1UPRA

Crystal structure of the pepp1 pleckstrin homology domain in complex with inositol 1,3,4,5-tetrakisphosphate
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
107
structure length
107
Chain Sequence
b'LRRDPNLPVHIRGWLHKQDSSGLRLWKRRWFVLSGHCLFYYKDSREESVLGSVLLPSYNIRPDGPGAPRGRRFTFTAEHPGMRTYVLAADTLEDLRGWLRALGRASR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING FAMILY A MEMBER 4
publication title Crystal Structure of the Pleckstrin Homology Domain of Pepp1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 19
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1uprA00
1V5UA 1BWNA 1J19A 4L6EA 1WVHA 5KCVA 1EAZA 5C5BA 1P6SA 2MKRA 4MT7A 3AJ4A 2N23A 5CLLB 1U2BA 3N7CA 2CODA 4DXAB 4HDQA 4WVFB 1OQNA 3PSCA 3PZDA 4EKUA 5KQ1A 2D2QA 2P0HA 1XODA 1BAKA 2H7EA 2OQBA 3BINA 1WJ1A 4MY6A 1NTVA 3LJUX 3DXEA 2P8VA 1NTYA 5JHGA 4GZUA 2KGXB 5DHFB 5D27A 2RSGA 4A5KA 1SGHA 3TW1A 3P7ZA 3D8DA 1E5WA 4CHMA 2NZ8B 4TYZA 3PP2A 1B55A 2IFSA 3ODOA 4DX8A 2EMSA 4A6HA 2DN6A 2COAA 3SYXA 1N3HA 2MWNB 1AWEA 4K17A 2DLWA 3T06A 3DXCA 3WYFB 3ULBA 3TO1A 1WGQA 4TKNA 5LONB 1V88A 1ZM0A 2YS3A 4IFSA 1PFJA 5J3TA 4K2PA 1W1DA 2M14A 3D8EA 4HB3B 2CAYA 5GOWB 2YS5A 3DXDA 1IRSA 3PVWA 1DDVA 1I7AA 4HB4B 1EVHA 1K5GB 2KCJA 2XQNM 2J0JA 2VKIA 1J0WA 1U5DA 1MIXA 3TFMA 5CLQB 1XX0A 3ML4A 2COCA 2DX5A 4ZRJA 1RRPB 2LYDA 4KVGB 2DKQA 2DYNA 2UZRA 3SUZA 2COFA 4KHAA 2VRWB 3RCPA 4YL8A 1KI1B 1X86A 5D3XA 4A6FB 2J0KA 1PMSA 2LOXA 4GPTB 2K00A 3FSSA 2L1CA 2FJLA 3CXBB 3QBVB 4Y94A 1UNQA 1ZC4B 1KZGA 4Z2NA 1TXDA 3PG7A 2N0YA 4K2OA 2IYBA 2UZSA 2LKOA 2DX1A 4F7HA 2DHIA 2RGNB 4B6HA 1P3RA 2EMTA 2DHKA 4D0NB 1ISNA 1UPQA 4IAPA 2D9VA 1LB1A 5D3YA 1DYNA 3HW2B 3TVVA 2Q13A 1OMWA 4P7IA 4PNKA 4Z2MB 1FHWA 4C0AA 3OANA 4WSFA 1XR0B 5C6RA 2V76A 1MK7B 1X11A 2ROZB 2D4QA 4WJ7A 1Y5OA 2D9XA 4NY0A 4HHVA 2DYQA 1NI2A 2P0DA 3FEHA 1FHOA 2GCJA 1U5EA 2GCLA 2CY5A 5JP4A 2UVMA 2R09A 2DTCA 2M38A 2MFQA 4A6FA 3U7DA 4HAZB 3SO6A 4HB2B 2OTXA 4BBKA 2GJYA 3G9WA 3GYPA 1M7RA 1ZVRA 2DHJA 2YSZA 5KQ4A 2LG1A 2KUPA 1WI1A 2PZ1A 4GXBA 4HAYB 1UEFA 1X05A 4DBBA 1ZC3B 3VIAA 2E2XA 1DROA 4KHBB 2I1KA 2D9YA 2NMBA 4KHOA 2Z0PA 3GYOA 3KZ1A 5C16A 2K2JA 1FGYA 3KRWA 4PQ0A 2JP2A 2YF0A 3MPXA 3QWMA 3V5WA 2ZPYA 2MDXA 2RVBB 1H4RA 4EJNA 3KY9A 1EGXA 5J3YA 3MDBC 1GG3A 1MKEA 3F0WA 1DDMA 4GN1A 1WJMA 1EF1A 5EFXA 1GC7A 2ELBA 3KRXA 1GC6A 5JHHA 4HAVB 3FM8C 3PVUA 3SV1A 3WA0A 5DIFB 2GS0A 2EC1A 2I5FA 3VOQA 1M7EA 2H7DA 4GMVA 1Q67A 1V89A 1V5MA 5D3WA 2VSZA 1DBHA 4HAWB 2I5CA 4H8SA 3KSYA 5DI9B 4F7UP 3ODXA 2DFKA 3D8FA 1QC6A 2Y8FA 2D9WA 4HAXB 2L2IA 4YONA 2Z0QA 1SHCA 1OY2A 3A98B 2YT0A 1FOEA 2LULA 1TQZA 2DKPA 4HB0B 1ZSQA 2RUKB 2QKLA 2Y7BA 4HDOA 5FI0A 4HATB 2I1JA 1FAOA 1FHXA 2W2XD 3UZTA 5LOPB 1UPRA 3PVLA 2D10A 5C79A 1V5PA 1U27A 1DDWA 2J0MA 2J59M 2X18A 3X23A 1MK9B 5HE3A 3O96A 2HE7A 4HAUB 4NSWA 5FI1A 3TCAA 4CHJA 1I2HA 1WG7A 4ZRKA 3M1IB 3ODWA 5JLJB 4ZRIA 3NSUA 1X1FA 4IOYX 1XD4A 1UNRA 1MIZB 5J3QA 2P0FA 2Y8GA 2DA0A 