A 4J9OA 1ZQYA 3HRDD 5ALHA 4ELUA 2W8LA 5ALEA 5JUMA 2RDIA 2M0NA 4RQMA 4TUSA 2FLLA 2IA6A 5DB6A 4DF8A 4C80A 4FZLA 2AGQA 2LBOA 5AM5A 4FE3A 4Y2JA 4IR1A 9ICHA 3Q8MA 2DQNB 2DGZA 2F1IA 2LMRA 2XCAA 3LDAA 2FPKA 4WJ3B 5J2AA 9ICEA 2PFPA 4RT3A 8ICHA 3SYZA 5J0WA 2EZXA 3OPXA 4FO6A 4YR2A 2XO7A 2AGPA 2HOFA 2KKPA 4R65A 3FYHA 3BS7A 8ICOA 3PX6A 4QWAA 3HILA 1JXEA 2G5HB 9ICWA 4LZGA 2GH1A 4ED0A 4K4HA 3GV7B 4ELTA 4DF4A 1ZQKA 1HUZA 4K4IA 5AKYA 5IIJA 5DDMA 3QU9A 2OEHA 4UB2A 3TADA 5AK6A 3F2DA 1J2NA 2ZJ5A 3S6JA 2P35A 3BS5A 4NWIA 4CE6A 2DKZA 2BPCA 3KKAC 4YVZA 1NZPA 2Y9TA 1ZQUA 5CB1A 2AGOA 1SZPA 2DF4B 4RQ3A 4P0PA 1WWUA 4NLZA 2HHWA 9ICGA 4QZBA 2P6UA 1L3TA 4GXJA 2BQ3A 3SI8A 5KT4A 1SL2A 3M8SA 4Y2YA 1T3NA 2WF7A 4NL9C 4MF8A 1YT3A 5KTQA 3T5HA 5AKZA 3NRZA 1J2MA 3LYSA 5KFTA 4JV2A 4RQNA 2VKQA 1ZQDA 2XI9A 4ECQA 3RRHA 2ZIVB 1DK3A 3TAPA 4DL3A 3TFRA 2R8HA 4HYKA 3HKZF 4UAUA 2DPIA 3IN5A 5L1JA 3WK4A 4IC9A 2FLNA 5DG9A 5KFIA 5ALLA 1XWLA 3C21A 5J0XA 4F92B 4IRCA 1K1SA 1U4BA 3FC4A 1Q46A 3NRWA 2BPGA 4M9NA 5EE1A 2ZIXB 5DDYA 4J9QA 4RNMA 1MC8A 3SEIA 4DFPA 1ZQGA 2DWQA 5J0OA 9ICSA 5EWEA 1NK5A 2VJ5A 3GIIA 3V7LA 5DQGA 2FMQA 5L1MA 5J0SA 2VIXA 3CW2C 3QUTA 2M9NA 3H0MB 1N48A 1QQ7A 4LZDA 4P4PA 4NLNA 1JN3A 5HR6A 3VC8A 4Q45A 2YTUA 1T7PA 4B9VA 1NKBA 2HOIA 3M9OB 5J0QA 3I1YA 5AI5A 4YXMA 2W04A 1S76D 1X6IA 1KTQA 3Q8KA 3G6VA 2XGQA 1TFRA 2DFLA 4O3NA 3HT3A 4Y2TA 3MGVA 1U47A 1ZQJA 2HHVA 1ZQOA 2RDJA 4ED8A 1D8LA 7ICKA 2E3TA 3ED5A 4O3QA 4YR3A 5KFUA 3ZDEA 1JROA 1U49A 3KBBA 1ZQWA 4DSJA 1JMSA 1KN5A 2JMGA 5HP4A 4RU9A 3KD3A 2C2DA 1JX4A 4CDGA 1ZQEA 4I2AA 4C7ZA 1O08A 4DL5A 4BUGA 2W03A 2ZUDA 2BCSA 4B9SA 2K89A 3SQIA 3M7DA 5EE9A 4NM1A 1SXEA 1UCVA 3WK5A 5KFQA 2KJ8A 4U7CA 4ECXA 2W9CA 4KLEA 4RQ6A 1ZQLA 4BXOA 1FEZA 3U26A 2MU2A 4MHVA 3BQ2A 4PHDA 1HIWA 2YMQA 4MFAA 1KQQA 1NKCA 2JZBB 1PK1B 1MA7A 1KDHA 3ZD9A 1TKDA 3QX7A 3WKBA 3C2MA 1UA1A 1SWVA 4FFDA 4EELA 5KFMA 2E8OA 1NJYA 3WK7A 4F4ZA 3QNMA 5AK5A 4Z6EA 3IV6A 5AKHA 4FS1A 1OXJA 8ICVA 2OYYA 1C20A 3MR3A 2KV2A 1S10A 4KX3A 4J9SA 4RQ1A 3HKZC 5KG7A 3TANA 1RQNA 3H7IA 4O3OA 1Q3VA 2GLEA 3D2NA 5E79U 4QWEA 2HW3A 1Z4NA 5J2HA 2H3VA 3M9NB 4LVSA 4Y2UA 4JWNA 3O0FA 1VLBA 3MFHA 2MRLA 3RJEA 3JPRA 9ICRA 4PGQA 5J8YC 3T5JA 2ZXHA 4DS5A 1BPYA 2XIDA 3EYZA 1RXWA 2EQYA 2ZIUB 1ZQIA 9ICJA 4I2HA 1ED1A 2IMWP 5KG3A 3N28A 5L1IA 2K4IA 1LKYB 3LVWA 8ICQA 2AXTU 2HSZA 9ICBA 8ICWA 4GXIA 2HHSA 4PL2A 2KMDA 5KFSA 5AKEA 1L7PA 3PW7A 3QXGA 4F50A 4EZ6A 3MC1A 1X66A 2VJ4A 3RB3A 3PSIA 3RF9A 1FIQA 4J9MA 9ICNA 3OTQA 5CWRA 2HMXA 5IILA 1FFVA 3RB0A 2HHTA 4UB4A 4NXZA 3VCBA 1VJ5A 5J2CA 4KLSA 2PMZC 9ICUA 1D8YA 1TK8A 5AKGA 1B4FA 2Q4TA 1Z1VA 3BQTA 2D3DA 4FBTA 1GO3F 1WG8A 1NKEA 4DQIA 5KAFU 4C8OA 2F8LA 3IRUA 4J03A 2JEIA 3ISCA 4Y2RA 1TK0A 5CRXA 4M6WB 2P6RA 1V85A 4JUZA 2HHUA 4DFJA 7ICFA 2UVWA 2W7OA 3V7JA 1PVPA 2KZMA 5KT5A 2BDUA 4PGXA 4BGDA 4KLQA 1ZQAA 2ZG6A 2KOBA 4ZOHC 1X9WA 5AKLA 2NRTA 1L7MA 1NI3A 5F9LA 1SIJA 5AI4A 1NK7A 2F76X 8ICIA 3KZXA 1QCKA 5HMLA 2XY6A 7ICVA 4OJ6A 4Q8EA 3I76A 4KTQA 3T79A 5AKXA 4DL6A 4FBUA 2RP5A 5J2KA 1NK4A 2W7PA 3AU6A 4OCZA 2Y0SC 3ETLA 1PK3A 4MFCA 1JI7A 4TUPA 4EZ9A 1NK6A 3C1YA 1BVSA 2ZTEA 3JPOA 2LKYA 3IG5A 3ONNA 3OHAA 5KFXA 2ATLA 4OD0A 3KHRA 2QARB 4DOCA 2RLTA 4GLXA 5EWGA 3QUCA 2KJ5A 7ICHA 1Z00A 4AP9A 5BOMA 4QNLA 5KFRA 1SV0A 4R66A 1X9SA 1N5XA 4FZMA 7ICTA 1Q3UA 1NZBA 4DSKA 4PZOA 2EDUA 5CJ7A 1ZQPA 5EE0A 5H2FU 3RBEA 4RNOA 2OM6A 4JV1A 1L6NA 2BGWA 