1UPRA

Crystal structure of the pepp1 pleckstrin homology domain in complex with inositol 1,3,4,5-tetrakisphosphate
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
LRRDPNLPVHIRGWLHKQDSSGLRLWKRRWFVLSGHCLFYYKDSREESVLGSVLLPSYNIRPDGPGAPRGRRFTFTAEHPGMRTYVLAADTLEDLRGWLRALGRASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING FAMILY A MEMBER 4
publication title Crystal Structure of the Pleckstrin Homology Domain of Pepp1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 19
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1uprA00
2DYNA 2K2UA 3TFMA 2UVMA 2J59M 2N23A 4HAVB 4ZRIA 4CHJA 1M7EA 2N0YA 3P7ZA 3SO6A 1WG7A 4CYEA 3TCAA 4Y94A 5HE2A 1TQZA 2ELBA 2EJ8A 1BTKA 3WYFB 1WVHA 1XKEA 5J3QA 4HDQA 2D4QA 2OTXA 2RSGA 1UPRA 3KRWA 1PMSA 5FI1A 2COFA 2K2JA 4DBBA 2YF0A 2LOXA 3SUZA 4MY6A 1U5FA 2HTHB 1DYNA 1U2BA 2Q13A 2YS5A 1DDWA 1X86A 4PNKA 3DXDA 2CAYA 2Y7BA 3BINA 2DHIA 3TW1A 3VOQA 2RNRB 4HAXB 2P0FA 4EMOA 2CY5A 3A8PA 4Z2MB 5HE1A 4GXBA 3U7DA 2BCJA 3D8FA 3NSUA 1QQGA 2D9WA 2HE7A 1FOEA 4CHMA 4K2PA 2RGNB 3QIJA 4DXAB 3PVUA 4NSWA 3DXEA 1X1FA 5JHHA 4HAYB 1ZM0A 2COAA 2Y8FA 4WVFB 1N3HA 4Z2NA 1Q67A 3HW2B 1V5UA 1AQCA 3SYXA 2COCA 4HB2B 2D9XA 2AEHA 2IFSA 5FI0A 4A6FB 5DIFB 2MWNB 3SV1A 1U27A 4WSFA 1XCGA 3MPXA 4KHBB 4GPTB 5D3YA 3ML4A 3ZVRA 2I1KA 2LULA 4A6KA 2YRYA 2VRWB 2AL6A 1MK9B 4YONA 3WA0A 1U5DA 2DFKA 4TKNA 3P6AA 4K81A 2W2WA 2YT0A 5GOWB 2XQNM 1OY2A 1KZGA 2L1CA 4DX90 4F7GA 2D11A 4K2OA 3KZ1A 2M38A 1Y5OA 4EJNA 5JP4A 1NTVA 3RCPA 3PEGA 5J3YA 1XR0B 2DN6A 4F7HA 4HAUB 3HQCA 5C6RA 2MDXA 1H4RA 4MK0A 2CRFA 4KHOA 2DLWA 2GCLA 4IAPA 1IRSA 5KQ1A 1PLSA 1BWNA 1FGZA 3TO1A 2KGXB 1NI2A 5J3TA 5D3WA 3FEHA 3F0WA 3G9WA 4WJ7A 1FHXA 5D27A 5JLJB 2FJLA 2DKPA 2CODA 1WGUA 2DX1A 2V76A 3KY9A 4TYZA 2DHJA 1V89A 2DA0A 5C16A 3HK0A 1PFJA 2CY4A 1ZSQA 1UNRA 1J19A 3D8EA 1J0WA 2G35A 2YS1A 1V5PA 2J0MA 3A98B 1WJ1A 4GMVA 2D9ZA 1BTNA 4D0NB 1I2HA 5C5BB 4P7IA 4YL8A 1ISNA 2Y8GA 1OQNA 1MAIA 4A5KA 1GC7A 1SGHA 5KCVA 2RVBB 3QBVB 1DDMA 5DHAB 2PZ1A 4GMXB 2LOZA 1XODA 3ODXA 4NY0A 2P0HA 2L2IA 3QWMA 1K5DB 3M1IB 1U29A 4HHVA 3ULCA 3KSYA 1MIZB 1ZVRA 2DTCA 5HE0A 2M14A 1WGQA 1M7RA 1P6SA 2DX5A 3N7CA 2EMTA 2LKOA 4HB4B 2ELAA 4HAWB 4GN1A 4IFSA 2ROVA 2ADZA 1H10A 5DH9B 3PP2A 2EC1A 4HAZB 1V5MA 3OANA 1EF1A 2P0DA 2Z0OA 1ZC3B 5C5BA 1U5EA 5KQ4A 5D3XA 1X05A 1I7AA 2MFQA 4L6EA 5D3VA 3UZTA 2DHKA 3VIAA 4DX8A 4HDOA 4HB0B 1P5TA 2EMSA 1RJ2A 4KVGB 1LB1A 2QKMA 3U8ZA 5CLQB 1U5GA 1X11A 2OQBA 1B55A 1FHWA 2QKLA 1OMWA 2Z0QA 4BBKA 2I1JA 5LONB 1TXDA 2J0JA 4HATB 4HB3B 4A6FA 1BAKA 1QC6A 3LJUX 1DBHA 3ODOA 1Z87A 3SNHA 2KCJA 2D9YA 2ROZB 3ZDTA 3CXBB 2IYBA 1GG3A 1Y19B 3AU4A 3PSCA 3PVLA 1MKEA 3PG7A 1P3RA 1DDVA 1WI1A 3AJ4A 4ZRJA 2W2XC 2R0DA 5C79A 4EKUA 3KRXA 4XWXA 2MKRA 4C0AA 3AU5A 1UNQA 2KUPA 2I5FA 3ODWA 2K00A 5DHFB 3GYOA 4K17A 4KAXB 1ZC4B 3PZDA 4A6HA 1NU2A 1TJ6A 5EFXA 3O96A 3V5WA 1AWEA 3X23A 2GJYA 2GS0A 1W1DA 2YT1A 2UZRA 2RLOA 1DROA 1V88A 1UEFA 2E2XA 