5DHAB 2ELAA 2YT1A 1BTNA 2K2UA 2RNRB 2Z0OA 3A8QA 3U8ZA 1AQCA 2AEHA 1NU2A 3IVFA 3ZVRA 4A6KA 2W2XC 2LOZA 2R0DA 1RJ2A 3SNHA 2YRYA 4GMXB 4XWXA 1V61A 5C5BB 1P5TA 5DH9B 4EMOA 1BTKA 2YS1A 1KZ7A 1LW3A 2CY4A 4DX90 1UNPA 3HQCA 3BJIA 3CIKA 1Z87A 3A8PA 2W2WA 1TJ6A 5L81A 1FGZA 1QQGA 3P6AA 2YVCA 5HE1A 1W1GA 3ZDTA 3HK0A 5HE2A 2HTHB 1U5GA 5D3VA 1XCGA 4KAXB 4CYEA 2ADZA 1X1GA 2ROVA 2AL6A 2D11A 1MPHA 3AU4A 2RLOA 3QIJA 1W1HA 1MAIA 5HE0A 1U29A 1U5FA 4K81A 1K5DB 1H10A 4F7GA 2CRFA 3PEGA 3F5RA 2BCJA 2EJ8A 2G35A 3AU5A 1WGUA 1FB8A 1PLSA 2QKMA 1XKEA 4MK0A 3ULCA 2D9ZA 1Y19B
chains in the Genus database with same CATH superfamily
1V5UA 1BWNA 1J19A 4L6EA 1WVHA 5KCVA 4OSNA 3HIEA 1EAZA 5C5BA 1P6SA 2MKRA 4MT7A 3AJ4A 2N23A 5CLLB 1U2BA 3N7CA 2CODA 4DXAB 4HDQA 2NBVA 1OQNA 3PSCA 3PZDA 4WVFB 4EKUA 5KQ1A 2D2QA 2P0HA 1XODA 1BAKA 2H7EA 2OQBA 3BINA 1WJ1A 4MY6A 1NTVA 2KUQA 3LJUX 3DXEA 2P8VA 1NTYA 5JHGA 4GZUA 2KGXB 5DHFB 5D27A 2RSGA 4A5KA 1SGHA 4QXAB 3TW1A 3P7ZA 3D8DA 1E5WA 4CHMA 2NZ8B 4TYZA 3PP2A 1B55A 2IFSA 3ODOA 4DX8A 2EMSA 4A6HA 2DN6A 2COAA 3SYXA 1N3HA 2MWNB 1AWEA 4K17A 2DLWA 3T06A 3DXCA 3WYFB 3ULBA 3TO1A 1WGQA 4TKNA 5LONB 1V88A 1ZM0A 2YS3A 4IFSA 1PFJA 5I2MA 5J3TA 4K2PA 1W1DA 2M14A 3D8EA 4HB3B 2CAYA 5GOWB 2YS5A 3DXDA 1IRSA 4CSQA 3PVWA 1DDVA 1I7AA 4HB4B 1EVHA 1K5GB 2KCJA 2XQNM 2J0JA 2VKIA 1J0WA 1U5DA 1MIXA 3TFMA 5CLQB 1XX0A 3ML4A 2COCA 2DX5A 4ZRJA 1RRPB 2KR0A 2LYDA 4KVGB 2DKQA 2DYNA 2UZRA 3SUZA 2COFA 4KHAA 2VRWB 3RCPA 4YL8A 1KI1B 1X86A 5D3XA 4A6FB 4DIXA 2J0KA 1PMSA 2LOXA 4GPTB 2K00A 3FSSA 2L1CA 2FJLA 3CXBB 3QBVB 4Y94A 1UNQA 1ZC4B 1KZGA 4Z2NA 1TXDA 3PG7A 2N0YA 4K2OA 2IYBA 2YT2A 2UZSA 2LKOA 2DX1A 4F7HA 2DHIA 2RGNB 4B6HA 1P3RA 2EMTA 2DHKA 4D0NB 2Z59A 1ISNA 1UPQA 4IAPA 2D9VA 4GOUA 1LB1A 5D3YA 1DYNA 3HW2B 3TVVA 2Q13A 4KHBA 1OMWA 4P7IA 4PNKA 4Z2MB 1FHWA 4C0AA 3OANA 3FVCA 4WSFA 1XR0B 5C6RA 5LG4B 2V76A 1MK7B 1X11A 2ROZB 2D4QA 4WJ7A 1Y5OA 2D9XA 4NY0A 2KIGA 4HHVA 2DYQA 1NI2A 2P0DA 3FEHA 1FHOA 2GCJA 1U5EA 2GCLA 2CY5A 5JP4A 2UVMA 2R09A 2Z13A 2DTCA 4QJ3B 2M38A 2MFQA 4A6FA 3U7DA 4HAZB 3SO6A 4HB2B 2OTXA 4BBKA 2GJYA 3G9WA 3GYPA 1M7RA 1ZVRA 4QJ4B 2DHJA 2YSZA 5KQ4A 2LG1A 2FJUB 2KUPA 1WI1A 2PZ1A 4GXBA 4HAYB 1UEFA 1X05A 4DBBA 1ZC3B 2K49A 3VIAA 2E2XA 1DROA 3NWDA 4KHBB 2I1KA 2D9YA 2NMBA 4KHOA 2Z0PA 3GYOA 3KZ1A 3NW8A 2K2JA 5C16A 1FGYA 3KRWA 4PQ0A 2JP2A 2YF0A 3MPXA 3QWMA 3V5WA 2ZPYA 2MDXA 2RVBB 1H4RA 4EJNA 3KY9A 1EGXA 5J3YA 4QJ5B 3MDBC 1GG3A 1MKEA 3F0WA 1DDMA 4GN1A 1WJMA 1EF1A 3B77A 5EFXA 1GC7A 2ELBA 3KRXA 1GC6A 5JHHA 4HAVB 3FM8C 3PVUA 3SV1A 3WA0A 5DIFB 2GS0A 2EC1A 2I5FA 3VOQA 1M7EA 2H7DA 2Z14A 4GMVA 1Q67A 4GNKB 1V89A 1V5MA 5D3WA 2VSZA 1DBHA 4HAWB 2I5CA 4H8SA 3KSYA 5DI9B 4F7UP 3ODXA 2DFKA 3D8FA 1QC6A 2Y8FA 2D9WA 4HAXB 3HSAA 2L2IA 4YONA 2Z0QA 1SHCA 1OY2A 3A98B 2YT0A 3NWAA 1FOEA 2LULA 1TQZA 2DKPA 4HB0B 1MI1A 1ZSQA 2RUKB 2QKLA 2Y7BA 4HDOA 5FI0A 4HATB 2I1JA 1FAOA 2Z4DA 1FHXA 1T77A 2W2XD 3UZTA 5LOPB 1UPRA 3PVLA 