1UPIA

Mycobacterium tuberculosis rmlc epimerase (rv3465)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
200
structure length
198
Chain Sequence
b'MKARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVSSAGVLRGLHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHGFLALQDNSTVMYLSAEYNPQREHTIATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDVRASGLLPRWEQTQRFIGEMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DTDP-4-DEHYDRORHAMNOSE 3,5-EPIMERASE
publication title Mycobacterium Tuberculosis Rmlc Epimerase (Rv3465): A Promising Drug-Target Structure in the Rhamnose Pathway
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Epimerase
total genus 43
structure length 198
sequence length 200
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2003-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1upiA00
5FPZA 3RPQA 4ONUA 1RGSA 4LUMA 3BU7A 3GBFA 1QY4A 1J1LA 2D5FA 3VHRA 1G6NA 1UD1A 1TQ5A 1ZZ9A 1ZRCA 3SXWA 5I0RA 4XFFA 2QDRA 3KSCA 2IXHA 2BYVE 3I59B 1O5UA 2CAVA 4HSJA 1RL3A 1OI6A 3CJXA 4HVOA 2ZKLA 4TLFA 5J7MA 1RUOA 5EFUA 4LUKA 2XL9A 1J3PA 2GZWA 4HLTA 5CU1A 4EWEA 4QXKA 1FI2A 4KU8A 4I09A 1UIKA 5J3UA 2P17A 3E6CC 1CAXA 3OF1A 4X6RB 1WLTA 4RD7A 3IIAA 3NVCA 1VJ2A 1YFWA 1ZZ7A 4IETA 3RZZA 1X8MA 4Q0UA 3S0MA 3USSA 2O8QA 3KCCA 3H1MA 1L3JA 2Q0AA 4K8FA 3LA2A 2Z69A 1ZRDA 1O5LA 3H3UA 1NYWA 4XF4A 1ZRRA 3WW4A 2QVSB 1O3QA 2XLFA 5KHKA 4PJYA 4Z07A 4HMZA 3E6DA 4I2OA 3H1YA 3E5XA 4F8AA 2BNMA 1QXRA 3M70A 2GH2A 2D93A 3TNPB 3UKNA 1QXJA 2B5HA 4I01A 3D0JA 5J48A 5JR7B 2FMYA 2BEOA 2CGPA 3DL3A 4HZFA 3NSTA 4IEZA 5I0UA 5BPXA 5KHGA 4KWJA 4LULA 1GQGA 1YFYA 3H50A 3H9AA 4WBBA 1EY2A 2ETEA 2DCTA 3EQEA 3H3ZA 3EJKA 1H1IA 5F1RA 3CLPA 2Z2SB 3MPBA 4JTNA 3OTFA 4FAGA 1PMIA 4LEJA 3SMHA 3DV8A 4BHPA 4QGLA 5LEKA 4I02A 4IEXA 5T3NA 2ATFA 2B9UA 1YUDA 3KGZA 4XFCA 1RC6A 1RUNA 3FZ3A 1LRHA 3MYXA 2F4PA 3ES1A 1CAUA 4P9GA 2VPVA 4PIYA 5FQ0A 3S7IA 4XETA 3IWZA 2V09A 4HVRA 4I3PA 3CL1A 4BIFA 2XHKA 1O7FA 2WFPA 5FDBA 1UPIA 2PQQA 4LTAA 3WW2A 3S7EA 2CV6A 2GC1A 4I0BA 2VECA 2PHLA 3MZHA 3BCWA 3MDPA 2XKPA 3D82A 1Y3TA 5I0TA 4BYYA 4E2SA 2QJVA 4HN1A 1H1MA 2IXJA 3N4MA 4Q0PA 2EAAA 3EBRA 4E2GA 5JSRA 1DZTA 2GAUA 2H6CA 1YWKA 4XFHA 3BB6A 4XF3A 1DGRA 1Q5OA 3CF6E 2HKXA 3DKWA 4KL1A 4WVZA 1IPJA 5AVPA 4YARA 3IDCB 1J3QA 1YLLA 5KBFA 1OD5A 5JSPA 1QWRA 4UBGA 4O9GA 1DZRA 3FWEA 5BXXA 2PFWA 4MX3A 1J58A 1I6XA 2MPFA 1NE6A 3ROUA 4EV0A 5E1RA 4MV2A 4N9IA 2I45A 4I0AA 3GYDA 4AXOA 4Q0SA 4FBFA 1FXZA 3I54A 5LRSA 5I8TA 2O1QA 4X6QB 3HQXA 2UY8A 4XFAA 2BNOA 3PLQA 4IEVA 4L2NA 1ZZBA 3E5QA 4IEPA 1CAWA 3ES4A 1CGPA 5I8SA 5FPXA 3WW1A 3C3VA 4WZCA 1X82A 2GC2A 4AQ2A 4AQ6A 5HI0A 1CX4A 1VR3A 4QGNA 4OFGA 4ORFA 2ET1A 2PHDA 2PAKA 4XF1A 2OZ6A 2K0GA 3H1WA 4ZU5A 1EYBA 3HIFA 4MGZE 4AVBA 4L11A 4AVAA 4LLOA 4QGMA 1XE7A 3U10A 2XL7A 4KWKA 1LR5A 4MUVA 4ZU7A 4GULA 3H7YA 4JVAA 2XLGA 3ACLA 3UKTA 2KXLA 3RYKA 3ETQA 3OCPA 5FLIA 2PA7A 2QCSB 1UCXA 3SCHA 5I8YA 4Q0QA 4MH0E 4D7TA 5CADA 1O3RA 4EROA 5I91A 5JAXA 1U12A 1YFXA 3NW4A 2CAUA 2B8MA 3HT1A 4XF9A 2H0VA 2N7GA 3OD0A 1SFNA 4BH9A 1NXMA 5KHJA 3CEWA 3BALA 3TNQA 3LWCA 2HJIA 2Y0OA 3BPZA 4FAHA 5KHHA 2PAEA 3QACA 2PAMA 2XLAA 2XGXA 1ZZ6A 1OFNA 5JCTA 1XE8A 4XFIA 1ZRFA 2GU9A 1SQ4A 5I0SA 2IXLA 4IEOA 2K9ZA 3LOIA 1XRUA 2QNKA 3M3IA 5C6CA 5D1IA 4PIZA 3RNSA 4F7ZA 4J1XA 1CAVA 1WGPA 5CVRA 4FT8A 1OMIA 3E5UA 1UW8A 1JUHA 5BY5A 3ELNA 3HT2A 3LZZA 1ZZCA 4IEUA 3NL1A 4IESA 1O3TA 2OZJA 4IEYA 1YFUA 3E97A 4J1WA 4IERA 3FHIB 3IDBB 4B29A 3D0SA 3ZDSA 1NE4A 4XEZA 5BUVA 2IXIA 3CO2A 4E2QA 1CAXB 1FT9A 2VQAA 1WA4A 3WW3A 4UBHA 3U11A 3NJZA 5C8WA 4MGIE 5EZWA 2ET7A 2BNNA 4HSLA 1DGWA 2E9QA 1ZZ8A 4XFBA 3IBMA 4JTOA 3ST7A 3G7DA 4Q29A 2OYZA 4LA2A 4KU7A 4A2UA 5FLHA 3RYRA 1O4TA 3KMHA 2WC2A 3FE5A 3I59A 3EHKA 4HN0A 3FFQA 4XF0A 4MZUA 1ZVFA 2MHFA 3RYPA 1CAWB 2Q30A 3LA7A 3H7JA 4QMAA 2IXCA 5JSOA 1LKNA 4YNIA 3OGJA 2UYBA 5KHIA 4XFGA 4D7SA 3KGLA 5BV6A 4IEQA 1ZREA 4YSFA 2D40A 3LAGA 4EWAA 1YHFA 5FLJA 1ZX5A 4HVQA 3PVBB 1GQHA 1Y9QA 3NKTA 4META 2IC1A 3B02A 4HBNA 5LRRA 4EWDA 4JV4A 1LB2A 3EO6A 4H7LA 3H8UA 4R8HA 1PM7A 3QOPA 1EPZA 3JZVA 4Q0VA 1Q43A 4PIXA 4Z82A 1IPKA 2OPKA 4MGYE 1X8EA 2EVXA 2IXKA 4KWLA 2EA7A 4YYOA 2GC0A 4R52A 1CAUB 5LEJA 5FQ0B 4OLLA 1O3SA 1J3RA 4LA3A 3FX3A 3L2HA 2FQPA 4AVCA 5I93A 2UYAA 4QX5A 1Q3EA 1NZCA 4ZU4A 4YRDA 4NVPA 4UXAA 4IEWA 1UIJA 1VP6A 2H6BA 2GC3A 3PNAA 2UY9A 3UKVA 3R6SA 1CAVB 1SEFA 2PYTA 1I5ZA 2C0ZA 4DINB 4N9HA 3SCFA 5K8SA 1J59A 3O14A 2Q4SA 1EP0A 4MGKE 2OA2A 2Q1ZB 2BGCA 5FCCA 1V70A 3RDIA 1ZNPA 4QM8A 5E16A 3E6BA 4CYDA 2MNGA 2PTMA 3I7DA 1HW5A 3SHRA 1RTVA 4QM9A 2XKOA 3SCGA 3U0ZA 1X7NA 3LA3A 4O9EA 2ZCWA 2D5HA 3FJSA 3DN7A
chains in the Genus database with same CATH superfamily