4IOYX 2X18A 1UNPA 2RUKB 2UZSA 4B6HA 2D10A 3GYPA 1W1GA 3D8DA 1MK7B 5JHGA 1E5WA 3ULBA 2P8VA 1FAOA 1UPQA 1EGXA 1NTYA 2ZPYA 1KI1B 2Z0PA 1K5GB 4H8SA 1MIXA 2H7EA 1LW3A 1W1HA 2H7DA 2YSZA 1FHOA 3F5RA 4PQ0A 1WJMA 2NZ8B 1RRPB 3IVFA 3BJIA 4MT7A 2VKIA 2D2QA 5L81A 3A8QA 3TVVA 2DKQA 3PVWA 4ZRKA 5CLLB 1FB8A 5LOPB 2J0KA 1EVHA 3FM8C 5HE3A 3MDBC 1KZ7A 1FGYA 2W2XD 2D9VA 3DXCA 3FSSA 1X1GA 5DI9B 2YS3A 3T06A 1SHCA 2GCJA 2I5CA 2LG1A 1MPHA 2R09A 4KHAA 2VSZA 1V61A 4GZUA 1GC6A 2NMBA 2DYQA 4F7UP 3CIKA 2YVCA 1XX0A 2JP2A 1EAZA 2LYDA 1XD4A
chains in the Genus database with same CATH superfamily
2DYNA 2K2UA 3TFMA 2UVMA 2J59M 2N23A 3NW8A 4HAVB 4ZRIA 1M7EA 4CHJA 2N0YA 2KR0A 3HSAA 3P7ZA 3SO6A 1WG7A 4CYEA 3TCAA 4Y94A 5HE2A 1TQZA 2ELBA 2EJ8A 5IRSA 1BTKA 3WYFB 1WVHA 1XKEA 5J3QA 4HDQA 2D4QA 2OTXA 2RSGA 1UPRA 3KRWA 1PMSA 5FI1A 2COFA 2K2JA 4DBBA 2YF0A 2LOXA 2GUMA 3SUZA 4MY6A 1U5FA 2HTHB 1DYNA 1U2BA 2Q13A 2YS5A 1DDWA 1X86A 4PNKA 5I2MA 3DXDA 2CAYA 2Y7BA 3BINA 2DHIA 2Z14A 3TW1A 3VOQA 2KIGA 3NWAA 2ZKMX 2RNRB 4HAXB 2P0FA 4EMOA 2CY5A 3A8PA 4Z2MB 5HE1A 4GXBA 3U7DA 2BCJA 3D8FA 3NSUA 1QQGA 2D9WA 2HE7A 4OSNA 2Z4DA 1FOEA 4CHMA 4K2PA 2RGNB 3QIJA 4DXAB 4DIXA 3PVUA 5LG4B 4NSWA 3DXEA 1X1FA 5JHHA 4HAYB 1ZM0A 2COAA 2Y8FA 4WVFB 1N3HA 4Z2NA 1Q67A 3HW2B 1V5UA 1AQCA 3SYXA 2COCA 4HB2B 2D9XA 2AEHA 2IFSA 5FI0A 4A6FB 5DIFB 2MWNB 3SV1A 1U27A 4WSFA 1XCGA 3MPXA 2R2YA 4KHBB 3OHMB 4GPTB 5D3YA 3ML4A 3ZVRA 2I1KA 2LULA 4QJ4B 4A6KA 2YRYA 2VRWB 2AL6A 1MK9B 4YONA 3WA0A 2K8EA 1U5DA 2DFKA 4TKNA 3P6AA 4K81A 2W2WA 2YT0A 3NWFA 5GOWB 2XQNM 1OY2A 1KZGA 2L1CA 4DX90 4F7GA 2D11A 4K2OA 3KZ1A 2M38A 1Y5OA 4EJNA 5JP4A 1NTVA 3RCPA 4CSQA 3PEGA 5J3YA 1XR0B 2DN6A 4F7HA 4HAUB 3HQCA 5C6RA 2MDXA 1H4RA 4MK0A 2CRFA 4KHOA 4HSIA 2DLWA 2GCLA 4IAPA 1IRSA 5KQ1A 1PLSA 1BWNA 1FGZA 3TO1A 5I2SA 2KGXB 1NI2A 5J3TA 5D3WA 3FEHA 3F0WA 4KHBA 3G9WA 4WJ7A 1FHXA 5D27A 5JLJB 2FJLA 2DKPA 2CODA 1WGUA 2DX1A 2V76A 3KY9A 3HIEA 4TYZA 2DHJA 1V89A 2DA0A 5C16A 3HK0A 1PFJA 2CY4A 4L1RA 1ZSQA 1UNRA 1ZYIA 1J19A 3D8EA 1J0WA 2G35A 2YS1A 1V5PA 2J0MA 3A98B 1WJ1A 4GMVA 2D9ZA 1BTNA 4D0NB 1I2HA 2FJUB 5C5BB 4P7IA 4YL8A 1ISNA 2Y8GA 1OQNA 1MAIA 4A5KA 1GC7A 1SGHA 5KCVA 2RVBB 3QBVB 1DDMA 5DHAB 2PZ1A 4GMXB 2LOZA 1XODA 3ODXA 4NY0A 2P0HA 2L2IA 3QWMA 3DCXA 1K5DB 3M1IB 1U29A 4HHVA 3ULCA 3KSYA 1MIZB 1ZVRA 2DTCA 4QJ3B 5HE0A 2M14A 1WGQA 1M7RA 1P6SA 2DX5A 3N7CA 2EMTA 2LKOA 4HB4B 2ELAA 4HAWB 4GN1A 3A58A 3NWDA 4IFSA 2ROVA 2ADZA 3U12A 1H10A 5DH9B 3PP2A 2EC1A 4HAZB 1V5MA 3OANA 1EF1A 2P0DA 2Z0OA 1ZC3B 5C5BA 1U5EA 5KQ4A 5D3XA 1X05A 1I7AA 4D6WA 2MFQA 4L6EA 5D3VA 3UZTA 2DHKA 4QXAB 3VIAA 4DX8A 2K49A 4HDOA 4HB0B 1P5TA 2EMSA 1RJ2A 3FVCA 4KVGB 1LB1A 2QKMA 3U8ZA 5CLQB 1U5GA 1X11A 2OQBA 1B55A 1FHWA 2QKLA 1OMWA 2Z0QA 4BBKA 2I1JA 5LONB 1TXDA 2J0JA 4HATB 4HB3B 4A6FA 1BAKA 1QC6A 3LJUX 1DBHA 3ODOA 1Z87A 3SNHA 2KCJA 2D9YA 2ROZB 3ZDTA 3CXBB 2IYBA 1GG3A 1Y19B 2NBVA 3AU4A 3PSCA 4QJ5B 3PVLA 1MKEA 3PG7A 1P3RA 