1UPUA

Structure of the uracil phosphoribosyltransferase, mutant c128v, bound to product uridine-1-monophosphate (ump)
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
224
structure length
224
Chain Sequence
b'QEESILQDIITRFPNVVLMKQTAQLRAMMTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPLDVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDETTAEPKLIYEKLPADIRERWVMLLDPMCATAGSVCKAIEVLLRLGVKEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGTM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL PHOSPHORIBOSYLTRANSFERASE
molecule tags Transferase
source organism Toxoplasma gondii
publication title Crystal structures of Toxoplasma gondii uracil phosphoribosyltransferase reveal the atomic basis of pyrimidine discrimination and prodrug binding.
pubmed doi rcsb
total genus 66
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1upuA00
1DKRA 1XTUA 1XZNA 4M0KA 5JV5A 4RHYA 1A96A 4RAOA 3DMPA 1LH0A 5EUCA 5BSKA 1YFZA 1ECBA 3GEPA 1DQPA 3DEZA 1GPH1 1QB8A 2E55A 3OZFA 4JLSA 4WN3A 1Z7GA 2HCRA 2FXVA 4P3KA 2GEBA 1AO0A 5HIAA 1O57A 1D6NA 4RQAA 3GGCA 1P19A 3O7MA 4P84A 1VDMA 1OROA 2VFAA 1A98A 1J7JA 3DAHA 1HMPA 4QYIB 5E38A 3ACBA 4RHXA 1G2QA 4ZFNA 1BD3A 4P83A 1U9YA 4RV4A 1VCHA 4QRIA 5ESWA 1WD5A 2PRYA 3GGJA 4MB6A 5KAPA 4LZOA 1XTTA 1ECGA 2C4KA 4RAQA 1P17A 1I0IA 4RABA 3M3HA 4IJQA 1V9SA 2PRZA 1GRVA 1UPFA 1XZ8A 2JI4A 2EHJA 5BQPA 1P4AA 1JLSA 1TC1A 1QK4A 1ZN8A 2PS1A 3EFHA 3N2LA 1QCDA 2JBHA 1G2PA 5IPFA 1STOA 1FSGA 1UPUA 1ECFA 2H06A 4F8EA 4X45A 1ZN7A 1I0LA 3QW4B 1BZYA 5IAOA 5K51A 4OHCA 3MJDA 2WNSA 3NAGA 3LPNA 4RADA 1HGXA 1ECJA 1ECCA 1QK3A 1L1RA 3ACDA 4M0PA 3ACCA 4LYGA 4S2UA 4JITA 5ESXA 4RANA 1ZN9A 1PZMA 1XTVA 4RQBA 2JKYA 1MZVA 1DBRA 4QYIA 1A4XA 4PAWA 1JLRA 4TWBA 1IBSA 4LZNA 1DQNA 4RACA 1W30A 4FYMA 1O5OA 1NULA 1A97A 2IGBA 1DKUA 1OPRA 2P1ZA 1UFRA 1QB7A 2YZKA 1U9ZA 3OZGA 4P80A 4RHUA 1A3CA 4P82A 1VSTA 4PFQA 1OREA 4LYYA 4RHTA 3MBIA 2DY0A 1CJBA 1G9SA 3OHPA 2JKZA 1I5EA 4X44A 1QK5A 3G6WA 2H07A 4KN6A 1BD4A 1P18A 2AEEA 1I14A 3LRTA 4M0UA 1TC2A 1Y0BA 4P86A 5KAMA 4Z1OA 4LZAA 1I13A 3S5JA 1G9TA 1L1QA 3HVUA 5BQOA 1R3UA 2XBUA 5BRNA 1QCCA 3KB8A 3H83A 5HKLA 1NONA 5JSQA 1A95A 4WMLA 4P81A 2H08A
chains in the Genus database with same CATH superfamily
1DAIA 4P7GA 3VZCA 4GOMD 4WJLA 1QVRA 2NWQA 5ARCA 2PZFA 3GNQA 1GJRA 3N8NA 4ZT6A 2WM8A 4ECEA 1JI0A 2R4QA 1RIIA 2IS6A 1DGQA 1MC5A 4LGYA 3LGSA 4LSMA 3WI7A 4PZ9A 4RJLA 4IEFB 5DULA 5IKPA 2WWFA 2V6IA 3LO8A 3IXQA 2QU7A 2J3EA 3R3YA 1H1LB 3L49A 1NJSA 5ALIA 1G18A 3C6MA 1O89A 2XIJA 2GTHA 2ONZA 4DLKA 3KKOA 4YJFB 1OROA 2Z9DA 3GDWA 1W5EA 2VL7A 3AY7A 4C0QC 2IYWA 3DHYA 4IX1A 1U99A 2PMDA 3GLGA 1E7MA 1E69A 5EL0A 4P93A 1HL7A 3SHTA 5JRDS 2VWGA 4YEDA 1GPYA 1DC3A 1E2LA 3VR0A 4RGVA 1EVKA 5FFMA 2PZGA 1IHUA 3IKMB 5CDTA 1N2IA 2PZMA 2V9CA 2BELA 3BB3A 5K0FA 3N7AA 9MHTA 1X7ZB 3DHVA 1Z13A 3TQIA 3OOHA 3PTZA 2R6FA 3VPXA 1W2WB 4LMRA 3P9CA 1V26A 3JZDA 3MRXA 4E13A 3FPSA 2QN7A 5IJ9A 2QPTA 4FILA 3KVNA 5HUJA 5KNCD 4B7UA 5DN9A 1TEVA 2J59A 3R9WA 1J1UA 3E05A 1CT9A 4EGAA 4Q1BA 2EWVA 2FVYA 2QTWB 3R3UA 4ND8A 4JMLA 1H0RA 1HBJA 1PQUA 2JEOA 2O3RA 4F3KA 5IPFA 2EFCB 4DZRA 4QEZA 3FFAA 3H6GA 4Q82A 1CZRA 2CVOA 1KK1A 2PXXA 5I9BA 1HWYA 3KKMA 4IGIA 3OT1B 5I9SA 5JZOA 1G2IA 1W46A 4UMDA 1EGVB 3RHZA 3H1TA 1N1MA 5IKXA 1KETA 3LDUA 2V4MA 4C0WA 1P7CA 1VBMA 1P8AA 2GJ9A 4B83A 1CHDA 4ESEA 1BA2A 3ZDAA 3PHGA 3TLBA 5I4KA 3AW9A 3S2FA 3KQUA 1EK2A 2PKQO 1TVKA 3B12A 4GKJB 4D8YA 1QTNA 3A6PC 5EIHA 4MQFA 1WLYA 4B9EA 1W44A 4W5RA 1UMDA 2XD9A 1GUZA 4GOKA 5BN1A 1GSHA 1SVOA 4PRZA 3T3HA 4Y2UA 4A8TA 4AI6A 2VJNA 3IEIA 2IWRA 3VV2A 4C7OA 4A3SA 1QPBA 2YV2A 5EG5A 4TTSA 5C3UA 4FFNA 3OJLA 4TRRA 3TQHA 4D74A 1G6OA 1W4BA 4DMFA 1OZGA 2VNSA 2YHIA 3LBYA 1C0KA 4EHBA 3CN9A 2QIOA 3IHLA 4MPTA 4MGHA 1F8GA 1T8PA 1M6VA 1J09A 4QXOA 3DMDA 4LDRA 1CVRA 5B1EA 3INGA 1RPTA 1XF9A 2BV3A 2HLNA 3NYQA 3HNRA 4CIWA 2XH8A 5D5HA 3K9WA 3GG2A 2QMOA 4Q3BA 3K73O 3BD8A 4LQDA 1F0NA 4OBBA 1JX6A 4GOJA 2IDKA 3CRVA 3ZBPA 1LBTA 3R8XA 3ZWMA 3ZEIA 4IHAA 1RAEA 2RKBA 4AJ4A 4HLCA 3UQZA 2V5AA 4JI5B 1BGXT 2F59A 2D7JA 5FLKA 4PCVA 1BX3A 4DSZA 1SOMA 1RRCA 1QGUA 2ZRHA 3E22B 4TYPA 4FEEA 5AKZA 3C8HA 5IJXA 2VJDA 1I94B 4XX0B 5DOVA 5JCZA 1V3QE 4TS4A 3R3ZA 4LHZA 1XTUA 5A0VA 2P75A 3PB3A 1VB3A 4BNVA 2FUG1 4BC1A 2DSTA 5A03A 2WM9B 1AKRA 4NCIA 2A30A 3DEFA 4LPSA 5C7OO 3F6SA 3ZDRA 3EHEA 4XDZA 4J90A 1KEEA 3OIUA 4CKBA 2FR8A 4R0VA 1XDUA 5HM6A 1FZTA 3LPMA 5F21A 4W5TA 2P9TA 2Q4TA 3AR6A 3LZ6A 1GIAA 1CUJA 4D0NA 3ETEA 1PR6A 2G7ZA 2IYYA 4GBJA 1LZLA 3JAWB 4GE0A 1CUWA 4FYWA 1QFXA 4WZBE 3V2HA 3LWDA 2ZGVA 3TL3A 1B74A 3KZKA 4C14A 3QSYA 1Y82A 5C5CA 4DIMA 1NUQA 2W8BA 1PF7E 3DFIA 16PKA 2BMDA 2I7CA 3B82A 3T0IA 3A9TA 1FMFA 1N6OA 2EKZA 4QOHA 5EQTA 2PZ8A 1PJ2A 1WW8A 3BL6A 4B6RA 4GDMA 2XUAA 4YP0A 5HG0A 4EG3A 4IQGA 9ABPA 2HJVA 3E9RA 4O5OA 1SU7A 1AMUA 1KI4A 3F5DA 1R0SA 2FDXA 3UKOA 2CWDA 4I99A 2AK3A 1TM5E 4S0ZA 1D9ZA 2X2PA 2ZQ5A 1P7WA 5D51S 1S9HA 4P7JA 1J90A 4UATA 1NVBA 4PW0A 4X8OA 5AXBA 3U3JA 1UK9A 3JAMA 3RIEA 4BASA 2CN1A 4WZBA 2DFNA 2ZRLA 3SXPA 4G4SO 1UBEA 4C2UA 3WGUA 1J0EA 3EXIA 4NH4A 