4SLIA 1YIPA 2J1SA 1FNYA 3W20A 4QKBA 3RPQA 4CP0A 4AL9A 1VBE2 4QQOA 4LUMA 4OMCA 1UYZA 3BIWE 3BU7A 4Q5OA 3O1VA 1QY4A 4BM8A 1UKGA 4NOTA 4A4AA 5HXVA 1KJLA 1JN2P 2PHUA 3OY8B 4LMFA 3VHRA 3ZPYA 3G6JB 1UPSA 4ATFA 2ZOEB 3NNGA 2QDRA 3QH7A 4XFFA 3T1LA 1PO21 4DXSA 4YGDA 2QE3A 2CL2A 2W1SA 2ZZQA 3I59B 1O5UA 3S30A 2HWD1 2R062 4HSJA 3POWA 1OI6A 3CJXA 2VCCA 4D6SA 1ULFA 1YQCA 4XYXA 1VALA 3HPNA 1AR71 4QXCA 3AM2A 2QQKA 2ZXQA 4E4HA 4S2FA 1T6BX 4TTGA 4QXKA 1FI2A 4CU6A 2DVDA 5DG1A 4OUSA 4QXBA 1W9WA 3KVBA 5FYIA 2O14A 3RG0A 1CAXA 3KD4A 5IYYA 2R1DA 3OF1A 4JHTA 5A70A 4ASLA 5FR3A 1HV0A 1G9CA 2C24A 1LULA 1AR93 1PO13 1HX6A 4X6RB 2G9GA 3SLIA 4XJZA 3BOWA 5JZGA 4TXWA 2WZEA 1ZZ7A 3MIGA 4IETA 1SFPA 4BQWA 2J1VA 2ZX3A 1XU2A 5M0TA 5IAXA 3USSA 2ZEWA 1LGBA 4HKLA 5GLZA 3OYWB 4FQ4A 2HYXA 3KCCA 1GP4A 1W6MB 2X09A 2FCUA 4AAXA 2VTXJ 2ILMA 5A3TA 1MS3A 2GNMA 3M3CA 1E5HA 4XJWA 5FMCA 1NYWA 1OF4A 1ZRRA 3WW4A 5FP4A 1ZYBA 5CISA 3JBG3 4FPKA 2WWJA 4B7KA 5FZ6A 5IJRA 4QQLA 1HIXA 4IDZA 1R1A1 3LIHA 4CEYA 4Z07A 4RR3A 2X29A 3CMGA 4HMZA 4CZSA 4CCKA 2HEYF 1EAH1 2BP6A 1ND2C 3H1YA 3TWIA 5ISLA 2R041 4P9YA 4F8AA 5KR7A 3M70A 1JODA 2GH2A 4FI9A 5FY8A 5HCAA 2D93A 4LQRA 1BBT2 1DG6A 1IS6A 2B5HA 3KV6A 4CUAA 2EIBA 3HR9A 3WCSA 3O0WA 5CIRA 4FOQA 4Z92B 5BNNB 1BLZA 3NSTA 4IEZA 5BPXA 3WNKA 3JD71 5KHGA 3O1TA 1AL21 4AVTA 1WCQA 4LBKA 2FBEA 1C8M3 2CHHA 2WQ4A 5IVJA 1AYN1 4NN0A 4YVSB 4N53B 3WNXA 3POSA 1IS3A 1S0EA 2XBO3 1STMA 1WW6A 3IDAA 2QBXA 2VR4A 2VCAA 5FZDA 5A7WA 4BQ5A 1O8SA 2B45X 3R4SA 4C8DA 1SLCA 5ACA2 1QJY2 4LEJA 2BFUS 5IWFA 3M8LA 4H14A 4Y1ZA 2C1FA 3SMHA 4BWOA 2NPIA 2WS91 1VRBA 4AGGA 4FFFA 2VAUA 4RGKA 4AZZA 2PHFA 4Q4V1 4C1XA 3ACFA 5LEKA 2WO2A 1YUDA 5FZFA 1WW5A 2WNVA 2WABA 3W5MA 1LHOA 3ES1A 3DGTA 4OZOA 4PIYA 2UU8A 2WQZC 1W05A 3KS7A 3AP9A 4Z8BA 1TG7A 1UXXX 3UK9A 1S0GA 3WQBA 4DRVA 2ZAHA 4I3PA 3AVSA 3GZAA 3ZFFC 1XE0A 1G9FA 3MEPA 1FV2A 1BZWA 4BOWA 5E8AA 4BZ4A 1G86A 3K3NA 5FZ9A 2XJQA 4P00B 4AHZA 2GC1A 2RDQA 1NG0A 4I0BA 4XUPA 3VD5A 4BQ2A 3AX4A 2PHLA 2XG3A 5EYXA 2LM3A 5C8CB 4J6GA 3TN93 2DBNA 1IS4A 1C5IA 2QQIA 4TSVA 1NCRA 5FKCA 1MS5A 2WBKA 2QJVA 2AACA 2JJ6A 5IVYA 2ZEZA 3TOJA 4QU2A 4CUBA 1AR92 5A1FA 1H1MA 3CJIA 3SH3A 4JHZA 4GWNA 2YUEA 5IVFA 5JLVA 1C1FA 3AMNA 1QDOA 5FZLA 3NV1A 1DZTA 5FK8A 5FY0A 3PIGA 5DUWA 5IK4A 1T6GC 1V9U1 2H6CA 4P08A 1XOYA 1WD3A 1WMEA 2JECA 3SH5A 3LGRA 3H8XA 5KC5A 2DURA 5FZ7A 3UJQA 2TNFA 3BB6A 2FCTA 1O91A 2VL4A 4XIOA 4Q4Y1 3OEAA 4FP2A 4ASKA 5DXDA 4CDUA 4YVWC 3JBG2 3PIJA 1D0HA 3DKWA 3VBUB 1DGRN 1Q8OA 2RM23 3OBRA 3J26N 4EN0A 4GJZA 1RMU3 3N36A 4BXSV 1QH6A 1J3QA 2Y38A 2WZ8A 1D4M1 1MEC3 2CY6A 4H55A 4OHZA 3ZFGC 1OOPB 2V72A 3HN3A 4KBZA 4S2DA 1G9BA 1VBC3 2GP5A 1V0AA 4IE0A 3WQ1A 2E32A 4LO8A 5FO8B 3ROUA 2ENRA 2C26A 1NY72 4KWUA 1QQP3 4NUBA 5E1RA 1UOFA 4RA0A 2HWF2 2WT0A 1MACA 3HBZA 4N9IA 2WT2A 4SBVA 4UFJA 5F5AA 4Y1YA 1IHMA 2PN5A 2YU2A 3TEZA 2JB4A 3I54A 3O0XA 4M01A 2G9FA 4QQPA 4UFHA 4WM7C 3T08A 1MQTA 1XNDA 2HLEA 2ZGNA 1MS9A 3LEGA 3HQXA 4XFAA 1ASJ3 4RR3B 1SFYA 3ACIA 1X9PA 1FOD3 1T2XA 4NR1A 3LFIA 4R9DA 4XBQA 1OUSA 2QQPA 3VL8A 2VD7A 5FBZA 1E57A 4DRRA 1DQ1A 4WZCA 1X82A 4LBLA 4AQ2A 5LWBA 2DCJA 3U78A 1QKQA 5FV3A 5FZGA 5HI0A 2RJKA 4AK3A 4JC1A 2PLV3 2WRAA 2JXAA 4XJUA 3VBHB 4CRQA 3VZLA 5FZ4A 2YROA 4ORFA 2JKXA 1EV13 5APAA 4RN5A 1JOJA 3ZXDA 1G9AA 4XF1A 3AYDA 4E4DX 2OZ6A 2K0GA 2OQ7A 4ZU5A 4M4RA 2ZHKA 3UETA 4AI9A 3PMSA 2V4VA 3X29B 2D6LX 4AVAA 4LLOA 1XNCA 5D21A 2A3XA 4QX8A 4AQSA 1DBNA 1LR5A 4FPJA 3AZVA 2HWB1 2W52A 5FOJB 4JVAA 2XLGA 3BTXA 4RSUA 3GJBA 3UKTA 2XWBB 2ZACA 5FYBA 1ZBA1 2OUHA 2EF6A 3VBRA 3WINE 5B2GB 1R091 2X53S 1FPN2 4HT1T 2BUKA 5IUQA 1HXS1 1XNKA 3C2UA 4MH0E 1BK1A 3CZUA 1W6QA 4D6RA 1JZ4A 2A6YA 3VD7A 2VTFA 1BVP1 3JXSA 2CAUA 3N7MA 2N7GA 3R0RA 1NCQA 1BMV2 1YRZA 2Y8KA 3RVHA 4QPGA 2YBPA 1JZ2A 1NXMA 4Y20A 5C71A 3BALA 3GM8A 2VMGA 2W46A 1XYOA 3I2IA 1PK6B 2HJIA 2TUNA 3ALQA 3NAPB 5CG8A 1O8PA 1R082 1SPPB 1UMHA 3AMMA 5L9VA 2IVIB 2H0BA 2VH9A 1OFNA 3GXUA 1AYM1 4XBLA 4D3WA 4HKWA 1PIV2 1OC1A 1QOSA 2Y6JA 3HOBA 5CBLA 2FMDA 4NO4A 4C0HA 3DPRA 4IEOA 4N43A 1KRIA 4P5HA 1AZDA 1XRUA 1KFUL 2QNKA 1REEA 3M3IA 4AG4A 3POBA 5FZBA 1JHJA 4AVSA 1UY2A 4MXVA 1W8WA 3NJYA 2JDKA 3ORJA 2AC1A 2W1WA 3RNSA 3Q9OA 2WIIB 4J1XA 1OQDA 1OMIA 1SBDA 2JG8B 2GP3A 3MO4A 1WCKA 1UW8A 5HCHA 1JUHA 1H9WA 2RV9A 3AB0A 3DUIA 1V6JA 3C7EA 3FBYA 2BTVC 1QXPA 3ELNA 1VBC2 3JUUA 1OPMA 1PMJX 1Y9MA 1ZZCA 4IQPA 1RHI1 4IESA 4CCEA 3U4SA 1REFA 1O3TA 1Y4WA 2HBTA 1JYCA 3HWJA 4TN7A 3ZSLA 1W8FA 1YFUA 3K4DA 2VZ3A 1KITA 3FFZA 4MOAA 1R1ZA 5GLTA 2A73B 3IDBB 2WAOA 4B29A 2QZ3A 3AKQA 5BUVA 4XEZA 4K1ZA 4QPWA 4OHXA 3T2OA 4X8PA 1BQPA 3U11A 1ULDA 5C8WA 1U5IA 3O1UA 5EZWA 1SHWB 2ET7A 5DZEA 4ATEA 2GMPA 4QX3A 2I07B 2E9QA 4YM3A 4M00A 4XFBA 3VKFC 4RL7A 2TBVA 5A32B 1VBA1 3B7MA 3F95A 4V2VA 4AI8A 5FZ3A 3T0DA 5FK7A 2B39A 2OYZA 3FHQA 4MXWA 3WDWA 3VZOA 4IV3C 4DMIA 4E9KA 1EV12 3HNBM 4AI0A 4LLFA 1O59A 2ZGTA 1IG3A 2WR9A 3CZJA 1HDKA 1O4TA 2RDNA 4CEWA 1AR81 3ZLIA 4YFWA 3R4UA 1AHSA 5KC6A 1H8TC 4MZUA 5FYCA 2EIEA 1GNYA 1ZVFA 4IGPA 5DAPA 2K46A 3RYPA 1B35B 2NMNA 2QQVA 2VOVA 2XDVA 3QLQA 5JOWA 5HBAA 5CG9A 2IXCA 3QH6A 1RUJ3 2YG0A 2G1MA 2WNUA 1VPHA 2Y6FA 5FZKA 4LK7A 3HQRA 1DQ0A 4XABA 1RUD3 4Q8KA 2AENA 3W9AA 5LCWL 3LEKA 1QJX3 2FD8A 3J8F3 1VRH3 3AVRA 1U5XA 5F3CA 3LAGA 1LEDA 5C5UA 3GZTB 1QMJA 2RMU3 3MLJA 3VBFC 5BNQA 1NUKA 1SG3A 5FO7B 3RFRA 3OUJA 3P5BA 3DECA 2X5IA 2VM9A 2JD4A 3OUHA 1Q8VA 3VUOA 3C7HA 1BJQA 4PBPA 1H9PA 1OH4A 3ZXEA 1LOGA 2Z42A 5LRRA 3N9QA 3ZOIA 3BYWA 1NXD1 3RZJA 3KM5A 4MHRA 4B1MA 3NNJA 3AZYA 1W2UA 4AAPA 1LB2A 3EO6A 1S4CA 3Q8FA 4IE7A 1W3XA 3WV6A 1UY3A 4IUGA 3AKRA 2BU9A 2RDSA 2TEPA 