2D10A 5C79A 1V5PA 1U27A 1DDWA 2J0MA 2J59M 2X18A 3X23A 1MK9B 5HE3A 3O96A 2HE7A 3OHMB 4HAUB 4NSWA 5FI1A 3TCAA 4CHJA 3DCXA 1I2HA 1WG7A 4ZRKA 3M1IB 3ODWA 5JLJB 4ZRIA 3NSUA 1X1FA 3NWFA 4IOYX 1XD4A 1UNRA 1MIZB 2RRFA 5J3QA 2P0FA 2Y8GA 2DA0A 5DHAB 4L1RA 2ELAA 2YT1A 1BTNA 2K2UA 2RNRB 2Z0OA 4HSIA 3A8QA 3U8ZA 1AQCA 2AEHA 3U12A 1NU2A 3IVFA 3ZVRA 4A6KA 2W2XC 2LOZA 2R0DA 1RJ2A 3SNHA 4D6WA 2R2YA 2YRYA 4GMXB 4XWXA 1V61A 5C5BB 2GUMA 1P5TA 5DH9B 4EMOA 1BTKA 2YS1A 1KZ7A 1LW3A 2CY4A 4DX90 1UNPA 3HQCA 3BJIA 3CIKA 1Z87A 3A8PA 2W2WA 1TJ6A 5L81A 1FGZA 1QQGA 3P6AA 2YVCA 5HE1A 1W1GA 3ZDTA 4OT1A 3HK0A 5HE2A 2HTHB 1U5GA 5D3VA 1XCGA 4KAXB 4CYEA 2ADZA 1X1GA 2ROVA 2AL6A 2KIEA 2D11A 1MPHA 3AU4A 2RLOA 3QIJA 1W1HA 1MAIA 5HE0A 1U29A 1U5FA 4K81A 1K5DB 1H10A 4F7GA 3A58A 2CRFA 2ZKMX 3PEGA 3F5RA 5M4YB 2BCJA 2EJ8A 2G35A 5I2SA 1ZYIA 3AU5A 1WGUA 1FB8A 1PLSA 2QKMA 1XKEA 4MK0A 3ULCA 2K8EA 2D9ZA 5IRSA 1Y19B
chains in the Genus database with same CATH topology
1V5UA 1BWNA 1J19A 4L6EA 1WVHA 5KCVA 1EAZA 5C5BA 1P6SA 2MKRA 4MT7A 3AJ4A 2N23A 5CLLB 1U2BA 3N7CA 2CODA 4DXAB 4HDQA 4WVFB 1OQNA 3PSCA 3PZDA 4EKUA 5KQ1A 2D2QA 2P0HA 1XODA 1BAKA 2H7EA 2OQBA 3BINA 1WJ1A 4MY6A 1NTVA 3LJUX 3DXEA 2P8VA 1NTYA 5JHGA 4GZUA 2KGXB 5DHFB 5D27A 2RSGA 4A5KA 1SGHA 3TW1A 3P7ZA 3D8DA 1E5WA 4CHMA 2NZ8B 4TYZA 3PP2A 1B55A 2IFSA 3ODOA 4DX8A 2EMSA 4A6HA 2DN6A 2COAA 3SYXA 1N3HA 2MWNB 1AWEA 4K17A 2DLWA 3T06A 3DXCA 3WYFB 3ULBA 3TO1A 1WGQA 4TKNA 5LONB 1V88A 1ZM0A 2YS3A 4IFSA 1PFJA 5J3TA 4K2PA 1W1DA 2M14A 3D8EA 4HB3B 2CAYA 5GOWB 2YS5A 3DXDA 1IRSA 3PVWA 1DDVA 1I7AA 4HB4B 1EVHA 1K5GB 2KCJA 2XQNM 2J0JA 2VKIA 1J0WA 1U5DA 1MIXA 3TFMA 5CLQB 1XX0A 3ML4A 2COCA 2DX5A 4ZRJA 1RRPB 2LYDA 4KVGB 2DKQA 2DYNA 2UZRA 3SUZA 2COFA 4KHAA 2VRWB 3RCPA 4YL8A 1KI1B 1X86A 5D3XA 4A6FB 2J0KA 1PMSA 2LOXA 4GPTB 2K00A 3FSSA 2L1CA 2FJLA 3CXBB 3QBVB 4Y94A 1UNQA 1ZC4B 1KZGA 4Z2NA 1TXDA 3PG7A 2N0YA 4K2OA 2IYBA 2UZSA 2LKOA 2DX1A 4F7HA 2DHIA 2RGNB 4B6HA 1P3RA 2EMTA 2DHKA 4D0NB 1ISNA 1UPQA 4IAPA 2D9VA 1LB1A 5D3YA 1DYNA 3HW2B 3TVVA 2Q13A 1OMWA 4P7IA 4PNKA 4Z2MB 1FHWA 4C0AA 3OANA 4WSFA 1XR0B 5C6RA 2V76A 1MK7B 1X11A 2ROZB 2D4QA 4WJ7A 1Y5OA 2D9XA 4NY0A 4HHVA 2DYQA 1NI2A 2P0DA 3FEHA 1FHOA 2GCJA 1U5EA 2GCLA 2CY5A 5JP4A 2UVMA 2R09A 2DTCA 2M38A 2MFQA 4A6FA 3U7DA 4HAZB 3SO6A 4HB2B 2OTXA 4BBKA 2GJYA 3G9WA 3GYPA 1M7RA 1ZVRA 2DHJA 2YSZA 5KQ4A 2LG1A 2KUPA 1WI1A 2PZ1A 4GXBA 4HAYB 1UEFA 1X05A 4DBBA 1ZC3B 3VIAA 2E2XA 1DROA 4KHBB 2I1KA 2D9YA 2NMBA 4KHOA 2Z0PA 3GYOA 3KZ1A 5C16A 2K2JA 1FGYA 3KRWA 4PQ0A 2JP2A 2YF0A 3MPXA 3QWMA 3V5WA 2ZPYA 2MDXA 2RVBB 1H4RA 4EJNA 3KY9A 1EGXA 5J3YA 3MDBC 1GG3A 1MKEA 3F0WA 1DDMA 4GN1A 1WJMA 1EF1A 5EFXA 1GC7A 2ELBA 3KRXA 1GC6A 5JHHA 4HAVB 3FM8C 3PVUA 3SV1A 3WA0A 5DIFB 2GS0A 2EC1A 2I5FA 3VOQA 1M7EA 2H7DA 4GMVA 1Q67A 1V89A 1V5MA 5D3WA 2VSZA 1DBHA 4HAWB 2I5CA 4H8SA 3KSYA 5DI9B 4F7UP 3ODXA 2DFKA 3D8FA 1QC6A 2Y8FA 2D9WA 4HAXB 2L2IA 4YONA 2Z0QA 1SHCA 1OY2A 