1DDVA 1WI1A 3AJ4A 4ZRJA 2W2XC 2R0DA 5C79A 4EKUA 3KRXA 4XWXA 2MKRA 4C0AA 3AU5A 1UNQA 2KUPA 1MI1A 2I5FA 3ODWA 2K00A 5DHFB 3GYOA 4K17A 4KAXB 1ZC4B 3PZDA 4A6HA 1NU2A 1TJ6A 5EFXA 3O96A 3V5WA 1AWEA 3X23A 2GJYA 2GS0A 1W1DA 2YT1A 2UZRA 2RLOA 1DROA 1V88A 1UEFA 2E2XA 4IOYX 4OT1A 2X18A 4GNKB 1UNPA 2RUKB 2UZSA 4B6HA 2Z13A 2D10A 3GYPA 1W1GA 3D8DA 1MK7B 5JHGA 1E5WA 3ULBA 2P8VA 1FAOA 1UPQA 1EGXA 1NTYA 2ZPYA 1KI1B 2Z0PA 1K5GB 4H8SA 1MIXA 2H7EA 1LW3A 1W1HA 4GOUA 2H7DA 2YSZA 1FHOA 3F5RA 4PQ0A 1WJMA 2NZ8B 1RRPB 3IVFA 3BJIA 4MT7A 2YT2A 2VKIA 2D2QA 5L81A 3A8QA 3TVVA 5M4YB 2DKQA 3PVWA 4ZRKA 5CLLB 1FB8A 5LOPB 2J0KA 1EVHA 3FM8C 2KIEA 5HE3A 3MDBC 1T77A 1KZ7A 1FGYA 2W2XD 2D9VA 3DXCA 3FSSA 1X1GA 5DI9B 2YS3A 2KUQA 3T06A 1SHCA 2GCJA 3B77A 2Z59A 2I5CA 2LG1A 1MPHA 2R09A 4KHAA 2VSZA 1V61A 4GZUA 1GC6A 2NMBA 2DYQA 4F7UP 2RRFA 3CIKA 2YVCA 1XX0A 2JP2A 1EAZA 2LYDA 1XD4A
chains in the Genus database with same CATH topology
2DYNA 2K2UA 3TFMA 2UVMA 2J59M 2N23A 4HAVB 4ZRIA 4CHJA 1M7EA 2N0YA 3P7ZA 3SO6A 1WG7A 4CYEA 3TCAA 4Y94A 5HE2A 1TQZA 2ELBA 2EJ8A 1BTKA 3WYFB 1WVHA 1XKEA 5J3QA 4HDQA 2D4QA 2OTXA 2RSGA 1UPRA 3KRWA 1PMSA 5FI1A 2COFA 2K2JA 4DBBA 2YF0A 2LOXA 3SUZA 4MY6A 1U5FA 2HTHB 1DYNA 1U2BA 2Q13A 2YS5A 1DDWA 1X86A 4PNKA 3DXDA 2CAYA 2Y7BA 3BINA 2DHIA 3TW1A 3VOQA 2RNRB 4HAXB 2P0FA 4EMOA 2CY5A 3A8PA 4Z2MB 5HE1A 4GXBA 3U7DA 2BCJA 3D8FA 3NSUA 1QQGA 2D9WA 2HE7A 1FOEA 4CHMA 4K2PA 2RGNB 3QIJA 4DXAB 3PVUA 4NSWA 3DXEA 1X1FA 5JHHA 4HAYB 1ZM0A 2COAA 2Y8FA 4WVFB 1N3HA 4Z2NA 1Q67A 3HW2B 1V5UA 1AQCA 3SYXA 2COCA 4HB2B 2D9XA 2AEHA 2IFSA 5FI0A 4A6FB 5DIFB 2MWNB 3SV1A 1U27A 4WSFA 1XCGA 3MPXA 4KHBB 4GPTB 5D3YA 3ML4A 3ZVRA 2I1KA 2LULA 4A6KA 2YRYA 2VRWB 2AL6A 1MK9B 4YONA 3WA0A 1U5DA 2DFKA 4TKNA 3P6AA 4K81A 2W2WA 2YT0A 5GOWB 2XQNM 1OY2A 1KZGA 2L1CA 4DX90 4F7GA 2D11A 4K2OA 3KZ1A 2M38A 1Y5OA 4EJNA 5JP4A 1NTVA 3RCPA 3PEGA 5J3YA 1XR0B 2DN6A 4F7HA 4HAUB 3HQCA 5C6RA 2MDXA 1H4RA 4MK0A 2CRFA 4KHOA 2DLWA 2GCLA 4IAPA 1IRSA 5KQ1A 1PLSA 1BWNA 1FGZA 3TO1A 2KGXB 1NI2A 5J3TA 5D3WA 3FEHA 3F0WA 3G9WA 4WJ7A 1FHXA 5D27A 5JLJB 2FJLA 2DKPA 2CODA 1WGUA 2DX1A 2V76A 3KY9A 4TYZA 2DHJA 1V89A 2DA0A 5C16A 3HK0A 1PFJA 2CY4A 1ZSQA 1UNRA 1J19A 3D8EA 1J0WA 2G35A 2YS1A 1V5PA 2J0MA 3A98B 1WJ1A 4GMVA 2D9ZA 1BTNA 4D0NB 1I2HA 5C5BB 4P7IA 4YL8A 1ISNA 2Y8GA 1OQNA 1MAIA 4A5KA 1GC7A 1SGHA 5KCVA 2RVBB 3QBVB 1DDMA 5DHAB 2PZ1A 4GMXB 2LOZA 1XODA 3ODXA 4NY0A 2P0HA 2L2IA 3QWMA 1K5DB 3M1IB 1U29A 4HHVA 3ULCA 3KSYA 1MIZB 1ZVRA 2DTCA 5HE0A 2M14A 1WGQA 1M7RA 1P6SA 2DX5A 3N7CA 2EMTA 2LKOA 4HB4B 2ELAA 4HAWB 4GN1A 4IFSA 2ROVA 2ADZA 1H10A 5DH9B 3PP2A 2EC1A 4HAZB 1V5MA 3OANA 1EF1A 2P0DA 2Z0OA 1ZC3B 5C5BA 1U5EA 5KQ4A 5D3XA 1X05A 1I7AA 2MFQA 4L6EA 5D3VA 3UZTA 2DHKA 3VIAA 4DX8A 4HDOA 4HB0B 1P5TA 2EMSA 1RJ2A 4KVGB 1LB1A 2QKMA 3U8ZA 5CLQB 1U5GA 1X11A 2OQBA 1B55A 1FHWA 2QKLA 1OMWA 2Z0QA 4BBKA 2I1JA 5LONB 1TXDA 2J0JA 4HATB 4HB3B 4A6FA 1BAKA 1QC6A 3LJUX 1DBHA 