1UPRA

Crystal structure of the pepp1 pleckstrin homology domain in complex with inositol 1,3,4,5-tetrakisphosphate
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
LRRDPNLPVHIRGWLHKQDSSGLRLWKRRWFVLSGHCLFYYKDSREESVLGSVLLPSYNIRPDGPGAPRGRRFTFTAEHPGMRTYVLAADTLEDLRGWLRALGRASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Pleckstrin Homology Domain of Pepp1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING FAMILY A MEMBER 4
total genus 19
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1uprA00
1FB8A 3ZVRA 1QQGA 5C5BB 3PG7A 3QWMA 1XKEA 1GC7A 1RJ2A 3X23A 4KHAA 5D3WA 2NMBA 1BAKA 3PVLA 1X1GA 3PZDA 2DFKA 3TW1A 1UNQA 1XR0B 1FHOA 2YF0A 2YS5A 2DKQA 2VSZA 5L81A 4C0AA 1V88A 2DX5A 2P8VA 2HTHB 2IYBA 2CAYA 3D8DA 1WI1A 4MT7A 2UZSA 2D9XA 4GMVA 2Y7BA 2ELAA 5DHFB 3NSUA 4HAUB 3SYXA 1W1GA 2P0HA 2YS1A 5J3YA 4K17A 3FSSA 4H8SA 4HAXB 2K2UA 2CODA 1W1HA 1N3HA 1AWEA 1TJ6A 5FI0A 2ROZB 3A8PA 4A5KA 3OANA 2D9YA 4A6FA 2DA0A 3AJ4A 2L1CA 3HK0A 1Z87A 2Z0PA 4KHBB 4HAWB 1IRSA 2G35A 2ZPYA 3CIKA 2DHJA 1W1DA 2H7EA 2CRFA 3ULCA 3WA0A 2D9ZA 3RCPA 5J3QA 1XD4A 4ZRJA 2LKOA 3WYFB 2XQNM 3A8QA 1XX0A 1GC6A 2N23A 2DHKA 2Z0OA 4ZRIA 1U5FA 3AU5A 1ISNA 2I5FA 5GOWB 2DKPA 1Y19B 2KCJA 3P7ZA 3GYOA 4GPTB 5JHGA 2UZRA 5D3YA 1PFJA 1WJ1A 5D27A 1K5GB 2HE7A 1OMWA 2NZ8B 3AU4A 3TO1A 2DN6A 3N7CA 4HDQA 1M7EA 3G9WA 1U2BA 2ELBA 2Y8GA 2LG1A 2E2XA 1V89A 1MK9B 3PP2A 5C6RA 5JHHA 1X1FA 3SV1A 4F7UP 2GCLA 2CY5A 5HE2A 2VRWB 4Y94A 3SUZA 1J19A 4DX8A 2JP2A 1MIXA 3MDBC 4K2PA 2QKLA 3MPXA 2DYNA 2LOZA 2DYQA 3QIJA 3TCAA 3KSYA 4PNKA 1DBHA 3M1IB 2RSGA 3ML4A 5HE1A 1PMSA 3ODOA 1FHXA 2AL6A 1X11A 4F7HA 1UNRA 1MAIA 1QC6A 1ZM0A 3QBVB 5FI1A 4CHJA 2X18A 5HE0A 1UEFA 1ZVRA 4GN1A 4YONA 3ZDTA 2D11A 3KRWA 1NTVA 1NTYA 1WGQA 1B55A 4KHOA 4GZUA 2DHIA 3ODWA 1OY2A 2I1KA 4F7GA 3VIAA 4IFSA 2PZ1A 1EGXA 1EF1A 5C5BA 1WG7A 3SNHA 4A6KA 5HE3A 4BBKA 2H7DA 1BTNA 2D10A 4K2OA 4TYZA 2MDXA 5KQ4A 2J59M 2DTCA 2LULA 1DDWA 1FHWA 1H10A 1TQZA 2KUPA 1Y5OA 1KZ7A 5DI9B 4NY0A 3A98B 2RLOA 5D3VA 2GJYA 2DLWA 3KRXA 3GYPA 4B6HA 2EC1A 2D9VA 1DYNA 4MK0A 1H4RA 2OTXA 2RVBB 1U29A 1UPRA 4A6FB 2W2XC 2GS0A 4HATB 1NU2A 4GMXB 2P0FA 3D8EA 2D2QA 5J3TA 1P5TA 3F5RA 2R09A 2Y8FA 4KVGB 3TVVA 4WSFA 2Z0QA 4HB3B 2W2XD 1X05A 2N0YA 5KQ1A 2RGNB 1TXDA 3VOQA 1ZC3B 1UNPA 2MKRA 2I5CA 2L2IA 1WJMA 1I2HA 3BINA 3KY9A 1DDMA 1XODA 1LW3A 1KI1B 4L6EA 1EVHA 1V5MA 3CXBB 4WVFB 1WVHA 3U7DA 4TKNA 3SO6A 2QKMA 2YVCA 1MIZB 1SGHA 1V61A 1MPHA 4HAVB 4YL8A 5DH9B 5C79A 2W2WA 1FGZA 1MKEA 1LB1A 2COAA 5JP4A 4XWXA 3D8FA 3ULBA 4EKUA 3PSCA 1E5WA 2EJ8A 2D9WA 4K81A 1WGUA 4D0NB 4IAPA 2Q13A 5CLQB 4CHMA 5DIFB 5JLJB 3IVFA 1U5EA 3U8ZA 1MK7B 2RNRB 2DX1A 1DDVA 5DHAB 2COCA 4MY6A 3PVWA 2KGXB 1J0WA 1DROA 1XCGA 3DXDA 3FEHA 4ZRKA 3P6AA 3ODXA 2R0DA 4HB2B 4Z2MB 1U5DA 3HQCA 2UVMA 2ROVA 2J0MA 2YT0A 2V76A 2VKIA 2BCJA 3F0WA 2AEHA 2J0JA 3DXEA 2MWNB 3HW2B 1V5UA 1V5PA 1P6SA 1Q67A 2M38A 5CLLB 3O96A 1FOEA 2ADZA 4IOYX 2COFA 1UPQA 