3A98B 2YT0A 1FOEA 2LULA 1TQZA 2DKPA 4HB0B 1ZSQA 2RUKB 2QKLA 2Y7BA 4HDOA 5FI0A 4HATB 2I1JA 1FAOA 1FHXA 2W2XD 3UZTA 5LOPB 1UPRA 3PVLA 2D10A 5C79A 1V5PA 1U27A 1DDWA 2J0MA 2J59M 2X18A 3X23A 1MK9B 5HE3A 3O96A 2HE7A 4HAUB 4NSWA 5FI1A 3TCAA 4CHJA 1I2HA 1WG7A 4ZRKA 3M1IB 3ODWA 5JLJB 4ZRIA 3NSUA 1X1FA 4IOYX 1XD4A 1UNRA 1MIZB 5J3QA 2P0FA 2Y8GA 2DA0A 5DHAB 2ELAA 2YT1A 1BTNA 2K2UA 2RNRB 2Z0OA 3A8QA 3U8ZA 1AQCA 2AEHA 1NU2A 3IVFA 3ZVRA 4A6KA 2W2XC 2LOZA 2R0DA 1RJ2A 3SNHA 2YRYA 4GMXB 4XWXA 1V61A 5C5BB 1P5TA 5DH9B 4EMOA 1BTKA 2YS1A 1KZ7A 1LW3A 2CY4A 4DX90 1UNPA 3HQCA 3BJIA 3CIKA 1Z87A 3A8PA 2W2WA 1TJ6A 5L81A 1FGZA 1QQGA 3P6AA 2YVCA 5HE1A 1W1GA 3ZDTA 3HK0A 5HE2A 2HTHB 1U5GA 5D3VA 1XCGA 4KAXB 4CYEA 2ADZA 1X1GA 2ROVA 2AL6A 2D11A 1MPHA 3AU4A 2RLOA 3QIJA 1W1HA 1MAIA 5HE0A 1U29A 1U5FA 4K81A 1K5DB 1H10A 4F7GA 2CRFA 3PEGA 3F5RA 2BCJA 2EJ8A 2G35A 3AU5A 1WGUA 1FB8A 1PLSA 2QKMA 1XKEA 4MK0A 3ULCA 2D9ZA 1Y19B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V5U A;  1BWN A;  1J19 A;  4L6E A;  1WVH A;  5KCV A;  1EAZ A;  5C5B A;  1P6S A;  2MKR A;  4MT7 A;  3AJ4 A;  2N23 A;  5CLL B;  1U2B A;  3N7C A;  2COD A;  4DXA B;  4HDQ A;  4WVF B;  1OQN A;  3PSC A;  3PZD A;  4EKU A;  5KQ1 A;  2D2Q A;  2P0H A;  1XOD A;  1BAK A;  2H7E A;  2OQB A;  3BIN A;  1WJ1 A;  4MY6 A;  1NTV A;  3LJU X;  3DXE A;  2P8V A;  1NTY A;  5JHG A;  4GZU A;  2KGX B;  5DHF B;  5D27 A;  2RSG A;  4A5K A;  1SGH A;  3TW1 A;  3P7Z A;  3D8D A;  1E5W A;  4CHM A;  2NZ8 B;  4TYZ A;  3PP2 A;  1B55 A;  2IFS A;  3ODO A;  4DX8 A;  2EMS A;  4A6H A;  2DN6 A;  2COA A;  3SYX A;  1N3H A;  2MWN B;  1AWE A;  4K17 A;  2DLW A;  3T06 A;  3DXC A;  3WYF B;  3ULB A;  3TO1 A;  1WGQ A;  4TKN A;  5LON B;  1V88 A;  1ZM0 A;  2YS3 A;  4IFS A;  1PFJ A;  5J3T A;  4K2P A;  1W1D A;  2M14 A;  3D8E A;  4HB3 B;  2CAY A;  5GOW B;  2YS5 A;  3DXD A;  1IRS A;  3PVW A;  1DDV A;  1I7A A;  4HB4 B;  1EVH A;  1K5G B;  2KCJ A;  2XQN M;  2J0J A;  2VKI A;  1J0W A;  1U5D A;  1MIX A;  3TFM A;  5CLQ B;  1XX0 A;  3ML4 A;  2COC A;  2DX5 A;  4ZRJ A;  1RRP B;  2LYD A;  4KVG B;  2DKQ A;  2DYN A;  2UZR A;  3SUZ A;  2COF A;  4KHA A;  2VRW B;  3RCP A;  4YL8 A;  1KI1 B;  1X86 A;  5D3X A;  4A6F B;  2J0K A;  1PMS A;  2LOX A;  4GPT B;  2K00 A;  3FSS A;  2L1C A;  2FJL A;  3CXB B;  3QBV B;  4Y94 A;  1UNQ A;  1ZC4 B;  1KZG A;  4Z2N A;  1TXD A;  3PG7 A;  2N0Y A;  4K2O A;  2IYB A;  2UZS A;  2LKO A;  2DX1 A;  4F7H A;  2DHI A;  2RGN B;  4B6H A;  1P3R A;  2EMT A;  2DHK A;  4D0N B;  1ISN A;  1UPQ A;  4IAP A;  2D9V A;  1LB1 A;  5D3Y A;  1DYN A;  3HW2 B;  3TVV A;  2Q13 A;  1OMW A;  4P7I A;  4PNK A;  4Z2M B;  1FHW A;  4C0A A;  3OAN A;  4WSF A;  1XR0 B;  5C6R A;  2V76 A;  1MK7 B;  1X11 A;  2ROZ B;  2D4Q A;  4WJ7 A;  1Y5O A;  2D9X A;  4NY0 A;  4HHV A;  2DYQ A;  1NI2 A;  2P0D A;  3FEH A;  1FHO A;  2GCJ A;  1U5E A;  2GCL A;  2CY5 A;  5JP4 A;  2UVM A;  2R09 A;  2DTC A;  2M38 A;  2MFQ A;  4A6F