3AB7A 4E0BA 1KEVA 3KD2A 2PWAA 4TKZA 3VNRA 1NLFA 3QW4B 4KACA 4R41A 2OHFA 1JHOA 5SYAA 2JAWA 4BLOA 1PJTA 5LYJF 2YRXA 2R1UA 2WYIA 3VYUB 4HDKB 1T5LA 1R9MA 3COVA 3WAKA 4F72A 1CJUC 5MN5A 4AJNA 4ITUA 3IP7A 5A9TA 3FWHA 2DWPA 3D5QA 5G0TA 2PXHA 2MYTA 1PEKE 2WJAA 2IHKA 4N8EA 3SF0A 4V1CI 1LZKA 1CQIB 1JPVA 1A1SA 3DVAB 3GN1A 4TKLA 4YCBA 4P35A 1XOIA 3HL0A 2RKWA 4Z0TA 3PR2B 1KE1A 4OI0A 2KSQA 4PQFA 2NO1A 1QTIA 4RFSA 2WFAA 4D9EA 3OQVA 1L5VA 3KXIA 2V59A 3MTIA 1ISPA 1GCIA 3FPJA 4I9NA 4MK4A 5IDXA 2V0GA 5BXQC 4CL8A 3B2QA 4RD3A 2OB1A 2R8BA 4E09A 4C7XA 2X0IA 3KLMX 4DC1A 4E2YA 3ECSA 1LQ2A 3GLQA 1AQUA 4BBZA 3DV9A 3RAPR 3ZIDA 1ESCA 4OD0A 1ISSA 1PJ4A 3MWDB 3PJRA 2JKZA 5D1NA 4YAIA 5F5XA 4DG9A 3GUHA 4E08A 5AMXA 3H84A 4X1KB 1EBFA 2BEUA 2R44A 3TE6A 1G38A 4MVJP 3SQDA 3IO5A 2WKSA 5HIIA 4P86A 2FJ0A 3DVLA 3ZE2B 2IELA 3GDGA 1X74A 4K88A 1D2AA 4IZIA 5CVDA 1OGIA 3NBKA 4KYVA 2OFFA 1E63A 1DKLA 2G63A 4OLHA 5B2EA 5I9MA 1P44A 3S4YA 1I5OA 4B6OA 2F00A 2QZPA 2QRHA 2OHHA 2C07A 1A5TA 1V5EA 2FN4A 2QX8A 3F6PA 3K5WA 4X1IA 1T4DA 4AS3A 4DV1B 4PU0A 3HB1A 1XQ1A 2VBFA 4GOOD 5F73A 1E0JA 1E2MA 1FDOA 1PJLA 3GJ5A 1WHSB 5HZGA 2WB2A 1EWQA 1Q7TA 3C6XA 3EE6A 1VSBA 3M6MD 2X0NA 3PFGA 2FXVA 3QU5A 4LY3A 4G5FA 1T6BY 2YQ5A 5JCOA 4EPXA 1AMOA 3B89A 4NCXA 2R7KA 3M1IA 5DV9A 1PCXA 1Z5VA 1FP1D 1YDHA 4UC0A 3EYWA 4RTSA 2DFTA 2W0MA 2V55B 4DLAA 3V7NA 1HMPA 4YC7A 3IUNA 4ZYVA 2FPGB 1IXZA 1UPXA 3H9GA 3SIPA 2PLFA 4XE5A 3QA9A 4GLBA 3PD7A 3D8SA 3IKVA 4GQIA 2H1OA 1V8FA 3O8BA 2G08A 1SXJD 2NXEA 3PQFA 3FDZB 2HHAA 3E27A 4J0EA 4J7UA 5KOYA 4O4IB 2IHJA 1VG8A 4LCJA 5F2KA 3EPHA 3A04A 1XNJA 1T3HA 1VL2A 2BC9A 1C4WA 2WYVA 2WIFA 1HG0A 3HUUA 4HYTA 2E87A 1PFVA 1UPFA 2JGDA 4PBSA 1LSOA 5CVCA 3I5YA 1N6KA 2EAUA 5MN6A 3B1VA 1A82A 3FB4A 1LNZA 3F47A 3IT2A 1BKSB 4DT1B 3FPHA 5E2AA 3V2IA 4EKEA 1A69A 4LI3X 2XNDA 3L9XA 1MGOA 4O25A 1NFFA 2E5FA 2DUNA 1SB9A 3QMVA 4N8SA 4DUZB 2EQ5A 4HFRA 3ICPA 4QGSA 1E8NA 1EZ1A 3PI7A 4WGGA 2WKQA 5IN5A 3BHMA 3M3DA 3IAHA 1OCEA 3GVXA 5IVDA 5ADUS 2DERA 1CB7A 1JALA 4X45A 5G2OA 2C98A 2Z58A 4KR6A 4TM7A 4JVSB 1E0AA 3DE4X 2ZB3A 4R5HA 1EDEA 1J5PA 1T3SA 3DZIA 3G49A 4JI8B 3IHKA 1UXIA 1J8YF 3V46A 1UIMA 4EDFA 4TMXA 4YLYA 3KXLA 1A9TA 5K99A 1Y7IA 4LJ9A 1NMZA 1Z39A 3TW8A 5BPHA 2HN9A 1UR5A 2GDJA 3Q1LA 4HNAA 2OBMA 4BO4A 7REQA 4R6XA 5K0JA 4KAXA 1FFCA 4YUZA 3U48A 2ZK7A 4JI3B 4RVNA 4JQYA 1V7ZA 1GILA 2B7LA 2JA2A 1SKQA 5AVZA 5JZSA 3K4HA 4WCDA 3PC8C 4DV3B 2V74B 4R71A 4JP8A 4J2OA 3PC3A 5T6BA 3EDQA 2A9PA 1B93A 5M2QA 2KW5A 4DL9A 4KVFA 3UOWA 1H8EA 5I48A 2IZOA 3JQBA 3D8TA 3B2EA 4KTVE 2QSJA 1GTSA 2VJYA 1I4LD 4NRDA 3RIHA 3T5DA 3DUFB 1SCKA 4RLSA 2ZCJA 5KYGA 3DAOA 3BTVA 2BZ1A 1OC2A 1HQKA 2WFLA 4FKMA 2FJUA 4UZSA 3VKWA 4IUYA 5AFSA 3OIYA 1U3VA 1T0HB 2VSOA 3CEHA 3QXCA 3T5BA 2NXJA 3F98A 3HDHA 4ZOQI 1YULA 2G1KA 1FFBA 3LPCA 4PZYA 5ES4B 1T5IA 1RHJA 1JR3A 3P19A 2NVUB 1N25A 4F4IA 1ZQ1A 4RZ2A 4R1TA 1J0AA 4V2UA 4XGQA 1PFGA 5FWYA 1XZCA 2JIBA 4B80A 3DBLA 2GYWA 5EGNA 2KHZA 1PDVA 3GT3A 4TYMA 1ZUNA 3ZJUA 3FVWA 3TJRA 1JAZA 2X0RA 1WZ2A 4QJBA 2OO3A 2PNFA 3EEQA 3EA0A 1E1YA 1NDQA 2FWPA 3O1LA 2HNBA 4DYVA 5HR5A 1OFHA 4DM3A 3P26A 5EIAA 1HYBA 4JYPA 1UCFA 1I2DA 1ESDA 2C7GA 2QGZA 3DF7A 3FBWA 3OIFA 3PSHA 2HSJA 1L1EA 2QE7A 1Y34E 2OHOA 7REQB 2YOFA 4AUMA 5CHYA 2P6OA 1PL6A 1ULBA 1I6KA 1PG5A 2J4DA 1XU9A 2K7ZA 2XUFA 3AUTA 3F5FA 3Q2IA 4UM7A 1X1CA 2Q4RA 2Q9BA 3GIWA 1JR2A 5HVNA 4EFDA 5F1KA 4L6IA 4NIMA 4B3GA 3HFSA 2ZAYA 4IJQA 4Z5XA 1CY0A 4KQHA 1V9SA 2J0VA 4NEHB 4RCZA 3GQBB 1W36B 2CCJA 5CXQA 4CCYA 3NBAA 3JVUA 3RC1A 1KSJA 2RHGB 2QMZA 5EE9A 2C5AA 4GVLA 5KHAA 1OQAA 3TSZA 1AA6A 5LN1A 2IF2A 2BEWA 2FSVA 2UYOA 4AYWA 4OLBA 1Z15A 2Q2QA 4RJKA 1Q6ZA 4DN6A 4M8LA 3KKEA 2IXFA 3OZIA 1K6XA 1N5IA 1BXRA 4CM4A 3ONEA 2VP6A 2IXEA 5GONF 4LJAA 2A58A 1G8FA 2O1WA 1NJ5A 1E61A 2NVUA 4BEBA 3QX9A 4HWRA 3IALA 1BWQA 4WLNA 4NDZA 2QVZX 3GRVA 2QRVA 3O0DA 3O4RA 4JBXA 2QVYX 2VYQA 3WHIA 4U2KA 1B43A 3TOSA 1PGJA 2QENA 3NM5A 5CT6A 1X7WB 1X1DA 4MCJA 4D81A 2X1MA 1JHVA 1KVRA 3MXOA 4AMBA 5IVKA 3DT9A 2VJQA 1TQHA 1F06A 1RYDA 1HEYA 4WCFC 2NOAA 3PUWA 3WGKA 1CWUA 2JLCA 2GT1A 2JB9A 2DU8A 1PHPA 1R2QA 2OFOA 1W36C 1D6JA 2BF7A 4HUQA 2KBEA 4LE2A 3UWSA 4ZAGA 4OOFA 2ZJ0A 3B52X 3PCTA 3L9WA 4M4SA 1CB0A 4I0WB 4IJMA 4CNBA 2P6PA 2QUIA 2CB9A 1IUKA 4A0RA 5LM3A 3CVXA 2DPHA 1MFPA 2AG8A 2QRJA 4MVCA 1P2TA 1YL7A 2KE5A 2WT8A 3IVCA 4QOSA 3NWJA 1KFBB 2ZM5A 3G6WA 1A8IA 3NXSA 1QLHA 1GPUA 1Q83A 5DHRA 3NIBA 1RM3A 2J5XA 3G79A 4XKJA 3K0HA 2E48A 4L5BA 1ZXBA 2LV8A 5A5GA 2IY8A 2FFQA 5JMPA 2FPPB 3EGDB 3TEJA 4RWZA 3T0FA 1CDOA 3W8DA 1ZD9A 4YJ2B 1RRFA 4GZ6A 2C61A 4FFVA 1E9RA 3ITDA 1NXOA 1QO0D 2I54A 4HDNA 3NT4A 1W4AA 2QTMA 4X66B 3KQHA 1HYGA 2AWOA 2IU6A 3CUUA 4ZVKA 3LPAA 1BVYF 4FEGA 1LH0A 5CNKA 1XSEA 2X40A 2PH3A 1BGWA 1RJ9A 3A4NA 4CZ2A 2A0XA 2MINA 3JARB 1ZK1A 3BTSA 4DHEA 3CUYA 3T7TA 2W6QA 5EMLA 2AMYA 2PRSA 1J2UA 1XZAA 3CEAA 5AP9A 2NUAB 3VZSA 3NAQA 3QWIA 4HFJA 2JVKA 2R11A 3STWA 4IDOA 1NNEA 3DR5A 3VAYA 3PGJA 1G21B 1BE6A 2J7KA 2XUIA 1OB5A 3V5NA 5FTJA 5BWOA 2YFQA 3LX6A 2DKFA 4TXJA 2QLLA 1L5WA 1HE3A 3AUJB 1ORRA 2FOXA 3I52A 3PL5A 3I61A 3KRTA 4ZRDA 3A2MA 5J23A 2WP0A 