1AX0A 3H8UA 4FO9A 4LOSA 3ZYRA 1EPZA 2BJSA 3MPPG 1DQ4A 5CYYA 1PMHX 4MGYE 3VZJA 4EN7B 4OI0A 4NPMA 5CB7A 2IXKA 2XWJB 2VO5A 5FXVA 1RUF3 4YYOA 2GC0A 4R52A 3CDZB 2CWMA 4P9XA 3V0AB 5BNOA 1VE0A 1JU4A 1W9SA 5C9AB 1D2QA 4LA3A 2ORXA 1AR72 4FPHA 1XC6A 4Y24A 5I93A 3N9MA 4YZ2A 4C91A 1A8MA 5DUXA 4LJHA 1OH3A 2VCBA 3AYEA 1Z78A 3WDXA 3ZMOA 2WJSA 2RS53 5DZGA 3IAQA 1DFQA 4QX2A 3ZR5A 3A22A 4QDSA 4P9IA 1PZ8A 1VMJA 4XILA 2UY9A 4JGYB 1POV0 3LIGA 4K40A 4QD2A 4XUQA 3NNFA 5DG2A 3RMXA 2C0ZA 5IVCA 3N7KA 5EWSA 3SCFA 4ASMB 2R0FA 4BE3A 2DWRA 4EN9B 3B5LB 3IPVA 3VDBA 2VUAA 5L19A 4JKLA 1WMDA 3QD6A 2DVBA 1ZBE1 2OA2A 2Q1ZB 2BGCA 1V70A 3I3MA 2PXJA 4QM8A 5LBCA 2GH8A 1UKRA 1GWLA 1VMFA 3WP5A 1XXNA 4CYDA 1W6NA 1K3IA 1NQDA 1POV1 1UMIA 3VGIA 2E26A 1HJFA 1OF3A 1Y9GA 2XKOA 3SCGA 2IFRA 1KDMA 1X7NA 4CCLA 4DY3A 5DPNA 1JYNA 2JKBA 1JZ6A 1EAH2 4O9EA 2ZCWA 2R042 4YW2A 4UW5A 1N47A 2WKKA 2P2KA 5FPZA 1P8JA 2J42A 2JE7A 2WFF1 3J7NA 5A33B 3RS6A 2FDIA 4UFLA 3GBFA 2HEWF 4XMAA 4C1WA 3ME2A 4URTA 4XOGA 1RUI3 4COWA 3QBQA 4BQYA 2VMHA 4LHSA 3J8F2 3JD72 3TRSB 2DUPA 2P5BA 2A6XA 4I30A 4ZS3A 1OXCA 3SXWA 5I0RA 4Q4X1 3HMYA 3KSCA 2IXHA 4CCDA 4M4PA 3DYOA 2WLPA 3IDEA 4XDQA 3GNEA 4E27A 1ST8A 1AYN2 1CN1A 1RL3A 2ZGOA 1L7RA 4D6QA 4M0HA 4BK4A 5LASA 4Q4W3 3A21A 1BHGA 1HRI1 1RUG1 2OIIA 3SKJE 4EJRA 3H8RA 4CDXC 2WNOA 1YI9A 2XL9A 4R9CA 4AQTA 4ARXA 5CU1A 2WNUB 3AZXA 4ZS2A 5FY9A 4I09A 1N3PA 2QQMA 3ZSJA 2VXJA 1QJZA 2Y34A 3DXTA 2WS92 3E6CC 5EJ1B 5T5OA 4Q4V2 1VBE3 4ES8A 1HQWA 5JR2A 2DCKA 2R30A 4RD7A 3IIAA 4HG6B 2IZWA 1QU0A 1WCSA 1W2NA 4XJ8A 4B4QA 3B3QE 3F2ZA 4RGAA 1ND2A 5A3MA 1BEV1 2O8QA 3U75A 4CA9A 1H0BA 2R063 1JZ5A 1EUUA 4MADA 4NIAA 2A6WA 5K0UC 4C90A 3LA2A 2Z69A 1DGLA 1O5LA 4RHV1 4XF4A 2QVSB 4AEDB 1DQ6A 1LAJA 3WG4A 2ZX4A 2D98A 3ZIXA 1SLLA 1XQNA 1OLRA 5ABJC 2WDBA 1ULGA 2XLFA 2WA4A 3POFA 3P1IA 5C70A 2DYCA 4OUMA 5LBEA 4JRAA 1AR61 1CJPA 4CSWA 5A6ZA 5GZCA 3VD4A 2BNMA 2E53A 4WV8A 2VQUA 1W28A 2AEZA 3TNPB 3ZDVA 1LTEA 3UKNA 1GP5A 1JYTA 1YJKA 2JB8A 3D0JA 1KDKA 4HFSA 1MS1A 2FMYA 2HWC1 2BEOA 3ASIA 2CGPA 4KG8A 2ZBJA 4LO6B 2UWCA 5A6YA 4PBOA 1LECA 2OPWA 1GLHA 3WZ1A 3POIA 4LULA 2CDPA 1F31A 4XAAA 2JDNA 1NZIA 4G3YC 1XBFA 4P9WA 4YWAA 1UNBA 3WHUA 4PLOA 1JZ3A 3POYA 2WZR1 4Q4Y2 3FN9A 2Y6LA 3VD3A 2VNOA 4FXKB 5A7NA 4W65A 5F1RA 2G4IA 1GP6A 2RVAA 5FRAA 4EZHA 3MHZA 4JTNA 4RQPC 1KD7A 4XCBA 4YW1A 2F4LA 5FZAA 1D4M2 4AHWA 5IATA 2JDAA 5FZMA 4UW4A 1F5JA 1AXYA 1AX2A 3V56A 2RS31 3VBSC 3A23A 1BBT3 1LEMA 1SLTA 3ZFFA 1UX7A 2BRTA 2LRPA 1F4AA 5GZDA 4I02A 5T3NA 4CU7A 2B9UA 3NV4A 1PGL1 1BVVA 5FY7A 3RWKX 1RC6A 2LS6A 1RUNA 3FZ3A 5CNAA 2QZ2A 5L7OC 1F4HA 4QKDA 1UWWA 1HV1A 3J4UH 3V64A 4P9GA 5AC91 1V00A 1URXA 2VW0A 4NAMA 4WM8C 5FXWA 4XETA 3IWZA 3S7IA 3NNLA 3P6BA 4Y5SA 5J1XA 1ND3C 1K5MC 3I2HA 5FYZA 2W2IA 2NM1A 2XHKA 3WVJA 4EQVA 5C4WC 3ON7A 4Q4W2 5FDBA 3ZYJB 2NQYA 4JCKA 3WHTA 2PQQA 4A6SA 1V6NA 4UAPA 4LTAA 4K3UA 1TME1 5L9BA 4AHYA 4EZ4A 3S7EA 1VBA3 2CV6A 4QPIB 1DYKA 2WN3A 3CU7A 1QJY3 3FBMA 3S6PA 2VECA 1YXWA 2J7MA 1W8NA 2J1AA 2OT7A 5I0TA 2MEV1 1Y3TA 5A3NA 2RS11 2V4AA 1CIYA 3LQCA 3N7JA 3E1F1 1HB4A 2R6QA 5E6HA 1U5YA 2BPA2 4NJ4A 4GKYA 3KT7A 3WUCA 3QCWA 4YVWA 3AP7A 3N4MA 3ITQA 2EAAA 2WSVA 5DDJ3 2PHTA 1W6OA 3ILFA 4LT5A 2RR11 3OGGA 3WF2A 4CDWB 2AUYA 3IAPA 5EIYB 1F35A 3NNMA 1F9KA 1W9TA 1UOGA 1JMUB 1H6XA 4BU2A 1XSQA 4JQTA 3ZFGA 2KR2A 3AJZA 2HWB2 3W58A 4AFBA 3D6EA 1ZBA2 3K4AA 1Z7S1 1R092 1UZVA 1YQ8A 5D8AC 5FZHA 2JG9C 3BVCA 4QDRA 4XF3A 4DIQA 1DGRA 4NWWA 1SZBA 5TSWA 1FMD3 1BCXA 1WZXA 4KBBA 2JDHA 1HXS2 3MF9A 1PX3A 1RB8G 2DTYA 3ZFEB 4YARA 2LALA 1YO8A 4WM7A 5KBFA 5JSPA 3M2MA 5F32A 4UBGA 4O9GA 1DZRA 2R16A 4XTPA 2P1BA 3MLKA 4XHXA 2VZVA 1WA6X 3CNAA 5BXXA 2CGOA 3ZYHA 5BNPC 3BU0A 2DVGA 5H9QA 5F7UA 1I6XA 4YZ5A 1PX4A 1LU2A 2CWSA 2YDEA 4OULA 3POGA 3UGFA 3ZIWA 1MS0A 1CIWA 1WW7A 4I0AA 5F9TA 3I4IA 4AXOA 4K6BA 5KWRA 2XJUA 3GBGA 3RWNA 2CU5A 5CFDC 1AYM2 3PUSA 3LEIA 3WXPA 3ETPA 4RGGA 1GZWA 2CGNA 2O1QA 1KGYA 2HBUA 2UY8A 2VG9A 1OLME 3PLQA 2DFBA 4IEVA 1XPWA 2PHXA 3SNMA 1VBB3 1ZZBA 3WNOA 3W59A 3T30A 3P3PA 1WUVA 1CAWA 3I2DA 3VBOB 3WD5A 4D7YA 4F3JA 3RQ0A 2VVEA 1L7LA 3WW1A 2Q1FA 4Y5Z0 2GC2A 4PQQA 4Q2FA 1OPOA 3I2FA 3WDVA 4XTMA 1NLQA 2QQNA 1VR3A 3R05A 1S0BA 1QJU1 3H8OA 5G05L 4QB6A 1C3HA 5C7GA 3VHPA 2ZX2A 3U4XA 1RHI2 4D69A 1V6KA 3MIFA 3ZM8A 5CKNA 2HWF3 1CZSA 2XJPA 5FP9A 5C3SA 5FJHA 4MGZE 4AVBA 3OGRA 5HXMA 4QX7A 3PJYA 4YM2A 5JI7A 4KWKA 4OYUA 4XMIA 1F5FA 4MUVA 1LESA 2E31A 5FZOA 2D44A 5EXOA 1PNFA 1JZ8A 3NQHA 3ZN6A 3ZSEA 2VUDA 2VBDA 1IKQA 2XUMA 1U5ZA 5FLIA 3MFCA 2QCSB 4Y1VA 2C4XA 2V73A 1VBA2 1UCXA 1S1AA 1QH7A 1XYPA 4JZRA 4Q0QA 5EQUA 4D7TA 3NKGA 5CADA 2BOIA 3EYPA 4XIKA 3WDTA 5JAXA 3NW4A 1W3VA 3POEA 1JHNA 2BVBA 4XF9A 3OD0A 1PVC1 1VAMA 1AR82 2B4KA 4MYEA 1OFSA 1JYWA 2BZDA 3Q8BA 3J7MA 5CA6A 2DF7A 5DDJ2 1OA3A 3PTYA 3UYJA 2Y0OA 4P9JA 2ZGUA 1HKDA 2PAEA 3QACA 2PAMA 1DQ2A 3PUIA 4GH4A 2EXIA 3WOGA 3PJQA 1QIQA 1RXGA 1RYYA 3VKLA 4XFIA 5JWPA 5FZ0A 4JGZC 2NP0A 5H9PA 5FPAA 4EYUA 1FNZA 2SBAA 2IFWA 4LKEA 3RZKA 1FPN3 5BNNC 4NIIA 1V6IA 2JE8A 2VUCA 2W47A 1FMD2 2VZOA 4LO4B 4I3GA 1AXKA 1DLCA 4DUXA 4YZ1A 5JUVA 2ID4A 2EIGA 4N90A 4HONA 2XJRA 4N53C 4HETA 4XQ4A 3THPA 2WINB 4YGBA 