3ODOA 1Z87A 3SNHA 2KCJA 2D9YA 2ROZB 3ZDTA 3CXBB 2IYBA 1GG3A 1Y19B 3AU4A 3PSCA 3PVLA 1MKEA 3PG7A 1P3RA 1DDVA 1WI1A 3AJ4A 4ZRJA 2W2XC 2R0DA 5C79A 4EKUA 3KRXA 4XWXA 2MKRA 4C0AA 3AU5A 1UNQA 2KUPA 2I5FA 3ODWA 2K00A 5DHFB 3GYOA 4K17A 4KAXB 1ZC4B 3PZDA 4A6HA 1NU2A 1TJ6A 5EFXA 3O96A 3V5WA 1AWEA 3X23A 2GJYA 2GS0A 1W1DA 2YT1A 2UZRA 2RLOA 1DROA 1V88A 1UEFA 2E2XA 4IOYX 2X18A 1UNPA 2RUKB 2UZSA 4B6HA 2D10A 3GYPA 1W1GA 3D8DA 1MK7B 5JHGA 1E5WA 3ULBA 2P8VA 1FAOA 1UPQA 1EGXA 1NTYA 2ZPYA 1KI1B 2Z0PA 1K5GB 4H8SA 1MIXA 2H7EA 1LW3A 1W1HA 2H7DA 2YSZA 1FHOA 3F5RA 4PQ0A 1WJMA 2NZ8B 1RRPB 3IVFA 3BJIA 4MT7A 2VKIA 2D2QA 5L81A 3A8QA 3TVVA 2DKQA 3PVWA 4ZRKA 5CLLB 1FB8A 5LOPB 2J0KA 1EVHA 3FM8C 5HE3A 3MDBC 1KZ7A 1FGYA 2W2XD 2D9VA 3DXCA 3FSSA 1X1GA 5DI9B 2YS3A 3T06A 1SHCA 2GCJA 2I5CA 2LG1A 1MPHA 2R09A 4KHAA 2VSZA 1V61A 4GZUA 1GC6A 2NMBA 2DYQA 4F7UP 3CIKA 2YVCA 1XX0A 2JP2A 1EAZA 2LYDA 1XD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYN A;  2K2U A;  3TFM A;  2UVM A;  2J59 M;  2N23 A;  4HAV B;  4ZRI A;  4CHJ A;  1M7E A;  2N0Y A;  3P7Z A;  3SO6 A;  1WG7 A;  4CYE A;  3TCA A;  4Y94 A;  5HE2 A;  1TQZ A;  2ELB A;  2EJ8 A;  1BTK A;  3WYF B;  1WVH A;  1XKE A;  5J3Q A;  4HDQ A;  2D4Q A;  2OTX A;  2RSG A;  1UPR A;  3KRW A;  1PMS A;  5FI1 A;  2COF A;  2K2J A;  4DBB A;  2YF0 A;  2LOX A;  3SUZ A;  4MY6 A;  1U5F A;  2HTH B;  1DYN A;  1U2B A;  2Q13 A;  2YS5 A;  1DDW A;  1X86 A;  4PNK A;  3DXD A;  2CAY A;  2Y7B A;  3BIN A;  2DHI A;  3TW1 A;  3VOQ A;  2RNR B;  4HAX B;  2P0F A;  4EMO A;  2CY5 A;  3A8P A;  4Z2M B;  5HE1 A;  4GXB A;  3U7D A;  2BCJ A;  3D8F A;  3NSU A;  1QQG A;  2D9W A;  2HE7 A;  1FOE A;  4CHM A;  4K2P A;  2RGN B;  3QIJ A;  4DXA B;  3PVU A;  4NSW A;  3DXE A;  1X1F A;  5JHH A;  4HAY B;  1ZM0 A;  2COA A;  2Y8F A;  4WVF B;  1N3H A;  4Z2N A;  1Q67 A;  3HW2 B;  1V5U A;  1AQC A;  3SYX A;  2COC A;  4HB2 B;  2D9X A;  2AEH A;  2IFS A;  5FI0 A;  4A6F B;  5DIF B;  2MWN B;  3SV1 A;  1U27 A;  4WSF A;  1XCG A;  3MPX A;  4KHB B;  4GPT B;  5D3Y A;  3ML4 A;  3ZVR A;  2I1K A;  2LUL A;  4A6K A;  2YRY A;  2VRW B;  2AL6 A;  1MK9 B;  4YON A;  3WA0 A;  1U5D A;  2DFK A;  4TKN A;  3P6A A;  4K81 A;  2W2W A;  2YT0 A;  5GOW B;  2XQN M;  1OY2 A;  1KZG A;  2L1C A;  4DX9 0;  4F7G A;  2D11 A;  4K2O A;  3KZ1 A;  2M38 A;  1Y5O A;  4EJN A;  5JP4 A;  1NTV A;  3RCP A;  3PEG A;  5J3Y A;  1XR0 B;  2DN6 A;  4F7H A;  4HAU B;  3HQC A;  5C6R A;  2MDX A;  1H4R A;  4MK0 A;  2CRF A;  4KHO A;  2DLW A;  2GCL A;  4IAP A;  1IRS A;  5KQ1 A;  1PLS A;  1BWN A;  1FGZ A;  3TO1 A;  2KGX B;  1NI2 A;  5J3T A;  5D3W A;  3FEH A;  3F0W A;  3G9W A;  4WJ7 A;  1FHX A;  5D27 A;  5JLJ B;  2FJL A;  2DKP A;  2COD A;  1WGU A;  2DX1 A;  2V76 A;  3KY9 A;  4TYZ A;  2DHJ A;  1V89 A;  2DA0 A;  5C16 A;  3HK0 A;  1PFJ A;  2CY4 A;  1ZSQ A;  1UNR A;  1J19 A;  3D8E A;  1J0W A;  2G35 A;  2YS1 A;  1V5P A;  2J0M A;  3A98 B;  1WJ1 A;  4GMV A;  2D9Z