3NHYA 3QVGA 3G0DA 5KYYA 2OOSA 5ALXA 1SD5A 4EQ6A 4EB6A 1RWBA 1IXYA 3DMFA 4PQGA 4I1VA 4J2TA 3KQKA 4N01A 5BY2A 2OK8A 3MPOA 5LD2B 2VNIA 2QAGB 4YXWA 1LB1B 4HH0A 3RC2A 1ZN8A 1RMTA 3UWDA 3FETA 3RTEA 3OCWA 1US8A 3VQTA 1IN8A 3W5CA 1AKVA 3M89A 2UXBB 3PKIA 1T0JB 3H6KA 1DBVO 4PLWA 4LGMA 1WVIA 3OZSA 3RAGA 5KC8A 2GGSA 4RD1A 3A4IA 2XGGA 4XJXA 4J0CA 4ZZIA 5GZ6A 1CR4A 3I8OA 1B8VA 1QDLB 1RU3A 1FXUA 4KFSA 4LZWA 1IHYA 2X1VA 1PSWA 421PA 1JHYA 2DWCA 3SG0A 2XUPA 2YIDA 2GM5A 4F3YA 2DHQA 4CXMA 3A4YA 3KC2A 1NURA 3Q8WA 3NKVA 3WB2A 2Q28A 3ZDBA 2NQ8A 4I50F 3RG8A 1FNMA 1O6GA 1TM4E 4UAGA 3S1AB 1TJ5A 5ECYA 3VHRA 5FOTA 2O59A 1G8AA 3H65A 3MJCA 3ZE9A 4ER3A 1D2CA 1QCZA 1UDAA 3AKEA 3H6HA 1N3BA 4LZPA 4X0EA 4DGQA 2A1TR 2PWYA 1EK5A 1OXMA 3GR6A 1IY1A 2VJMA 2AG5A 4P82A 2EFGA 1ANKA 2XB6A 2XJ9A 1PJZA 2ID4A 2PS9A 4IHKA 4FQ7A 3IAAA 3VRHA 4CG3A 2QW0X 4ZYZA 5AW8A 3NV9A 3ZHCA 3OFND 4LC0A 5HF5A 3VOTA 4BY9E 4YRCA 1TYEB 2Q7XA 4Y0AA 3Q3VA 2P6MA 4NS4A 2UVDA 2CDBA 3E2PA 5BVHA 2PG3A 1JXQA 5I9NA 5LB4A 2DEUA 4MVWA 1P7ZA 4RTOA 2GVDC 1GU1A 2YXDA 4KNWA 4MLDA 1EDZA 1KMMA 2AF4C 2ZWIA 3ZV4A 4CDGA 2F3QA 2XDAA 1A8HA 2REXB 4L9AA 2ODPA 3IHWA 4R8LA 3TYXA 3NMUF 2Z2KA 1CJSA 4R1OA 1Z68A 4B6FA 5BQ3A 1X1EA 3S55A 5KDDA 2H08A 4CM3A 2JFQA 5JD3A 4LHWA 3FOZA 3L93A 5IT0A 2FK7A 3QP9A 1JEEA 3UXYA 1GZVA 2P2NA 1ZMTA 1H42A 1G5HA 2ATXA 3KEGA 3PFCA 4IDHA 3F2IA 1DCKA 3BM5A 4H7IA 3AWIA 3RVRA 1XRMA 9GPBA 2ZIGA 4HAUA 4HNAB 5I7FA 2H9AA 4PHHA 1FE8A 1MZPA 1NPYA 1JBKA 1AIPA 2WJHA 1LD3A 1RYHA 1IIRA 3KUXA 3P4UA 4XIJA 3HH8A 4AN4A 3KT8A 1GARA 5ALUA 5BNWA 3EQ8A 3JW8A 4LS3A 4CI0B 4R51A 5CXUA 2O8CB 1LU9A 2OHXA 4B3CA 2OKGA 1GG9A 4ACBA 2K7FA 1I4TD 1SKUA 1Z38A 3HYNA 1L4MA 1U4OA 4FJ2A 4N0QA 1O6ZA 1VHTA 2I87A 3FZQA 3PG5A 5A05A 2H17A 3L6EA 1FOEB 2LE0A 6PFKA 4PHFA 1PWYE 3A58B 1Z2OX 1H8ED 3RT7A 3VTFA 5K7SA 1TPZA 3RYIB 2I9PA 2OZEA 3C85A 2X9GA 1FQKA 3RVSA 2NXNA 3CR8A 3CW8X 1E9EA 2FX5A 4J94A 1U7OA 2CKDA 1G291 4MVJF 1R5OA 4QTZA 5CFMA 2QLFA 4Q4DA 1VKZA 1N9ZA 3P9ZA 2QD3A 3GYBA 4LDNA 4BDSA 2D7CA 3URMA 3JYHA 3IQIX 4Z3DA 3K1AA 3F67A 4PAMA 4RIIA 2RGDA 4EY7A 1SK9A 2VO1A 3LHSA 1Q3TA 5F2EA 4IOKA 1GAEO 3T52A 3E0QA 3TTSA 2Z08A 3T1VA 4DJTA 3M4NA 1B0ZA 3NKFA 3NBZC 1U0GA 1JEYB 5EFZA 5DBOA 4JGIA 2B5WA 5AVOA 1A9YA 2OLKA 2A35A 5A4FS 1QV7A 4JL6A 4YECA 3HBMA 4TMFA 1M2KA 2SBTA 1ZK3A 1VL8A 4INJA 1I7LA 5GAJA 3TZQA 3WGGA 2HDHA 3TAXA 3SWWA 1YVPA 2CUKA 2EOAA 1ZNWA 2Y0BA 3OMXA 2RDMA 4IF6A 1K06A 2RGYA 4PTZA 2FQXA 2NZYA 1BVRA 3QYFA 3EVTA 3GU3A 1RXSA 4WBNB 5A4DA 2XOKA 1JA9A 2B7CA 3GUYA 3UKDA 5LR6A 5AM2A 4A8JB 3KQWA 2Q1XA 1IZZA 3QWFA 4EUEA 2XNDD 4QA9A 1GPWB 3OLZA 2CKMA 4HDQB 3OF5A 1MX5A 5G1PA 1X0XA 4C88A 2QD5A 3UGJA 1Y4AE 3U7IA 3A3OA 2VSNA 5FL7A 5EQFA 1JDBC 3A9RA 1V4NA 4BWGA 1Z25A 4NQRA 2O5RA 2QR3A 2X6QA 4M36A 2GEFA 4G1MB 2I1QA 3IV9A 2H2AA 1H9AA 5DTRA 1GZSA 3F8SA 1YS4A 3MCZA 3YASA 2PKQP 1H0HA 3Q12A 1MO4A 2A5DA 4ODIA 2E5WA 1F9AA 2J7PD 3C7AA 3IR5A 5B7PA 3TUZC 2Z04A 3UZUA 1QS0A 1P29A 3ABSB 1OGJA 1LDMA 1F8UA 4LSZA 2Z0MA 2GD1O 1DIGA 1U9JA 2JI9A 2PH1A 3AR7A 2GN9A 4OLJA 1EXMA 4OXKA 4XX1A 2Y1GA 1XQXA 2QZ4A 3BWCA 2YZ7A 4JOBA 1NU8A 5CB8A 5A2QA 1UT6A 2V0CA 3H75A 4QXAA 2BBOA 5A7GA 4HRAA 2NZVG 4CM4B 5CJPA 5HDQA 1HT0A 1T26A 1UC4B 1Y3CE 2EJUA 3JSAA 3SJBA 1JW9B 3GGCA 4WNIA 3WK4A 5DX0A 3G9QA 4R9RA 2WFZA 5AM0A 5IVPA 2VDQB 2BP7A 4EVIA 4FEAA 2J08A 1IJFA 1N2GA 1TM3E 4XB2A 2MCFA 1DG9A 1B8OA 1BSVA 2ZRNA 5JE8A 1PDOA 3U5TA 2B8TA 2QMHA 1QYRA 4CR8A 3F1LA 3AUSA 3W0LB 3CYFA 1QG0A 1XG5A 3NCTA 1II8A 1UZUA 4BGVA 4BYGA 3G2QA 4DF3A 3PXGA 5K8IA 4H7KA 1KVUA 3PYXA 2BFCA 2ZUCA 3GFPA 4KXXA 2ZTLA 2WPNA 3BJEA 4I2NA 4QUHA 4TWJA 3REQB 3TLZA 2QTGA 1E0DA 3E6AA 3ROGA 3L4SO 3FCXA 2OM6A 3TIGA 2FN9A 4JIMA 3NHKA 3W05A 3AVQA 5ALLA 2VC2B 3EBOA 2WHPB 3KFVA 1ECLA 1XO1A 1EH5A 3EA4A 3PK0A 2AR0A 1NXVA 1HTWA 3BCRA 3I6BA 3CWQA 4HXYA 4X20B 3UVEA 5BVGA 1YK1A 3AJAA 3EW7A 3H17A 3C7KA 3PXAA 2AOVA 4LHEA 4ERNA 5C53B 1ESNA 2D62A 4NESA 1OTXA 3X1MA 2WU4A 1KQNA 4W63A 1P1FA 4YI3A 3RU2A 2YIMA 5AK4A 1UBOS 4G5SA 1XA0A 4JIGA 1HRKA 1T9GR 3GDHA 4Q9IA 1AV7A 3JV7A 4GMKA 4BFTA 4MI9A 4OMFG 4QM7A 3DPIA 4B0OA 2JLXA 4BN4A 4C89A 3DC2A 4FJ1A 4V0MA 4YGXB 1WS6A 3P2KA 4IY1A 4YB8A 4C0JA 4HEQA 4Q4AB 2OPBA 1ZESA 4KAJA 5KSZA 2AEMA 1MB3A 4G1UC 3KEMA 4MVJD 1WPRA 3ONDA 2ZAIA 3LX5A 4F56A 4PN3A 1RJ9B 4YQYA 4NU8X 4DDUA 4QPDA 3ZN2A 5CGZA 4CIXA 4K87A 5FNVB 4BLRA 4M0PA 3B36A 1RJWA 4GL4A 2OUIA 2G9ZA 4EPTA 3W3AH 4Y9UA 2E6KA 2J8ZA 3ODGA 1Z83A 4R2KA 4AZ0B 1JG2A 1G66A 5KNDD 3TZHA 1CY6A 5F1YA 3QU9A 3EJWA 4UEKA 3K6KA 3JR3A 4H3SA 5CXSA 3G82C 5FO1A 4PGGA 5JYCA 2BM9A 5BNTA 1LTQA 4D6XA 5CA0F 1ENPA 1T9BA 4I8XA 4HS4A 4NL4H 1FW6A 4LNAA 4OQLA 3C5VA 3UOGA 5JC8A 4JXJA 3M2TA 3V1LA 3F0TA 3JWJA 4BCBA 4MR9B 1KSFX 3QXSA 5G1OA 1GYRA 1M2NA 4Q6BA 4HNVA 4Z7JA 3CLHA 1FMTA 4PX2A 4XASA 5FJIA 3L7DA 3LAWA 1C1XB 4PFQA 2PZKA 4ZOLB 4NHOA 2REBA 3BEOA 4H31A 1IB0A 3GK3A 4XLLA 1KK0A 4F91B 1MR3F 1P3DA 4E6EA 3L01A 4BFYA 5H82A 3ZOZA 5EWLB 1DG1G 3VNVA 1JECA 4PG7A 4QGAA 3G2JA 3RV4A 4L5CA 3SZRA 2X9QA 4LQCA 1QRUA 2NZ8A 3MG9A 2YXNA 5TGTA 5TF0A 4IMRA 1ONNA 1NUAA 1UZNA 1KEUA 3DEHA 1UC5B 3OE5A 4IDNA 2YICA 2JVIA 