3N7PD 5ALGA 4UQGA 4C4SA 4KITB 5DB7A 3QU5A 3RAQA 1XC9A 3PY8A 2VANA 5DBBA 1UHUA 3UMBA 3GIMA 2KTQA 5ALKA 2KN7A 4OJ5A 4UBBA 1XNSA 4MFFA 1XS9D 1IG6A 2A19A 4QZGA 5CEHA 1BPXA 3FAHA 2QKQA 1RZTA 1BPDA 1DXSA 4EEKA 2A1AA 3JPPA 2PFQA 1PVQA 2BCQA 3T3FA 3TKAA 2IOFK 2HBMA 5D4BA 3RJHA 3KFUF 2PFNA 2QB0B 2YMMA 4UAVA 4UAZA 1A0PA 4C8NA 1T4GA 5KFVA 1ZQVA 3MDCA 2K4HA 2W9BA 1LV5A 5G5GA 2YB4A 4KX5A 4PH5A 2KFZA 5AKIA 3L3FX 1ZQZA 4IQUA 4F5RA 2KICA 9ICXA 4P4MA 5F3XB 1S97A 4DSEA 5ALTA 2KZZA 2I9GA 4YMMA 5CR0A 1F5SA 1V97A 4I27A 2WF9A 2LPEA 4OO1J 2G07A 3PR5B 3QZ7A 2FMPA 2VA2A 3EWAA 5KFZA 3V6KA 4UAYA 4F5OA 3ZDCA 4ED7A 2ALZA 3GZFA 2EAOA 3M6KA 3MGHA 1WUDA 4KN7A 1PZNA 3WKDA 1S9FA 4USAA 4UB5A 1XO0A 2YQEA 4C8MA 2B6GA 2ODGA 2V9WA 1BNOA 3AL0B 4GC6A 1KSPA 3NGDA 2AQ4A 2H3FA 4B6JA 1S0MA 3WK9A 3OGUA 1CEZA 1YZ7A 2C28A 5ALSA 2JH1A 3K1ZA 4EBEA 1M6YA 5KFEA 2E5SA 1SKRA 4CNQA 1Z19A 5J2IA 2W9AA 1B0XA 2D8CA 4Z6FA 3GIJA 5B5EU 3EW9A 1KBUA 5DKWA 1AQ6A 2Z7JA 3RBDA 3PO5A 3NVWA 2MAXA 1A77A 4O5CA 4TURA 4YMOA 1T3QA 4IRKA 4ED3A 5HHHA 7ICPA 4R8UB 1XSLA 1S0VA 4XUSA 5J2JA 3D6JA 4JV0A 4YQWA 1A76A 2J6UA 1SXDA 2W9MA 2HHXA 1JIHA 3C5GA 1URJA 2P66A 4ECYA 4YP3A 1X42A 3MFIA 1ZD5A 4XRHA 4O5KA 4ZH4A 2KG5A 5AHXA 4I2EA 9ICOA 2A1JB 2OXOA 1NJZA 4DSIA 2NO4A 5EOZA 5BOLA 2F1JA 2G09A 3G6YA 2MA1A 5HR7A 3AEVA 1O03A 4O0IA 1QTMA 3QU7A 3ZD8A 1CUKA 4KLMA 5ALMA 2ZTCA 1N62A 2IOHA 4Y2VA 1SGGA 4OJOA 4F5PA 3QUBA 3T5KA 3NASA 1XU4A 1L5UA 5KFHA 8ICNA 3PW5A 5BPCA 3RFAA 5DGAA 4EBDA 1B22A 1IM4A 4UB1A 5F9NA 4CGZA 5KL8B 1UQVA 1JUDA 3ICXA 4B9UA 2QB0A 4ECUA 5KFKA 4F4YA 7ICMA 4B9NA 2PMZF 3KOOA 4IRDA 3UM9A 4UATA 4JWMA 4Z6CA 1Q8KA 3M6ZA 3KHHA 5DLGA 2HBLA 2C2RA 3DEEA 1NK9A 3WK8A 3MGIA 4M9LA 2RQ5A 4RQ7A 3TARA 4YFKA 1KFSA 3M1YA 3AMZA 2NRZA 2W3RA 2K60A 4F4WA 2DBYA 2N1RA 5AIBA 4PPXA 2HI0A 4CF5A 2MSNA 2W43A 3HW8A
chains in the Genus database with same CATH topology
2GH1A 2H3ZA 2VJ5A 4QNLA 4ICAA 2HOQA 2K4EA 2HMXA 4FZMA 2OXOA 2VIXA 2H3QA 3VCBA 1NZBA 1Q3UA 5A0LA 2WAQF 4OO1J 2A3VA 2G07A 2JHDA 2PMZC 2G09A 4KMOB 1D8BA 2MA1A 2G08A 5HR7A 2OH2A 3IG8A 3E0FA 4QIWF 3F2DA 3H0MB 2Q4TA 4NWIA 2OM6A 2JH7A 3CP8A 3N7SC 3GZFA 3NUQA 1GO3F 4A8EA 2HBJA 3M6KA 2H3IA 4AYBF 1F44A 2R18A 1WUDA 2DF4B 2RHFA 4FZNA 1L6NA 4QJFB 3SAGA 2YB1A 3F5EA 4P0PA 2F8LA 5HR6A 3N7PD 2CRXA 2K8BB 2G0AA 3VC8A 1XO0A 3PSPA 2OYYA 3IP4B 4BX9C 2KV2A 4U6PA 2HOIA 4C0ZA 4KX3A 1A6SA 3CRXA 4OJOA 2RRDA 2F2AB 2Y0SF 3F5AA 5CRXA 3AL0B 2W04A 3HKZC 2GOLA 2KHQA 2KIWA 3N7RC 2CN1A 5C0YA 2ZIWA 3LVVA 2YX8A 3F2CA 1Q3VA 1HEKA 3D2NA 4OJPA 3RFAA 2W7OA 4OJ5A 2H3FA 1XNSA 3MGVA 1YT3A 4P0PB 2WB1F 1PVPA 2JGAA 3H0RB 2BDUA 2H3VA 3PSFA 3SMVA 4JMUA 4CGZA 4NLBA 2XICA 3LYSA 2ZG6A 2E1FA 5KL8B 2JH1A 2KOBA 2WAQC 3K1ZA 3F53A 2M0NA 2G06A 2E5SA 2VKQA 3O0FA 2XI9A 3SAFA 2K8CB 2G5IB 3PSTA 4GFJA 2ZIWB 2JMGA 4OJLA 5KL1B 2ZIVB 1Z19A 1DRGA 3ICXA 2MRLA 1Z1BA 1OUQA 2F76X 2D6FC 2CPRA 4CDGA 1PVQA 3KZXA 4NV0A 1SZHA 2NV3A 4AYBC 4FZLA 2KVCA 4ACOA 2ZIVA 2LBOA 4OJ6A 1ZQ1C 3D2SA 1KBUA 2LYAA 2KD1A 3HKZF 2ZXHA 2KEYA 4FE3A 4BUGA 3T79A 2XIDA 2PMZF 2W03A 2ZIUB 2Z7JA 3IN5A 1TAMA 2RP5A 2HBMA 1ED1A 2DQNB 4IC9A 3C29A 2W7PA 2XVTA 2DGZA 1P7DA 3KFUF 3M6ZA 2HBKA 1IIPA 2HBLA 2K89A 2Y0SC 3DEEA 3SQIA 2K4IA 2ZIUA 3M7DA 3LVWA 4WJ3B 4PL1A 1PVRA 4CRXA 3PSIA 3GU3A 1A0PA 2KJ8A 2KKVA 4QIWC 1MA7A 3H0LB 4U7CA 4P0QB 3OPXA 2LKYA 3IG5A 2LHTA 3ONNA 1UPHA 4PL2A 3NRWA 2WB1C 2HOFA 2E1EA 2N1RA 2KKPA 5T14A 