A;  1BTN A;  4D0N B;  1I2H A;  5C5B B;  4P7I A;  4YL8 A;  1ISN A;  2Y8G A;  1OQN A;  1MAI A;  4A5K A;  1GC7 A;  1SGH A;  5KCV A;  2RVB B;  3QBV B;  1DDM A;  5DHA B;  2PZ1 A;  4GMX B;  2LOZ A;  1XOD A;  3ODX A;  4NY0 A;  2P0H A;  2L2I A;  3QWM A;  1K5D B;  3M1I B;  1U29 A;  4HHV A;  3ULC A;  3KSY A;  1MIZ B;  1ZVR A;  2DTC A;  5HE0 A;  2M14 A;  1WGQ A;  1M7R A;  1P6S A;  2DX5 A;  3N7C A;  2EMT A;  2LKO A;  4HB4 B;  2ELA A;  4HAW B;  4GN1 A;  4IFS A;  2ROV A;  2ADZ A;  1H10 A;  5DH9 B;  3PP2 A;  2EC1 A;  4HAZ B;  1V5M A;  3OAN A;  1EF1 A;  2P0D A;  2Z0O A;  1ZC3 B;  5C5B A;  1U5E A;  5KQ4 A;  5D3X A;  1X05 A;  1I7A A;  2MFQ A;  4L6E A;  5D3V A;  3UZT A;  2DHK A;  3VIA A;  4DX8 A;  4HDO A;  4HB0 B;  1P5T A;  2EMS A;  1RJ2 A;  4KVG B;  1LB1 A;  2QKM A;  3U8Z A;  5CLQ B;  1U5G A;  1X11 A;  2OQB A;  1B55 A;  1FHW A;  2QKL A;  1OMW A;  2Z0Q A;  4BBK A;  2I1J A;  5LON B;  1TXD A;  2J0J A;  4HAT B;  4HB3 B;  4A6F A;  1BAK A;  1QC6 A;  3LJU X;  1DBH A;  3ODO A;  1Z87 A;  3SNH A;  2KCJ A;  2D9Y A;  2ROZ B;  3ZDT A;  3CXB B;  2IYB A;  1GG3 A;  1Y19 B;  3AU4 A;  3PSC A;  3PVL A;  1MKE A;  3PG7 A;  1P3R A;  1DDV A;  1WI1 A;  3AJ4 A;  4ZRJ A;  2W2X C;  2R0D A;  5C79 A;  4EKU A;  3KRX A;  4XWX A;  2MKR A;  4C0A A;  3AU5 A;  1UNQ A;  2KUP A;  2I5F A;  3ODW A;  2K00 A;  5DHF B;  3GYO A;  4K17 A;  4KAX B;  1ZC4 B;  3PZD A;  4A6H A;  1NU2 A;  1TJ6 A;  5EFX A;  3O96 A;  3V5W A;  1AWE A;  3X23 A;  2GJY A;  2GS0 A;  1W1D A;  2YT1 A;  2UZR A;  2RLO A;  1DRO A;  1V88 A;  1UEF A;  2E2X A;  4IOY X;  2X18 A;  1UNP A;  2RUK B;  2UZS A;  4B6H A;  2D10 A;  3GYP A;  1W1G A;  3D8D A;  1MK7 B;  5JHG A;  1E5W A;  3ULB A;  2P8V A;  1FAO A;  1UPQ A;  1EGX A;  1NTY A;  2ZPY A;  1KI1 B;  2Z0P A;  1K5G B;  4H8S A;  1MIX A;  2H7E A;  1LW3 A;  1W1H A;  2H7D A;  2YSZ A;  1FHO A;  3F5R A;  4PQ0 A;  1WJM A;  2NZ8 B;  1RRP B;  3IVF A;  3BJI A;  4MT7 A;  2VKI A;  2D2Q A;  5L81 A;  3A8Q A;  3TVV A;  2DKQ A;  3PVW A;  4ZRK A;  5CLL B;  1FB8 A;  5LOP B;  2J0K A;  1EVH A;  3FM8 C;  5HE3 A;  3MDB C;  1KZ7 A;  1FGY A;  2W2X D;  2D9V A;  3DXC A;  3FSS A;  1X1G A;  5DI9 B;  2YS3 A;  3T06 A;  1SHC A;  2GCJ A;  2I5C A;  2LG1 A;  1MPH A;  2R09 A;  4KHA A;  2VSZ A;  1V61 A;  4GZU A;  1GC6 A;  2NMB A;  2DYQ A;  4F7U P;  3CIK A;  2YVC A;  1XX0 A;  2JP2 A;  1EAZ A;  2LYD A;  1XD4 A; 
#chains in the Genus database with same CATH topology
 2DYN A;  2K2U A;  3TFM A;  2UVM A;  2J59 M;  2N23 A;  3NW8 A;  4HAV B;  4ZRI A;  1M7E A;  4CHJ A;  2N0Y A;  2KR0 A;  3HSA A;  3P7Z A;  3SO6 A;  1WG7 A;  4CYE A;  3TCA A;  4Y94 A;  5HE2 A;  1TQZ A;  2ELB A;  2EJ8 A;  5IRS A;  1BTK A;  3WYF B;  1WVH A;  1XKE A;  5J3Q A;  4HDQ A;  2D4Q A;  2OTX A;  2RSG A;  1UPR A;  3KRW A;  1PMS A;  5FI1 A;  2COF A;  2K2J A;  4DBB A;  2YF0 A;  2LOX A;  2GUM A;  3SUZ A;  4MY6 A;  1U5F A;  2HTH B;  1DYN A;  1U2B A;  2Q13 A;  2YS5 A;  