3FUUA 1T0UA 4M86A 5AJVB 4D98A 3ZX4A 4B31A 1Y1PA 4WN9B 3AFMA 2RGXA 1IAVA 1JSRA 2H9YA 1AK9A 3LWBA 5FTNA 5HRCA 1U9IC 3EAFA 3I04A 5AYVA 5ICEA 1Q0TA 1JSLA 4D7AA 1WXHA 3P2MA 4TLBA 3COSA 4RCYA 1PIWA 4RV5A 1XQ9A 1BYUA 2IA5A 4M0KA 2PA0A 3WLAA 4EYGA 2H2DA 1JAHA 1FFHA 2HWWA 4ZT3A 2XWJI 3LMKA 1VLLA 1T0PA 3DDNA 3TL6A 1V71A 3GEBA 3ZZUA 5JRZA 2BRUA 3QYJA 5K0LA 1SG6A 5F4ZA 3T1QA 5C3MA 1YCFA 3CO0S 1COZA 2H1RA 2C0CA 5BSVA 1ZVQA 4LKOA 4ZEXA 1RAGA 1GKUB 1SFRA 1WUHS 2G1AA 1KIAA 3S1AA 5B3LA 4BB9A 4MICA 2WTMA 3C2QA 1DX6A 3G7NA 4TWIA 4H0CA 4AF8A 4B09A 1LWOA 1JXMA 3FKSA 4WESA 5LBUA 4R05A 5CRIA 2A5FA 1AC5A 1E18A 2CVPA 4AS2A 3UWMA 5JU6A 2R47A 3EPKA 3OT1A 3KHSA 2QRZA 1E6LA 1NVUQ 2HLDA 3FTQA 3DP9A 3TNJA 1YC5A 2P5TB 3WWYA 1RABA 2R8EA 3PQEA 5DH9A 3Q3JB 1HZZC 1FU8A 1REQB 3C41J 3QVOA 1QF7A 2ON6A 4G56A 1ABFA 3ZKAA 4EM6A 3IBCA 1XXHE 4E5VA 1ULTA 4AWAA 4AJLA 1GRVA 2EBUA 3HSSA 5FIUA 3ZW8A 5CEEA 1E3DA 2UUOA 1Z4JA 3E15A 4MEAA 1QO9A 3QFHA 4JSRA 2PVPA 1H4SA 1KDOA 1QAOA 3PT5A 4RDIA 1WDWB 1LK7A 5LYJB 3PXXA 4K6OA 1MF7A 1VYUA 2OEPA 1LK5A 3BKWA 2GQ0A 3D8UA 4XJVA 4AIIA 4AJJA 1MT3A 1N2CE 3UK1A 4BQPA 4KYTA 3BMQA 1T8WA 4GSLA 3KJIA 3VSEA 4V02A 3HC7A 5TRTA 4RPKA 1WCIB 5JAMA 1U2QA 4YX9A 1VSQA 1NYRA 1ZEJA 1NG9A 1DQSA 3TRFA 3BB4A 1NW4A 1VMEA 2DPXA 2HWYA 5T41A 3S3TA 3SS8A 4EJMA 3IEXA 2GXSA 3KJEA 4DSUA 5SY9A 4YRRA 4OQNA 3QKIA 4ZO6A 1N2CB 3IAEA 4EPRA 5CYPA 3SNHA 1W59A 2OBBA 1IATA 4B3BA 4B7CA 4YP9A 2XVYA 2ZBFA 2RK6A 4PCLA 2GK7A 1RAAA 3VH3A 1YT5A 4M53A 1UF9A 2WVJA 5IYZF 1QGUB 1P33A 5KNCA 4FBLA 2HA3A 2WHXA 1IQUA 3QOWA 1CUIA 1DDGA 1RLIA 4LOKA 5BXYA 4KWEA 1H66A 1MABB 3A05A 4MW7A 3WIBA 1U2EA 1HO3A 1UFKA 4GO1A 1QLJA 5CUQA 4D0SA 2K2WA 2D74A 4OBXA 4IOMA 5I8WA 4CFYA 3FJYA 2JBWA 2AC7A 2ZAMA 2HCTA 3AHIA 2OXCA 4W9MC 3WMWA 1N32B 2B1QA 1N8NA 3R3VA 4R54A 4KPFC 4GX2A 1VG0B 1TM1E 2PL9A 1WCYA 3B5IA 2OM2A 3PIRA 3UM9A 2BR3A 1YBFA 2DTDA 1JFVA 3EIOA 2UZIR 2AQKA 1F8XA 3MINA 3IUJA 3MUEA 2NAFA 2Y76A 3OQ6A 4MW1A 5FRDA 4BGDA 1DSSG 1AK2A 1O58A 1ORDA 1S01A 1JHUA 1PG2A 1U5BB 1HDYA 2P11A 3IMEA 2OFWA 1R0CA 2AF3C 2QRPA 3ZDFA 4A8JC 2AFRA 4KK4A 4GD3Q 3W1WA 4KR9A 4EUKA 1ISFA 1PR4A 4JI4B 3DM5A 2YYZA 1DQPA 3WX0A 3MOGA 4E30A 3H7AA 3NRBA 3K0BA 1TYBE 1DDIA 2BFOA 3NDRA 4TWRA 4A0HA 5BT9A 3ANNA 3TECE 3OQBA 4HN4B 5G4KB 2FZEA 5AIBA 3ZHOA 2YJ4A 3JASB 3RSZA 3MTBA 2J3KA 4DA9A 4RK7A 4O4JA 4URVR 4DV4B 4UVIA 1E7WA 3TO5A 1ZW6A 5MDHA 3KSRA 5TC4A 4ZHQA 1XZIA 2OP0A 1AS2A 1M2FA 3L0DA 4RZ3A 1TA4A 2X7JA 2GEUA 4HAVA 3W5IA 4UU1A 2ECFA 4RY8A 1CUGA 1B73A 2L2QA 1EFVA 4R2WA 1BYIA 1RYYA 1UBNA 3MS7A 4XYLA 4J0QA 5FTLA 2PUBA 1P1BA 4TV9B 2NT4A 2YWEA 1AN0A 4KR0A 1DINA 2CUNA 3DL4A 1DT3A 2CDAA 1VIAA 1C2TA 5FPPA 2MR5A 4P3YA 2PYZA 4X1YA 4HG2A 4O0LA 3CLSD 2FA9A 1TO6A 1PNOA 2NACA 4RVDA 3TS1A 3WYEA 4BLUA 3GFFA 4H6PA 3TMKA 3CX6A 3ANXA 4RFSB 3O5AA 4MUYA 2H2IA 3V7WA 5BUQA 4CKBB 4V1CA 4CTNA 3GLIA 1JDNA 1PNQA 3D7KA 1ZITA 4MUJA 2P8SA 2PY6A 1DPGA 1E5VA 2BF4A 3N9IA 1XTIA 2WAOA 5DVZA 3ROFA 5I4BA 5LWHA 3IOEA 1Q84A 3UXEA 4Q24A 1CEYA 3WA6A 1H5QA 1T1JA 3K2BA 3R8FA 5JPCA 5DWDA 2P35A 2X0JA 2ZIWB 4CQLB 4BNIA 5GIOE 1SCUB 2VSQA 1KRXA 3I28A 2VDPB 2IVFA 4PBTA 3X1KA 5DX1A 2W6OA 4MGZR 4YQFA 2OMEA 2W8BB 5FLYA 1CZLA 1OAOA 2NO9A 1G7CA 1IC6A 3EZNA 5AI4A 2C04A 4XGNA 5CG2A 4CWAA 3AVOA 4MUFA 2QQEA 1MJGM 1V5WA 5EE5B 4D3ZA 3EFOA 3HBFA 4FKBA 3ZZ1A 3TQOA 3HDTA 2QQGA 3E84A 1CEQA 1OC4A 3IGFA 2Q3JA 3KZCA 3RSHA 4BB5A 4S35A 2AYXA 2XYPA 4DYDA 2JFXA 1UM9B 3ZTWA 2OAEA 1JWBB 1DAGA 1P1KA 2X4DA 1DC7A 1ZMOA 5JAIA 3F7NA 1NSTA 4U7FA 3WRXC 2I2CA 3WRVA 3OPMA 1II9A 4LXGA 4JYAB 3T7CA 2L0XA 4JUIA 2AW5A 4XLTA 3OUUA 1YNSA 2ZT6A 3I05A 3OTOB 2BKEA 3DBVO 2VQFB 3HTXA 4REOA 1NIJA 1ISMA 4KQ9A 4OL9A 2AC2A 4KUGA 1XEWX 4RELA 3SSAA 4EJSC 1EFVB 2OZLB 3TR5A 2JCVA 4B2IA 3ZHYA 4BBJA 4RHCA 3G5TA 5BOVA 1FFGA 4J1SA 1OLSB 4QYTA 2QN3A 4AJHA 3OLWA 1DEOA 5HF8A 1IONA 2QL9A 1DLJA 1O6FA 2D59A 5CM9C 1UQUA 1DS6A 2C84A 2QZ9A 2YJNA 3ZWCA 5C37A 3IP8A 4JC4A 2YN2A 3DVAA 1JMYA 4MROA 5D5QA 3L7IA 3KYCB 3WDLA 4N7JA 4NP6A 2F55A 5IJ0B 3RNLA 1OFGA 5CDHA 1DO0A 2H3HA 3BGOS 4DIFA 4TL8A 4QFCA 2ZWMA 1G8HA 5K6RA 4RVHA 1E58A 4DDTA 2AV6A 1NVFA 2PGXA 1K7SN 3H2IA 4KTTE 3WRWA 1F6WA 1Y1LA 1Z56C 4C04A 2NLOA 1EUDA 3PFFA 4QJ5A 4YRFA 5FOWA 3SP1A 1IOLA 1U0FA 2GD6A 2H7XA 3LT0A 2HCRA 4C03A 1SCUA 2ST1A 1T43A 1QNFA 1OAOC 1S6YA 2AEFA 1P3JA 3C98A 3ENKA 3GEIA 4GNRA 4KWCA 5JDCA 1RLOA 1T10A 4TWZA 4PR3A 2AJLI 4WZAA 2V7VA 4LRTB 4MQEB 3OZ7A 1GOTA 2WF8A 1KC1A 4LXQA 3MYYA 3FWZA 4NATA 4KWIA 4MR9A 4U7PB 2Y71A 1EUZA 5TQ2A 5L7YA 5ERGB 5K8UA 4DR4B 2BKVA 4KJXA 5DWVA 4D9GA 1Z82A 3AU8A 3ZDZB 4CKYA 4JNKA 3R0QA 1KAEA 2INGX 4QKQA 3PNSA 1C1HA 5KQRA 1P80A 2RGNC 3TRDA 3T4UA 1XPUA 4HX2A 3CVWA 1DAMA 1NTRA 2QD1A 1ATIA 2W8ZA 2WYHA 4LXHA 1T8TA 2QTAA 2ZBVA 3J7AC 2XRYA 4MVYA 3DYVA 1WF6A 2W00A 1Y3IA 2DWUA 4K1LA 1NJ2A 3RJMA 4GPZA 1JP7A 2OD9A 3GFSA 3QWBA 4OBEA 5EJ4A 2IZ1A 2W70A 4QDZA 2RH4A 1LVUA 1A2QA 1LS1A 3CX7A 1UIRA 1G3IA 4C07A 3ZWKA 3WSTA 4KN8A 1YJCA 1M6VB 4O4JF 4JI7B 1KRWA 3UT5B 4JQCA 2VDUE 3DLBA 3HJNA 2E4WA 5CA1B 3FVVA 4MVJE 3IPLA 4AY3A 1G59A 2ZOSA 1TKCA 4IJ5A 2W6PA 2Q5CA 5EKSA 4RO0A 3E9MA 