5F5CA 1QEXA 4B4RA 5BY5A 3HAGA 2C5DA 3LZZA 3CBNA 1X9TA 1TMF1 2VZPA 4UFMA 1VBD1 1R083 1QHDA 4A41A 5FIXA 5GZEA 3UJOA 1UU4A 3PVEA 5DUUA 2HWE1 1PIV3 4J1WA 1XSRA 4IV3A 3GZUC 3ECQA 3J9SA 3ILNA 3OBTA 3VD9A 1FATA 3JCIA 4FVVA 5JPNB 1CAXB 1FT9A 1GWMA 2A3YA 1G7YA 1VBB2 2ZAAA 3BODA 4YG0A 2ARBA 3ZPOA 3LF7A 1OQEA 2XJSA 1AF9A 1HRV1 2W94A 3NJZA 3PUHA 2BNNA 4HSLA 4R9BA 1H8TA 4NPLA 3RZLA 4PLNA 5JZGB 1DYOA 2G19A 1S2KA 1LNSA 5E89A 1WMFA 5IHRA 4BJ0A 3MV11 3WEZA 3BN6A 5IFTA 1NLSA 4JX0A 3UESA 3ST7A 1Y43B 3WLUA 1ENRA 1KS4A 4YW5A 4NHYA 1CD3G 4KU7A 1SCRA 1GZWB 4PF5A 3RYRA 1PGW1 4HL0A 2WC2A 3D3AA 5C8CC 3AZZA 2KD7A 1J84A 2ZHMA 1TZOA 4JAAA 4B7EA 4B1LA 1ULPA 4QKFA 2MHFA 2DFCA 1CAWB 2P4EA 1W8HA 2AH2A 2Q30A 3H7JA 3LA7A 4HKOA 4QDQA 4MGSA 4JDOA 3WNMA 1ENQA 4CEYB 5IK7A 1LKNA 1XNTA 1GR3A 3HD8B 3OGJA 1ACCA 2UYBA 2QTWB 3LSDA 5KHIA 3HQUA 2JX9A 4CXYA 4RS5C 2CTVA 1ZREA 1NQJA 1XNAA 2W08A 4XJ9A 2W95A 1DU3D 4XAEA 3AL6A 3THDA 5IK5A 3MIBA 3O1RA 1UN1A 2Y6HA 4WVMA 4FP3A 5CFCA 3I3EA 2ZEYA 4HVQA 3I8TA 3W5NA 1GQHA 4CDQA 3O1SA 2D97A 3KHBA 3NKTA 3KT4A 3VV1A 5JXHA 2BBVA 3VBUC 3WNLA 3OSDA 1RJ7A 4P5YA 3LE0A 2BVVA 5FZOB 4E4SA 3B02A 5A7SA 3AKPA 5C3OA 5A3OA 3RZHA 3A4UA 4NHXA 1OOPC 1FYUA 5A6QA 2G9ZA 1RUE1 3DYMA 2WFF2 3M1HA 5A7WB 5I0DA 1CQ9A 3USUA 4CCNA 4R8HA 4PF1A 3QOPA 1ZRFA 4CU9A 2E33A 3NWKA 1RVF1 1DHKB 2VZTA 5K9YA 1X8EA 1NA1C 1OVPA 1GZTA 3GJAA 3KV9A 3N9PA 4MG2A 3ZSMA 4Q4X2 3VL9A 2EA7A 2EXJA 3PUQA 5DAVA 5A7OA 1WLWA 2E6VA 2VC9A 2WNVB 1HB3A 3NV3A 3OG2A 3OGSA 4OI2A 5GKAC 1H2NA 1J3RA 1W6PA 4COZA 1HRI2 4S2HA 4GH4B 2UYAA 4IV1A 3T1MA 4ZU4A 4YM0A 2XONA 4AEDC 5IVVA 2R071 1DYPA 1HN1A 2P3YA 4INDA 1QOTA 1UIJA 4PCRA 3LDKA 1SBFA 2BBAA 3VBHC 3D8CA 2VE1A 2GC3A 2D6MA 2WQ8A 3PNAA 4TYSA 3UKVA 5JMCA 4CPBA 1GKBA 2W39A 4FPOB 4LO5B 3K48A 4PT6A 5FYYA 5T52A 2W0XA 3KLSA 4YLZA 1NCRB 4DINB 1AL0G 4AFMA 4N9HA 1NT0A 1V6OA 5K8SA 1US2A 1YNAA 1PO23 2Q4SA 3CJIB 5F5QA 4CXWA 4IL7A 4MGKE 1BEV2 3WG2A 2WA3A 4Q27A 2HWD3 3PVOA 4Y33A 5K4LA 3RDIA 1ZNPA 3T0BA 4OI1A 3WX5A 3AKSA 3E6BA 3M3EA 5LZ6A 1FX5A 1GU3A 4RHV2 2MNGA 3MIHA 2FDHA 2OW4A 1PM4A 4CCMA 1AR73 1QGLA 2QKDA 3CIHA 5HV0A 4A42A 2E7TA 3T0AA 3PMEA 2A6ZA 3KF3A 2ZX1A 5CAZA 1IG0A 2VVFA 2YMZA 4CDUB 4GB31 3RSJA 4V2WA 1AR62 1O4ZA 1ODNA 2D5HA 4YM1A 3BTZA 2E51A 2QQLA 3UT0A 2E7QA 1RUH1 2D3RA 4UF0A 4K20A 4UFIA 1F15A 1RGSA 1FV3A 2HWC2 1PK6C 4CDXA 2XJVA 3KB5A 3GCWA 3NAPC 5KXDA 3KCYA 1MZFA 1J1LA 3RRDA 2YC0A 1LCLA 1TQ5A 1ZRCA 1W04A 1YQ2A 3WP6A 1ULEA 3WF0A 4A3ZA 3KHCA 2CDOA 3O1PA 3ZXLA 1E5SA 4CP9A 1OSGA 1UO9A 2WL1A 4HVOA 2ZKLA 3OUIA 4GXLA 2ES3A 2YGMA 4G4FA 5J7MA 1OD3A 4FOVA 2VZRA 2ARAA 1MQTB 1RUOA 5EFUA 4OHYA 4LUKA 1R1A3 4ISRA 3I49A 3LB9A 1J3PA 2GZWA 1EAH3 2JG8C 4EWEA 3S5AA 1POQA 2R043 2XOMA 3B01A 2ZA9A 1UIKA 2SLIA 5J3UA 2KA3A 1A8DA 1H1AA 2OS2A 2RJLA 2RS32 5GALA 5K0UA 2Z4FA 3JU9A 1V6MA 5ACA1 3SQOA 3UL2A 3ZXFA 4OHVA 5F2SA 1D2SA 1RUC1 2DBIA 1DZQA 2W1UA 1PGL2 1S0FA 2A5ZA 3D4KA 4K1YA 4Y4RA 5CFCB 4QB2A 4A7YA 4UWDA 4RFT0 5ABJA 2IWGB 3JD73 1VJ2A 1YFWA 4CDQB 1AL23 4XJAA 3AP6A 4IE5A 1COV1 1X36A 2X10A 1K12A 4HOOA 4NROA 4YW7A 5DMYA 2JICA 2R1BA 4UFKA 4ZZ5A 1AYN3 1LGNA 1L3JA 1W8ZA 3AL5A 3H1MA 4FOWA 4K8FA 4UYBA 4DUWA 1MZEA 2NMOA 3KQRA 1D4VB 1A78A 3CHXA 4B3NA 1GNZA 1GOHA 1TME2 5FUNA 4Y26A 2YPDA 5G04L 2VW2A 1WW4A 3IT8A 4TWTA 1QNWA 2NN8A 4KMQA 5FPUA 5KHKA 3VBRB 5A3PA 2MEV2 4K8RB 1S0IA 2WS93 3E6DA 2A1XA 4Q4V3 1Z0HA 1ZA7A 2W87A 3LKJA 3LPGA 4IXLA 2VNRA 1W90A 2VVDA 4Q1PA 5LBBA 4LBQA 1W6QB 1QXJA 2NLRA 4I01A 1B09A 4IE4A 3MUY1 2Z5WA 1AR91 1PO11 5KXCA 2VU9A 5J48A 2EIDA 4RQPA 1PO22 1NCQB 5T55A 1WBLA 3DL3A 4HZFA 3S57A 1B35C 1VLNA 4QPGB 2HWD2 4IV1B 3M3QA 4KWJA 4Y20B 4AW7A 2QUOA 5FYTA 3VDDA 3VBSA 1GQGA 1YFYA 2WO3A 3H50A 3H9AA 4OI4A 3T4HB 1ULOA 4K21A 2RDRA 2DCTA 3THCA 2ADEA 4YW6A 3EQEA 3H3ZA 4WZFA 4YPJA 5ANQA 4TZDA 3TEYA 1IGOA 2F17A 1H1IA 2YBSA 2LUWA 5E88A 2ZS6B 1WBFA 2IVJA 3CLPA 4BA6A 3GDBA 1IPSA 5L7OA 3DPRB 4XURA 2P37A 4N43B 3OTFA 4NIDA 4WM8A 3JBG1 4EN6B 1UZZA 1UYPA 2GMMA 2ZABA 2YZ4A 2YB7A 1CZTA 4ZONA 1ND3A 1K5MA 1TEIA 3Q8AA 1OLQA 3DV8A 4A44A 5KXBA 4BHPA 3K46A 3VDAA 4FPYA 1L7QA 4GJYA 5C4WA 2VJXA 1GV9A 4GQ7A 3H42B 3LSEA 1V9U3 1I3HA 3K4ZA 1LRHA 3MYXA 3ACHA 1SACA 1CAUA 3WF1A 2BOJA 1DQ5A 1C5HA 5B4XA 3V0BA 4Q4Y3 4HVRA 2VMEA 1JYVA 1O7FA 2VZ1A 3KWVA 4JQRA 2UWBA 2YU1A 5A80A 4M3CA 1C8M1 1UPIA 2B7YA 1R1A2 4OUEA 4FPLA 3WG3A 3WW2A 1ENSA 3O1OA 2YXSA 1D4M3 3FLRA 4BIOA 2XBO1 2WYFA 1ULCA 3GGLA 3MZHA 3BCWA 5C9AC 4BYYA 5LB6A 2VZUA 1QJU2 2WYSA 5FZCA 4HN1A 5D8AA 2JG9A 2WN2A 1UOBA 1W39A 4HPKA 1GOFA 2GSYA 2JDYA 2P3KA 4M0NA 4MXWB 4P02B 4Q0PA 4AEKA 4CP9B 5A7QA 3EBRA 1AL22 3VKOA 4ZHNA 5JSRA 4BQ4A 3LDBA 5FP3A 4JRLA 4JGYC 4CEWB 1CPNA 3ZXAC 4YW4A 1YWKA 3POJA 5BNPA 1YCIA 1OURA 4FTEA 1QNYA 3AYAA 5FWJA 1HN0A 1JUIA 2O8OA 2YFZA 4QQ2A 4ZXKA 2DTWA 1GZCA 3NV2A 4WVZA 4GMP0 2WNEA 1A34A 1IPJA 4YGEA 5CFDA 4GWIA 5AVPA 5FY5A 2YY1A 1UXZA 2ZGMA 3IDCB 5FY4A 3WP4A 1SCSA 5F8PA 1LOFC 5GLWA 3WP3A 4LE4A 3TN91 1PVC2 4MX3A 1J58A 3OY8A 4FFHA 2MPFA 1SLBA 4EV0A 4GALA 4KG0A 4COVA 5FUIA 2X5IB 4G9SB 1S2EA 3GYDA 4GMP1 2Q1MA 1OBNA 4MGTA 4FBFA 1PGSA 4JDMA 5FMOL 2HYKA 4DZGA 2HWB3 3PURA 3MICA 5I8TA 2VGDA 4A3XA 4DXZA 1ZBA3 