1DDW A;  1X86 A;  4PNK A;  5I2M A;  3DXD A;  2CAY A;  2Y7B A;  3BIN A;  2DHI A;  2Z14 A;  3TW1 A;  3VOQ A;  2KIG A;  3NWA A;  2ZKM X;  2RNR B;  4HAX B;  2P0F A;  4EMO A;  2CY5 A;  3A8P A;  4Z2M B;  5HE1 A;  4GXB A;  3U7D A;  2BCJ A;  3D8F A;  3NSU A;  1QQG A;  2D9W A;  2HE7 A;  4OSN A;  2Z4D A;  1FOE A;  4CHM A;  4K2P A;  2RGN B;  3QIJ A;  4DXA B;  4DIX A;  3PVU A;  5LG4 B;  4NSW A;  3DXE A;  1X1F A;  5JHH A;  4HAY B;  1ZM0 A;  2COA A;  2Y8F A;  4WVF B;  1N3H A;  4Z2N A;  1Q67 A;  3HW2 B;  1V5U A;  1AQC A;  3SYX A;  2COC A;  4HB2 B;  2D9X A;  2AEH A;  2IFS A;  5FI0 A;  4A6F B;  5DIF B;  2MWN B;  3SV1 A;  1U27 A;  4WSF A;  1XCG A;  3MPX A;  2R2Y A;  4KHB B;  3OHM B;  4GPT B;  5D3Y A;  3ML4 A;  3ZVR A;  2I1K A;  2LUL A;  4QJ4 B;  4A6K A;  2YRY A;  2VRW B;  2AL6 A;  1MK9 B;  4YON A;  3WA0 A;  2K8E A;  1U5D A;  2DFK A;  4TKN A;  3P6A A;  4K81 A;  2W2W A;  2YT0 A;  3NWF A;  5GOW B;  2XQN M;  1OY2 A;  1KZG A;  2L1C A;  4DX9 0;  4F7G A;  2D11 A;  4K2O A;  3KZ1 A;  2M38 A;  1Y5O A;  4EJN A;  5JP4 A;  1NTV A;  3RCP A;  4CSQ A;  3PEG A;  5J3Y A;  1XR0 B;  2DN6 A;  4F7H A;  4HAU B;  3HQC A;  5C6R A;  2MDX A;  1H4R A;  4MK0 A;  2CRF A;  4KHO A;  4HSI A;  2DLW A;  2GCL A;  4IAP A;  1IRS A;  5KQ1 A;  1PLS A;  1BWN A;  1FGZ A;  3TO1 A;  5I2S A;  2KGX B;  1NI2 A;  5J3T A;  5D3W A;  3FEH A;  3F0W A;  4KHB A;  3G9W A;  4WJ7 A;  1FHX A;  5D27 A;  5JLJ B;  2FJL A;  2DKP A;  2COD A;  1WGU A;  2DX1 A;  2V76 A;  3KY9 A;  3HIE A;  4TYZ A;  2DHJ A;  1V89 A;  2DA0 A;  5C16 A;  3HK0 A;  1PFJ A;  2CY4 A;  4L1R A;  1ZSQ A;  1UNR A;  1ZYI A;  1J19 A;  3D8E A;  1J0W A;  2G35 A;  2YS1 A;  1V5P A;  2J0M A;  3A98 B;  1WJ1 A;  4GMV A;  2D9Z A;  1BTN A;  4D0N B;  1I2H A;  2FJU B;  5C5B B;  4P7I A;  4YL8 A;  1ISN A;  2Y8G A;  1OQN A;  1MAI A;  4A5K A;  1GC7 A;  1SGH A;  5KCV A;  2RVB B;  3QBV B;  1DDM A;  5DHA B;  2PZ1 A;  4GMX B;  2LOZ A;  1XOD A;  3ODX A;  4NY0 A;  2P0H A;  2L2I A;  3QWM A;  3DCX A;  1K5D B;  3M1I B;  1U29 A;  4HHV A;  3ULC A;  3KSY A;  1MIZ B;  1ZVR A;  2DTC A;  4QJ3 B;  5HE0 A;  2M14 A;  1WGQ A;  1M7R A;  1P6S A;  2DX5 A;  3N7C A;  2EMT A;  2LKO A;  4HB4 B;  2ELA A;  4HAW B;  4GN1 A;  3A58 A;  3NWD A;  4IFS A;  2ROV A;  2ADZ A;  3U12 A;  1H10 A;  5DH9 B;  3PP2 A;  2EC1 A;  4HAZ B;  1V5M A;  3OAN A;  1EF1 A;  2P0D A;  2Z0O A;  1ZC3 B;  5C5B A;  1U5E A;  5KQ4 A;  5D3X A;  1X05 A;  1I7A A;  4D6W A;  2MFQ A;  4L6E A;  5D3V A;  3UZT A;  2DHK A;  4QXA B;  3VIA A;  4DX8 A;  2K49 A;  4HDO A;  4HB0 B;  1P5T A;  2EMS A;  1RJ2 A;  3FVC A;  4KVG B;  1LB1 A;  2QKM A;  3U8Z A;  5CLQ B;  1U5G A;  1X11 A;  2OQB A;  1B55 A;  1FHW A;  2QKL A;  1OMW A;  2Z0Q A;  4BBK A;  2I1J A;  5LON B;  1TXD A;  2J0J A;  4HAT B;  4HB3 B;  4A6F A;  1BAK A;  1QC6 A;  3LJU X;  1DBH A;  3ODO A;  1Z87 A;  3SNH A;  2KCJ A;  2D9Y A;  2ROZ B;  3ZDT A;  3CXB B;  2IYB A;  1GG3 A;  1Y19 B;  2NBV