A;  3U7D A;  4HAZ B;  3SO6 A;  4HB2 B;  2OTX A;  4BBK A;  2GJY A;  3G9W A;  3GYP A;  1M7R A;  1ZVR A;  2DHJ A;  2YSZ A;  5KQ4 A;  2LG1 A;  2KUP A;  1WI1 A;  2PZ1 A;  4GXB A;  4HAY B;  1UEF A;  1X05 A;  4DBB A;  1ZC3 B;  3VIA A;  2E2X A;  1DRO A;  4KHB B;  2I1K A;  2D9Y A;  2NMB A;  4KHO A;  2Z0P A;  3GYO A;  3KZ1 A;  5C16 A;  2K2J A;  1FGY A;  3KRW A;  4PQ0 A;  2JP2 A;  2YF0 A;  3MPX A;  3QWM A;  3V5W A;  2ZPY A;  2MDX A;  2RVB B;  1H4R A;  4EJN A;  3KY9 A;  1EGX A;  5J3Y A;  3MDB C;  1GG3 A;  1MKE A;  3F0W A;  1DDM A;  4GN1 A;  1WJM A;  1EF1 A;  5EFX A;  1GC7 A;  2ELB A;  3KRX A;  1GC6 A;  5JHH A;  4HAV B;  3FM8 C;  3PVU A;  3SV1 A;  3WA0 A;  5DIF B;  2GS0 A;  2EC1 A;  2I5F A;  3VOQ A;  1M7E A;  2H7D A;  4GMV A;  1Q67 A;  1V89 A;  1V5M A;  5D3W A;  2VSZ A;  1DBH A;  4HAW B;  2I5C A;  4H8S A;  3KSY A;  5DI9 B;  4F7U P;  3ODX A;  2DFK A;  3D8F A;  1QC6 A;  2Y8F A;  2D9W A;  4HAX B;  2L2I A;  4YON A;  2Z0Q A;  1SHC A;  1OY2 A;  3A98 B;  2YT0 A;  1FOE A;  2LUL A;  1TQZ A;  2DKP A;  4HB0 B;  1ZSQ A;  2RUK B;  2QKL A;  2Y7B A;  4HDO A;  5FI0 A;  4HAT B;  2I1J A;  1FAO A;  1FHX A;  2W2X D;  3UZT A;  5LOP B;  1UPR A;  3PVL A;  2D10 A;  5C79 A;  1V5P A;  1U27 A;  1DDW A;  2J0M A;  2J59 M;  2X18 A;  3X23 A;  1MK9 B;  5HE3 A;  3O96 A;  2HE7 A;  4HAU B;  4NSW A;  5FI1 A;  3TCA A;  4CHJ A;  1I2H A;  1WG7 A;  4ZRK A;  3M1I B;  3ODW A;  5JLJ B;  4ZRI A;  3NSU A;  1X1F A;  4IOY X;  1XD4 A;  1UNR A;  1MIZ B;  5J3Q A;  2P0F A;  2Y8G A;  2DA0 A;  5DHA B;  2ELA A;  2YT1 A;  1BTN A;  2K2U A;  2RNR B;  2Z0O A;  3A8Q A;  3U8Z A;  1AQC A;  2AEH A;  1NU2 A;  3IVF A;  3ZVR A;  4A6K A;  2W2X C;  2LOZ A;  2R0D A;  1RJ2 A;  3SNH A;  2YRY A;  4GMX B;  4XWX A;  1V61 A;  5C5B B;  1P5T A;  5DH9 B;  4EMO A;  1BTK A;  2YS1 A;  1KZ7 A;  1LW3 A;  2CY4 A;  4DX9 0;  1UNP A;  3HQC A;  3BJI A;  3CIK A;  1Z87 A;  3A8P A;  2W2W A;  1TJ6 A;  5L81 A;  1FGZ A;  1QQG A;  3P6A A;  2YVC A;  5HE1 A;  1W1G A;  3ZDT A;  3HK0 A;  5HE2 A;  2HTH B;  1U5G A;  5D3V A;  1XCG A;  4KAX B;  4CYE A;  2ADZ A;  1X1G A;  2ROV A;  2AL6 A;  2D11 A;  1MPH A;  3AU4 A;  2RLO A;  3QIJ A;  1W1H A;  1MAI A;  5HE0 A;  1U29 A;  1U5F A;  4K81 A;  1K5D B;  1H10 A;  4F7G A;  2CRF A;  3PEG A;  3F5R A;  2BCJ A;  2EJ8 A;  2G35 A;  3AU5 A;  1WGU A;  1FB8 A;  1PLS A;  2QKM A;  1XKE A;  4MK0 A;  3ULC A;  2D9Z A;  1Y19 B; 
#chains in the Genus database with same CATH topology
 1V5U A;  1BWN A;  1J19 A;  4L6E A;  1WVH A;  5KCV A;  4OSN A;  3HIE A;  1EAZ A;  5C5B A;  1P6S A;  2MKR A;  4MT7 A;  3AJ4 A;  2N23 A;  5CLL B;  1U2B A;  3N7C A;  2COD A;  4DXA B;  4HDQ A;  2NBV A;  1OQN A;  3PSC A;  3PZD A;  4WVF B;  4EKU A;  5KQ1 A;  2D2Q A;  2P0H A;  1XOD A;  1BAK A;  2H7E A;  2OQB A;  3BIN A;  1WJ1 A;  4MY6 A;  1NTV A;  2KUQ A;  3LJU X;  3DXE A;  2P8V A;  1NTY A;  5JHG A;  4GZU A;  2KGX B;  5DHF B;  5D27 A;  2RSG A;  4A5K A;  1SGH