4O3MA 2KHVA 1URJA 2ZIXB 4NLCA 3AQFA 2K4HA 4P0QA 3SAHA 4BJQA 3CYMA 2KNJA 2YB4A 3ALRA 4KX5A 3L3FX 2KJ9A 2VJ4A 2K8AA 2KICA 3C28A 1CRXA 1HIWA 2KJ5A 1T94A 3PZPA 2ZIXA 3AQEA 2F77X 2G5HB 3F2BA 3D2QA 3RF9A 1ECWA 2LYBA 2ZXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3Z A;  4ICA A;  2K4E A;  2HMX A;  1A6S A;  2JMG A;  2H3Q A;  2GOL A;  1UPH A;  2NV3 A;  2N1R A;  2LYA A;  1HEK A;  2K4H A;  2H3F A;  1TAM A;  2H3I A;  4IC9 A;  1ED1 A;  1HIW A;  2H3V A;  1L6N A;  4JMU A;  1ECW A;  2K4I A;  2LYB A; 
#chains in the Genus database with same CATH topology
 1RXV A;  2BR0 A;  2K4E A;  3L5K A;  2ISO A;  3C2L A;  1N60 A;  1X6J A;  1K5O A;  3MDA A;  1HUO A;  3QUQ A;  3SZ2 A;  5KFN A;  3IG8 A;  2C2E A;  2DKX A;  4Y2X A;  3JPT A;  4QIW F;  4I2B A;  5KT6 A;  5AM2 A;  1V9P A;  2VA8 A;  1SV4 A;  3N7S C;  4A8E A;  8ICR A;  8ICA A;  5KFD A;  5AM3 A;  2UVV A;  4U6P A;  5DBC A;  3KZI U;  2Y0S F;  3Q8L A;  8ICX A;  2GOL A;  1KLN A;  2KHQ A;  5C0Y A;  4QZH A;  4KLU A;  1NJX A;  7ICQ A;  8ICG A;  3NS1 A;  4DL2 A;  3WKC A;  2WHE A;  8ICP A;  3KTQ A;  2JGA A;  5HMM A;  3PMN A;  4MF2 A;  2E1F A;  1QSY A;  2WAQ C;  4I2D A;  2LYH A;  5J2D A;  4J9R A;  1FO4 A;  5ALI A;  2FDR A;  3RTV A;  2D6F C;  4ELV A;  5KFB A;  2CXY A;  4R8U A;  8ICY A;  2ZIV A;  4DCC A;  4QZI A;  4ED2 A;  2LYA A;  5J2G A;  4J9K A;  4TQR A;  4UAS A;  2C22 A;  3Q8S B;  4O3S A;  1COK A;  5J0P A;  5KAI U;  3TAC B;  1ZRN A;  1S5L U;  1NNL A;  3BDP A;  2W11 A;  2FPL A;  4FS2 A;  4M0A A;  9ICV A;  3TAD C;  3RB6 A;  7ICL A;  2F1H A;  1UT8 A;  4P0Q B;  1T8E A;  4I2G A;  2WB1 C;  3SR6 A;  1KEJ A;  4BJQ A;  1X9M A;  2I5H A;  3UXN A;  2AU0 A;  4M2Y A;  2ZIX A;  3D2Q A;  3C28 A;  1JRP A;  3OJS A;  5C5J A;  2LYB A;  3I28 A;  2AJQ A;  3MAB A;  3UPQ A;  1TV9 A;  8ICS A;  2LM1 A;  4ECT A;  1WWV A;  2E8M A;  3IDW A;  2A3V A;  4KMO B;  5ALF A;  2JEJ A;  4CF4 A;  2FI1 A;  5KFJ A;  2JV3 A;  4ED6 A;  2JH7 A;  5AM1 A;  5DG7 A;  4C7Y A;  2HVH A;  4QZ9 A;  4DLE A;  1F0M A;  4DQQ A;  4US8 A;  4F5Q A;  2FPM A;  3SV3 A;  2YY6 A;  3RJG A;  1KRP A;  2W54 A;  2Q0Z X;  3HWT A;  5KNI A;  4QZC A;  3H8M A;  4GC7 A;  3ETR A;  2YX8 A;  3A0B U;  4OJP A;  2AH5 A;  5DQI A;  4EX6 A;  4ED1 A;  7ICS A;  1X2I A;  3E2E A;  5AK4 A;  4I2C A;  4Q44 A;  3HJE A;  3KKA A;  4C8K A;  5J2E A;  3QZ8 A;  2G06 A;  4Y2Q A;  3RR8 A;  3E58 A;  4GFJ A;  4PHP A;  3BJY A;  4KLD A;  1OUQ A;  2J6T A;  4AYB C;  5ALO A;  5KFL A;  5D46 A;  2PXI A;  2R8J A;  4PGY A;  4RPY A;  2LM4 A;  1OW5 A;  3BZC A;  4NL9 A;  3G6X A;  2VA3 A;  1XSN A;  3J81 j;  4J9L A;  4QIW C;  3H0L B;  3V6J A;  2LHT A;  5IIM A;  3RAX A;  1XSP A;  5KG2 A;  2HHQ A;  1J97 A;  4NLG A;  5HNK A;  1SL0 A;  2NO5 A;  1D9F A;  2ASJ A;  1Z4O A;  3OSP A;  2V4Q A;  4QZE A;  3H8W A;  2JZB A;  1PK1 A;  2OHF A;  3BS5 B;  1SKW A;  1D8B A;  3OHB A;  4M9H A;  7ICR A;  8ICF A;  4QWB A;  3OSN A;  4Q8F A;  5CHG A;  4DQS A;  1F44 A;  1S0N A;  4IQW A;  1VDV A;  3PW0 A;  2BCV A;  5J0R A;  2YB1 A;  3F5E A;  4JB3 A;  3SEN A;  2K8B B;  4ECS A;  5AIC A;  1LB2 B;  2W55 A;  4KLO A;  3NVV A;  4C0Z A;  2ZTD A;  1Z3E B;  4HAI A;  3V72 A;  2F2A B;  1C7Y A;  2K4P A;  2KP7 A;  3N7R C;  5ALN A;  5J0Y A;  1EXN A;  1N61 A;  7ICJ A;  1KFT A;  2KVS A;  3EPI A;  1N5W A;  2XCP A;  4X5V A;  4UAR A;  1ZQS A;  1FFU A;  4F5N A;  5ALP A;  1DK2 A;  3B9J A;  2WFA