A;  3AU4 A;  3PSC A;  4QJ5 B;  3PVL A;  1MKE A;  3PG7 A;  1P3R A;  1DDV A;  1WI1 A;  3AJ4 A;  4ZRJ A;  2W2X C;  2R0D A;  5C79 A;  4EKU A;  3KRX A;  4XWX A;  2MKR A;  4C0A A;  3AU5 A;  1UNQ A;  2KUP A;  1MI1 A;  2I5F A;  3ODW A;  2K00 A;  5DHF B;  3GYO A;  4K17 A;  4KAX B;  1ZC4 B;  3PZD A;  4A6H A;  1NU2 A;  1TJ6 A;  5EFX A;  3O96 A;  3V5W A;  1AWE A;  3X23 A;  2GJY A;  2GS0 A;  1W1D A;  2YT1 A;  2UZR A;  2RLO A;  1DRO A;  1V88 A;  1UEF A;  2E2X A;  4IOY X;  4OT1 A;  2X18 A;  4GNK B;  1UNP A;  2RUK B;  2UZS A;  4B6H A;  2Z13 A;  2D10 A;  3GYP A;  1W1G A;  3D8D A;  1MK7 B;  5JHG A;  1E5W A;  3ULB A;  2P8V A;  1FAO A;  1UPQ A;  1EGX A;  1NTY A;  2ZPY A;  1KI1 B;  2Z0P A;  1K5G B;  4H8S A;  1MIX A;  2H7E A;  1LW3 A;  1W1H A;  4GOU A;  2H7D A;  2YSZ A;  1FHO A;  3F5R A;  4PQ0 A;  1WJM A;  2NZ8 B;  1RRP B;  3IVF A;  3BJI A;  4MT7 A;  2YT2 A;  2VKI A;  2D2Q A;  5L81 A;  3A8Q A;  3TVV A;  5M4Y B;  2DKQ A;  3PVW A;  4ZRK A;  5CLL B;  1FB8 A;  5LOP B;  2J0K A;  1EVH A;  3FM8 C;  2KIE A;  5HE3 A;  3MDB C;  1T77 A;  1KZ7 A;  1FGY A;  2W2X D;  2D9V A;  3DXC A;  3FSS A;  1X1G A;  5DI9 B;  2YS3 A;  2KUQ A;  3T06 A;  1SHC A;  2GCJ A;  3B77 A;  2Z59 A;  2I5C A;  2LG1 A;  1MPH A;  2R09 A;  4KHA A;  2VSZ A;  1V61 A;  4GZU A;  1GC6 A;  2NMB A;  2DYQ A;  4F7U P;  2RRF A;  3CIK A;  2YVC A;  1XX0 A;  2JP2 A;  1EAZ A;  2LYD A;  1XD4 A; 
#chains in the Genus database with same CATH homology
 2DYN A;  2K2U A;  3TFM A;  2UVM A;  2J59 M;  2N23 A;  4HAV B;  4ZRI A;  4CHJ A;  1M7E A;  2N0Y A;  3P7Z A;  3SO6 A;  1WG7 A;  4CYE A;  3TCA A;  4Y94 A;  5HE2 A;  1TQZ A;  2ELB A;  2EJ8 A;  1BTK A;  3WYF B;  1WVH A;  1XKE A;  5J3Q A;  4HDQ A;  2D4Q A;  2OTX A;  2RSG A;  1UPR A;  3KRW A;  1PMS A;  5FI1 A;  2COF A;  2K2J A;  4DBB A;  2YF0 A;  2LOX A;  3SUZ A;  4MY6 A;  1U5F A;  2HTH B;  1DYN A;  1U2B A;  2Q13 A;  2YS5 A;  1DDW A;  1X86 A;  4PNK A;  3DXD A;  2CAY A;  2Y7B A;  3BIN A;  2DHI A;  3TW1 A;  3VOQ A;  2RNR B;  4HAX B;  2P0F A;  4EMO A;  2CY5 A;  3A8P A;  4Z2M B;  5HE1 A;  4GXB A;  3U7D A;  2BCJ A;  3D8F A;  3NSU A;  1QQG A;  2D9W A;  2HE7 A;  1FOE A;  4CHM A;  4K2P A;  2RGN B;  3QIJ A;  4DXA B;  3PVU A;  4NSW A;  3DXE A;  1X1F A;  5JHH A;  4HAY B;  1ZM0 A;  2COA A;  2Y8F A;  4WVF B;  1N3H A;  4Z2N A;  1Q67 A;  3HW2 B;  1V5U A;  1AQC A;  3SYX A;  2COC A;  4HB2 B;  2D9X A;  2AEH A;  2IFS A;  5FI0 A;  4A6F B;  5DIF B;  2MWN B;  3SV1 A;  1U27 A;  4WSF A;  1XCG A;  3MPX A;  4KHB B;  4GPT B;  5D3Y A;  3ML4 A;  3ZVR A;  2I1K A;  2LUL A;  4A6K A;  2YRY A;  2VRW B;  2AL6 A;  1MK9 B;  4YON A;  3WA0 A;  1U5D A;  2DFK A;  4TKN A;  3P6A A;  4K81 A;  2W2W A;  2YT0 A;  5GOW B;  2XQN M;  1OY2 A;  1KZG A;  2L1C A;  4DX9 0;  4F7G A;  2D11 A;  4K2O A;  3KZ1 A;  2M38 A;  1Y5O A;  4EJN A;  5JP4 A;  1NTV A;  3RCP A;  3PEG A;  5J3Y A;  1XR0 B;  2DN6 A;  4F7H A;  4HAU B;  3HQC A;  5C6R A;  