1V3VA 1C7FA 3N0RA 4E5DA 4LFBB 2PN1A 3BFJA 1AX9A 2P90A 5J5CA 1CZKA 1C8LA 4IHJA 3IUEA 1XVUA 3IT3A 4W7HA 5FI3A 1EAMA 4RQBA 4WXEA 2JHAA 1W2GA 5KS2A 4IXDA 4KPYA 5KSYA 5E6RA 2JPDA 2EDCA 2FWRA 2PAFA 3LE8A 3ZBTA 3LV8A 1EUDB 3H5VA 4JFAA 4BVEA 3TK1A 2HJSA 3H2SA 1ETHA 3K0AB 3DC7A 3DV0B 1CS0A 3RIGA 1GAWA 3RKUA 5BWCA 4JK3A 5F64A 4ETMA 4U7WA 4GEGA 3HO8A 3MJFA 5ADHA 2XEXA 4ZV4A 2GFIA 3CT6A 4KJZA 1JQ3A 2HDWA 3JYNA 4Y2QA 4D80A 1KI7A 5CFRA 5CIYA 1GKKA 1GQSA 4RFLA 2D1SA 3GRKA 4YK7A 4P2BA 1TQ6A 1JJAA 4XGKA 2MIIA 4A0GA 2DQ4A 3L8DA 3MPUA 5JJLA 5IKEA 3EVCA 2WM3A 4MW5A 4Y30A 1O5TA 4CN8A 5KNBH 4UREA 2R6DA 4JELA 1E1QD 3JAWA 3R7BA 5IBRA 1H65A 1WKBA 2HXYA 2I55A 5BWMA 2I2DA 1CRZA 1T2VA 221PA 3A0UA 3LDHA 3FYCA 1BMTA 1RHMA 3A1NA 2H1LA 4X5OA 3HR8A 5T4FA 1ZMBA 1I2BA 4CMIA 1KI9A 1AGRA 4IUCS 5GGYA 1JDVA 1YD7A 4MV1A 1CUFA 1M1ZA 4OAQA 3QQ5A 4FFWA 2C5SA 5KTSA 4B82A 2HR1A 2V7WA 2ZT5A 3DT8A 3MCTA 3MZ0A 3UT5A 1HX7A 3HJRA 4RSRA 1KFCB 2JFGA 2AQIA 5LQNA 2V98A 1SUCA 5AW7A 1EFTA 3HU3A 3JVIA 2FEWB 3O8QB 4I55F 1T3LA 4RBNA 4WA8A 5B53A 5D86A 1MBZA 2YS6A 3OZFA 3SHFA 5J2TB 2DHDA 2VDKB 2GEBA 4CEIB 2C2BA 1O96B 4RPHA 1HDXA 1YQXA 3FYDA 4KG7A 2YHUA 2ZJ6A 1AXRA 4PEVA 2NPOA 2XIQA 1IOVA 1L5YA 4I5IA 2X7XA 1URPA 4EI7A 3C1UA 2FPRA 4N39A 3KSDO 4RPCA 2R00A 4MSUA 4Q5IA 5K9ZA 5KMGB 1VBFA 4C6HA 3BGSA 4NOLA 3A10A 5EJAA 5ITZA 3DO5A 2P78A 5TV2A 2E4YA 1GCUA 1UKBA 4PZCA 4OHWA 5JZBA 1IBMB 5H83A 1SR8A 2CFRA 4RF3A 2R1VB 4GW3A 5CMLA 3WRXA 2IEZA 3AUXA 3G9ZA 3W9UA 4DAOA 3TL2A 3IDQA 4YV2A 4JB2A 4JGBA 4QJ4A 3GB9A 5EZYB 1W5FA 2VT6A 4UBJA 2JBHA 4CM9D 1WLSA 2HU7A 1TVCA 5IJWA 3RANA 3FMFA 1XKLA 4B73A 1SUPA 1VKNA 3ABOB 4JJGA 2G06A 1NMEA 4GWLA 5LU8A 4C4TA 1QZ3A 1Y1TA 3PDUA 4XM0A 4X3OA 1RLTA 2PZAA 4UXIA 1R1DA 2O3UA 4FR0A 1N9KA 1U8UA 2ZPUA 3P0HA 3OQPA 4ND6A 4PLPA 4Y2VA 5DI3A 5D7BA 3SFVA 4P3PA 4BEWA 5C4MA 3N7UA 4NBSA 4LJKA 4BJ1A 4EMUA 5JWOA 3ACCA 4M98A 1GVHA 4JITA 3AI2A 1G7TA 3TLMA 5K3OA 5KKAA 3DZGA 3IODA 4Y0VA 4CL3A 2WSIA 1N0HA 2CT8A 1KSHA 2BZSA 4PLHA 4KQXA 3WWCA 4NHEA 1L4EA 2RG1A 3MN1A 4CM8A 1C2YA 4G0WA 3SCZA 1E1NA 4X1IB 4MJXA 1AUPA 1KVTA 4ZTUB 2C1XA 2VQ6A 5DXAA 3T1TA 1KJ8A 1N2OA 3FTEA 1F6DA 3UTDA 4NCAA 1EE1A 1KKUA 3AYZB 4ZT7A 2ZSHA 3LDGA 4C3VA 2ZJBA 2ZIEA 1Q16A 1P5ZB 3C5CA 3R6TA 3WV4A 4EL5A 1I01A 2R86A 2VKTA 3GCWA 2AOUB 4RD6A 1JUDA 1XLUA 5D01A 3T1NA 5A5FA 5K4HA 1FJGB 2OC9A 1OI2A 4ND2A 1GEGA 1T1EA 1W19A 1RWWA 1Z8HA 2IEIA 4URFA 1RM0A 4BAGA 2H0AA 2PT9A 3RJ9A 2EKQA 1P73A 3AFGA 3BXZA 1A9ZA 2QN8A 4X1YB 4XUEA 3WQSB 2OR3A 1DJMA 1YBAA 4GRAA 5EZ6B 3ZHSA 1WTCA 1E1DA 4TVKA 4X71A 3RS0A 5GVSA 2FUNB 2OQIA 3CVYA 1OZ0A 2O2GA 3OTQA 4KLCA 1YRLA 4L3VA 1J99A 1KVSA 4W5WA 5DOZA 5BSUA 5FWXB 8AT1A 2PWZA 1WIWA 4O4IA 1R3UA 1WXFA 2QP9X 3HBNA 4G5OA 4U1RA 3I30X 3FWKA 4XIIA 2BKUA 3NNNA 4RVSA 1MVOA 4PC7A 3VPAA 4XTRA 1JIVA 3GLFB 3L7CA 3BGWA 4HLNA 1QP4A 3O9VA 3QWAA 3X3HA 5E7QA 4OI4A 2AN5A 3BBPA 4RWEA 4DB2A 3DHEA 3W4JA 4RZSA 3RF6A 3WSWA 5GZ3A 1S2DA 2AEJA 4PHGA 5ELLA 4BLTA 1UXGA 1RMQA 1SQ0A 3SKVA 2NZJA 4KV7A 1Q7EA 2QAGA 4TPKA 1JEQB 4XQEA 1U7DA 3DONA 3FMIA 2ZJ2A 4AN1A 2VQSA 1U0HC 2UYYA 3GG9A 4JLMA 4ML3A 4Q19A 2Y66A 3WXBA 2H1IA 4XCXA 3WZ2A 1WXQA 3LFUA 3A31A 1T9ZA 1ZCBA 2J48A 3RAEC 4NJEA 4JVOA 4K0RA 3SQNA 5JJCA 1DO8A 2X58A 3IKLA 2VQEB 2FF5A 3I2FA 3GFBA 1AUQA 1MO5A 2I6UA 3IHTA 3SR0A 3HCCA 5CK5A 4AMUA 4ZGWA 3NO4A 4RKRA 3R3SA 4G65A 4B84A 2DG2A 4EJ2A 5JSHA 1U0EA 1AQNA 5HPYB 1TIPA 3PX7A 1SWWA 4B3IA 3QU4A 5ICCA 2W2MA 3N5KA 2W6CX 4ZI2A 2FZ4A 4WT7A 3QEBZ 4UARA 1P2DA 2F9FA 4DDVA 2WMDA 4CLOA 2ABWA 4PZUA 3FNEA 4RZXA 1E62A 1R9JA 3A6JA 3QYAA 3V4SA 4WW0A 2CL5A 6Q21A 1UPUA 4MITA 2IP4A 4BZXA 5EMHA 4EJFA 2PX6A 3GEMA 1WHTA 2ZIFA 2GSWA 3N59A 4D5EA 1C4KA 1RLJA 2BTQA 2JIPA 3AEYA 4QHSA 1PAUA 3IRVA 4HI0E 2GETA 1NRWA 3EDMA 3RJTA 4BKOA 1RIFA 3ELBA 2HJWA 1DQYA 2O8DA 4KMMA 2F8MA 2GD2A 2CXQA 1E8MA 1AD2A 1KQ3A 1ECCA 2C78A 2D1YA 4HAXA 1LLUA 4LYGA 4M76B 3UUWA 5AW2A 3CINA 1NR5A 3QEOA 4HQFA 4H15A 3EH1A 1GPKA 4DR6B 4ME6A 1F3OA 5FA5A 2GZSA 3TZCA 3BIFA 2J31A 4MYDA 5DTQA 2W93A 2YRFA 4AJOA 2OESA 2WLSA 2ZSUA 2AG1A 2MYNA 2PX5A 2AKEA 4OLFA 4LC1A 5FJJA 4Z9YA 2JFHA 1T9HA 1VYVA 1I9CA 1M0WA 2Q8NA 3GX1A 2ZROA 4FLFA 3LXMA 3UAGA 1DEXA 1AQLA 3BE5A 3CUEF 1SXIA 3RRYA 2W5UA 3FNBA 2GX6A 1T9KA 2P2YA 3GP3A 4HWGA 2G7MC 1XZPA 2GJKA 2ZIXA 3I6ZA 3KJXA 2EYQA 1X7YA 3OTHA 4GGOA 4OK3A 3OHPA 5AW1A 1XMSA 2MDTA 4J16C 3U17A 3LFTA 4AAYA 1SGWA 3WGMA 2YZNA 5JAPA 4G4JA 4GFDA 3RQSA 1VRWA 3KYIB 4MYSA 2EX4A 1DZ3A 5REQB 3ICCA 1FDRA 2RGWA 3QOYA 1J5XA 1XCLA 3IB3A 3FFTA 4AO6A 4G0MA 1I3KA 2XA2A 2GEKA 2IXAA 3IV7A 4P98A 4DG8A 2IIBA 1FP6A 4LWOA 4YR7A 4JUBA 1JIXA 2WWTA 3URKA 3G2NA 2ET6A 2VQ3A 3JQ7B 5DYTA 1M1NB 3GFVA 1A8SA 4I9GA 1XRPA 3VC7A 5IX8A 2W37A 5IM4A 5BR8B 2WDPA 1IPEA 3RYIA 1J6UA 2FR1A 3C3BA 1L4YA 2R2AA 4UPDA 2KI5A 5JT1A 2REQA 4NJMB 5FUBA 3DFMA 3AXSA 3LU1A 3RIYA 4BP1A 2NTJA 5AI5A 3L6UA 4P3KA 4JAVC 3O6VA 4U2DA 5K8LA 2PQ2A 1Y5LA 1W0CA 2C57A 3U19A 2BTEA 2TYSB 2V7QA 1O4WA 1Z6YA 2HBYA 5B6IA 1BHO1 3BXEA 3H2BA 2ATVA 4ALNA 3T5GA 2GKSA 1CYEA 2C3MA 1FUEA 1VMAA 4LX0A 3TLXA 2XUZA 4HNRA 4TTTS 5SY4A 2VYCA 2B6NA 4OV6B 3KPVA 1VMKA 