A;  5AI0 A;  1KKX A;  3H0R B;  1RPL A;  3FDS A;  3B0Y A;  4UB6 U;  3H8S A;  2IBK A;  2ZIW B;  5DLF A;  4J9N A;  1Z1B A;  4PHE A;  4NV0 A;  5AM0 A;  2ZJA A;  4DFK A;  1QSL A;  4O5E A;  3DV9 A;  2JEG A;  1TAM A;  1MSW D;  1ZQR A;  3SD7 A;  1ZRM A;  5CP2 A;  1RDF A;  2YMP A;  4DSL A;  1IIP A;  2BZF A;  4J9P A;  2KE7 A;  2ZIU A;  5KFG A;  3SV4 A;  3RH6 A;  4CRX A;  1COO A;  8ICE A;  2KKV A;  1LKY A;  3JPQ A;  4RPZ A;  3ZI4 A;  5TIS U;  1SB3 C;  2JR5 A;  4NLC A;  2BQU A;  3PW4 A;  3GV8 B;  3RJI A;  5KG6 A;  4K4G A;  4G9B A;  5AKK A;  4YD2 A;  2F77 X;  1ECW A;  4EX7 A;  2H3Z A;  4M04 A;  2H3Q A;  2ZUB A;  5EWF A;  5KFW A;  4YCX A;  2WF6 A;  4LJX A;  3QU2 A;  1ZJN A;  3CP8 A;  4M47 A;  2BCR A;  4ECV A;  3UQ0 A;  3UXP A;  4QZA A;  4KLI A;  4IS7 A;  4M9J A;  4BX9 C;  2GO7 A;  1ZQH A;  5KG1 A;  4DOB A;  3EUB 2;  3GDX A;  8ICT A;  3MR2 A;  3ISB A;  1ZET A;  4M6W A;  2FE9 A;  8ICU A;  5ALU A;  3SMV A;  3FM9 A;  3A0H U;  4UW9 A;  4QZ8 A;  1BPE A;  3PML A;  4RT2 A;  4NJ8 A;  2JEF A;  5G5H A;  2MUT B;  3TI0 A;  3SAF A;  4I28 A;  5J2B A;  4C8L A;  2KFN A;  4YR0 A;  2KIV A;  5GTI U;  9ICI A;  3N4M B;  5ALQ A;  2NYV A;  2B0C A;  3D2S A;  2KD1 A;  2HDO A;  1L7N A;  2KEY A;  2O6K A;  2XC9 A;  5AI8 A;  4CCH A;  1ZQX A;  3AN1 A;  3MBY A;  3RRG A;  4YD1 A;  1U45 A;  3TQ1 A;  4DWI A;  2QLT A;  1ZYQ A;  4DL7 A;  1PVR A;  2W9C B;  9ICQ A;  4DO9 A;  3GU3 A;  4Z6D A;  3RB4 A;  4BXO B;  3AUO A;  3C1Z A;  3WU2 U;  3RJF A;  5T14 A;  1UA0 A;  1RQL A;  1ZQM A;  4QW8 A;  3V7K A;  3SAH A;  2V4R A;  5DB9 A;  5J8Y A;  1ZD3 A;  4MEY A;  4YG2 A;  4QZD A;  4QWD A;  2WTF A;  2IHN A;  4I2J A;  2QAR A;  2AQ0 A;  4ICA A;  5ALR A;  1S0O A;  4KMU A;  1L7O A;  2WAQ F;  2EZZ A;  1JXL A;  5KG5 A;  4XA5 A;  5DG8 A;  3GFK B;  4ECZ A;  2R8I A;  1PUZ A;  5JU5 A;  3E0F A;  9ICA A;  9ICT A;  2BKE A;  2LI6 A;  3NUQ A;  2H3I A;  5KFP A;  3C2K A;  3QEA Z;  3SAG A;  1RG6 A;  5K4L A;  4DLG A;  2KSO B;  3IP4 B;  1D9D A;  4B9L A;  1IV8 A;  3CRX A;  2EZY A;  2EAM A;  3K75 D;  7ICU A;  2ZIW A;  1N2X A;  3LVV A;  1HEK A;  3BQ1 A;  4IQV A;  4Q43 A;  4UAW A;  2J6S A;  1ZQQ A;  1V38 A;  2WB1 F;  3H4B A;  1NOM A;  3N97 B;  5ALX A;  4O9M A;  4EEY A;  5AM4 A;  8ICM A;  1N56 A;  2GWS A;  4R63 A;  1L3V A;  2BCU A;  7ICI A;  4ACO A;  2DPJ A;  4M9G A;  2I6X A;  1SKS A;  3RH5 A;  7ICO A;  1DOQ A;  4F3O A;  1H38 A;  1SV0 C;  1RM6 C;  3KHL A;  2HBK A;  2IOF A;  3PX4 A;  3QU4 A;  5DGB A;  3Q8P B;  4PL1 A;  4P2H A;  4F2S A;  5ALV A;  5ALD A;  1MQ3 A;  1UPH A;  2IHM A;  2ESE A;  2UVR A;  4YN4 A;  1BPB A;  2KHV A;  1QH9 A;  1L8O A;  1S8O A;  4C4T A;  1B43 A;  3PO4 A;  3LWM A;  3ALR A;  5KG4 A;  1U9L A;  2EH9 A;  3C23 A;  2K8A A;  3H8J A;  5AK3 A;  1CRX A;  4O3P A;  5J29 A;  4GXK A;  1T94 A;  4DQP A;  1BNP A;  1TAQ A;  3F2B A;  1ZQF A;  8ICB A;  3RH4 A;  3UMG A;  1MQ2 A;  3V6H A;  1QLN A;  1NJW A;  4YXJ A;  3R9K A;  3AU2 A;  4KLF A;  3QEB Z;  2OH2 A;  4US9 A;  9ICK A;  4Y2P A;  2BHN A;  2PFO A;  3ISD A;  4AYB F;  4QWC A;  1N63 A;  4QJF B;  4TQS A;  2G0A A;  1ZOL A;  4NM2 A;  4BWM A;  3UQ2 A;  2RRD A;  3F5A A;  4DSF A;  5ALW A;  1ZQN A;  2JRZ A;  2KIW A;  2MUT A;  4RNN A;  4RQ2 A;  1L3U A;  3M9M B;  5D49 A;  5L1L A;  7ICN A;  1TAU A;  3TFS A;  5KFA A;  4O3R A;  9ICC A;  3OJU A;  5TZV A;  8ICJ A;  2XGP A;  3HX0 A;  5ALY A;  3UXO A;  3PVX