4EMOA 1NI2A 4HDOA 4EJNA 3PVUA 1PLSA 3LJUX 4A6HA 5LONB 2OQBA 2J0KA 2GCJA 3T06A 4Z2NA 2YS3A 2I1JA 2YSZA 3TFMA 2YT1A 2FJLA 3DXCA 1GG3A 4HB0B 1OQNA 4HHVA 1I7AA 2YRYA 2K2JA 3PEGA 1BTKA 4HAZB 1K5DB 5KCVA 4NSWA 2EMSA 1ZSQA 2M14A 2MFQA 2RUKB 1KZGA 2IFSA 3KZ1A 2P0DA 1EAZA 2D4QA 4GXBA 3UZTA 5C16A 1FAOA 2LYDA 2LOXA 1ZC4B 5EFXA 1AQCA 2K00A 5LOPB 4DBBA 4PQ0A 4CYEA 1BWNA 1M7RA 1X86A 2CY4A 4KAXB 3BJIA 1FGYA 1U27A 4HAYB 3V5WA 4DXAB 4P7IA 4HB4B 5D3XA 1RRPB 1U5GA 2EMTA 1SHCA 1P3RA 4WJ7A 3FM8C 4DX90
chains in the Genus database with same CATH superfamily
1FB8A 3ZVRA 1QQGA 5C5BB 3PG7A 3QWMA 1XKEA 1GC7A 1RJ2A 3X23A 4KHAA 5D3WA 2NMBA 2Z59A 1BAKA 3PVLA 1X1GA 4GOUA 3PZDA 2DFKA 3TW1A 3NW8A 1UNQA 1XR0B 1FHOA 2YF0A 2YS5A 2DKQA 2VSZA 5L81A 5IRSA 4C0AA 1V88A 2DX5A 2P8VA 2HTHB 2IYBA 2CAYA 3D8DA 1WI1A 4MT7A 2UZSA 2D9XA 4GMVA 2Y7BA 2ELAA 2K49A 5DHFB 3NSUA 4HAUB 3SYXA 1W1GA 2P0HA 2YS1A 5J3YA 4K17A 2Z13A 3FSSA 4H8SA 4HAXB 2K2UA 2CODA 1W1HA 1N3HA 1AWEA 1TJ6A 5FI0A 2ROZB 3A8PA 4A5KA 4QJ5B 3OANA 2D9YA 4A6FA 2DA0A 3AJ4A 2L1CA 2KIEA 3HK0A 1Z87A 2Z0PA 4KHBB 4HAWB 1IRSA 2G35A 2ZPYA 3CIKA 2DHJA 1W1DA 2H7EA 2CRFA 3ULCA 3WA0A 2D9ZA 3RCPA 5J3QA 1XD4A 4ZRJA 2LKOA 3WYFB 2XQNM 3A8QA 1XX0A 1GC6A 2N23A 2DHKA 2Z0OA 3HIEA 3B77A 4ZRIA 1U5FA 3AU5A 1ISNA 2I5FA 5GOWB 4GNKB 2DKPA 1Y19B 2KCJA 3P7ZA 3GYOA 4GPTB 2Z4DA 5JHGA 2UZRA 5D3YA 1PFJA 1WJ1A 5D27A 1K5GB 2HE7A 4OSNA 1OMWA 2NZ8B 3AU4A 3TO1A 2DN6A 3N7CA 4HDQA 1M7EA 3G9WA 3OHMB 1U2BA 2ELBA 3NWDA 2Y8GA 2LG1A 2E2XA 1V89A 1MK9B 3PP2A 4DIXA 5C6RA 5JHHA 1X1FA 3SV1A 4F7UP 2GCLA 2CY5A 5HE2A 2VRWB 4Y94A 3SUZA 1J19A 4DX8A 2JP2A 1MIXA 3MDBC 4K2PA 2QKLA 3MPXA 2DYNA 2LOZA 2DYQA 4HSIA 3QIJA 3TCAA 3KSYA 4PNKA 3NWAA 1DBHA 3M1IB 1MI1A 2RSGA 3ML4A 5HE1A 1PMSA 3ODOA 1FHXA 2AL6A 1X11A 4D6WA 4F7HA 1UNRA 3A58A 1MAIA 1QC6A 1ZM0A 3QBVB 5FI1A 4CHJA 4OT1A 2X18A 5HE0A 1UEFA 1ZVRA 4GN1A 4YONA 3ZDTA 2D11A 3KRWA 1NTVA 1NTYA 1WGQA 1B55A 4KHOA 4GZUA 2DHIA 3ODWA 1OY2A 2I1KA 4F7GA 3VIAA 4IFSA 2PZ1A 1EGXA 1EF1A 5C5BA 1WG7A 3SNHA 4A6KA 5HE3A 4BBKA 2H7DA 1BTNA 2D10A 4K2OA 4TYZA 2MDXA 5KQ4A 2J59M 5I2SA 2DTCA 2LULA 2NBVA 1DDWA 1FHWA 1H10A 1TQZA 2KUPA 1Y5OA 1KZ7A 5DI9B 4NY0A 5M4YB 3A98B 2RLOA 5D3VA 3DCXA 2GJYA 2DLWA 3KRXA 3GYPA 4B6HA 2EC1A 4QXAB 2D9VA 1DYNA 4MK0A 1H4RA 2OTXA 2RVBB 1U29A 1UPRA 4A6FB 2W2XC 2GS0A 4KHBA 4HATB 5LG4B 1NU2A 4GMXB 2P0FA 3D8EA 2D2QA 5J3TA 4L1RA 1P5TA 3F5RA 2R09A 1T77A 2Y8FA 2KUQA 4KVGB 3TVVA 4WSFA 2Z0QA 4HB3B 2R2YA 1X05A 2N0YA 2W2XD 5KQ1A 2KR0A 2RGNB 1TXDA 2YT2A 2GUMA 3VOQA 1ZC3B 1UNPA 2MKRA 2I5CA 2L2IA 2RRFA 1WJMA 1I2HA 3BINA 3KY9A 1DDMA 3U12A 1XODA 1LW3A 1KI1B 4L6EA 1EVHA 1V5MA 3CXBB 4WVFB 1WVHA 3U7DA 4TKNA 3SO6A 2QKMA 2K8EA 1MIZB 2YVCA 1SGHA 1V61A 1MPHA 4HAVB 4YL8A 5DH9B 5C79A 2W2WA 1FGZA 1MKEA 1LB1A 2COAA 5JP4A 4XWXA 3D8FA 3ULBA 4EKUA 3PSCA 1E5WA 2EJ8A 2D9WA 4K81A 1WGUA 4D0NB 4IAPA 2Q13A 4QJ3B 5CLQB 4CHMA 5DIFB 3FVCA 5JLJB 3IVFA 1U5EA 3U8ZA 1MK7B 