5FOBB 1R093 2P3JA 3E5QA 1O4YA 3O0VA 5J09A 5FZEA 1OUXA 3GF6A 5GLUA 3FUQA 1CGPA 1HXS3 4KGQA 2VOWA 5DAXA 2WWUA 3VKMA 1GBGA 3C3VA 1KFXL 1N1TA 5EYYA 3TBDA 2RM21 1MVQA 2B46X 1YJLA 2W1QA 2O0OA 4AQ6A 1CX4A 3N3HA 1RMU1 3TB0A 1APNA 4NAOA 2W3JA 4NHMA 1IS5A 3FL7A 5LBFA 3VZNA 1MEC1 2ET1A 5CEHA 3TEXA 5BNOB 1TMF2 3VDDB 1UU5A 2PAKA 4LKFA 2DUQA 2WNUC 5FYMA 3VBSB 5FUPA 1VBC1 4P9LA 1VBD2 1GNHA 1V9U2 1JYIA 3HNMA 2YC4A 3OYWA 1W6MA 1W9YA 1AYM3 1QQP1 4L11A 2PQSA 3U10A 2XL7A 2FZ1A 3MFAA 2BGOA 2VZSA 1LHUA 3K3OA 5EP9A 4ZU7A 4GULA 3U07A 5FXXA 1U0AA 5HPOA 2J22A 3B93A 3IIIA 2FHRA 1W9FA 3WSOA 4BDVB 1ALYA 1MVEA 2LW8A 1ASJ1 2EICA 1KJRA 1CPMA 2W9XA 4XXAA 4YGCA 1FOD1 2PA7A 1UY0A 1YEWA 3U37A 5FKBA 3SCHA 4CXXA 5I8YA 4J25A 3IPVB 4XVHA 4LKSA 1WLDA 1NX9A 1PVXA 1I9RA 3K51A 4EROA 1O3RA 2Q8OA 3WF4A 1U12A 4JGZA 3HT1A 1IQDC 4KNCA 1BKZA 2OXBA 4XXPA 1RHI3 2H0VA 4QU1A 4XC9A 1SBEA 2PLV1 1JXNA 4BPZA 4N8MA 1SFNA 4ES9A 1PGW2 1N1VA 5BNNA 1W6NB 1R64A 1EV11 2YGLA 4IW3A 4LBOA 5KHJA 5A6XA 1UL9A 3LWCA 1JI6A 4NHKA 3MW4A 4FAHA 2YV8A 3IB3A 4M3CB 5GZFA 2XLAA 2XGXA 5LATA 3FMGA 4N53A 1H4HA 2EAKA 3AC0A 4DPNA 5JCTA 4OMDA 1CR7A 1NOVA 4OZXA 4PDWC 2GNBA 3HJRA 1K5JA 5FYHA 2GU9A 2VBBA 3BGAA 2ZGKA 4L97A 2IXLA 1PZ7A 1H2KA 1C4RA 1ZM1A 3LOIA 4LHLA 4Y5TA 4GA9A 3WDUA 1IKPA 2Y33A 3NJVA 4W50A 2Y60A 3ATGA 2RHPA 4NE9A 4PIZA 5D1IA 3WUDA 3ZN5A 5K7PA 2JG9B 4F7ZA 5F2WA 1CAVA 5CVRA 2VQTA 3N9OA 1UY4A 2XQRA 4YZ4A 1N3OA 4GWJA 5AFBA 4QWNA 4AFAA 5IAVA 3KVAA 5AVAA 1KXGA 1AR83 2WLQA 5A3WA 4B4PA 1W2OA 3VZKA 2GALA 1UZ0A 1XB9A 4NIHA 4XCAA 2EXHA 4IEYA 1XU1A 1RIRA 4FFGA 3MI8A 1LOAA 4Y3OA 1VB2A 4AGVA 5FY1A 2ZGPA 2VCMA 4KQ7A 5FO9B 2XHNA 3E97A 1OA2A 3DEMA 3WNNA 3D0SA 3ZDSA 1RVF2 3I3BA 1TNRA 2Y6KA 2IXIA 4ITCA 4Y1XA 3CO2A 5JXJA 2IUWA 3OEBA 2VQAA 3VHOA 1WA4A 3JB4C 2J1TA 3B94A 3LCPA 1COV3 4MGIE 5C8CA 2XVLA 1TNFA 2VULA 1ZZ8A 2JDZA 4JTOA 3S5QA 2XMLA 2JEMA 4PI2A 4D8MA 1WCDJ 2XXZA 4Q29A 5LA9A 4F83A 3A0KA 5IK8A 1K42A 1ND2B 3ZKUA 3WF3A 4FQZA 2D7FA 2R49A 4LIUA 5FXZA 2LTNA 2VMCA 3IM0A 5HCFA 4A2UA 2R072 2Q5TA 1GANA 3NRUA 4QPIC 4RS5A 5JIAA 1CJDA 1W03A 2VOKA 3KV5A 2JWPA 3MW3A 3I97A 1W99A 3T2QA 1UQXA 1WLCA 5J98B 4CCJA 4DEQA 4LPLA 4XF0A 4LIVA 4YG6A 2WO1A 2JIGA 2FDKA 4NWVA 5FQ0A 2VXRA 4DNYA 3MGUA 2YC2A 3VBUA 1FAYA 1KS5A 1SLAA 3KGLA 5BV6A 3B9IA 4CDWC 4IEQA 5JVVA 2A70A 4HK9A 4QHOA 1LODA 2D40A 1OOPA 4RYDA 4W6YA 4FTBA 1W0OA 1UYYA 4URAA 1Y9QA 5J37A 2ZZJA 4H3WA 1GSLA 1GWKA 1I1EA 4A6OA 3PDQA 4META 1YQ6A 3O5SA 1NA1A 2ZMKA 5CKQA 1IZ3A 1D0GA 2LROA 1EUTA 1W06A 4HBNA 2J1UA 3ZFEC 1X50A 2QDNA 4GB32 4U2AA 5L36A 4KGGA 3UGGA 1JOPA 2VZQA 5F5IA 4EWDA 1RUH2 3WG1A 2GN7A 2QQUA 4PLMA 5IFPA 1JBCA 5GJ6A 1I5PA 3WDYA 1WWYA 1AJOA 3NJXA 1Q43A 2GMEA 4AEMA 3HEIA 4DEVA 5DQ0A 1HJGA 1RUJ1 4L8QA 1ZBE3 3ZFFB 3DCQA 3N9NA 1A6CA 2EVXA 4JGZB 5JOZA 5A1LA 1C1LA 1RUD1 1UOJA 4KWLA 4R4ZA 3ZYPA 3VBHA 5FAXA 1QJX1 3J8F1 1POV3 1VRH1 3HBKA 1NKGA 4N7IA 1OHFA 3EMRA 2P3IA 3INAA 2ZGLA 4JKMA 4CTEA 5LA1A 3L9JT 5FQ0B 5B4NA 3TYJA 3ZYIB 2RMU1 2PHRA 3L2HA 2FQPA 3OPTA 4W4ZA 4UOJA 3VBOC 4AVCA 2EALA 4QX5A 4BISA 1Q3EA 3N35A 2JE9A 1WD4A 2X8KA 1GYKA 4YRDA 4Q1RA 2AYHA 5DAWA 3PVNA 4A45A 4NVPA 4AI2A 4UXAA 1JZ7A 1C8NA 3CQOA 4IEWA 5ERLA 3O1MA 3OGVA 4QX0A 4XACA 4XQWA 1VP6A 5C3QA 1H8VA 4QT6A 2WFF3 2JENA 2ARXA 2ZHNA 2XH6A 3PTRB 1CONA 1JU3A 1RUC2 1CESA 4H7MA 4MO3M 3R6SA 3LOBA 1WCUA 1ZRIA 4HXCA 1CAVB 2XB6C 1HB2A 1LGCA 2ZTNA 2P6HA 3ZYGA 1AXZA 3ILRA 4S2GA 2W91A 4Q4X3 1JYXA 1COV2 2BFUL 3O14A 3AK0A 4W6XA 5AFEA 5JOXA 1EP0A 4YVWB 4YZ3A 5FPBA 5FCCA 4BK5A 5T5LA 3A0NA 3SC7X 1W6OB 5E16A 3ZXKA 4YVSC 1YQ5A 1RUF1 2QQJA 3N7LA 2Q8EA 3THTA 2PTMA 1S55A 2AREA 2BDRA 2WT1A 1HRI3 1HQNA 1RUG3 3I7DA 1HW5A 4IGQA 3VZMA 3VKNA 3SHRA 1XJAA 4QXHA 3R4DB 2UURA 4WVWA 3W21A 3ZFGB 4BQXA 1PK6A 1TE1B 1CVNA 3NAPA 1OLMA 1CZVA 1SPPA 4LO7A 4ZKTB 3U0ZA 3RI8A 2XVKA 5T54A 1Q8QA 4A7ZA 2OVUA 1ODMA 2XUEA 1MZ5A 2CNAA 2R32A 3B9CA 5T5JA 1QJFA 4FOYA 3FJSA 2RS51 2Y0IA 1J83A 4GAZA 4Y1UA 1BYHA 4A7KA 3KQ4B 3LD8A 4ONUA 4WM7B 2FCVA 1LHNA 1PO12 1VAKA 4TLGA 3L2YA 1QJEA 2DU1A 3TAYA 4GMP3 2JG8A 2VTXA 5FBJA 1BEV3 2D5FA 1G6NA 1TVGA 3HVDA 4XUTA 1UD1A 2OKXA 1ZZ9A 4FTSA 4ZXEA 1YC61 2P34A 4RS5B 3IZOA 3FC0A 4RHV3 5FPVA 1Q56A 1W2TA 2BYVE 3WT3A 4NIGA 2YPJA 4XE9A 2CAVA 4DB5A 4CUCA 3AKTA 4TLFA 4QAWA 4AI3A 3FHAA 1DLLA 4GZ9A 3I2JA 4HLTA 2J1RA 2VQ0A 1AR63 3PU8A 4KU8A 1Q8PA 5SV8A 3RJ2X 5EJZB 3VBFA 2QQWA 4BXFA 3JQXA 4NRMA 2P17A 5A1AA 4FPEA 1N3QA 5C3RA 1SLIA 4NRQA 3CKHA 5FP7A 3ZO0B 4CPBD 4DXTA 1PZ9A 5FFOC 1O6UA 1RJ8A 3BIEA 1CX1A 2HWC3 3AJYA 3IKWA 1WLTA 2AZ5A 3NVCA 2J1EA 1ZBE2 2BWAA 3KCXA 2ZGQA 3MIDA 3NO8A 4OQ9A 3RZZA 4Z1VA 5A32A 3KT1A 3ZXGA 1X8MA 2E7AA 1RUI1 4Q0UA 4MSVA 3S0MA 5DAQA 1NA1B 2KM2A 2WZR3 3M7AA 2Q0AA 3MLLA 2WUHA 5JOYA 1ZRDA 4MGQA 3H3UA 4CP1A 1A3KA 3BI3A 3C7FA 1C8M2 1OA4A 2BWCA 3ZXJA 4BMEA 4AI1A 4HK8A 3VB9A 5JZGC 1O3QA 3I2GA 1S0JA 2V5DA 2XBO2 3K77A 4Q4W1 3ZN6B 1B35A 2JIJA 4O61A 3OOXA 4PJYA 4LNVA 2RS33 4Q26A 4I2OA 3E5XA 1PHMA 4E4ZA 3Q8CA 1QXRA 4LXLA 1HQLA 5FP8A 1OVSA 4R4XA 1JS9A 4I0WB 5FMDA 5FZ8A 2F6BA 1SDDB 1VBE1 3T4VA 1LENA 4GKXA 5AC93 5JR7B 4W6WA 2AR6A 5EJ3A 3FUOA 5I0UA 2Q8CA 4CEYC 1DF0A 1C28A 2WO7A 4RR3C 4ARYA 1GZ9A 2DVFA 