2MDX A;  1H4R A;  4MK0 A;  2CRF A;  4KHO A;  2DLW A;  2GCL A;  4IAP A;  1IRS A;  5KQ1 A;  1PLS A;  1BWN A;  1FGZ A;  3TO1 A;  2KGX B;  1NI2 A;  5J3T A;  5D3W A;  3FEH A;  3F0W A;  3G9W A;  4WJ7 A;  1FHX A;  5D27 A;  5JLJ B;  2FJL A;  2DKP A;  2COD A;  1WGU A;  2DX1 A;  2V76 A;  3KY9 A;  4TYZ A;  2DHJ A;  1V89 A;  2DA0 A;  5C16 A;  3HK0 A;  1PFJ A;  2CY4 A;  1ZSQ A;  1UNR A;  1J19 A;  3D8E A;  1J0W A;  2G35 A;  2YS1 A;  1V5P A;  2J0M A;  3A98 B;  1WJ1 A;  4GMV A;  2D9Z A;  1BTN A;  4D0N B;  1I2H A;  5C5B B;  4P7I A;  4YL8 A;  1ISN A;  2Y8G A;  1OQN A;  1MAI A;  4A5K A;  1GC7 A;  1SGH A;  5KCV A;  2RVB B;  3QBV B;  1DDM A;  5DHA B;  2PZ1 A;  4GMX B;  2LOZ A;  1XOD A;  3ODX A;  4NY0 A;  2P0H A;  2L2I A;  3QWM A;  1K5D B;  3M1I B;  1U29 A;  4HHV A;  3ULC A;  3KSY A;  1MIZ B;  1ZVR A;  2DTC A;  5HE0 A;  2M14 A;  1WGQ A;  1M7R A;  1P6S A;  2DX5 A;  3N7C A;  2EMT A;  2LKO A;  4HB4 B;  2ELA A;  4HAW B;  4GN1 A;  4IFS A;  2ROV A;  2ADZ A;  1H10 A;  5DH9 B;  3PP2 A;  2EC1 A;  4HAZ B;  1V5M A;  3OAN A;  1EF1 A;  2P0D A;  2Z0O A;  1ZC3 B;  5C5B A;  1U5E A;  5KQ4 A;  5D3X A;  1X05 A;  1I7A A;  2MFQ A;  4L6E A;  5D3V A;  3UZT A;  2DHK A;  3VIA A;  4DX8 A;  4HDO A;  4HB0 B;  1P5T A;  2EMS A;  1RJ2 A;  4KVG B;  1LB1 A;  2QKM A;  3U8Z A;  5CLQ B;  1U5G A;  1X11 A;  2OQB A;  1B55 A;  1FHW A;  2QKL A;  1OMW A;  2Z0Q A;  4BBK A;  2I1J A;  5LON B;  1TXD A;  2J0J A;  4HAT B;  4HB3 B;  4A6F A;  1BAK A;  1QC6 A;  3LJU X;  1DBH A;  3ODO A;  1Z87 A;  3SNH A;  2KCJ A;  2D9Y A;  2ROZ B;  3ZDT A;  3CXB B;  2IYB A;  1GG3 A;  1Y19 B;  3AU4 A;  3PSC A;  3PVL A;  1MKE A;  3PG7 A;  1P3R A;  1DDV A;  1WI1 A;  3AJ4 A;  4ZRJ A;  2W2X C;  2R0D A;  5C79 A;  4EKU A;  3KRX A;  4XWX A;  2MKR A;  4C0A A;  3AU5 A;  1UNQ A;  2KUP A;  2I5F A;  3ODW A;  2K00 A;  5DHF B;  3GYO A;  4K17 A;  4KAX B;  1ZC4 B;  3PZD A;  4A6H A;  1NU2 A;  1TJ6 A;  5EFX A;  3O96 A;  3V5W A;  1AWE A;  3X23 A;  2GJY A;  2GS0 A;  1W1D A;  2YT1 A;  2UZR A;  2RLO A;  1DRO A;  1V88 A;  1UEF A;  2E2X A;  4IOY X;  2X18 A;  1UNP A;  2RUK B;  2UZS A;  4B6H A;  2D10 A;  3GYP A;  1W1G A;  3D8D A;  1MK7 B;  5JHG A;  1E5W A;  3ULB A;  2P8V A;  1FAO A;  1UPQ A;  1EGX A;  1NTY A;  2ZPY A;  1KI1 B;  2Z0P A;  1K5G B;  4H8S A;  1MIX A;  2H7E A;  1LW3 A;  1W1H A;  2H7D A;  2YSZ A;  1FHO A;  3F5R A;  4PQ0 A;  1WJM A;  2NZ8 B;  1RRP B;  3IVF A;  3BJI A;  4MT7 A;  2VKI A;  2D2Q A;  5L81 A;  3A8Q A;  3TVV A;  2DKQ A;  3PVW A;  4ZRK A;  5CLL B;  1FB8 A;  5LOP B;  2J0K A;  1EVH A;  3FM8 C;  5HE3 A;  3MDB C;  1KZ7 A;  1FGY A;  2W2X D;  2D9V A;  3DXC A;  3FSS A;  1X1G A;  5DI9 B;  2YS3 A;  3T06 A;  1SHC A;  2GCJ A;  2I5C A;  2LG1 A;  1MPH A;  2R09 A;  4KHA A;  2VSZ A;  1V61 A;  4GZU A;  1GC6 A;  2NMB A;  2DYQ A;  4F7U P;  3CIK A;  2YVC A;  1XX0 A;  2JP2 A;  1EAZ A;  2LYD A;  1XD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...