2RNRB 2DX1A 1DDVA 2ZKMX 5DHAB 2COCA 4MY6A 3PVWA 2KGXB 5I2MA 1J0WA 1DROA 1XCGA 3DXDA 3FEHA 4ZRKA 3P6AA 3ODXA 2R0DA 4HB2B 4Z2MB 1U5DA 3HQCA 2UVMA 2ROVA 2J0MA 2YT0A 2V76A 2VKIA 2BCJA 3F0WA 2AEHA 2J0JA 3DXEA 2MWNB 3HW2B 1V5UA 1V5PA 1P6SA 2KIGA 1Q67A 2M38A 5CLLB 3O96A 1FOEA 2ADZA 4IOYX 2COFA 1UPQA 4EMOA 1NI2A 4HDOA 2Z14A 4EJNA 3PVUA 1PLSA 3LJUX 4A6HA 5LONB 2OQBA 2J0KA 2GCJA 3T06A 4Z2NA 2YS3A 2I1JA 2YSZA 3TFMA 2YT1A 2FJLA 3DXCA 1GG3A 4HB0B 1OQNA 4HHVA 1I7AA 2YRYA 2K2JA 3PEGA 1BTKA 4HAZB 1K5DB 5KCVA 4NSWA 2EMSA 1ZSQA 2M14A 2MFQA 2RUKB 1KZGA 2IFSA 1ZYIA 3KZ1A 2P0DA 1EAZA 2D4QA 4GXBA 3UZTA 5C16A 1FAOA 2LYDA 2LOXA 1ZC4B 5EFXA 1AQCA 2K00A 4QJ4B 5LOPB 4DBBA 4PQ0A 4CYEA 3NWFA 1BWNA 1M7RA 1X86A 2CY4A 4CSQA 4KAXB 3BJIA 1FGYA 1U27A 4HAYB 3V5WA 4DXAB 2FJUB 4P7IA 4HB4B 5D3XA 1RRPB 1U5GA 2EMTA 1SHCA 1P3RA 4WJ7A 3FM8C 3HSAA 4DX90
chains in the Genus database with same CATH topology
1FB8A 3ZVRA 1QQGA 5C5BB 3PG7A 3QWMA 1XKEA 1GC7A 1RJ2A 3X23A 4KHAA 5D3WA 2NMBA 1BAKA 3PVLA 1X1GA 3PZDA 2DFKA 3TW1A 1UNQA 1XR0B 1FHOA 2YF0A 2YS5A 2DKQA 2VSZA 5L81A 4C0AA 1V88A 2DX5A 2P8VA 2HTHB 2IYBA 2CAYA 3D8DA 1WI1A 4MT7A 2UZSA 2D9XA 4GMVA 2Y7BA 2ELAA 5DHFB 3NSUA 4HAUB 3SYXA 1W1GA 2P0HA 2YS1A 5J3YA 4K17A 3FSSA 4H8SA 4HAXB 2K2UA 2CODA 1W1HA 1N3HA 1AWEA 1TJ6A 5FI0A 2ROZB 3A8PA 4A5KA 3OANA 2D9YA 4A6FA 2DA0A 3AJ4A 2L1CA 3HK0A 1Z87A 2Z0PA 4KHBB 4HAWB 1IRSA 2G35A 2ZPYA 3CIKA 2DHJA 1W1DA 2H7EA 2CRFA 3ULCA 3WA0A 2D9ZA 3RCPA 5J3QA 1XD4A 4ZRJA 2LKOA 3WYFB 2XQNM 3A8QA 1XX0A 1GC6A 2N23A 2DHKA 2Z0OA 4ZRIA 1U5FA 3AU5A 1ISNA 2I5FA 5GOWB 2DKPA 1Y19B 2KCJA 3P7ZA 3GYOA 4GPTB 5JHGA 2UZRA 5D3YA 1PFJA 1WJ1A 5D27A 1K5GB 2HE7A 1OMWA 2NZ8B 3AU4A 3TO1A 2DN6A 3N7CA 4HDQA 1M7EA 3G9WA 1U2BA 2ELBA 2Y8GA 2LG1A 2E2XA 1V89A 1MK9B 3PP2A 5C6RA 5JHHA 1X1FA 3SV1A 4F7UP 2GCLA 2CY5A 5HE2A 2VRWB 4Y94A 3SUZA 1J19A 4DX8A 2JP2A 1MIXA 3MDBC 4K2PA 2QKLA 3MPXA 2DYNA 2LOZA 2DYQA 3QIJA 3TCAA 3KSYA 4PNKA 1DBHA 3M1IB 2RSGA 3ML4A 5HE1A 1PMSA 3ODOA 1FHXA 2AL6A 1X11A 4F7HA 1UNRA 1MAIA 1QC6A 1ZM0A 3QBVB 5FI1A 4CHJA 2X18A 5HE0A 1UEFA 1ZVRA 4GN1A 4YONA 3ZDTA 2D11A 3KRWA 1NTVA 1NTYA 1WGQA 1B55A 4KHOA 4GZUA 2DHIA 3ODWA 1OY2A 2I1KA 4F7GA 3VIAA 4IFSA 2PZ1A 1EGXA 1EF1A 5C5BA 1WG7A 3SNHA 4A6KA 5HE3A 4BBKA 2H7DA 1BTNA 2D10A 4K2OA 4TYZA 2MDXA 5KQ4A 2J59M 2DTCA 2LULA 1DDWA 1FHWA 1H10A 1TQZA 2KUPA 1Y5OA 1KZ7A 5DI9B 4NY0A 3A98B 2RLOA 5D3VA 2GJYA 2DLWA 3KRXA 3GYPA 4B6HA 2EC1A 2D9VA 1DYNA 4MK0A 1H4RA 2OTXA 2RVBB 1U29A 1UPRA 4A6FB 2W2XC 2GS0A 4HATB 1NU2A 4GMXB 2P0FA 3D8EA 2D2QA 5J3TA 1P5TA 3F5RA 2R09A 2Y8FA 4KVGB 3TVVA 4WSFA 2Z0QA 4HB3B 2W2XD 1X05A 2N0YA 5KQ1A 2RGNB 1TXDA 3VOQA 1ZC3B 1UNPA 2MKRA 2I5CA 2L2IA 1WJMA 1I2HA 3BINA 3KY9A 1DDMA 1XODA 1LW3A 1KI1B 4L6EA 1EVHA 1V5MA 3CXBB 4WVFB 1WVHA 3U7DA 4TKNA 3SO6A 2QKMA 2YVCA 1MIZB 1SGHA 1V61A 1MPHA 4HAVB 4YL8A 5DH9B 5C79A 2W2WA 1FGZA 1MKEA 1LB1A 2COAA 5JP4A 4XWXA 3D8FA 3ULBA 4EKUA 3PSCA 1E5WA 2EJ8A 