A;  4QXA B;  3TW1 A;  3P7Z A;  3D8D A;  1E5W A;  4CHM A;  2NZ8 B;  4TYZ A;  3PP2 A;  1B55 A;  2IFS A;  3ODO A;  4DX8 A;  2EMS A;  4A6H A;  2DN6 A;  2COA A;  3SYX A;  1N3H A;  2MWN B;  1AWE A;  4K17 A;  2DLW A;  3T06 A;  3DXC A;  3WYF B;  3ULB A;  3TO1 A;  1WGQ A;  4TKN A;  5LON B;  1V88 A;  1ZM0 A;  2YS3 A;  4IFS A;  1PFJ A;  5I2M A;  5J3T A;  4K2P A;  1W1D A;  2M14 A;  3D8E A;  4HB3 B;  2CAY A;  5GOW B;  2YS5 A;  3DXD A;  1IRS A;  4CSQ A;  3PVW A;  1DDV A;  1I7A A;  4HB4 B;  1EVH A;  1K5G B;  2KCJ A;  2XQN M;  2J0J A;  2VKI A;  1J0W A;  1U5D A;  1MIX A;  3TFM A;  5CLQ B;  1XX0 A;  3ML4 A;  2COC A;  2DX5 A;  4ZRJ A;  1RRP B;  2KR0 A;  2LYD A;  4KVG B;  2DKQ A;  2DYN A;  2UZR A;  3SUZ A;  2COF A;  4KHA A;  2VRW B;  3RCP A;  4YL8 A;  1KI1 B;  1X86 A;  5D3X A;  4A6F B;  4DIX A;  2J0K A;  1PMS A;  2LOX A;  4GPT B;  2K00 A;  3FSS A;  2L1C A;  2FJL A;  3CXB B;  3QBV B;  4Y94 A;  1UNQ A;  1ZC4 B;  1KZG A;  4Z2N A;  1TXD A;  3PG7 A;  2N0Y A;  4K2O A;  2IYB A;  2YT2 A;  2UZS A;  2LKO A;  2DX1 A;  4F7H A;  2DHI A;  2RGN B;  4B6H A;  1P3R A;  2EMT A;  2DHK A;  4D0N B;  2Z59 A;  1ISN A;  1UPQ A;  4IAP A;  2D9V A;  4GOU A;  1LB1 A;  5D3Y A;  1DYN A;  3HW2 B;  3TVV A;  2Q13 A;  4KHB A;  1OMW A;  4P7I A;  4PNK A;  4Z2M B;  1FHW A;  4C0A A;  3OAN A;  3FVC A;  4WSF A;  1XR0 B;  5C6R A;  5LG4 B;  2V76 A;  1MK7 B;  1X11 A;  2ROZ B;  2D4Q A;  4WJ7 A;  1Y5O A;  2D9X A;  4NY0 A;  2KIG A;  4HHV A;  2DYQ A;  1NI2 A;  2P0D A;  3FEH A;  1FHO A;  2GCJ A;  1U5E A;  2GCL A;  2CY5 A;  5JP4 A;  2UVM A;  2R09 A;  2Z13 A;  2DTC A;  4QJ3 B;  2M38 A;  2MFQ A;  4A6F A;  3U7D A;  4HAZ B;  3SO6 A;  4HB2 B;  2OTX A;  4BBK A;  2GJY A;  3G9W A;  3GYP A;  1M7R A;  1ZVR A;  4QJ4 B;  2DHJ A;  2YSZ A;  5KQ4 A;  2LG1 A;  2FJU B;  2KUP A;  1WI1 A;  2PZ1 A;  4GXB A;  4HAY B;  1UEF A;  1X05 A;  4DBB A;  1ZC3 B;  2K49 A;  3VIA A;  2E2X A;  1DRO A;  3NWD A;  4KHB B;  2I1K A;  2D9Y A;  2NMB A;  4KHO A;  2Z0P A;  3GYO A;  3KZ1 A;  3NW8 A;  2K2J A;  5C16 A;  1FGY A;  3KRW A;  4PQ0 A;  2JP2 A;  2YF0 A;  3MPX A;  3QWM A;  3V5W A;  2ZPY A;  2MDX A;  2RVB B;  1H4R A;  4EJN A;  3KY9 A;  1EGX A;  5J3Y A;  4QJ5 B;  3MDB C;  1GG3 A;  1MKE A;  3F0W A;  1DDM A;  4GN1 A;  1WJM A;  1EF1 A;  3B77 A;  5EFX A;  1GC7 A;  2ELB A;  3KRX A;  1GC6 A;  5JHH A;  4HAV B;  3FM8 C;  3PVU A;  3SV1 A;  3WA0 A;  5DIF B;  2GS0 A;  2EC1 A;  2I5F A;  3VOQ A;  1M7E A;  2H7D A;  2Z14 A;  4GMV A;  1Q67 A;  4GNK B;  1V89 A;  1V5M A;  5D3W A;  2VSZ A;  1DBH A;  4HAW B;  2I5C A;  4H8S A;  3KSY A;  5DI9 B;  4F7U P;  3ODX A;  2DFK A;  3D8F A;  1QC6 A;  2Y8F A;  2D9W A;  4HAX B;  3HSA A;  2L2I A;  4YON A;  2Z0Q A;  1SHC A;  1OY2 A;  3A98 B;  2YT0 A;  3NWA A;  1FOE A;  2LUL A;  1TQZ A;  2DKP A;  4HB0 B;  1MI1 A;  1ZSQ A;  2RUK B;  2QKL A;  2Y7B A;  4HDO A;  5FI0 A;  4HAT B;  2I1J A;  1FAO A;  2Z4D A;  1FHX A;  1T77 A;  2W2X D;  3UZT