2VXCA 4EY4A 1YQTA 5D87A 4GC5A 1TTHA 1Y7PA 2VIIA 1C9EA 2CBXA 3T94A 2P9HA 4O33A 2PUHA 1YRHA 2IUYA 3J81k 4KQ2A 1XZJA 4Y1RA 5F52A 1WUJS 1ZD4A 3RRZA 3KJHA 1JBQA 4HADA 1B42A 3OQJA 1JMKC 1ZC3A 1L4HA 3RE1A 2XAUA 5CD1A 4PRYA 3OX1A 2FZLA 2J7PA 3AZQA 4J16A 1FLDA 1GADO 3WYGA 2BY4A 3G7UA 2QTHA 5MHTA 4CJXA 3KL2A 1MT0A 1RFLA 2X8AA 5B3KA 4MH0R 4V0NA 4ZK2A 5BRJA 1BNCA 5KKNB 2IYOA 3P52A 2A5JA 3AH8A 5GJWC 2JD1A 5L3RA 3T0GA 4IUBS 3TFOA 1HDRA 1QQTA 1YOBA 3BUSA 1WP9A 3Q41A 4I36A 1YA4A 1V5FA 2X22A 2Q3HA 4P33A 3SOZA 4BP8A 4ND1A 3JALA 4UEQA 4U7TB 5FA8A 5CAEB 1Y3DE 4Y6PA 1BAPA 2FW7A 3FPFA 1A88A 4WOKA 1B1CA 1NAIA 4ENTA 3AEKB 3T54A 3QI7A 2IH2A 13PKA 2RCNA 4G5QA 1SBQA 1HOTA 4S2UA 4OB7A 2GILA 2DF8A 3VR1A 2BGMA 4CCYB 1ZAYA 1HDEA 5CTAA 1QG4A 1K97A 3TQFA 4PGMA 2BUAA 1T4CA 2RHCA 2G28A 3OUZA 1XMVA 2Z2YA 3KWJA 4MUXA 4RJIA 1GZUA 2FP4A 2CVFA 4JS0A 1UPTA 2GF9A 5LZ5A 2G67A 3IT1A 4M0MA 4YAUA 2RHHA 1WA5A 3TMAA 2WG2A 2AT1A 1GUBA 1Y8AA 3EGEA 3GV0A 1GGVA 3OJ0A 2XV1A 1U3TA 2QP4A 3NATA 1U8YA 4UXHA 5NULA 1TQ4A 4TZ0A 3IUQA 1KF0A 4LNUA 4MO2A 4DQVA 5BNZA 8OHMA 3KNZA 2B83A 1X94A 3UBTA 1AF4A 1MOPA 4I55A 4EVQA 3UMMA 2X5OA 3AVTA 3BXHA 2II6A 3GI1A 3LIIA 3PD1A 3V97A 3KS9A 3FLBA 1G5TA 4D4IA 1JIJA 5TLSA 1OYWA 4LY0A 3V8RA 5LIRA 5DLQC 1X1RA 4UU0A 3WGYA 1BJTA 4LZAA 1XJWA 3GRUA 4AWXA 3QPAA 3K1YA 1Y9JA 4KFTA 2JH9A 1KH1A 3FHJA 3LBFA 4CG1A 5L4LA 1DX4A 3JWGA 3QVWA 2ZUUA 1EJ0A 4ROTA 4ER6A 3I45A 3COWA 5JS2A 3X43A 1QO7A 2J3HA 4HMPA 1X80A 1ZD1A 3GJ4A 4WWHA 5CLHA 2XKKA 2JGRA 4C78A 4KL8S 5JVDF 4O8CA 1JQBA 2KS6A 1O95A 4M22A 1B16A 2FMFA 5K6AC 3FJOA 2X5KO 4NU6A 1NR1A 5FR1A 2JLRA 2BEJA 5JLAA 2XVZA 3Q7RA 1TVMA 4LY6A 1RHKA 3LD9A 4B44A 1V16B 5KYTA 4B3XA 4FCVA 4Z53A 1R88A 1TMYA 1D4ZA 4TKVA 3G5AA 1T5HX 4TTJA 3X2EA 2V54A 5CBKA 2GD0A 4UTNA 4HNUA 4M89A 3DE6X 2PCJA 3HXTA 4IFTA 3MXTA 5D6OA 3TR0A 4YJ2A 3H8JA 2VZ8A 4ESOA 4AYXA 4MKRA 4KIGA 3WGVA 1PUJA 1WQ4A 4G86A 4J1NA 1IY9A 1QQBA 3CLVA 1Y48E 1Y5RA 1W34A 5BP7A 1EGMB 2IXDA 2ZSBA 4ONEA 3EF0A 4IHJF 4K2HA 2ONKA 5IM5A 2EF0A 2P3OA 3RB8A 3SYTA 2PMFA 4DXAA 1PYOA 3D81A 1XVLA 1XXHA 3HI6A 3SSMA 1YDWA 1ST3A 3EZGA 1YB2A 2ZE5A 1GAXA 1VRCA 2P5SA 4L4ZA 3KSAC 1TAQA 2GKGA 4B6GA 1COWA 4BNJA 3W4IA 3FCYA 3WNZA 4A0SA 1TAHA 2VXOA 3GJ0A 4YROA 1H2XA 3F6EX 5LP6B 1XHLA 3CT4A 4AMZA 4K9RA 1BJKA 1JHAA 2R7AA 5FFFA 1KR2A 5FUXA 5JALA 4QX6A 2I3GA 5D84A 2GEDA 3VPGA 3UAOA 2O0LA 4I1UA 4IXMA 1IWBB 2WTBA 5IM4F 3OPVA 3L6DA 1W581 3DL7A 4LF7B 2BFFB 4D8TA 4EFNA 1PZNA 4PE5B 5HW0A 4EFKA 3M1LA 2XR1A 2CE7A 3W3AA 3L82B 4FFOA 1KO1A 1OGYA 1PZMA 2IE0A 4RQUA 4M1OA 4DCJA 5FTMA 1S2OA 3VI4B 4BO8A 3KDAA 1DBRA 2JJ8A 4BN5A 1Z4QA 4GPIB 3FPKA 1JFLA 1C1YA 1KYIA 2ODAA 1BXGB 3MF4A 5IHPA 2HCFA 3GVIA 1WXEA 1SRRA 3AFHA 4JJ8A 1EVIA 3ZYZA 3FPEA 4F45A 4HGYA 3OIDA 2I3BA 3DFFA 3W06A 1WXIA 4FFPA 4ZO9A 5EKTA 1QX4A 3T5PA 3LC7O 1GRQA 2TS1A 3PPYA 3OPXA 1R74A 2FLKA 4ZDWA 1DTWB 4IIHA 2VTBA 4YQZA 2VHVA 4PHCA 2HIGA 6CHYA 1TTQB 4H7EA 1J0XO 2ORYA 2FFBA 3KOUA 3FNRA 1BEUB 4PO8A 1GTVA 3GAZA 4PCAA 3F5SA 2FNAA 2DFDA 3SIRA 1KAHA 1BEEA 1VGQA 1U2ZA 3L7LA 3C3JA 1KZHA 4DLPA 3B9PA 4MUAA 2GK6A 2ZS7A 1JFSA 5LMZA 2ZTUA 3PE4A 3OFKA 4HWPA 1DMSA 2X0DA 3HFRA 3GPDG 3DQZA 3PDHA 4Q00A 1M8JA 1U8ZA 3OWHA 4ZRMA 3JWHA 2VHQA 5IXJA 4MV6A 2RC6A 1L5HA 2CXSA 1Z7EA 2ISSD 2VK4A 2VYFA 2WD7B 2HLHA 1G6HA 1QIHA 2XECA 1N6PA 4UKDA 4QIHA 4WLUA 3FR7A 4ILEA 4PYMA 5DYNA 4EYKA 3CXUA 1OX5A 1FK8A 1F9EA 3DYBA 4JJEA 5KYWA 1MORA 4BPBA 3H5TA 2XCSB 2HNAA 4B7XA 4AT1A 3DG9A 3HGTA 1ZI9A 1JG3A 3IIKA 1ZONA 4FU0A 3I5UA 5DE3A 2CZGA 1D6MA 1KPGA 3A1VA 3IEUA 4FEYA 5J5VA 4CIDA 1GDTA 2BFFA 5LMNB 3DMGA 1NZDA 3ZE7A 1M1UA 3LXUX 4I1IA 3LOPA 4BZQA 1JDZA 4N47A 4LYFA 4OXRA 5D3MB 5A5VA 1DJQA 2B61A 2OBFA 3GAMA 5B4UA 1IK4A 1D9XA 4S0XA 3NDBB 3E82A 5DK4A 3RWOA 2I6QA 3KZOA 3VU0A 4DA8A 4OHRA 4TL9A 3QWHA 4DR7B 4TXMA 4YRZA 1WCIA 1QCYA 1K0UA 1LEHA 1L5MA 1U0SY 4UUBA 5CFPA 4KRFA 1X38A 3SQOA 1NMSA 1ORHA 3I4FA 3NEPX 4ND7A 2EKBA 3U2QA 2R6HA 3EWAA 4BVGA 3U7RA 4DVJA 5DXJA 3HJCA 3L46A 1P4AA 1FFXA 4ZGBA 4EJSB 5CPBA 4UJ5A 3C5EA 3V4ZA 1ODIA 4PAGA 4EGSA 4S1TA 3EQ9A 3OEED 2QN9A 4D1YA 4I46A 2D1FA 2P9BA 2D8AA 4AG6A 2CFSA 1HPLA 1R6UA 4X6YA 2ODEA 4J0JA 1J22A 1M5UA 3VR4D 1HQDA 3SY8A 5HP4A 3BH7A 2B4YA 3I9OA 3LGAA 3LQQA 1L5HB 2H4YA 4J2HA 3ZE6A 1U2TA 4C0LA 5IT9A 1P74A 3VYTB 4TS9A 4W5OA 2IS4A 2WJVA 1WB4A 4HRXA 3LHDA 4W5JA 5A6SB 4NCHA 1DWUA 1JHRA 2WMOB 2IZZA 5A1TA 3RS8A 1CC1S 1CPYA 4KUHA 3RADC 2RGUA 5DSTA 4QGBA 1P39A 1G63A 1GRNA 2A0YA 5JQGA 3CUWA 3QKRB 1CZHA 5FEUA 1G21A 4JB0A 2Q0SA 4KSCA 4M7WA 2CJXA 2QSUA 1HV8A 4LC9A 1NI3A 1LRJA 1X9IA 5HILA 4CMEC 4HSEA 5BR1A 3BQ9A 3CX4A 4FFSA 3UXHA 4L76A 5DCLA 4HRYA 4O1HA 1U0BB 1L4BA 1JH9A 2O19A 3LP5A 3VM6A 4JHXA 4XB1A 4YJGB 3AR5A 4JLJA 5AWFC 4BMXA 2HTEA 3P2OA 4OLAA 2JA1A 2X9NA 3SBDA 5LLSA 1CP3A 1NU6A 3UK7A 5F4BA 4BVJA 3I5XA 3R0ZA 4C30A 3WE7A 3H18A 4ALIA 4WECA 2YZMA 2WAYA 1XMXA 3RC7A 2NYAA 3IBTA 2BFDA 3JASA 3O84A 1J24A 4MAAA 3WLPA 1HKHA 4FFBA 2RGNA 5IVIA 1VCMA 2ZS9A 3NM6B 3IAFA 3T9CA 1L7PA 4G0VA 1TKRA 3HVUA 2PBFA 2VPIA 2A6PA 3CWCA 2C96A 3ZH9B 4HQ0A 3FCSB 2BTOA 1DDOA 2I33A 2YV5A 4P81A 5EXTA 3LUBA 5TQVA 2Z8YA 