2D9WA 4K81A 1WGUA 4D0NB 4IAPA 2Q13A 5CLQB 4CHMA 5DIFB 5JLJB 3IVFA 1U5EA 3U8ZA 1MK7B 2RNRB 2DX1A 1DDVA 5DHAB 2COCA 4MY6A 3PVWA 2KGXB 1J0WA 1DROA 1XCGA 3DXDA 3FEHA 4ZRKA 3P6AA 3ODXA 2R0DA 4HB2B 4Z2MB 1U5DA 3HQCA 2UVMA 2ROVA 2J0MA 2YT0A 2V76A 2VKIA 2BCJA 3F0WA 2AEHA 2J0JA 3DXEA 2MWNB 3HW2B 1V5UA 1V5PA 1P6SA 1Q67A 2M38A 5CLLB 3O96A 1FOEA 2ADZA 4IOYX 2COFA 1UPQA 4EMOA 1NI2A 4HDOA 4EJNA 3PVUA 1PLSA 3LJUX 4A6HA 5LONB 2OQBA 2J0KA 2GCJA 3T06A 4Z2NA 2YS3A 2I1JA 2YSZA 3TFMA 2YT1A 2FJLA 3DXCA 1GG3A 4HB0B 1OQNA 4HHVA 1I7AA 2YRYA 2K2JA 3PEGA 1BTKA 4HAZB 1K5DB 5KCVA 4NSWA 2EMSA 1ZSQA 2M14A 2MFQA 2RUKB 1KZGA 2IFSA 3KZ1A 2P0DA 1EAZA 2D4QA 4GXBA 3UZTA 5C16A 1FAOA 2LYDA 2LOXA 1ZC4B 5EFXA 1AQCA 2K00A 5LOPB 4DBBA 4PQ0A 4CYEA 1BWNA 1M7RA 1X86A 2CY4A 4KAXB 3BJIA 1FGYA 1U27A 4HAYB 3V5WA 4DXAB 4P7IA 4HB4B 5D3XA 1RRPB 1U5GA 2EMTA 1SHCA 1P3RA 4WJ7A 3FM8C 4DX90
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FB8 A;  3ZVR A;  1QQG A;  5C5B B;  3PG7 A;  3QWM A;  1XKE A;  1GC7 A;  1RJ2 A;  3X23 A;  4KHA A;  5D3W A;  2NMB A;  1BAK A;  3PVL A;  1X1G A;  3PZD A;  2DFK A;  3TW1 A;  1UNQ A;  1XR0 B;  1FHO A;  2YF0 A;  2YS5 A;  2DKQ A;  2VSZ A;  5L81 A;  4C0A A;  1V88 A;  2DX5 A;  2P8V A;  2HTH B;  2IYB A;  2CAY A;  3D8D A;  1WI1 A;  4MT7 A;  2UZS A;  2D9X A;  4GMV A;  2Y7B A;  2ELA A;  5DHF B;  3NSU A;  4HAU B;  3SYX A;  1W1G A;  2P0H A;  2YS1 A;  5J3Y A;  4K17 A;  3FSS A;  4H8S A;  4HAX B;  2K2U A;  2COD A;  1W1H A;  1N3H A;  1AWE A;  1TJ6 A;  5FI0 A;  2ROZ B;  3A8P A;  4A5K A;  3OAN A;  2D9Y A;  4A6F A;  2DA0 A;  3AJ4 A;  2L1C A;  3HK0 A;  1Z87 A;  2Z0P A;  4KHB B;  4HAW B;  1IRS A;  2G35 A;  2ZPY A;  3CIK A;  2DHJ A;  1W1D A;  2H7E A;  2CRF A;  3ULC A;  3WA0 A;  2D9Z A;  3RCP A;  5J3Q A;  1XD4 A;  4ZRJ A;  2LKO A;  3WYF B;  2XQN M;  3A8Q A;  1XX0 A;  1GC6 A;  2N23 A;  2DHK A;  2Z0O A;  4ZRI A;  1U5F A;  3AU5 A;  1ISN A;  2I5F A;  5GOW B;  2DKP A;  1Y19 B;  2KCJ A;  3P7Z A;  3GYO A;  4GPT B;  5JHG A;  2UZR A;  5D3Y A;  1PFJ A;  1WJ1 A;  5D27 A;  1K5G B;  2HE7 A;  1OMW A;  2NZ8 B;  3AU4 A;  3TO1 A;  2DN6 A;  3N7C A;  4HDQ A;  1M7E A;  3G9W A;  1U2B A;  2ELB A;  2Y8G A;  2LG1 A;  2E2X A;  1V89 A;  1MK9 B;  3PP2 A;  5C6R A;  5JHH A;  1X1F A;  3SV1 A;  4F7U P;  2GCL A;  2CY5 A;  5HE2 A;  2VRW B;  4Y94 A;  3SUZ A;  1J19 A;  4DX8 A;  2JP2 A;  1MIX A;  3MDB C;  4K2P A;  2QKL A;  3MPX A;  2DYN A;  2LOZ A;  2DYQ A;  3QIJ A;  3TCA A;  3KSY A;  4PNK A;  1DBH A;  3M1I B;  2RSG A;  3ML4 A;  5HE1 A;  1PMS A;  3ODO A;  1FHX A;  2AL6 A;  1X11 A;  4F7H A;  1UNR A;  1MAI A;  1QC6 A;  1ZM0 A;  3QBV B;  5FI1 A;  4CHJ A;  2X18 A;  5HE0 A;  1UEF A;  1ZVR A;  4GN1 A;  4YON A;  3ZDT A;  2D11 A;  3KRW A;  1NTV A;  1NTY A;  1WGQ A;  1B55 A;  4KHO A;  4GZU A;  2DHI A;  3ODW A;  1OY2 A;  2I1K A;  4F7G A;  3VIA A;  4IFS A;  2PZ1 A;  1EGX A;  1EF1 A;  5C5B A;  1WG7 A;  3SNH A;  4A6K A;  5HE3 