3VHNA 4WBBA 3C7GA 3PL0A 1N1SA 1EY2A 2ETEA 1RUG2 2BQPA 3OBZA 1E5IA 2R061 3DXUA 4LOTA 1TME3 3EJKA 3B00A 3NMBA 5FREA 5FTTC 5IVEA 3B69A 4IGOA 4GD4A 1M4WA 2Z2SB 3MPBA 1UMZA 2MEV3 2RS13 3URFA 4FAGA 3JB8A 1PMIA 4XZPA 3T09A 5EPAA 1ENXA 1QDCA 3OJBA 3TN92 5F3GA 2WZPP 1K45A 4QGLA 3MIEA 4K9SA 1ONAA 1S0CA 4XDPA 4ZZ8A 4QX1A 1LOEA 4IEXA 2WSUA 2ATFA 2RR13 3KGZA 1Q8SA 2XR4A 3D5OA 1DP0A 4O65A 4XFCA 2WAAA 4L0PA 3UV9A 5A7PA 4FFIA 4QHBA 2F4PA 4M3CF 5FJKA 1C57A 1G8WA 4BLJA 3V0AA 1RITA 4AFDA 2FZ2A 3DF0A 2VPVA 2YYOA 1XYNA 5C9AA 1W8UA 2V09A 1QOOA 1E5RA 1BK0A 2C9AA 1Z7S3 3IMMA 3RZGA 3RJRA 5DABA 1GUIA 3CL1A 4BIFA 3KF5A 2D6NA 4AE2A 2WFPA 4AYUA 2VMDA 3SISA 2VOTA 4OHWA 2BGPA 5H9RA 2DCZA 4IV3B 3Q8EA 3SEEA 4KH9A 4XZUG 5LA0A 2WNVC 4JGYA 2VNGA 5CKMA 2RM22 3FLPA 5D2AA 1DGWX 1W8TA 3A7QA 1MR5A 1RMU2 4LR4A 3MDPA 2XKPA 3D82A 5GLVA 5J96B 1H8TB 2L9LA 4QQHA 4UT5A 2RJ2A 1XNBA 4GH4C 4E2SA 4LHKA 1MEC2 5FWEA 1WKYA 4XUOA 1X33A 5F6LB 2V5YA 2NYYA 2PMWB 4L99A 2IXJA 5C5TA 1BBT1 4LBQD 3IMNA 1EPWA 3WCRA 2XPJA 2VBPA 2VW1A 1QQP2 2ZHLA 3BTAA 4NPRA 5T5PA 3WQ7A 4E2GA 2GAUA 3OB8A 1OQ1A 2GNTA 5FMBA 5IW0A 2WZR2 5CZKA 1LOFA 4FPGA 4NMIA 5FYUA 4ET7A 1DIWA 1NCRC 2I74A 1MZ6A 5DZFA 4XFHA 3VBFB 5T50A 2W5FA 3RZMA 1ASJ2 1NLRA 3GCXA 1HB1A 2B9VA 1IQAA 3CJIC 4AFCA 1FOD2 4FSJA 3OD4A 3CF6E 1Q5OA 4LKDA 2HKXA 3BTYA 4KL1A 3MBWA 2GN3A 2W92A 1V6LA 4XBNA 1YLLA 5F39A 5A33A 1OD5A 3SITA 1QJU3 1QWRA 4OQ8A 2Y6GA 1QJY1 2ORZA 3FWEA 2PLV2 4IE6A 4WVMB 1MS4A 2PFWA 4FPCA 5L9RA 3PU3A 1H2MA 1NE6A 2DDUA 3VN4A 4EN8B 4CDUC 4MV2A 3LEMA 5AC92 3PUAA 2I45A 4AR2A 4Q0SA 4E8DA 4COYA 2AEYA 2VUJA 1FXZA 4Y22A 5DDJ1 5C33A 5C3PA 2JDUA 3WR0A 2ZJCA 5LRSA 1W2AX 2JDPA 4X6QB 3M3OA 3HNYM 1LHWA 2BNOA 3DYPA 4YG3A 4LBMA 4L2NA 4M3CE 3USUB 2E63A 4UI9L 4IEPA 5L73A 3ES4A 4Z2AA 5I8SA 4CVUA 1BXHA 2DV9A 5FPXA 2RS12 3C8XA 2DUOA 3GBWA 3OBAA 3ZVXA 1FMD1 3ZMNA 3ZSKA 3ZR6A 4DQAA 5ANNA 4CUGA 2DVAA 3OPZA 4D94A 3ACGA 4GIQA 1H30A 1PVC3 2EXKA 3GZEA 4QB1A 4QGNA 1YIFA 1MQTC 4OFGA 5EV7A 5HCBA 5FYSA 1AX1A 2D43A 2PHDA 5IT6A 5LW9A 1DDLA 3LFMA 2RR12 4R9AA 2A7AA 2DCYA 2ZX0A 5A3UA 1W6PB 3O7OA 3H1WA 2JDMA 2BERA 1EYBA 3HIFA 4ZY9A 4AEJA 4QHZA 3AFGA 4QGMA 1XE7A 3EXUA 4Y4YA 1OKOA 3WNPA 2JD9A 1MS8A 2ZGSA 1Z7S2 4AEDA 3BKZA 3KZ4C 2I2SA 1AUYA 5CFCC 2ADDA 3H7YA 4LBJA 5H9SA 3ACLA 4CDQC 1QF3A 1US3A 4LORA 2X05A 5HV4A 2KXLA 3UNPA 3RYKA 3ETQA 3K75B 3OCPA 1REDA 4JKKA 2OQ6A 1VBB1 3JQWA 3EB7A 2BW8A 4FPFA 5I91A 1SMVA 4OCTA 1PNGA 2XVGA 4PDWA 5JI9A 1YFXA 1F8VA 2B8MA 2FDJA 1TMF3 2VMIA 1GMMA 2DU0A 3BOPA 1VBD3 1LOBA 4BH9A 3VBRC 2D6PA 3CEWA 2FDGA 2RE9A 3TNQA 1NY71 3T2TA 4COUA 4L92A 5DN2A 2R0HA 2HWE3 2HWF1 3BPZA 5KHHA 4K7JA 2A3WA 1UU6A 5LK7B 4L9BA 4DFSA 4DXRA 1ZZ6A 1VIWB 5JIUA 1XE8A 4HANA 3APBA 1HLCA 1SQ4A 1HRV3 5I0SA 4XW3A 3T2PA 2K9ZA 2VMFA 5FPLA 3TEWA 1NCQC 4UF0B 3U1XA 3AP5A 3PHMA 1JW6A 3N9LA 4QPGC 3AXDA 4DO0A 1UY1A 5C6CA 4IV1C 4WVVA 4CDXB 1WGPA 2A75A 4FT8A 4XHBA 4AGRA 4AOCA 3E5UA 5F3IA 4OVEA 2HH9A 1H4GA 3ZKYA 3MW2A 5J36A 3HT2A 1IOAA 3AXEA 1WMXA 1CWPA 3BPSA 3VLBB 5FYVA 3DPRC 4N43C 4MVTA 3I3DA 5BYNA 4IEUA 1OKQA 3NL1A 3T3YA 4AF9A 1W0PA 3IN9A 3LPFA 2OZJA 3V65A 4GWMA 4DY5A 4LE3A 1UF2C 5F6KA 3MUZ1 4IERA 3FHIB 1J1TA 1NE4A 2D6OX 1LHVA 3AMPA 5DUVA 2D3PA 1RUJ2 4E2QA 5K0UB 1AVBA 2ZKNA 4QPIA 3WW3A 4UBHA 1RUD2 2VY0A 1KQRA 2UWAA 2A6VA 3KV4A 4AVVA 1DGWA 1QJX2 3RGBA 1FPN1 1VRH2 4H2AA 3P3NA 3IBMA 1VB4A 5ABJB 4FCAA 3RMYA 3AZWA 4Q8LA 4AHXA 4CCOA 2RMU2 3G7DA 1GOGA 2Y26A 4LA2A 5FMOS 4Y22B 2GNDA 5LA2A 4B8EA 4CDWA 5FLHA 3AMHA 4BQ3A 1BMV1 2A71A 1SDWA 2VOXA 1UX6A 1H2LA 3KMHA 4BLIA 1YI7A 3FE5A 3I59A 1RUE3 3EHKA 4HN0A 3FFQA 1LU1A 4XQDA 2C6SA 4ZPIA 3ZN4A 1UAIA 2R7EB 1R081 1VMHA 4Z2WA 4JDNA 4QMAA 3BUCA 1RVF3 4D0QA 4DS0A 5JSOA 5KXEA 4YNIA 3AMQA 4RFRB 4XUNA 1PIV1 4PHZA 4PQ9A 4XFGA 3J7HA 4ISQA 4D7SA 1S0DA 4LK6A 3GHMA 3ZFEA 4DUVA 1Y7BA 4LBNA 5JXGA 3ABZA 4LBQB 4DOUA 4CEWC 2OX0A 2XQXA 3I2KA 3ENRA 4YSFA 1DCSA 4EWAA 1RINA 1YHFA 1RUF2 3AYCA 4BQ1A 4RQPB 4X8NA 5FLJA 5EHDA 1LJ7A 1ZX5A 2ZPXA 3PVBB 3OPWA 2YHJA 2RG4A 3FLTA 3O12A 2AGSA 4BB3A 1N1YA 2FDFA 2R073 3MV01 1JH5A 3UGHA 2IC1A 5LY1A 2B42B 4FXGB 3U14A 2HWE2 3M4FA 3MF6A 2RS52 2ZMLA 4JV4A 4N7UA 5F37A 1S2BA 5L7OB 5LK5A 4XPVA 4YFZA 5JDBA 1H6YA 2ZMNA 3HN1A 4WM8B 4H7LA 5LY2A 1PM7A 2OUJA 3H3LA 2QFEA 2ARCA 1ND3B 1K5MB 3VBOA 1HRV2 3JZVA 1GICA 2X5IC 4KI5M 4PIXA 4Q0VA 4QKNA 4Z82A 1AJKA 1IPKA 2WWSA 5A3LA 1VAVA 5GM0A 1NAEA 2OPKA 4PDWB 5C4WB 3AFKA 4O7XA 2ZEXA 3GALA 1YYNA 4CE8A 1KEXA 1UZYA 2QQOA 4LHNA 4UW6A 3J7LA 3RI9A 1JOBA 2BV4A 3DKQA 1CAUB 5LEJA 4P14A 2PELA 3K2OA 2CYFA 4OLLA 4V1PA 5FZIA 1O3SA 3FX3A 4NRPA 3AP4A 3C7OA 1OT5A 4MLOA 1G9DA 3V0BB 1NZCA 5JXIA 4UW3A 4GB33 2Q8DA 4EE2A 1LOCA 2GDFA 2K2SA 4CCCA 3I3QA 4W8JA 4E8CA 2C9KA 1J59A 1RUH3 1GQPA 1UYXA 3GHNA 2H6BA 4YVSA 2Y64A 5SV5A 4BCUA 2VNVA 4NHLA 1W8OA 4LITA 2D6KA 2NZ9A 5BNOC 5F3EA 3VDDC 3WQ0A 1W0NA 2YBKA 4U36A 4CU8A 1SEFA 2PYTA 1I5ZA 4YW3A 2CSGA 1MPXA 2Z79A 5D8AB 4AWDA 5IVBA 5GZGA 1RUI2 4BMBA 1JTZX 1UZWA 3WY6A 1D7PM 4HPKB 3ZYBA 2XJTA 4XDOA 2P6CA 2ERFA 1M06G 2ZGRA 5JPMB 5JMOA 2HEVF 3SH4A 5FZ1A 4CP2A 3ZX7A 2W68A 3H0OA 1GFF2 3SKVA 1RXFA 4C0BA 3LDRA 1RTVA 3I2OA 5BNPB 3SEPA 4QM9A 2YFUA 4QPYA 3VDCA 3ZYFA 1F2NA 4PI0A 1RUE2 3LA3A 5ACA3 4MHUA 1ZA4A 1RUC3 2PHWA 2D3SA 3DN7A 5CFDB