A;  1ZD2 P;  2K8C B;  2G5I B;  4F2R A;  4KLH A;  1DRG A;  8ICC A;  2OWO A;  1DGS A;  1SZH A;  1TE2 A;  1BPZ A;  1X9X A;  1UT5 A;  3BZK A;  3MR6 A;  4CF3 A;  3PW2 A;  1L3S A;  1RYR A;  2PKE A;  4EEN A;  3NVY A;  2XVT A;  3LK9 A;  3JPS A;  4GIB A;  8ICL A;  3LWL A;  4KLL A;  3BQ7 A;  1DGJ A;  2R8K A;  4B9M A;  2H5X A;  2I1Q A;  2WF8 A;  5ALJ A;  3T5L A;  2E1E A;  3GQC A;  4BWJ A;  3AQF A;  1Z00 B;  3CYM A;  1Y88 A;  2ZJ8 A;  3AQE A;  5AKJ A;  2WF5 A;  3WKE A;  5KFY A;  5JRT A;  2W3S A;  4JK1 A;  2XY5 A;  4RUA A;  2KSO A;  1U48 A;  2Y1I A;  4MEX A;  1TVA A;  4R64 A;  2A1J A;  1MN8 A;  2G08 A;  4UB3 A;  4I2F A;  2OCE A;  2YN4 A;  5III A;  5J2F A;  4KLT A;  2F8K A;  2E8P A;  2HBJ A;  2EAN A;  4F72 A;  5KT2 A;  2XY7 A;  1KW4 A;  2Y9U A;  2NRX A;  1NK0 A;  3HP6 A;  2HCF A;  1HJP A;  3ZDD A;  3H4D A;  2ES6 A;  3C5F A;  2QB1 A;  4RPX A;  4EYH B;  5KG0 A;  3PNC A;  2CN1 A;  4BDP A;  3M8R A;  3F2C A;  3EPG A;  4RUC A;  4IL6 U;  2NRW A;  7ICG A;  3PSF A;  5FP0 A;  2XIC A;  5JTI A;  4P4O A;  4F8R A;  2BPF A;  3F53 A;  1S77 D;  1YZ6 A;  3ORY A;  3ZDA A;  3WKA A;  3TAQ A;  1ZJM A;  2R8G A;  1WYG A;  3AM9 A;  1WCN A;  2KVC A;  5HHI A;  4QW9 A;  3GIL A;  7ICE A;  1L8L A;  1IXR A;  1CI4 A;  1SL1 A;  3C29 A;  4TUQ A;  2BDP A;  2PI5 A;  3RJK A;  4ECR A;  3THV A;  4DFD A;  4EYI B;  5DQH A;  2L5Y A;  2F44 A;  2W9B B;  5IIK A;  3NTU A;  1RYU A;  3B0X A;  4PZN A;  2KK0 A;  5AI9 A;  2KNJ A;  2KJ9 A;  5KFF A;  2ASD A;  4RQ4 A;  4DQR A;  4E0D A;  1QQ6 A;  3IHQ B;  4NLK A;  3IM1 A;  1LVH A;  2DUY A;  1ZQC A;  4DEZ A;  3WK6 A;  2JHD A;  4UB8 U;  3BQ0 A;  2FMS A;  5CA7 A;  3K1R B;  5KT3 A;  1K1Q A;  4DFM A;  2RHF A;  4FZN A;  5KT7 A;  4DS4 A;  2W8K A;  5IIN A;  5ALZ A;  3PX0 A;  3RR7 A;  3HPO A;  3PSP A;  4F71 A;  2EAP A;  3MR5 A;  4KLJ A;  5J0T A;  1X40 A;  4B9T A;  1KFD A;  5L1K A;  2NRV A;  3QYP A;  5DB8 A;  9ICF A;  1ZXI A;  5IIO A;  1ZQB A;  4P0P B;  2Y1J A;  3K4G A;  3RJJ A;  4JMU A;  4I29 A;  4NLB A;  2KZ3 A;  4XQ8 A;  9ICP A;  4UBC A;  5AI6 A;  1ZD4 A;  2E8N A;  3Q8R B;  3Q8Q B;  3PST A;  2FJ6 A;  5KL1 B;  4F91 B;  4ECW A;  4OJL A;  1QSS A;  4KN4 A;  2CPR A;  1SWW A;  2NV3 A;  4F4K A;  8ICZ A;  3H40 A;  3DDH A;  1ZQ1 C;  4PHA A;  3GV5 B;  4PJ0 U;  4C4R A;  2FLP A;  5AIA A;  2ZUC A;  4RQ8 A;  3QE9 Y;  1JAL A;  5KFC A;  3CNH A;  8ICK A;  2ISP A;  4RQ5 A;  1QQ5 A;  3EZ5 A;  9ICL A;  3GIK A;  3L4P A;  3PV8 A;  1TK5 A;  2HVI A;  1NK8 A;  4O3M A;  1RYS A;  4P0Q A;  3UMC A;  2B21 A;  3PR4 A;  4G3I A;  4NY8 A;  3JPN A;  4F93 B;  3PZP A;  1P7D A;  2ZXI A;  4QZF A;  1WCL A;  2HOQ A;  1ARO P;  5KFO A;  5A0L A;  5B66 U;  3NVZ A;  4Y2S A;  4YMN A;  2AHO B;  3KHG A;  1ZQT A;  1BGX T;  2UVU A;  4EBC A;  9ICM A;  2R18 A;  2JXJ A;  2BQR A;  1KL9 A;  5EE3 A;  2YML A;  4KLG A;  2CRX A;  1XO1 A;  4I2I A;  4DOA A;  5L9X A;  1A6S A;  3ZDB A;  2F3N A;  2ASL A;  4RQ0 A;  4RZR A;  5DBA A;  4F4X A;  2PI4 A;  4DL4 A;  5J0U A;  5GTH U;  2DL0 A;  4IQT A;  4IR9 A;  4J9O A;  1ZQY A;  3HRD D;  5ALH A;  4ELU A;  2W8L A;  5ALE A;  5JUM A;  2RDI A;  2M0N A;  4RQM A;  4TUS A;  2FLL A;  2IA6 A;  5DB6 A;  4DF8 A;  4C80 A;  4FZL A;  2AGQ A;  2LBO A;  5AM5 A;  4FE3 A;  4Y2J A;  4IR1 A;  9ICH A;  3Q8M A;  2DQN B;  2DGZ A;  2F1I A;  2LMR A;  2XCA A;  3LDA A;  2FPK A;  4WJ3 B;  5J2A A;  9ICE A;  2PFP A;  4RT3 A;  8ICH