A;  4BBK A;  2H7D A;  1BTN A;  2D10 A;  4K2O A;  4TYZ A;  2MDX A;  5KQ4 A;  2J59 M;  2DTC A;  2LUL A;  1DDW A;  1FHW A;  1H10 A;  1TQZ A;  2KUP A;  1Y5O A;  1KZ7 A;  5DI9 B;  4NY0 A;  3A98 B;  2RLO A;  5D3V A;  2GJY A;  2DLW A;  3KRX A;  3GYP A;  4B6H A;  2EC1 A;  2D9V A;  1DYN A;  4MK0 A;  1H4R A;  2OTX A;  2RVB B;  1U29 A;  1UPR A;  4A6F B;  2W2X C;  2GS0 A;  4HAT B;  1NU2 A;  4GMX B;  2P0F A;  3D8E A;  2D2Q A;  5J3T A;  1P5T A;  3F5R A;  2R09 A;  2Y8F A;  4KVG B;  3TVV A;  4WSF A;  2Z0Q A;  4HB3 B;  2W2X D;  1X05 A;  2N0Y A;  5KQ1 A;  2RGN B;  1TXD A;  3VOQ A;  1ZC3 B;  1UNP A;  2MKR A;  2I5C A;  2L2I A;  1WJM A;  1I2H A;  3BIN A;  3KY9 A;  1DDM A;  1XOD A;  1LW3 A;  1KI1 B;  4L6E A;  1EVH A;  1V5M A;  3CXB B;  4WVF B;  1WVH A;  3U7D A;  4TKN A;  3SO6 A;  2QKM A;  2YVC A;  1MIZ B;  1SGH A;  1V61 A;  1MPH A;  4HAV B;  4YL8 A;  5DH9 B;  5C79 A;  2W2W A;  1FGZ A;  1MKE A;  1LB1 A;  2COA A;  5JP4 A;  4XWX A;  3D8F A;  3ULB A;  4EKU A;  3PSC A;  1E5W A;  2EJ8 A;  2D9W A;  4K81 A;  1WGU A;  4D0N B;  4IAP A;  2Q13 A;  5CLQ B;  4CHM A;  5DIF B;  5JLJ B;  3IVF A;  1U5E A;  3U8Z A;  1MK7 B;  2RNR B;  2DX1 A;  1DDV A;  5DHA B;  2COC A;  4MY6 A;  3PVW A;  2KGX B;  1J0W A;  1DRO A;  1XCG A;  3DXD A;  3FEH A;  4ZRK A;  3P6A A;  3ODX A;  2R0D A;  4HB2 B;  4Z2M B;  1U5D A;  3HQC A;  2UVM A;  2ROV A;  2J0M A;  2YT0 A;  2V76 A;  2VKI A;  2BCJ A;  3F0W A;  2AEH A;  2J0J A;  3DXE A;  2MWN B;  3HW2 B;  1V5U A;  1V5P A;  1P6S A;  1Q67 A;  2M38 A;  5CLL B;  3O96 A;  1FOE A;  2ADZ A;  4IOY X;  2COF A;  1UPQ A;  4EMO A;  1NI2 A;  4HDO A;  4EJN A;  3PVU A;  1PLS A;  3LJU X;  4A6H A;  5LON B;  2OQB A;  2J0K A;  2GCJ A;  3T06 A;  4Z2N A;  2YS3 A;  2I1J A;  2YSZ A;  3TFM A;  2YT1 A;  2FJL A;  3DXC A;  1GG3 A;  4HB0 B;  1OQN A;  4HHV A;  1I7A A;  2YRY A;  2K2J A;  3PEG A;  1BTK A;  4HAZ B;  1K5D B;  5KCV A;  4NSW A;  2EMS A;  1ZSQ A;  2M14 A;  2MFQ A;  2RUK B;  1KZG A;  2IFS A;  3KZ1 A;  2P0D A;  1EAZ A;  2D4Q A;  4GXB A;  3UZT A;  5C16 A;  1FAO A;  2LYD A;  2LOX A;  1ZC4 B;  5EFX A;  1AQC A;  2K00 A;  5LOP B;  4DBB A;  4PQ0 A;  4CYE A;  1BWN A;  1M7R A;  1X86 A;  2CY4 A;  4KAX B;  3BJI A;  1FGY A;  1U27 A;  4HAY B;  3V5W A;  4DXA B;  4P7I A;  4HB4 B;  5D3X A;  1RRP B;  1U5G A;  2EMT A;  1SHC A;  1P3R A;  4WJ7 A;  3FM8 C;  4DX9 0; 
#chains in the Genus database with same CATH topology
 1FB8 A;  3ZVR A;  1QQG A;  5C5B B;  3PG7 A;  3QWM A;  1XKE A;  1GC7 A;  1RJ2 A;  3X23 A;  4KHA A;  5D3W A;  2NMB A;  2Z59 A;  1BAK A;  3PVL A;  1X1G A;  4GOU A;  3PZD A;  2DFK A;  3TW1 A;  3NW8 A;  1UNQ A;  1XR0 B;  1FHO A;  2YF0 A;  2YS5 A;  2DKQ A;  2VSZ A;  5L81 A;  5IRS A;  4C0A A;  1V88 A;  2DX5 A;  2P8V A;  2HTH B;  2IYB A;  2CAY A;  3D8D A;  1WI1 A;  4MT7 A;  2UZS A;  2D9X A;  4GMV A;  2Y7B A;  2ELA A;  2K49 A;  5DHF B;  3NSU A;  4HAU B;  3SYX A;  1W1G A;  2P0H A;  2YS1 