chains in the Genus database with same CATH topology
4SLIA 1YIPA 1FNYA 3RPQA 4CP0A 1VBE2 4QQOA 4LUMA 3BIWE 3BU7A 1QY4A 4BM8A 1UKGA 4NOTA 5HXVA 1KJLA 1JN2P 2PHUA 3OY8B 3VHRA 3ZPYA 3G6JB 1UPSA 4ATFA 2ZOEB 4XFFA 2QDRA 3QH7A 3T1LA 1PO21 4YGDA 2QE3A 2CL2A 2ZZQA 3S30A 3I59B 1O5UA 2HWD1 2R062 4HSJA 3POWA 1OI6A 3CJXA 1ULFA 4XYXA 1VALA 1AR71 3AM2A 4S2FA 4QXKA 1FI2A 2DVDA 5DG1A 4OUSA 3RG0A 1CAXA 3KD4A 2R1DA 3OF1A 4ASLA 1HV0A 1G9CA 1LULA 1AR93 1PO13 1HX6A 4X6RB 2G9GA 3SLIA 4XJZA 3BOWA 5JZGA 1ZZ7A 3MIGA 4IETA 2ZX3A 1XU2A 3USSA 1LGBA 4HKLA 5GLZA 3OYWB 4FQ4A 3KCCA 1W6MB 2ILMA 1MS3A 2GNMA 3M3CA 4XJWA 1NYWA 1ZRRA 3WW4A 1ZYBA 3JBG3 4FPKA 4B7KA 4QQLA 1HIXA 1R1A1 4CEYA 4Z07A 4RR3A 2X29A 4HMZA 4CZSA 2HEYF 1EAH1 3H1YA 1ND2C 3TWIA 2R041 4P9YA 4F8AA 3M70A 2GH2A 5HCAA 2D93A 1BBT2 1DG6A 1IS6A 2B5HA 3WCSA 3HR9A 3O0WA 5CIRA 4FOQA 4Z92B 5BNNB 3NSTA 4IEZA 5BPXA 5KHGA 3JD71 1AL21 4AVTA 4LBKA 2FBEA 1C8M3 2WQ4A 1AYN1 4NN0A 4YVSB 4N53B 3WNXA 3POSA 1IS3A 1S0EA 2XBO3 1WW6A 2B45X 3R4SA 1SLCA 5ACA2 1QJY2 4LEJA 2BFUS 3M8LA 4H14A 4Y1ZA 2C1FA 3SMHA 4BWOA 2NPIA 2WS91 4AGGA 2PHFA 4Q4V1 4C1XA 5LEKA 1YUDA 1WW5A 2WNVA 1LHOA 3ES1A 3DGTA 4PIYA 2UU8A 2WQZC 3KS7A 3AP9A 4Z8BA 3UK9A 1S0GA 4DRVA 2ZAHA 4I3PA 3GZAA 3ZFFC 3MEPA 1G9FA 1FV2A 1BZWA 4BOWA 5E8AA 4BZ4A 1G86A 2XJQA 4AHZA 2GC1A 1NG0A 4I0BA 3AX4A 2PHLA 2XG3A 5EYXA 2LM3A 5C8CB 4J6GA 3TN93 1IS4A 1C5IA 4TSVA 1NCRA 1MS5A 2QJVA 2JJ6A 3TOJA 4QU2A 1AR92 1H1MA 3CJIA 3SH3A 4GWNA 2YUEA 5JLVA 1C1FA 3AMNA 1QDOA 3NV1A 1DZTA 5IK4A 5DUWA 1T6GC 1V9U1 2H6CA 1WD3A 1WMEA 2JECA 3SH5A 3LGRA 5KC5A 2DURA 3UJQA 2TNFA 3BB6A 1O91A 4XIOA 4Q4Y1 4FP2A 5DXDA 4CDUA 4YVWC 3JBG2 3VBUB 1D0HA 3DKWA 1DGRN 1Q8OA 2RM23 3OBRA 3J26N 4EN0A 1RMU3 3N36A 1QH6A 1J3QA 2Y38A 1D4M1 1MEC3 2CY6A 4H55A 4OHZA 3ZFGC 1OOPB 4S2DA 1G9BA 1VBC3 3WQ1A 4LO8A 5FO8B 3ROUA 2ENRA 1NY72 5E1RA 1QQP3 4RA0A 2HWF2 2WT0A 1MACA 3HBZA 4N9IA 2WT2A 4SBVA 4Y1YA 1IHMA 2PN5A 3I54A 3O0XA 4M01A 2G9FA 4QQPA 4WM7C 1MQTA 1XNDA 2ZGNA 1MS9A 3HQXA 4XFAA 1ASJ3 4RR3B 1SFYA 1FOD3 4NR1A 4R9DA 4XBQA 2QQPA 3VL8A 5FBZA 1E57A 4DRRA 1DQ1A 4WZCA 1X82A 4LBLA 4AQ2A 2DCJA 1QKQA 5HI0A 2RJKA 4AK3A 4JC1A 2PLV3 2JXAA 4XJUA 3VBHB 4CRQA 3VZLA 2YROA 4ORFA 1EV13 1JOJA 3ZXDA 1G9AA 4XF1A 3AYDA 4E4DX 2OZ6A 2K0GA 4ZU5A 2ZHKA 3PMSA 3X29B 2D6LX 4AVAA 4LLOA 1XNCA 2A3XA 4AQSA 1DBNA 1LR5A 4FPJA 3AZVA 2HWB1 2W52A 5FOJB 4JVAA 2XLGA 4RSUA 3UKTA 2XWBB 2ZACA 2OUHA 1ZBA1 2EF6A 3VBRA 3WINE 5B2GB 1R091 2X53S 1FPN2 4HT1T 2BUKA 5IUQA 1HXS1 1XNKA 3C2UA 4MH0E 1BK1A 1W6QA 2A6YA 1BVP1 2CAUA 3N7MA 2N7GA 3R0RA 1NCQA 1BMV2 1YRZA 4QPGA 1NXMA 4Y20A 3BALA 4K6BA 2VMGA 1XYOA 5CG8A 1PK6B 2HJIA 2TUNA 3ALQA 3NAPB 1R082 3AMMA 2H0BA 2VH9A 1OFNA 1AYM1 4XBLA 4D3WA 4HKWA 1PIV2 1QOSA 5CBLA 2FMDA 4NO4A 4C0HA 3DPRA 4IEOA 4N43A 1KRIA 4P5HA 1AZDA 1XRUA 1KFUL 2QNKA 1REEA 3M3IA 4AG4A 4AVSA 4MXVA 3RNSA 3Q9OA 2WIIB 4J1XA 1OQDA 1OMIA 1SBDA 2JG8B 1WCKA 1UW8A 1JUHA 1H9WA 3AB0A 3DUIA 3FBYA 1V6JA 2BTVC 1QXPA 3ELNA 1VBC2 3JUUA 1OPMA 1ZZCA 4IQPA 1RHI1 4IESA 1O3TA 1REFA 1JYCA 3HWJA 3ZSLA 1YFUA 1KITA 3FFZA 1R1ZA 5GLTA 2A73B 3IDBB 4B29A 2QZ3A 3AKQA 5BUVA 4XEZA 4K1ZA 4OHXA 4X8PA 1BQPA 3U11A 1ULDA 5C8WA 1U5IA 5EZWA 2ET7A 5DZEA 4ATEA 2GMPA 2I07B 2E9QA 4YM3A 4M00A 4XFBA 3VKFC 4RL7A 2TBVA 5A32B 1VBA1 3B7MA 4AI8A 2B39A 2OYZA 4MXWA 3WDWA 3VZOA 4IV3C 4DMIA 4E9KA 1EV12 4AI0A 4LLFA 2ZGTA 1HDKA 1O4TA 4CEWA 1AR81 4YFWA 3R4UA 1AHSA 5KC6A 1H8TC 4MZUA 1ZVFA 3RYPA 1B35B 2NMNA 2VOVA 5JOWA 3QLQA 5HBAA 5CG9A 2IXCA 3QH6A 1RUJ3 2WNUA 1DQ0A 1RUD3 4Q8KA 2AENA 3W9AA 1QJX3 3J8F3 1VRH3 1U5XA 3LAGA 1LEDA 3GZTB 1QMJA 2RMU3 3MLJA 3VBFC 5BNQA 5FO7B 2X5IA 2JD4A 1Q8VA 3VUOA 1BJQA 4PBPA 1H9PA 3ZXEA 1LOGA 2Z42A 5LRRA 1NXD1 3KM5A 3AZYA 1W2UA 1LB2A 3EO6A 3WV6A 3AKRA 3H8UA 2TEPA 4FO9A 1AX0A 3ZYRA 1EPZA 3MPPG 1DQ4A 3VZJA 4MGYE 4OI0A 4EN7B 5CB7A 2IXKA 2XWJB 1RUF3 4YYOA 2GC0A 4R52A 2CWMA 4P9XA 3V0AB 5BNOA 5C9AB 1D2QA 4LA3A 1AR72 4FPHA 4Y24A 5I93A 4YZ2A 4C91A 1A8MA 5DUXA 3AYEA 3ZMOA 1Z78A 3WDXA 2WJSA 2RS53 5DZGA 1DFQA 4P9IA 1PZ8A 4XILA 2UY9A 4JGYB 1POV0 4K40A 4QD2A 5DG2A 3RMXA 2C0ZA 3N7KA 5EWSA 3SCFA 4ASMB 2R0FA 4BE3A 2DWRA 4EN9B 3B5LB 3IPVA 2VUAA 5L19A 1WMDA 3QD6A 2DVBA 1ZBE1 2OA2A 2Q1ZB 2BGCA 1V70A 4QM8A 3WP5A 1UKRA 2GH8A 1XXNA 4CYDA 1W6NA 1NQDA 1POV1 3VGIA 2XKOA 3SCGA 2IFRA 1KDMA 1X7NA 4DY3A 2JKBA 1EAH2 4O9EA 2ZCWA 2R042 4YW2A 4UW5A 1N47A 2WKKA 2P2KA 5FPZA 2JE7A 2WFF1 5A33B 3RS6A 3GBFA 2HEWF 4XMAA 4C1WA 3ME2A 4URTA 4COWA 1RUI3 3QBQA 2VMHA 3J8F2 3JD72 3TRSB 2DUPA 2A6XA 4I30A 3SXWA 5I0RA 4Q4X1 3HMYA 3KSCA 2IXHA 2WLPA 3IDEA 4XDQA 3GNEA 4E27A 2ZGOA 1AYN2 1CN1A 1RL3A 4M0HA 4Q4W3 4EJRA 1HRI1 1RUG1 2OIIA 4CDXC 2XL9A 1YI9A 4R9CA 4AQTA 5CU1A 2WNUB 3AZXA 4I09A 1N3PA 3ZSJA 1QJZA 2WS92 3E6CC 5T5OA 4Q4V2 1VBE3 4ES8A 1HQWA 2DCKA 2R30A 4RD7A 3IIAA 2IZWA 1QU0A 1WCSA 4XJ8A 4B4QA 3B3QE 4RGAA 1ND2A 5A3MA 1BEV1 2O8QA 1H0BA 2R063 2A6WA 5K0UC 4C90A 3LA2A 2Z69A 1DGLA 1O5LA 4RHV1 4XF4A 2QVSB 4AEDB 1DQ6A 3WG4A 2ZX4A 2D98A 3ZIXA 1SLLA 1XQNA 1OLRA 5ABJC 1ULGA 2XLFA 2WA4A 2DYCA 4OUMA 4JRAA 1AR61 1CJPA 5GZCA 2BNMA 