2FFAA 1E7YA 1W48A 1JJIA 2BEVA 2BFBB 4LHVA 1BS2A 4IO0A 4KXVA 3DMHA 1GM5A 2BSAA 3IKJA 1FMJA 1QMGA 1CIPA 5BSKA 2ZYGA 3WGTA 1B1AA 1N7JA 1KEWA 1U04A 3ZI4A 2WEKA 4DBZA 1KJWA 1EA7A 3CLUD 1T4CB 2E55A 1RNLA 1YRAA 1TK9A 3KEFA 4MINA 4OI2A 2ORVA 2XE4A 2IITA 5CM2Z 5B37A 3RD5A 1DX9A 2QZJA 4F85A 3QEMB 1A9RA 3OZCA 4XWGA 1OKKD 1XMJA 4AUEA 3UUGA 4KXWA 4B75A 3NWEA 2VPWA 1GPDG 1YONA 1RRMA 1N2EA 3MIZA 3KLNA 3ER6A 3L7OA 3RS7A 1W25A 1VLHA 5ALYA 4RDXA 5H9WA 3NDJA 4YREA 2H0RA 1E2GA 3BDIA 4RM2A 4OJMX 4MB6A 1U9CA 5KAPA 5LDGA 4YCCA 3U1BA 1JPJA 2GZ3A 3M6WA 3X1DA 4C1BA 1UMKA 3HCNA 1GGMA 4JZYA 2A5LA 4JJ6A 5EMKA 4OXQA 2IYPA 4UBKA 5DNUA 1LPSA 4UU7A 2YYSA 5FPYA 2XT6A 4TTPA 2ZZKA 3SLRA 4PVDA 4YBZA 5LZ7A 1N5MA 5LOVB 1QCDA 1U3WA 3P9SA 3C6BA 2AXNA 2YWFA 3OKFA 2BGKA 1H93A 4NYIR 5LXTB 3TNLA 5CA1F 2RHLA 3TTWA 4O4JB 2F9LA 2QLTA 4MKXA 2H29A 3V4RA 1M6YA 2YKGA 4KZKA 3I2YX 1T6NA 3NYRA 3VO2A 3L06A 3HEBA 3PHHA 4IICA 5BOSB 3K2IA 3E35A 2QIPA 3KP1A 4K6KA 5CEFA 1H85A 4F4DA 1E3LA 3U49A 2AFHA 2JLUA 1NPDA 2JCXA 3H2HA 2XZLA 2PXAA 3AUKA 1O03A 1FUYB 2QPLA 3D7LA 2NU7B 2Q5EA 4CEJB 3FSGD 3FHOA 1J8MF 3S2GA 4BU1A 4QGHA 1PT8A 1MV8A 5ALKA 5E4FA 1IY0A 4UE3S 621PA 2DPLA 3HKCA 1VKRA 5T4BA 3TW0A 3DMYA 2EFDB 5FI5A 2WHQA 4DS3A 3M6XA 3BJMA 1HE5A 4N1AA 1VSVA 3HBJA 1GNPA 1D6SA 4MS1A 1R64A 4BWYA 2N3ZA 3SZUA 1JR3E 1CNEA 1QGED 1YQEA 3ODPA 1TGVA 3P32A 5EWJB 4D9KA 2VNHA 5AK0A 4YQEA 4EVRA 1E3SA 2VJBA 2BM8A 1X1QA 5SZHB 4MWEA 4YRTA 4F6RB 5ICSA 2IW1A 4ARCA 5AJTA 2FPWA 1DKOA 2J67A 2KLHA 3AOEC 1PN3A 4MV7A 3RS9A 4TZ6A 2WZCA 2LRHA 4FBMA 4HTFB 1HRDA 3AXTA 4UCWA 4EHHA 4N76A 1CIVA 3GJ8A 3CISA 4PTYA 2J9YB 3EARA 3MJTA 1JLLB 4IPTA 4ITRC 4CQLA 3F7MA 2GTPA 2RSLA 1A2BA 3KT3A 4O2BF 4EBFA 1EMDA 2WU1A 1XA4A 2VXYA 2WT9A 3B78A 3DMNA 4GG1A 2IU4A 1F7VA 1G9TA 4JJFA 3BMOA 4CKCB 4KX3A 3WLSA 2WIGA 3IO3A 1TW3A 4HXFB 3F1KA 5DT2A 3BWXA 3NGXA 4LSWA 4LVNA 4Y6OA 4W6QA 1DC4A 1FLAA 2B0JA 3PNVA 4IJVA 2FYTA 3FIJA 3SK0A 3RWMB 3E5MA 3FWPA 1H8HA 3L8HA 3WMGA 2P5YA 3BE4A 2WAXA 3CZCA 3X1ZA 5K0GA 4MI3A 3T3DA 2NSDA 4P4GA 3HJGA 4R5MA 3DBIA 1UJMA 2CMFA 2ANCA 3DEZA 1WSAA 4H3HB 3SM3A 3IP6A 2ANBA 2QJRA 4FZVA 4JEHA 2YTZA 3CSDA 4CQJA 1QFZA 3HXPA 3W3ZB 1AO0A 2F3SA 2CZQA 3RHTA 3UWKA 4FKZA 4RA9A 2XZOA 1GTG1 3AKZA 3VUEA 2NP7A 3ZNNA 2CZCA 3AG5A 3R9XA 2YIVX 3K53A 3OQHA 2C20A 3CUKA 3C14C 3CW9A 2VH2A 2EJCA 3FPGA 4W9NC 3D4BA 1QP7A 5JBIA 3TLYA 4M37A 2QYHA 3O8OB 4DQDA 4LFCB 1N2CA 2HXSA 3WGLA 3PUJA 3FVRA 4CMEA 4RTPA 3IYLW 3CCCA 3F5QA 3MT9A 2L18A 3O8LA 2AYZA 4U7GA 4PFSA 2DXIA 1T6XA 2JL1A 3UK2A 1ZLYA 4ZC1A 1G98A 4AKTA 3HR4A 2Q3CA 2E3JA 4XSHA 2D4HA 4RL6A 2FEPA 1I7QB 3A4MA 3NTVA 1YJQA 3SXUA 3GRRA 2QRNA 1SBYA 1UBGA 2CLOB 2FV8A 4IS3A 5DBEX 5JEDA 1ID1A 1TEHA 3TXAA 2R84A 1UEXC 2WWGA 5DN6D 3ILXA 1SXPA 2QTBA 4CMGA 3IB6A 1KZGB 4Q1AA 1YZKA 2ZE6A 2O7QA 3FGZA 1MW9X 1T13A 2QL6A 1ONSA 3JRWA 5FR2A 3VHXB 3K71B 4JV5B 2Z1NA 1FMLA 5KYWB 3O8CA 1EWRA 4K03A 4HC4A 1A71A 3LT1A 2ZWAA 1FVFA 3MERA 3P2EA 2GZ1A 4GRDA 4PZLA 3LCCA 1IEQA 5E9WA 2ZUSA 3N2GA 3HWSA 5IARA 1QZZA 1A9SA 2PQ6A 2TSYB 5LYJA 4UNRA 4PAWA 1Y37A 3C15C 1XZHA 4Q12A 6YASA 1YZGA 4C0XA 2N9UA 3AF0A 3LHKA 2GXAA 2QGNA 4QVKA 1KOJA 2AHRA 3EVFA 3DLIA 2IT1A 2PAAA 2WU8A 5SYMA 4F3NA 1SKYE 1FP4A 1YDFA 3SC3A 4DLWA 1SHJA 3ZDXB 2XNCA 3ETNA 3Q8LA 1NN3A 1WZUA 1LA2A 1OREA 2YQZA 2VRNA 2ZJ4A 4O2BA 4DBVO 2P62A 2ECQA 3GT0A 3W7AA 2PS3A 4KFUA 4BB6A 2HHCA 3EOZA 4X20A 5EVJA 3ZW7A 1QTRA 1FTNA 1UAGA 1P1CA 1VC2A 3TEFA 4JOCA 4YMHA 1I4OA 1JVNA 1SBTA 5FL7D 1B8PA 4BLWA 1IUOA 1E3EA 2OUKA 2XQKA 2NXCA 1K63A 3MTEA 4JROA 4Q47A 4CCAA 1YCHA 1U8AA 4RGBA 3ZGYA 5ALJA 3MCWA 4C4OA 1I6MA 1GKYA 1UKEA 4YJ3B 1R8SA 1NBEA 4DXHA 2C31A 4JD5A 5BRNA 3P2JA 3B3QA 2Y1CA 2E0IA 2Q49A 1HLDA 1M83A 1XHEA 1Q20A 2IVZA 2XOKD 1FYXA 2XQIA 3NB0A 5BSRA 4A73A 1JRLA 2ISQA 2JFZA 5KX5F 1H1TA 4ZP1A 3FOAA 3E58A 3MB8A 1L3BA 1WBBA 1RJGA 4YRQA 3I83A 3OBBA 3ORRA 1KERA 5ILGA 3VKFA 1YS2X 1NN0A 1G0NA 3OTWA 3ZR4B 5AKGA 4CL2A 3ZTYA 3EVBA 2MYPA 3RSCA 1JG1A 1Q7CA 3B3FA 3ZJTA 1MDFA 1RWKA 4FK8A 3ZX5A 2JEZA 2P2SA 1IJKA 4HH3C 2VATA 2IU0A 5TQ0A 2QRQA 2DB3A 5ALWA 1AVTA 1YL6A 4FQ5A 4OHFA 2JARA 5H80A 4H77A 1V3UA 3WL8A 1EFAA 4AWBA 4HSGA 1ZI8A 4BB0A 4C7OB 2XGOA 1Z5GA 4IS2A 4LJLA 3N87A 3HCEA 4TVBA 1GA1A 3K7EA 5ESWA 5FLXA 2Q62A 4FOOA 1RQGA 2R6GA 1IAQA 3O4JA 4D4KA 2PL3A 4IXWA 2JFPA 5B55A 5HJ5A 1R16A 2ZSKA 1FSZA 1GKLA 3HB9A 1KNQA 4WOPA 2O2IA 4PPYA 4QBIA 5DTMA 3ZOKA 3WDMA 3LUDA 1MMFB 1UEJA 4G41A 5JCPA 3UJBA 3EEYA 3OX3A 1YCGA 1KJZA 2P79A 1L4GA 2Q46A 1KOFA 3AKYA 2G5GX 2PL1A 4D25A 3IPYA 1G2PA 5BUZA 2ZYVX 3G23A 2ZQYA 1A9XA 2W4QA 3SPXA 3A6LA 2BMVA 1QKJA 3NI2A 4R16A 3HN6A 3QA3E 4UM9B 2IKQA 1SD2A 1TL7C 2H2HA 3ETHA 4MIYA 5DDIP 4B7AA 1S0UA 2X4IA 3CONA 4K9KA 3F71A 4P4SB 3FYTA 1XI2A 1SNYA 4RKQA 3GFTA 2P9YA 1CS4C 1XLVA 1ACJA 3NNDA 3ZHRA 1M2OB 1UBRS 5I7VA 4YONB 1QE3A 1RRGA 2CUTA 1UBCA 3A8TA 3LJKA 1BFUA 3PDCA 4RIFA 4X85A 3RKRA 2O1XA 4GYKA 4UTZA 5EZ5A 4J3NA 1VFPA 5KOHB 5ILOA 4MAMA 1Q74A 2QGFA 4B2PA 4L8GA 5ARBA 1BCRA 1O6CA 5JG7A 3WLHA 3D6NB 3T9FA 1X8KA 1USGA 2PIAA 2RH8A 2HF2A 3FOBA 3L3BA 3N6RA 2UVQA 2CLLB 1CE8A 4NMMA 4H7JA 4C20A 1SO8A 2BBWA 