A;  5J3Y A;  4K17 A;  2Z13 A;  3FSS A;  4H8S A;  4HAX B;  2K2U A;  2COD A;  1W1H A;  1N3H A;  1AWE A;  1TJ6 A;  5FI0 A;  2ROZ B;  3A8P A;  4A5K A;  4QJ5 B;  3OAN A;  2D9Y A;  4A6F A;  2DA0 A;  3AJ4 A;  2L1C A;  2KIE A;  3HK0 A;  1Z87 A;  2Z0P A;  4KHB B;  4HAW B;  1IRS A;  2G35 A;  2ZPY A;  3CIK A;  2DHJ A;  1W1D A;  2H7E A;  2CRF A;  3ULC A;  3WA0 A;  2D9Z A;  3RCP A;  5J3Q A;  1XD4 A;  4ZRJ A;  2LKO A;  3WYF B;  2XQN M;  3A8Q A;  1XX0 A;  1GC6 A;  2N23 A;  2DHK A;  2Z0O A;  3HIE A;  3B77 A;  4ZRI A;  1U5F A;  3AU5 A;  1ISN A;  2I5F A;  5GOW B;  4GNK B;  2DKP A;  1Y19 B;  2KCJ A;  3P7Z A;  3GYO A;  4GPT B;  2Z4D A;  5JHG A;  2UZR A;  5D3Y A;  1PFJ A;  1WJ1 A;  5D27 A;  1K5G B;  2HE7 A;  4OSN A;  1OMW A;  2NZ8 B;  3AU4 A;  3TO1 A;  2DN6 A;  3N7C A;  4HDQ A;  1M7E A;  3G9W A;  3OHM B;  1U2B A;  2ELB A;  3NWD A;  2Y8G A;  2LG1 A;  2E2X A;  1V89 A;  1MK9 B;  3PP2 A;  4DIX A;  5C6R A;  5JHH A;  1X1F A;  3SV1 A;  4F7U P;  2GCL A;  2CY5 A;  5HE2 A;  2VRW B;  4Y94 A;  3SUZ A;  1J19 A;  4DX8 A;  2JP2 A;  1MIX A;  3MDB C;  4K2P A;  2QKL A;  3MPX A;  2DYN A;  2LOZ A;  2DYQ A;  4HSI A;  3QIJ A;  3TCA A;  3KSY A;  4PNK A;  3NWA A;  1DBH A;  3M1I B;  1MI1 A;  2RSG A;  3ML4 A;  5HE1 A;  1PMS A;  3ODO A;  1FHX A;  2AL6 A;  1X11 A;  4D6W A;  4F7H A;  1UNR A;  3A58 A;  1MAI A;  1QC6 A;  1ZM0 A;  3QBV B;  5FI1 A;  4CHJ A;  4OT1 A;  2X18 A;  5HE0 A;  1UEF A;  1ZVR A;  4GN1 A;  4YON A;  3ZDT A;  2D11 A;  3KRW A;  1NTV A;  1NTY A;  1WGQ A;  1B55 A;  4KHO A;  4GZU A;  2DHI A;  3ODW A;  1OY2 A;  2I1K A;  4F7G A;  3VIA A;  4IFS A;  2PZ1 A;  1EGX A;  1EF1 A;  5C5B A;  1WG7 A;  3SNH A;  4A6K A;  5HE3 A;  4BBK A;  2H7D A;  1BTN A;  2D10 A;  4K2O A;  4TYZ A;  2MDX A;  5KQ4 A;  2J59 M;  5I2S A;  2DTC A;  2LUL A;  2NBV A;  1DDW A;  1FHW A;  1H10 A;  1TQZ A;  2KUP A;  1Y5O A;  1KZ7 A;  5DI9 B;  4NY0 A;  5M4Y B;  3A98 B;  2RLO A;  5D3V A;  3DCX A;  2GJY A;  2DLW A;  3KRX A;  3GYP A;  4B6H A;  2EC1 A;  4QXA B;  2D9V A;  1DYN A;  4MK0 A;  1H4R A;  2OTX A;  2RVB B;  1U29 A;  1UPR A;  4A6F B;  2W2X C;  2GS0 A;  4KHB A;  4HAT B;  5LG4 B;  1NU2 A;  4GMX B;  2P0F A;  3D8E A;  2D2Q A;  5J3T A;  4L1R A;  1P5T A;  3F5R A;  2R09 A;  1T77 A;  2Y8F A;  2KUQ A;  4KVG B;  3TVV A;  4WSF A;  2Z0Q A;  4HB3 B;  2R2Y A;  1X05 A;  2N0Y A;  2W2X D;  5KQ1 A;  2KR0 A;  2RGN B;  1TXD A;  2YT2 A;  2GUM A;  3VOQ A;  1ZC3 B;  1UNP A;  2MKR A;  2I5C A;  2L2I A;  2RRF A;  1WJM A;  1I2H A;  3BIN A;  3KY9 A;  1DDM A;  3U12 A;  1XOD A;  1LW3 A;  1KI1 B;  4L6E A;  1EVH A;  1V5M A;  3CXB B;  4WVF B;  1WVH A;  3U7D A;  4TKN A;  3SO6 A;  2QKM A;  2K8E A;  1MIZ B;  2YVC A;  1SGH A;  1V61 A;  1MPH A;  4HAV B;  4YL8 A;  5DH9 B;  5C79 A;  2W2W A;  1FGZ A;  1MKE A;  1LB1 A;  2COA A;  5JP4 A;  4XWX A;  3D8F A;  3ULB A;  4EKU A;  3PSC A;  1E5W A;  2EJ8 A;  2D9W A;  4K81 A;  1WGU A;  4D0N B;  4IAP A;  2Q13 