2E53A 4WV8A 3TNPB 1LTEA 3UKNA 1YJKA 3D0JA 1KDKA 4HFSA 1MS1A 2FMYA 2HWC1 2BEOA 3ASIA 2CGPA 4KG8A 2ZBJA 4LO6B 2UWCA 4PBOA 1LECA 1GLHA 3WZ1A 4LULA 1F31A 4G3YC 3WHUA 4P9WA 4PLOA 3POYA 2WZR1 4Q4Y2 2VNOA 4FXKB 4W65A 5F1RA 2G4IA 5FRAA 4JTNA 4YW1A 4RQPC 1KD7A 4AHWA 1D4M2 4UW4A 1F5JA 1AXYA 1AX2A 3V56A 2RS31 3VBSC 1BBT3 1LEMA 1SLTA 3ZFFA 5GZDA 4I02A 5T3NA 2B9UA 3NV4A 1PGL1 1BVVA 1RC6A 1RUNA 3FZ3A 5CNAA 2QZ2A 5L7OC 1HV1A 3J4UH 3V64A 4P9GA 5AC91 1V00A 1URXA 2VW0A 4WM8C 3S7IA 5FQ0A 4XETA 3IWZA 1ND3C 1K5MC 2NM1A 2XHKA 3WVJA 5C4WC 4Q4W2 5FDBA 3ZYJB 2NQYA 4JCKA 3WHTA 2PQQA 1V6NA 4LTAA 4K3UA 1TME1 4AHYA 3S7EA 1VBA3 2CV6A 4QPIB 1DYKA 3S6PA 3CU7A 1QJY3 3FBMA 2VECA 1YXWA 5I0TA 2MEV1 1Y3TA 2RS11 3N7JA 2R6QA 2BPA2 1U5YA 4GKYA 3KT7A 3WUCA 3QCWA 4YVWA 3AP7A 3N4MA 2EAAA 2WSVA 5DDJ3 2PHTA 1W6OA 3ILFA 4LT5A 2RR11 3OGGA 4CDWB 2AUYA 1F9KA 3ZFGA 3AJZA 2HWB2 3W58A 4AFBA 3D6EA 1ZBA2 1Z7S1 1R092 5D8AC 2JG9C 4XF3A 1DGRA 4NWWA 5TSWA 1FMD3 1BCXA 4KBBA 1HXS2 3MF9A 1RB8G 2DTYA 3ZFEB 4YARA 2LALA 1YO8A 4WM7A 5KBFA 5JSPA 3M2MA 4UBGA 4O9GA 1DZRA 2R16A 4XTPA 5BXXA 3MLKA 4XHXA 3CNAA 2CGOA 5BNPC 2DVGA 5H9QA 1I6XA 4YZ5A 2CWSA 1LU2A 2YDEA 4OULA 3ZIWA 1MS0A 1CIWA 1WW7A 4I0AA 5F9TA 3I4IA 4AXOA 5KWRA 2XJUA 3GBGA 3RWNA 5CFDC 1AYM2 3WXPA 4RGGA 1GZWA 2CGNA 2O1QA 2UY8A 2VG9A 3PLQA 2DFBA 4IEVA 2PHXA 3SNMA 1VBB3 1ZZBA 3W59A 3P3PA 1WUVA 1CAWA 3I2DA 3VBOB 3WD5A 4D7YA 4F3JA 3RQ0A 2VVEA 3WW1A 4Y5Z0 2GC2A 4Q2FA 3WDVA 1OPOA 4XTMA 1VR3A 3R05A 1S0BA 1QJU1 1C3HA 3VHPA 2ZX2A 3U4XA 1RHI2 4D69A 1V6KA 3MIFA 2HWF3 2XJPA 4MGZE 4AVBA 3PJYA 4YM2A 5JI7A 4KWKA 4XMIA 1F5FA 4MUVA 1LESA 2D44A 5EXOA 1PNFA 3ZSEA 3ZN6A 1IKQA 2XUMA 1U5ZA 5FLIA 3MFCA 2QCSB 4Y1VA 2V73A 1VBA2 1UCXA 1S1AA 1QH7A 1XYPA 4Q0QA 4D7TA 3NKGA 5CADA 4XIKA 3WDTA 5JAXA 3NW4A 1JHNA 2BVBA 4XF9A 3OD0A 1PVC1 1VAMA 1AR82 4MYEA 1OFSA 5CA6A 2DF7A 5DDJ2 1OA3A 3PTYA 2Y0OA 4P9JA 2ZGUA 1HKDA 2PAEA 3QACA 2PAMA 1DQ2A 4GH4A 2EXIA 3WOGA 3PJQA 3VKLA 4XFIA 5JWPA 4JGZC 2NP0A 5H9PA 2SBAA 1FNZA 2IFWA 1FPN3 5BNNC 1V6IA 4LO4B 1FMD2 4I3GA 1AXKA 4YZ1A 2EIGA 4N90A 2XJRA 4N53C 4HETA 4XQ4A 3THPA 2WINB 4YGBA 5BY5A 4B4RA 3HAGA 2C5DA 3LZZA 1TMF1 1VBD1 1R083 1QHDA 5GZEA 3UJOA 1UU4A 3PVEA 5DUUA 2HWE1 1PIV3 4J1WA 4IV3A 3GZUC 3ECQA 3J9SA 3ILNA 3OBTA 1FATA 3JCIA 4FVVA 5JPNB 1CAXB 1FT9A 4YG0A 2A3YA 1G7YA 1VBB2 2ZAAA 3BODA 2ARBA 3NJZA 1OQEA 2XJSA 1AF9A 1HRV1 2BNNA 4HSLA 4R9BA 1H8TA 4PLNA 5JZGB 5E89A 1S2KA 1WMFA 1NLSA 3ST7A 1Y43B 3WLUA 1ENRA 1KS4A 4YW5A 1CD3G 4KU7A 1SCRA 1GZWB 4PF5A 3RYRA 1PGW1 4HL0A 2WC2A 5C8CC 3AZZA 2ZHMA 4JAAA 4B7EA 2MHFA 2DFCA 1CAWB 2Q30A 2AH2A 3LA7A 3H7JA 4HKOA 4CEYB 4JDOA 1ENQA 1LKNA 1GR3A 3HD8B 3OGJA 2UYBA 3LSDA 5KHIA 2JX9A 4RS5C 2CTVA 1ZREA 1NQJA 2W08A 4XJ9A 1DU3D 5IK5A 3MIBA 1UN1A 4WVMA 4FP3A 5CFCA 4HVQA 3I8TA 1GQHA 4CDQA 2D97A 3NKTA 3KT4A 3VV1A 2BBVA 3VBUC 1RJ7A 2BVVA 4E4SA 3B02A 3AKPA 3A4UA 1OOPC 1FYUA 1RUE1 2WFF2 3M1HA 1CQ9A 3USUA 4R8HA 3QOPA 3NWKA 1RVF1 1DHKB 5K9YA 1X8EA 1NA1C 3ZSMA 4Q4X2 3VL9A 2EA7A 2EXJA 1WLWA 2E6VA 2WNVB 3NV3A 4OI2A 5GKAC 1H2NA 1J3RA 1W6PA 4COZA 1HRI2 4S2HA 4GH4B 2UYAA 4IV1A 3T1MA 4ZU4A 4YM0A 2R071 1DYPA 4INDA 1QOTA 1UIJA 4PCRA 1SBFA 3VBHC 3D8CA 2GC3A 2D6MA 3PNAA 5JMCA 4TYSA 3UKVA 1GKBA 2W39A 4FPOB 4LO5B 3K48A 5T52A 2W0XA 3KLSA 4YLZA 1NCRB 4DINB 1AL0G 4AFMA 4N9HA 1V6OA 5K8SA 1YNAA 1PO23 2Q4SA 3CJIB 5F5QA 4IL7A 4MGKE 1BEV2 3WG2A 2WA3A 4Q27A 2HWD3 3PVOA 3RDIA 3WX5A 1ZNPA 4OI1A 3AKSA 3E6BA 3M3EA 1FX5A 4RHV2 2MNGA 3MIHA 2OW4A 1AR73 1QGLA 2QKDA 2E7TA 3PMEA 2A6ZA 2ZX1A 5CAZA 2VVFA 2YMZA 4CDUB 4GB31 3RSJA 1AR62 1O4ZA 2D5HA 4YM1A 2E51A 2E7QA 1RUH1 2D3RA 4K20A 1RGSA 1FV3A 2HWC2 1PK6C 4CDXA 2XJVA 3KB5A 3NAPC 5KXDA 3KCYA 1MZFA 1J1LA 3RRDA 2YC0A 1LCLA 1TQ5A 1ZRCA 3WP6A 1ULEA 3ZXLA 1OSGA 2WL1A 4HVOA 2ZKLA 4GXLA 2ES3A 2YGMA 4G4FA 5J7MA 4FOVA 1RUOA 1MQTB 5EFUA 4OHYA 4LUKA 1R1A3 4ISRA 3LB9A 1J3PA 2GZWA 1EAH3 2JG8C 4EWEA 2R043 3B01A 2ZA9A 1UIKA 2SLIA 5J3UA 2KA3A 1A8DA 1H1AA 2RJLA 2RS32 5GALA 5K0UA 3JU9A 1V6MA 5ACA1 3UL2A 3ZXFA 4OHVA 1D2SA 1RUC1 1DZQA 1PGL2 1S0FA 2A5ZA 3D4KA 4K1YA 5CFCB 4A7YA 4RFT0 5ABJA 2IWGB 3JD73 1VJ2A 1YFWA 4CDQB 1AL23 4XJAA 3AP6A 1COV1 1X36A 2JICA 2R1BA 1AYN3 1LGNA 1L3JA 3H1MA 4FOWA 4K8FA 1MZEA 2NMOA 3KQRA 1D4VB 1A78A 4B3NA 1GNZA 1TME2 4Y26A 2VW2A 1WW4A 3IT8A 4TWTA 1QNWA 2NN8A 5KHKA 3VBRB 2MEV2 1S0IA 2WS93 3E6DA 4Q4V3 1Z0HA 3LKJA 4IXLA 2VNRA 2VVDA 4Q1PA 4LBQA 1W6QB 1QXJA 2NLRA 4I01A 1B09A 2Z5WA 1AR91 1PO11 5KXCA 2VU9A 5J48A 5T55A 4RQPA 1PO22 1NCQB 1WBLA 3DL3A 4HZFA 1B35C 1VLNA 4QPGB 2HWD2 4IV1B 3M3QA 4KWJA 4Y20B 4AW7A 2QUOA 3VDDA 3VBSA 1GQGA 1YFYA 3H50A 3H9AA 4OI4A 4K21A 2DCTA 3EQEA 3H3ZA 4WZFA 4TZDA 1IGOA 1H1IA 2LUWA 5E88A 2ZS6B 1WBFA 3CLPA 4BA6A 5L7OA 3DPRB 2P37A 4N43B 3OTFA 4WM8A 3JBG1 4EN6B 1UZZA 2GMMA 2ZABA 2YZ4A 1ND3A 1K5MA 1TEIA 1OLQA 3DV8A 5KXBA 4BHPA 4FPYA 5C4WA 1GV9A 4GQ7A 3LSEA 1V9U3 1I3HA 1LRHA 3MYXA 1SACA 1CAUA 1DQ5A 1C5HA 3V0BA 4Q4Y3 4HVRA 1O7FA 4JQRA 2UWBA 4M3CA 1C8M1 1UPIA 2B7YA 1R1A2 4FPLA 3WG3A 3WW2A 1ENSA 2YXSA 1D4M3 3FLRA 4BIOA 2XBO1 1ULCA 3MZHA 3BCWA 5C9AC 4BYYA 1QJU2 4HN1A 5D8AA 2JG9A 1W39A 4HPKA 2GSYA 2P3KA 4M0NA 4MXWB 4Q0PA 4AEKA 3EBRA 1AL22