A;  3SYZ A;  5J0W A;  2EZX A;  3OPX A;  4FO6 A;  4YR2 A;  2XO7 A;  2AGP A;  2HOF A;  2KKP A;  4R65 A;  3FYH A;  3BS7 A;  8ICO A;  3PX6 A;  4QWA A;  3HIL A;  1JXE A;  2G5H B;  9ICW A;  4LZG A;  2GH1 A;  4ED0 A;  4K4H A;  3GV7 B;  4ELT A;  4DF4 A;  1ZQK A;  1HUZ A;  4K4I A;  5AKY A;  5IIJ A;  5DDM A;  3QU9 A;  2OEH A;  4UB2 A;  3TAD A;  5AK6 A;  3F2D A;  1J2N A;  2ZJ5 A;  3S6J A;  2P35 A;  3BS5 A;  4NWI A;  4CE6 A;  2DKZ A;  2BPC A;  3KKA C;  4YVZ A;  1NZP A;  2Y9T A;  1ZQU A;  5CB1 A;  2AGO A;  1SZP A;  2DF4 B;  4RQ3 A;  4P0P A;  1WWU A;  4NLZ A;  2HHW A;  9ICG A;  4QZB A;  2P6U A;  1L3T A;  4GXJ A;  2BQ3 A;  3SI8 A;  5KT4 A;  1SL2 A;  3M8S A;  4Y2Y A;  1T3N A;  2WF7 A;  4NL9 C;  4MF8 A;  1YT3 A;  5KTQ A;  3T5H A;  5AKZ A;  3NRZ A;  1J2M A;  3LYS A;  5KFT A;  4JV2 A;  4RQN A;  2VKQ A;  1ZQD A;  2XI9 A;  4ECQ A;  3RRH A;  2ZIV B;  1DK3 A;  3TAP A;  4DL3 A;  3TFR A;  2R8H A;  4HYK A;  3HKZ F;  4UAU A;  2DPI A;  3IN5 A;  5L1J A;  3WK4 A;  4IC9 A;  2FLN A;  5DG9 A;  5KFI A;  5ALL A;  1XWL A;  3C21 A;  5J0X A;  4F92 B;  4IRC A;  1K1S A;  1U4B A;  3FC4 A;  1Q46 A;  3NRW A;  2BPG A;  4M9N A;  5EE1 A;  2ZIX B;  5DDY A;  4J9Q A;  4RNM A;  1MC8 A;  3SEI A;  4DFP A;  1ZQG A;  2DWQ A;  5J0O A;  9ICS A;  5EWE A;  1NK5 A;  2VJ5 A;  3GII A;  3V7L A;  5DQG A;  2FMQ A;  5L1M A;  5J0S A;  2VIX A;  3CW2 C;  3QUT A;  2M9N A;  3H0M B;  1N48 A;  1QQ7 A;  4LZD A;  4P4P A;  4NLN A;  1JN3 A;  5HR6 A;  3VC8 A;  4Q45 A;  2YTU A;  1T7P A;  4B9V A;  1NKB A;  2HOI A;  3M9O B;  5J0Q A;  3I1Y A;  5AI5 A;  4YXM A;  2W04 A;  1S76 D;  1X6I A;  1KTQ A;  3Q8K A;  3G6V A;  2XGQ A;  1TFR A;  2DFL A;  4O3N A;  3HT3 A;  4Y2T A;  3MGV A;  1U47 A;  1ZQJ A;  2HHV A;  1ZQO A;  2RDJ A;  4ED8 A;  1D8L A;  7ICK A;  2E3T A;  3ED5 A;  4O3Q A;  4YR3 A;  5KFU A;  3ZDE A;  1JRO A;  1U49 A;  3KBB A;  1ZQW A;  4DSJ A;  1JMS A;  1KN5 A;  2JMG A;  5HP4 A;  4RU9 A;  3KD3 A;  2C2D A;  1JX4 A;  4CDG A;  1ZQE A;  4I2A A;  4C7Z A;  1O08 A;  4DL5 A;  4BUG A;  2W03 A;  2ZUD A;  2BCS A;  4B9S A;  2K89 A;  3SQI A;  3M7D A;  5EE9 A;  4NM1 A;  1SXE A;  1UCV A;  3WK5 A;  5KFQ A;  2KJ8 A;  4U7C A;  4ECX A;  2W9C A;  4KLE A;  4RQ6 A;  1ZQL A;  4BXO A;  1FEZ A;  3U26 A;  2MU2 A;  4MHV A;  3BQ2 A;  4PHD A;  1HIW A;  2YMQ A;  4MFA A;  1KQQ A;  1NKC A;  2JZB B;  1PK1 B;  1MA7 A;  1KDH A;  3ZD9 A;  1TKD A;  3QX7 A;  3WKB A;  3C2M A;  1UA1 A;  1SWV A;  4FFD A;  4EEL A;  5KFM A;  2E8O A;  1NJY A;  3WK7 A;  4F4Z A;  3QNM A;  5AK5 A;  4Z6E A;  3IV6 A;  5AKH A;  4FS1 A;  1OXJ A;  8ICV A;  2OYY A;  1C20 A;  3MR3 A;  2KV2 A;  1S10 A;  4KX3 A;  4J9S A;  4RQ1 A;  3HKZ C;  5KG7 A;  3TAN A;  1RQN A;  3H7I A;  4O3O A;  1Q3V A;  2GLE A;  3D2N A;  5E79 U;  4QWE A;  2HW3 A;  1Z4N A;  5J2H A;  2H3V A;  3M9N B;  4LVS A;  4Y2U A;  4JWN A;  3O0F A;  1VLB A;  3MFH A;  2MRL A;  3RJE A;  3JPR A;  9ICR A;  4PGQ A;  5J8Y C;  3T5J A;  2ZXH A;  4DS5 A;  1BPY A;  2XID A;  3EYZ A;  1RXW A;  2EQY A;  2ZIU B;  1ZQI A;  9ICJ A;  4I2H A;  1ED1 A;  2IMW P;  5KG3 A;  3N28 A;  5L1I A;  2K4I A;  1LKY B;  3LVW A;  8ICQ A;  2AXT U;  2HSZ A;  9ICB A;  8ICW A;  4GXI A;  2HHS A;  4PL2 A;  2KMD A;  5KFS A;  5AKE A;  1L7P A;  3PW7 A;  3QXG A;  4F50 A;  4EZ6 A;  3MC1 A;  1X66 A;  2VJ4 A;  3RB3 A;  3PSI A;  3RF9 A;  1FIQ A;  4J9M A;  9ICN A;  3OTQ A;  5CWR A;  2HMX A;  5IIL