A;  4QJ3 B;  5CLQ B;  4CHM A;  5DIF B;  3FVC A;  5JLJ B;  3IVF A;  1U5E A;  3U8Z A;  1MK7 B;  2RNR B;  2DX1 A;  1DDV A;  2ZKM X;  5DHA B;  2COC A;  4MY6 A;  3PVW A;  2KGX B;  5I2M A;  1J0W A;  1DRO A;  1XCG A;  3DXD A;  3FEH A;  4ZRK A;  3P6A A;  3ODX A;  2R0D A;  4HB2 B;  4Z2M B;  1U5D A;  3HQC A;  2UVM A;  2ROV A;  2J0M A;  2YT0 A;  2V76 A;  2VKI A;  2BCJ A;  3F0W A;  2AEH A;  2J0J A;  3DXE A;  2MWN B;  3HW2 B;  1V5U A;  1V5P A;  1P6S A;  2KIG A;  1Q67 A;  2M38 A;  5CLL B;  3O96 A;  1FOE A;  2ADZ A;  4IOY X;  2COF A;  1UPQ A;  4EMO A;  1NI2 A;  4HDO A;  2Z14 A;  4EJN A;  3PVU A;  1PLS A;  3LJU X;  4A6H A;  5LON B;  2OQB A;  2J0K A;  2GCJ A;  3T06 A;  4Z2N A;  2YS3 A;  2I1J A;  2YSZ A;  3TFM A;  2YT1 A;  2FJL A;  3DXC A;  1GG3 A;  4HB0 B;  1OQN A;  4HHV A;  1I7A A;  2YRY A;  2K2J A;  3PEG A;  1BTK A;  4HAZ B;  1K5D B;  5KCV A;  4NSW A;  2EMS A;  1ZSQ A;  2M14 A;  2MFQ A;  2RUK B;  1KZG A;  2IFS A;  1ZYI A;  3KZ1 A;  2P0D A;  1EAZ A;  2D4Q A;  4GXB A;  3UZT A;  5C16 A;  1FAO A;  2LYD A;  2LOX A;  1ZC4 B;  5EFX A;  1AQC A;  2K00 A;  4QJ4 B;  5LOP B;  4DBB A;  4PQ0 A;  4CYE A;  3NWF A;  1BWN A;  1M7R A;  1X86 A;  2CY4 A;  4CSQ A;  4KAX B;  3BJI A;  1FGY A;  1U27 A;  4HAY B;  3V5W A;  4DXA B;  2FJU B;  4P7I A;  4HB4 B;  5D3X A;  1RRP B;  1U5G A;  2EMT A;  1SHC A;  1P3R A;  4WJ7 A;  3FM8 C;  3HSA A;  4DX9 0; 
#chains in the Genus database with same CATH homology
 1FB8 A;  3ZVR A;  1QQG A;  5C5B B;  3PG7 A;  3QWM A;  1XKE A;  1GC7 A;  1RJ2 A;  3X23 A;  4KHA A;  5D3W A;  2NMB A;  1BAK A;  3PVL A;  1X1G A;  3PZD A;  2DFK A;  3TW1 A;  1UNQ A;  1XR0 B;  1FHO A;  2YF0 A;  2YS5 A;  2DKQ A;  2VSZ A;  5L81 A;  4C0A A;  1V88 A;  2DX5 A;  2P8V A;  2HTH B;  2IYB A;  2CAY A;  3D8D A;  1WI1 A;  4MT7 A;  2UZS A;  2D9X A;  4GMV A;  2Y7B A;  2ELA A;  5DHF B;  3NSU A;  4HAU B;  3SYX A;  1W1G A;  2P0H A;  2YS1 A;  5J3Y A;  4K17 A;  3FSS A;  4H8S A;  4HAX B;  2K2U A;  2COD A;  1W1H A;  1N3H A;  1AWE A;  1TJ6 A;  5FI0 A;  2ROZ B;  3A8P A;  4A5K A;  3OAN A;  2D9Y A;  4A6F A;  2DA0 A;  3AJ4 A;  2L1C A;  3HK0 A;  1Z87 A;  2Z0P A;  4KHB B;  4HAW B;  1IRS A;  2G35 A;  2ZPY A;  3CIK A;  2DHJ A;  1W1D A;  2H7E A;  2CRF A;  3ULC A;  3WA0 A;  2D9Z A;  3RCP A;  5J3Q A;  1XD4 A;  4ZRJ A;  2LKO A;  3WYF B;  2XQN M;  3A8Q A;  1XX0 A;  1GC6 A;  2N23 A;  2DHK A;  2Z0O A;  4ZRI A;  1U5F A;  3AU5 A;  1ISN A;  2I5F A;  5GOW B;  2DKP A;  1Y19 B;  2KCJ A;  3P7Z A;  3GYO A;  4GPT B;  5JHG A;  2UZR A;  5D3Y A;  1PFJ A;  1WJ1 A;  5D27 A;  1K5G B;  2HE7 A;  1OMW A;  2NZ8 B;  3AU4 A;  3TO1 A;  2DN6 A;  3N7C A;  4HDQ A;  1M7E A;  3G9W A;  1U2B A;  2ELB A;  2Y8G A;  2LG1 A;  2E2X A;  1V89 A;  1MK9 B;  3PP2 A;  5C6R A;  5JHH A;  1X1F A;  3SV1 A;  4F7U P;  2GCL A;  2CY5 A;  5HE2 A;  2VRW B;  4Y94 A;  3SUZ A;  1J19 A;  4DX8 A;  2JP2 A;  1MIX A;  3MDB C;  4K2P A;  2QKL A;  3MPX A;  2DYN A;  