A;  5LOP B;  1UPR A;  3PVL A;  2D10 A;  5C79 A;  1V5P A;  1U27 A;  1DDW A;  2J0M A;  2J59 M;  2X18 A;  3X23 A;  1MK9 B;  5HE3 A;  3O96 A;  2HE7 A;  3OHM B;  4HAU B;  4NSW A;  5FI1 A;  3TCA A;  4CHJ A;  3DCX A;  1I2H A;  1WG7 A;  4ZRK A;  3M1I B;  3ODW A;  5JLJ B;  4ZRI A;  3NSU A;  1X1F A;  3NWF A;  4IOY X;  1XD4 A;  1UNR A;  1MIZ B;  2RRF A;  5J3Q A;  2P0F A;  2Y8G A;  2DA0 A;  5DHA B;  4L1R A;  2ELA A;  2YT1 A;  1BTN A;  2K2U A;  2RNR B;  2Z0O A;  4HSI A;  3A8Q A;  3U8Z A;  1AQC A;  2AEH A;  3U12 A;  1NU2 A;  3IVF A;  3ZVR A;  4A6K A;  2W2X C;  2LOZ A;  2R0D A;  1RJ2 A;  3SNH A;  4D6W A;  2R2Y A;  2YRY A;  4GMX B;  4XWX A;  1V61 A;  5C5B B;  2GUM A;  1P5T A;  5DH9 B;  4EMO A;  1BTK A;  2YS1 A;  1KZ7 A;  1LW3 A;  2CY4 A;  4DX9 0;  1UNP A;  3HQC A;  3BJI A;  3CIK A;  1Z87 A;  3A8P A;  2W2W A;  1TJ6 A;  5L81 A;  1FGZ A;  1QQG A;  3P6A A;  2YVC A;  5HE1 A;  1W1G A;  3ZDT A;  4OT1 A;  3HK0 A;  5HE2 A;  2HTH B;  1U5G A;  5D3V A;  1XCG A;  4KAX B;  4CYE A;  2ADZ A;  1X1G A;  2ROV A;  2AL6 A;  2KIE A;  2D11 A;  1MPH A;  3AU4 A;  2RLO A;  3QIJ A;  1W1H A;  1MAI A;  5HE0 A;  1U29 A;  1U5F A;  4K81 A;  1K5D B;  1H10 A;  4F7G A;  3A58 A;  2CRF A;  2ZKM X;  3PEG A;  3F5R A;  5M4Y B;  2BCJ A;  2EJ8 A;  2G35 A;  5I2S A;  1ZYI A;  3AU5 A;  1WGU A;  1FB8 A;  1PLS A;  2QKM A;  1XKE A;  4MK0 A;  3ULC A;  2K8E A;  2D9Z A;  5IRS A;  1Y19 B; 
#chains in the Genus database with same CATH homology
 1V5U A;  1BWN A;  1J19 A;  4L6E A;  1WVH A;  5KCV A;  1EAZ A;  5C5B A;  1P6S A;  2MKR A;  4MT7 A;  3AJ4 A;  2N23 A;  5CLL B;  1U2B A;  3N7C A;  2COD A;  4DXA B;  4HDQ A;  4WVF B;  1OQN A;  3PSC A;  3PZD A;  4EKU A;  5KQ1 A;  2D2Q A;  2P0H A;  1XOD A;  1BAK A;  2H7E A;  2OQB A;  3BIN A;  1WJ1 A;  4MY6 A;  1NTV A;  3LJU X;  3DXE A;  2P8V A;  1NTY A;  5JHG A;  4GZU A;  2KGX B;  5DHF B;  5D27 A;  2RSG A;  4A5K A;  1SGH A;  3TW1 A;  3P7Z A;  3D8D A;  1E5W A;  4CHM A;  2NZ8 B;  4TYZ A;  3PP2 A;  1B55 A;  2IFS A;  3ODO A;  4DX8 A;  2EMS A;  4A6H A;  2DN6 A;  2COA A;  3SYX A;  1N3H A;  2MWN B;  1AWE A;  4K17 A;  2DLW A;  3T06 A;  3DXC A;  3WYF B;  3ULB A;  3TO1 A;  1WGQ A;  4TKN A;  5LON B;  1V88 A;  1ZM0 A;  2YS3 A;  4IFS A;  1PFJ A;  5J3T A;  4K2P A;  1W1D A;  2M14 A;  3D8E A;  4HB3 B;  2CAY A;  5GOW B;  2YS5 A;  3DXD A;  1IRS A;  3PVW A;  1DDV A;  1I7A A;  4HB4 B;  1EVH A;  1K5G B;  2KCJ A;  2XQN M;  2J0J A;  2VKI A;  1J0W A;  1U5D A;  1MIX A;  3TFM A;  5CLQ B;  1XX0 A;  3ML4 A;  2COC A;  2DX5 A;  4ZRJ A;  1RRP B;  2LYD A;  4KVG B;  2DKQ A;  2DYN A;  2UZR A;  3SUZ A;  2COF A;  4KHA A;  2VRW B;  3RCP A;  4YL8 A;  1KI1 B;  1X86 A;  5D3X A;  4A6F B;  2J0K A;  1PMS A;  2LOX A;  4GPT B;  2K00 A;  3FSS A;  2L1C A;  2FJL A;  3CXB B;  3QBV B;  4Y94 A;  1UNQ A;  1ZC4 B;  1KZG A;  4Z2N A;  1TXD A;  3PG7 A;  2N0Y A;  4K2O A;  2IYB A;  2UZS A;  2LKO A;  2DX1 A;  4F7H A;  2DHI A;  2RGN