A;  1FFV A;  3RB0 A;  2HHT A;  4UB4 A;  4NXZ A;  3VCB A;  1VJ5 A;  5J2C A;  4KLS A;  2PMZ C;  9ICU A;  1D8Y A;  1TK8 A;  5AKG A;  1B4F A;  2Q4T A;  1Z1V A;  3BQT A;  2D3D A;  4FBT A;  1GO3 F;  1WG8 A;  1NKE A;  4DQI A;  5KAF U;  4C8O A;  2F8L A;  3IRU A;  4J03 A;  2JEI A;  3ISC A;  4Y2R A;  1TK0 A;  5CRX A;  4M6W B;  2P6R A;  1V85 A;  4JUZ A;  2HHU A;  4DFJ A;  7ICF A;  2UVW A;  2W7O A;  3V7J A;  1PVP A;  2KZM A;  5KT5 A;  2BDU A;  4PGX A;  4BGD A;  4KLQ A;  1ZQA A;  2ZG6 A;  2KOB A;  4ZOH C;  1X9W A;  5AKL A;  2NRT A;  1L7M A;  1NI3 A;  5F9L A;  1SIJ A;  5AI4 A;  1NK7 A;  2F76 X;  8ICI A;  3KZX A;  1QCK A;  5HML A;  2XY6 A;  7ICV A;  4OJ6 A;  4Q8E A;  3I76 A;  4KTQ A;  3T79 A;  5AKX A;  4DL6 A;  4FBU A;  2RP5 A;  5J2K A;  1NK4 A;  2W7P A;  3AU6 A;  4OCZ A;  2Y0S C;  3ETL A;  1PK3 A;  4MFC A;  1JI7 A;  4TUP A;  4EZ9 A;  1NK6 A;  3C1Y A;  1BVS A;  2ZTE A;  3JPO A;  2LKY A;  3IG5 A;  3ONN A;  3OHA A;  5KFX A;  2ATL A;  4OD0 A;  3KHR A;  2QAR B;  4DOC A;  2RLT A;  4GLX A;  5EWG A;  3QUC A;  2KJ5 A;  7ICH A;  1Z00 A;  4AP9 A;  5BOM A;  4QNL A;  5KFR A;  1SV0 A;  4R66 A;  1X9S A;  1N5X A;  4FZM A;  7ICT A;  1Q3U A;  1NZB A;  4DSK A;  4PZO A;  2EDU A;  5CJ7 A;  1ZQP A;  5EE0 A;  5H2F U;  3RBE A;  4RNO A;  2OM6 A;  4JV1 A;  1L6N A;  2BGW A;  3N7P D;  5ALG A;  4UQG A;  4C4S A;  4KIT B;  5DB7 A;  3QU5 A;  3RAQ A;  1XC9 A;  3PY8 A;  2VAN A;  5DBB A;  1UHU A;  3UMB A;  3GIM A;  2KTQ A;  5ALK A;  2KN7 A;  4OJ5 A;  4UBB A;  1XNS A;  4MFF A;  1XS9 D;  1IG6 A;  2A19 A;  4QZG A;  5CEH A;  1BPX A;  3FAH A;  2QKQ A;  1RZT A;  1BPD A;  1DXS A;  4EEK A;  2A1A A;  3JPP A;  2PFQ A;  1PVQ A;  2BCQ A;  3T3F A;  3TKA A;  2IOF K;  2HBM A;  5D4B A;  3RJH A;  3KFU F;  2PFN A;  2QB0 B;  2YMM A;  4UAV A;  4UAZ A;  1A0P A;  4C8N A;  1T4G A;  5KFV A;  1ZQV A;  3MDC A;  2K4H A;  2W9B A;  1LV5 A;  5G5G A;  2YB4 A;  4KX5 A;  4PH5 A;  2KFZ A;  5AKI A;  3L3F X;  1ZQZ A;  4IQU A;  4F5R A;  2KIC A;  9ICX A;  4P4M A;  5F3X B;  1S97 A;  4DSE A;  5ALT A;  2KZZ A;  2I9G A;  4YMM A;  5CR0 A;  1F5S A;  1V97 A;  4I27 A;  2WF9 A;  2LPE A;  4OO1 J;  2G07 A;  3PR5 B;  3QZ7 A;  2FMP A;  2VA2 A;  3EWA A;  5KFZ A;  3V6K A;  4UAY A;  4F5O A;  3ZDC A;  4ED7 A;  2ALZ A;  3GZF A;  2EAO A;  3M6K A;  3MGH A;  1WUD A;  4KN7 A;  1PZN A;  3WKD A;  1S9F A;  4USA A;  4UB5 A;  1XO0 A;  2YQE A;  4C8M A;  2B6G A;  2ODG A;  2V9W A;  1BNO A;  3AL0 B;  4GC6 A;  1KSP A;  3NGD A;  2AQ4 A;  2H3F A;  4B6J A;  1S0M A;  3WK9 A;  3OGU A;  1CEZ A;  1YZ7 A;  2C28 A;  5ALS A;  2JH1 A;  3K1Z A;  4EBE A;  1M6Y A;  5KFE A;  2E5S A;  1SKR A;  4CNQ A;  1Z19 A;  5J2I A;  2W9A A;  1B0X A;  2D8C A;  4Z6F A;  3GIJ A;  5B5E U;  3EW9 A;  1KBU A;  5DKW A;  1AQ6 A;  2Z7J A;  3RBD A;  3PO5 A;  3NVW A;  2MAX A;  1A77 A;  4O5C A;  4TUR A;  4YMO A;  1T3Q A;  4IRK A;  4ED3 A;  5HHH A;  7ICP A;  4R8U B;  1XSL A;  1S0V A;  4XUS A;  5J2J A;  3D6J A;  4JV0 A;  4YQW A;  1A76 A;  2J6U A;  1SXD A;  2W9M A;  2HHX A;  1JIH A;  3C5G A;  1URJ A;  2P66 A;  4ECY A;  4YP3 A;  1X42 A;  3MFI A;  1ZD5 A;  4XRH A;  4O5K A;  4ZH4 A;  2KG5 A;  5AHX A;  4I2E A;  9ICO A;  2A1J B;  2OXO A;  1NJZ A;  4DSI A;  2NO4 A;  5EOZ A;  5BOL A;  2F1J A;  2G09 A;  3G6Y A;  2MA1 A;  5HR7 A;  3AEV A;  1O03 A;  4O0I A;  1QTM A;  3QU7 A;  3ZD8 A;  1CUK A;  4KLM A;  5ALM A;  2ZTC A;  1N62 