2LOZ A;  2DYQ A;  3QIJ A;  3TCA A;  3KSY A;  4PNK A;  1DBH A;  3M1I B;  2RSG A;  3ML4 A;  5HE1 A;  1PMS A;  3ODO A;  1FHX A;  2AL6 A;  1X11 A;  4F7H A;  1UNR A;  1MAI A;  1QC6 A;  1ZM0 A;  3QBV B;  5FI1 A;  4CHJ A;  2X18 A;  5HE0 A;  1UEF A;  1ZVR A;  4GN1 A;  4YON A;  3ZDT A;  2D11 A;  3KRW A;  1NTV A;  1NTY A;  1WGQ A;  1B55 A;  4KHO A;  4GZU A;  2DHI A;  3ODW A;  1OY2 A;  2I1K A;  4F7G A;  3VIA A;  4IFS A;  2PZ1 A;  1EGX A;  1EF1 A;  5C5B A;  1WG7 A;  3SNH A;  4A6K A;  5HE3 A;  4BBK A;  2H7D A;  1BTN A;  2D10 A;  4K2O A;  4TYZ A;  2MDX A;  5KQ4 A;  2J59 M;  2DTC A;  2LUL A;  1DDW A;  1FHW A;  1H10 A;  1TQZ A;  2KUP A;  1Y5O A;  1KZ7 A;  5DI9 B;  4NY0 A;  3A98 B;  2RLO A;  5D3V A;  2GJY A;  2DLW A;  3KRX A;  3GYP A;  4B6H A;  2EC1 A;  2D9V A;  1DYN A;  4MK0 A;  1H4R A;  2OTX A;  2RVB B;  1U29 A;  1UPR A;  4A6F B;  2W2X C;  2GS0 A;  4HAT B;  1NU2 A;  4GMX B;  2P0F A;  3D8E A;  2D2Q A;  5J3T A;  1P5T A;  3F5R A;  2R09 A;  2Y8F A;  4KVG B;  3TVV A;  4WSF A;  2Z0Q A;  4HB3 B;  2W2X D;  1X05 A;  2N0Y A;  5KQ1 A;  2RGN B;  1TXD A;  3VOQ A;  1ZC3 B;  1UNP A;  2MKR A;  2I5C A;  2L2I A;  1WJM A;  1I2H A;  3BIN A;  3KY9 A;  1DDM A;  1XOD A;  1LW3 A;  1KI1 B;  4L6E A;  1EVH A;  1V5M A;  3CXB B;  4WVF B;  1WVH A;  3U7D A;  4TKN A;  3SO6 A;  2QKM A;  2YVC A;  1MIZ B;  1SGH A;  1V61 A;  1MPH A;  4HAV B;  4YL8 A;  5DH9 B;  5C79 A;  2W2W A;  1FGZ A;  1MKE A;  1LB1 A;  2COA A;  5JP4 A;  4XWX A;  3D8F A;  3ULB A;  4EKU A;  3PSC A;  1E5W A;  2EJ8 A;  2D9W A;  4K81 A;  1WGU A;  4D0N B;  4IAP A;  2Q13 A;  5CLQ B;  4CHM A;  5DIF B;  5JLJ B;  3IVF A;  1U5E A;  3U8Z A;  1MK7 B;  2RNR B;  2DX1 A;  1DDV A;  5DHA B;  2COC A;  4MY6 A;  3PVW A;  2KGX B;  1J0W A;  1DRO A;  1XCG A;  3DXD A;  3FEH A;  4ZRK A;  3P6A A;  3ODX A;  2R0D A;  4HB2 B;  4Z2M B;  1U5D A;  3HQC A;  2UVM A;  2ROV A;  2J0M A;  2YT0 A;  2V76 A;  2VKI A;  2BCJ A;  3F0W A;  2AEH A;  2J0J A;  3DXE A;  2MWN B;  3HW2 B;  1V5U A;  1V5P A;  1P6S A;  1Q67 A;  2M38 A;  5CLL B;  3O96 A;  1FOE A;  2ADZ A;  4IOY X;  2COF A;  1UPQ A;  4EMO A;  1NI2 A;  4HDO A;  4EJN A;  3PVU A;  1PLS A;  3LJU X;  4A6H A;  5LON B;  2OQB A;  2J0K A;  2GCJ A;  3T06 A;  4Z2N A;  2YS3 A;  2I1J A;  2YSZ A;  3TFM A;  2YT1 A;  2FJL A;  3DXC A;  1GG3 A;  4HB0 B;  1OQN A;  4HHV A;  1I7A A;  2YRY A;  2K2J A;  3PEG A;  1BTK A;  4HAZ B;  1K5D B;  5KCV A;  4NSW A;  2EMS A;  1ZSQ A;  2M14 A;  2MFQ A;  2RUK B;  1KZG A;  2IFS A;  3KZ1 A;  2P0D A;  1EAZ A;  2D4Q A;  4GXB A;  3UZT A;  5C16 A;  1FAO A;  2LYD A;  2LOX A;  1ZC4 B;  5EFX A;  1AQC A;  2K00 A;  5LOP B;  4DBB A;  4PQ0 A;  4CYE A;  1BWN A;  1M7R A;  1X86 A;  2CY4 A;  4KAX B;  3BJI A;  1FGY A;  1U27 A;  4HAY B;  3V5W A;  4DXA B;  4P7I A;  4HB4 B;  5D3X A;  1RRP B;  1U5G A;  2EMT A;  1SHC A;  1P3R A;  4WJ7 A;  3FM8 C;  4DX9 0; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...