B;  4B6H A;  1P3R A;  2EMT A;  2DHK A;  4D0N B;  1ISN A;  1UPQ A;  4IAP A;  2D9V A;  1LB1 A;  5D3Y A;  1DYN A;  3HW2 B;  3TVV A;  2Q13 A;  1OMW A;  4P7I A;  4PNK A;  4Z2M B;  1FHW A;  4C0A A;  3OAN A;  4WSF A;  1XR0 B;  5C6R A;  2V76 A;  1MK7 B;  1X11 A;  2ROZ B;  2D4Q A;  4WJ7 A;  1Y5O A;  2D9X A;  4NY0 A;  4HHV A;  2DYQ A;  1NI2 A;  2P0D A;  3FEH A;  1FHO A;  2GCJ A;  1U5E A;  2GCL A;  2CY5 A;  5JP4 A;  2UVM A;  2R09 A;  2DTC A;  2M38 A;  2MFQ A;  4A6F A;  3U7D A;  4HAZ B;  3SO6 A;  4HB2 B;  2OTX A;  4BBK A;  2GJY A;  3G9W A;  3GYP A;  1M7R A;  1ZVR A;  2DHJ A;  2YSZ A;  5KQ4 A;  2LG1 A;  2KUP A;  1WI1 A;  2PZ1 A;  4GXB A;  4HAY B;  1UEF A;  1X05 A;  4DBB A;  1ZC3 B;  3VIA A;  2E2X A;  1DRO A;  4KHB B;  2I1K A;  2D9Y A;  2NMB A;  4KHO A;  2Z0P A;  3GYO A;  3KZ1 A;  5C16 A;  2K2J A;  1FGY A;  3KRW A;  4PQ0 A;  2JP2 A;  2YF0 A;  3MPX A;  3QWM A;  3V5W A;  2ZPY A;  2MDX A;  2RVB B;  1H4R A;  4EJN A;  3KY9 A;  1EGX A;  5J3Y A;  3MDB C;  1GG3 A;  1MKE A;  3F0W A;  1DDM A;  4GN1 A;  1WJM A;  1EF1 A;  5EFX A;  1GC7 A;  2ELB A;  3KRX A;  1GC6 A;  5JHH A;  4HAV B;  3FM8 C;  3PVU A;  3SV1 A;  3WA0 A;  5DIF B;  2GS0 A;  2EC1 A;  2I5F A;  3VOQ A;  1M7E A;  2H7D A;  4GMV A;  1Q67 A;  1V89 A;  1V5M A;  5D3W A;  2VSZ A;  1DBH A;  4HAW B;  2I5C A;  4H8S A;  3KSY A;  5DI9 B;  4F7U P;  3ODX A;  2DFK A;  3D8F A;  1QC6 A;  2Y8F A;  2D9W A;  4HAX B;  2L2I A;  4YON A;  2Z0Q A;  1SHC A;  1OY2 A;  3A98 B;  2YT0 A;  1FOE A;  2LUL A;  1TQZ A;  2DKP A;  4HB0 B;  1ZSQ A;  2RUK B;  2QKL A;  2Y7B A;  4HDO A;  5FI0 A;  4HAT B;  2I1J A;  1FAO A;  1FHX A;  2W2X D;  3UZT A;  5LOP B;  1UPR A;  3PVL A;  2D10 A;  5C79 A;  1V5P A;  1U27 A;  1DDW A;  2J0M A;  2J59 M;  2X18 A;  3X23 A;  1MK9 B;  5HE3 A;  3O96 A;  2HE7 A;  4HAU B;  4NSW A;  5FI1 A;  3TCA A;  4CHJ A;  1I2H A;  1WG7 A;  4ZRK A;  3M1I B;  3ODW A;  5JLJ B;  4ZRI A;  3NSU A;  1X1F A;  4IOY X;  1XD4 A;  1UNR A;  1MIZ B;  5J3Q A;  2P0F A;  2Y8G A;  2DA0 A;  5DHA B;  2ELA A;  2YT1 A;  1BTN A;  2K2U A;  2RNR B;  2Z0O A;  3A8Q A;  3U8Z A;  1AQC A;  2AEH A;  1NU2 A;  3IVF A;  3ZVR A;  4A6K A;  2W2X C;  2LOZ A;  2R0D A;  1RJ2 A;  3SNH A;  2YRY A;  4GMX B;  4XWX A;  1V61 A;  5C5B B;  1P5T A;  5DH9 B;  4EMO A;  1BTK A;  2YS1 A;  1KZ7 A;  1LW3 A;  2CY4 A;  4DX9 0;  1UNP A;  3HQC A;  3BJI A;  3CIK A;  1Z87 A;  3A8P A;  2W2W A;  1TJ6 A;  5L81 A;  1FGZ A;  1QQG A;  3P6A A;  2YVC A;  5HE1 A;  1W1G A;  3ZDT A;  3HK0 A;  5HE2 A;  2HTH B;  1U5G A;  5D3V A;  1XCG A;  4KAX B;  4CYE A;  2ADZ A;  1X1G A;  2ROV A;  2AL6 A;  2D11 A;  1MPH A;  3AU4 A;  2RLO A;  3QIJ A;  1W1H A;  1MAI A;  5HE0 A;  1U29 A;  1U5F A;  4K81 A;  1K5D B;  1H10 A;  4F7G A;  2CRF A;  3PEG A;  3F5R A;  2BCJ A;  2EJ8 A;  2G35 A;  3AU5 A;  1WGU A;  1FB8 A;  1PLS A;  2QKM A;  1XKE A;  4MK0 A;  3ULC A;  2D9Z A;  1Y19 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...