A;  2IOH A;  4Y2V A;  1SGG A;  4OJO A;  4F5P A;  3QUB A;  3T5K A;  3NAS A;  1XU4 A;  1L5U A;  5KFH A;  8ICN A;  3PW5 A;  5BPC A;  3RFA A;  5DGA A;  4EBD A;  1B22 A;  1IM4 A;  4UB1 A;  5F9N A;  4CGZ A;  5KL8 B;  1UQV A;  1JUD A;  3ICX A;  4B9U A;  2QB0 A;  4ECU A;  5KFK A;  4F4Y A;  7ICM A;  4B9N A;  2PMZ F;  3KOO A;  4IRD A;  3UM9 A;  4UAT A;  4JWM A;  4Z6C A;  1Q8K A;  3M6Z A;  3KHH A;  5DLG A;  2HBL A;  2C2R A;  3DEE A;  1NK9 A;  3WK8 A;  3MGI A;  4M9L A;  2RQ5 A;  4RQ7 A;  3TAR A;  4YFK A;  1KFS A;  3M1Y A;  3AMZ A;  2NRZ A;  2W3R A;  2K60 A;  4F4W A;  2DBY A;  2N1R A;  5AIB A;  4PPX A;  2HI0 A;  4CF5 A;  2MSN A;  2W43 A;  3HW8 A; 
#chains in the Genus database with same CATH homology
 2GH1 A;  2H3Z A;  2VJ5 A;  4QNL A;  4ICA A;  2HOQ A;  2K4E A;  2HMX A;  4FZM A;  2OXO A;  2VIX A;  2H3Q A;  3VCB A;  1NZB A;  1Q3U A;  5A0L A;  2WAQ F;  4OO1 J;  2A3V A;  2G07 A;  2JHD A;  2PMZ C;  2G09 A;  4KMO B;  1D8B A;  2MA1 A;  2G08 A;  5HR7 A;  2OH2 A;  3IG8 A;  3E0F A;  4QIW F;  3F2D A;  3H0M B;  2Q4T A;  4NWI A;  2OM6 A;  2JH7 A;  3CP8 A;  3N7S C;  3GZF A;  3NUQ A;  1GO3 F;  4A8E A;  2HBJ A;  3M6K A;  2H3I A;  4AYB F;  1F44 A;  2R18 A;  1WUD A;  2DF4 B;  2RHF A;  4FZN A;  1L6N A;  4QJF B;  3SAG A;  2YB1 A;  3F5E A;  4P0P A;  2F8L A;  5HR6 A;  3N7P D;  2CRX A;  2K8B B;  2G0A A;  3VC8 A;  1XO0 A;  3PSP A;  2OYY A;  3IP4 B;  4BX9 C;  2KV2 A;  4U6P A;  2HOI A;  4C0Z A;  4KX3 A;  1A6S A;  3CRX A;  4OJO A;  2RRD A;  2F2A B;  2Y0S F;  3F5A A;  5CRX A;  3AL0 B;  2W04 A;  3HKZ C;  2GOL A;  2KHQ A;  2KIW A;  3N7R C;  2CN1 A;  5C0Y A;  2ZIW A;  3LVV A;  2YX8 A;  3F2C A;  1Q3V A;  1HEK A;  3D2N A;  4OJP A;  3RFA A;  2W7O A;  4OJ5 A;  2H3F A;  1XNS A;  3MGV A;  1YT3 A;  4P0P B;  2WB1 F;  1PVP A;  2JGA A;  3H0R B;  2BDU A;  2H3V A;  3PSF A;  3SMV A;  4JMU A;  4CGZ A;  4NLB A;  2XIC A;  3LYS A;  2ZG6 A;  2E1F A;  5KL8 B;  2JH1 A;  2KOB A;  2WAQ C;  3K1Z A;  3F53 A;  2M0N A;  2G06 A;  2E5S A;  2VKQ A;  3O0F A;  2XI9 A;  3SAF A;  2K8C B;  2G5I B;  3PST A;  4GFJ A;  2ZIW B;  2JMG A;  4OJL A;  5KL1 B;  2ZIV B;  1Z19 A;  1DRG A;  3ICX A;  2MRL A;  1Z1B A;  1OUQ A;  2F76 X;  2D6F C;  2CPR A;  4CDG A;  1PVQ A;  3KZX A;  4NV0 A;  1SZH A;  2NV3 A;  4AYB C;  4FZL A;  2KVC A;  4ACO A;  2ZIV A;  2LBO A;  4OJ6 A;  1ZQ1 C;  3D2S A;  1KBU A;  2LYA A;  2KD1 A;  3HKZ F;  2ZXH A;  2KEY A;  4FE3 A;  4BUG A;  3T79 A;  2XID A;  2PMZ F;  2W03 A;  2ZIU B;  2Z7J A;  3IN5 A;  1TAM A;  2RP5 A;  2HBM A;  1ED1 A;  2DQN B;  4IC9 A;  3C29 A;  2W7P A;  2XVT A;  2DGZ A;  1P7D A;  3KFU F;  3M6Z A;  2HBK A;  1IIP A;  2HBL A;  2K89 A;  2Y0S C;  3DEE A;  3SQI A;  2K4I A;  2ZIU A;  3M7D A;  3LVW A;  4WJ3 B;  4PL1 A;  1PVR A;  4CRX A;  3PSI A;  3GU3 A;  1A0P A;  2KJ8 A;  2KKV A;  4QIW C;  1MA7 A;  3H0L B;  4U7C A;  4P0Q B;  3OPX A;  2LKY A;  3IG5 A;  2LHT A;  3ONN A;  1UPH A;  4PL2 A;  3NRW A;  2WB1 C;  2HOF A;  2E1E A;  2N1R A;  2KKP A;  5T14 A;  4O3M A;  2KHV A;  1URJ A;  2ZIX B;  4NLC A;  3AQF A;  2K4H A;  4P0Q A;  3SAH A;  4BJQ A;  3CYM A;  2KNJ A;  2YB4 A;  3ALR A;  4KX5 A;  3L3F X;  2KJ9 A;  2VJ4 A;  2K8A A;  2KIC A;  3C28 A;  1CRX A;  1HIW A;  2KJ5 A;  1T94 A;  3PZP A;  2ZIX A;  3AQE A;  2F77 X;  2G5H B;  3F2B A;  3D2Q A;  3RF9 A;  1ECW A;  2LYB A;  2ZXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...