5FTWA 4CKWB 3ORQA 1E2FA 1PWEA 3ESBA 3GGDA 2IGBA 1OBHA 2ZB8A 3QVSA 2JHFA 1KTVA 4EO9A 5KU1A 2P91A 1T24A 1MC8A 2RK3A 3DDHA 5COBA 5BN3A 5EOVA 1O95D 3OFNA 1ZKMA 3VU9A 2B94A 1UP4A 1N0WA 1Z5WA 3E2MA 3A2KA 2ZJFA 1I2MA 2OCBA 2V6GA 3P20A 4Q9NA 4YJHB 2H4JA 3SEAA 2H8GA 2XVMA 3CF6R 4Z1MD 1HL3A 4D0LB 3A6FA 3OA2A 1UDXA 2IOYA 1JT9A 1SCJA 2QQFA 2VJCA 3FWNA 2WE7A 3QBDA 4ZAFA 3QX8A 4YDQA 3L0CA 4EHAA 1NLUA 4CGYA 2P4HX 3Q98A 4JHLA 1U2DC 2N0SA 3KT6A 4MJ7A 1C0LA 2C2WA 3DMRA 3B6JA 4ZT4A 5JY6A 5AI8A 4FHGA 4OL0A 4URZR 2G3YA 3GRYA 1VCNA 4Q9DA 3EXAA 3HKBA 1F38A 2I6TA 2X5XA 4U3JB 5JFOA 4OB8A 2R87A 3V8QA 2FLWA 3UHAA 1PJ3A 5EHZA 4BS9A 3QQPA 4XVQA 4X8MA 2IHNA 3Q9NA 2O0KA 1M5RA 2OQRA 3KOZA 4MP8A 1EG7A 3OZUA 2CNLA 5CIQA 5F12A 4D3DA 4MLZA 4K9MA 2O3QA 3GNLA 3UJ7A 4IDGA 1VLJA 2O2CA 4COOA 4IDFA 3OLXA 3QVMA 4NOJA 3VGPA 2AKAB 4A6EA 5AVSA 4QHTA 3P4XA 3AEUB 3ACBA 5DGCA 1IM5A 3CRQA 1JU3A 2IX9A 2COUA 3T7RA 2B78A 1TNDA 3KJNA 2ZCUA 1SEVA 3O03A 3D54D 1QF6A 1J8DA 4I3HA 4C5CA 2WVHA 3KCNA 3OIGA 2O8DB 1GGHA 1RWNA 2PUTA 3GJTA 4C1NA 4DM7A 2PMWB 2HK6A 3CNEA 5D2CA 3ZV5A 4ZCMA 1PL0A 4Z9BA 3RLIA 1AB5A 3G13A 4EUHA 1N6IA 4JP3A 5KREA 1MVLA 3AQ4A 1FTSA 4JBLA 1T36B 1NYLA 5EJ5A 5H3HA 4ZVLA 2Z98A 5IEBA 2ODQA 4DEYA 2PS1A 5AKIA 2MSWA 3RRBA 3F6YA 3IJPA 4K3VA 2Z2IA 3D2LA 1NC1A 1STOA 3GRCA 2PSEA 5AVYA 1ZRHA 2F6RA 2HLPA 3O92A 1AS3A 1HC7A 1N0VC 4BV3A 2BOVA 1XRSB 1LRLA 3EXEB 1VJCA 3NHSA 1T3TA 2L17A 2WHYA 4FDMA 3UJHA 1T6YA 2Y1KA 3WY9A 1J7KA 1A5AB 4YUAA 1QQ5A 5HEKA 4OXXA 2Q3MA 1IMJA 3A6ZA 4C2BA 3WGOA 2KB0A 4RF2A 2HQOA 3ZWBA 2M98A 3AIOA 4LWZA 2OGTA 1T8YA 3A6EA 2X3FA 3HRHA 3B1KA 2H54A 2XT0A 4M9QA 4P5EA 1Y5NA 5H02A 1P61B 2OZVA 3AP2A 3E9NA 4W5NA 3QOXA 3RSFA 4BDTA 5KI6A 3G2HA 2AB0A 2OZPA 4MUMA 1Q3KA 3QTLA 3JQ8A 5GM2A 2ZTHA 4YAEA 1JLHA 1XMOB 3JQCA 4RHEA 4RMIA 3GBPA 1CJMA 3FDJA 3BD6A 4N7BA 1D1QA 4IIFA 4ALMA 2QUKA 2FRDA 2XSZD 4N54A 3FD8A 4BO9A 2A8YA 3CE9A 5K8VA 3VJRA 5B7GA 3AVYA 2CJYA 1W8DA 1K92A 2DBYA 2QA5A 5ICGA 1LDGA 4AO7A 3KKKA 3A25A 4PRLA 1DG3A 3FSRA 3H86A 3IBYA 3LYUA 2C00A 3QRWA 1P9NA 4GQBA 4UMFA 3CF2A 3USZA 1K89A 2FWMX 3KFXA 1AOXA 3VNQA 1P7PA 1EX7A 3DLAA 1BDHA 2QE6A 4IMIB 2I76A 1K4KA 4YDSA 1PJ8A 1ADJA 3BH0A 1A04A 1Q2UA 2B1RA 4P38A 4QDXA 4YRJA 4G8DA 2HEGA 3LT4A 1R9NA 2R1VA 3S8MA 1V11A 2CD7A 2H1CA 3I72A 1BS9A 1H2ZA 2PLAA 5F3DA 1NSYA 1U6KA 1GFWA 3D7NA 3DFZA 2B30A 5CDSA 1OW3B 5CB4F 3C1AA 3I0MA 4INZA 1C30B 4OQMA 5HBGA 3V8VA 2IUUA 1ZX1A 5AKXA 5EP1A 1DC6A 1XWFA 1HOXA 2ZAOA 1C9DB 3FPCA 1KIFA 3OHSX 3PQ2A 4L02A 5LB2A 4MIEA 1RXVA 2CHEA 2PFSA 2NTVA 4J7AA 2XA9A 2I3DA 3F9CA 3IRUA 4OKSA 1GV0A 1GL7A 2E49A 1BW9A 3KTDA 4W99A 3WTCA 1C50A 2WTAA 3IE0A 4QRIA 5EJ2A 2YJ6A 2IPXA 1AUXA 1KARA 3ERCA 1W29A 1WD7A 5EI5A 7AT1A 1T8RA 4AFNA 1XAGA 3PQ5A 1BWRA 4X90A 3WVNA 4RK4A 4M83A 3RK0A 4DRXA 4M8SA 1HT2E 2EHJA 3O95A 5JYEA 5ALNA 1RQPA 3WQHA 2DQZA 3QE9Y 3I5MA 1Y89A 4EHIA 1E2IA 1N1DA 5KTOA 1E1CA 1W85B 1Z7YA 3BRQA 2PGAA 1BN6A 3DMTA 2WA2A 3GA7A 2AOUA 5B36A 3OU2A 1WAMA 2B2XA 4K05A 2YN4A 1VLZA 1ZCFA 3UG6A 5A3RA 4YRAA 2DTEA 3R4VA 1O94A 2EG5A 2QV7A 4NMXB 2O8BA 3PUVA 2E2WA 1LLDA 2G4CA 3GLSA 2WJYA 2QG4A 1S89A 4S04A 5H4HA 1RRKA 3ND7A 4H6WA 2IZ7A 1ODSA 3EBPA 3BWMA 4Z7NB 5K09A 3NTUA 1U2DA 4LHYA 1GGEA 1AKWA 3SVLA 2NUPB 4D9FA 5CT5A 4P3NA 1UBLS 3OU7A 1JR3D 4FHZA 3L0BA 1L8OA 4ALJA 4R6WA 5MFPA 5T57A 4KK3A 5HCNA 4RGQA 4ZKEA 4ZMRA 3C8UA 1TO1E 1NRJB 5T3YA 2FZCA 3K5HA 1CERA 4JBGA 2A86A 5DFAA 4B32A 3N6VA 1OH6A 1E96A 4XJSA 2Y8EA 2OBXA 4PFKA 2EGGA 5G4LA 4Z2AA 3O31A 3I0NA 5IU6A 5LQMA 4C3ZA 1QE5A 1JVSA 3BZUA 1ZISA 4RVCA 5DI3B 1O95C 2YJ5A 3GROA 1K2WA 1Z36A 4NENB 1TIBA 4OU4A 3MJSA 5JAOA 2ZJ7A 1IQPA 4K9NA 1SZDA 3EPRA 2EJWA 3ONVA 3QIVA 1MB9A 2ZTVA 4XI9A 4NJOA 1AB6A 3R6LA 1ODFA 2GS9A 2QTFA 1E2DA 2QMEA 3E48A 2GN4A 3VBCA 4OQDA 2HGZA 2H63A 3CLUC 3QBVA 3NEYA 3ZTTA 3U56A 1RHUA 2FMTA 2HSGA 1EK6A 1I6LA 1Y0BA 2E6UX 3D6VA 3OF3A 1ESZA 1NF2A 3KPYA 3OWOA 4LDZA 2CK3A 3MGAA 4R8RA 3FOCA 3D43A 1TZBA 1ND6A 3H9QA 4KXFB 3K2EA 3AU9A 5I7RA 5E2IA 4ZVUA 3T3IA 4LZLA 3FHCB 4HFNA 3VJMA 4HDKA 3ZI7A 4GWGA 5CA1A 3U4QB 3T3NA 1H4TA 3OKAA 1MOQA 4AP6A 4CDRA 3FFBA 5I5GA 4JQZA 2QN2A 2C5HA 3IKTA 3HBLA 1M2EA 2C7OA 2FPIA 3E3AA 4XZ3A 2QT0A 3INNA 1R8JA 2QX4A 2ZZMA 1OAAA 1L5OA 2H2FA 1XJQA 2LDXA 5BPFA 4TV9F 1CUBA 1KOGA 2FEOA 3NTRA 3W79A 4GLJA 2NUPA 3PQDA 4J3FA 2BVNA 4COKA 2XBMA 2O2EA 2ZI7A 3PGVA 3RYTC 4ZALA 2NU8A 1R6XA 1UFOA 3MWEA 5HM8A 1PL8A 3KFLA 4MW6A 4I8IA 1TDJA 2HMTA 1UK8A 3JQAB 3TSCA 2FB9A 3VHLB 1THMA 2C2KA 2JLQA 4OHBA 3SMVA 2G9UA 4QG7A 1YS9A 4FS8A 3QXGA 1X9HA 2FCAA 3CR3C 3TOCA 1XVIA 1Z0UA 2F1IA 3KDPA 4PZDA 4XWAA 1EU1A 3EPLA 2NTNA 1G41A 1YMVA 3A70A 3QF4A 2OG2A 3GCZA 4DIDA 4II2A 4LF5B 3V3TA 4AM8A 3BG5A 4L0QA 4IJWA 3CEJA 4OYRA 3RBVA 4UBMA 3PX2A 4GPD1 2YUTA 2YZ2A 4LJ4A 5K05A 1F7UA 1G9XA 4GXQA 3EDCA 4BAUA 3RH0A 3DAPA 4BKUA 3ZWXA 4MS3A 1WKCA 1ZD5A 2PUGA 4PLVA 1GPLA 2ZBQA 2H2WA 2ZYUX 1SVMA 4GP7A 4TKUA 4X91A 2NX2A 5L3ZA 4EX6A 3FKSD 3QYPA 1O8BA 1SAYA 3BOSA 3Q5DA 1LGYA 2XQFA 3ABRB 3QKSB 4HDNB 2VHZA 4D43A 1QHHA 4U5XA 2ETVA 3BA6A 4RFVA 5AXCA 1HDIA 4EHFA 2CMDA 2I91A 4BIMA 1G42A 2IYQA 2P3LA 3UGTA 3BTOA 3Q2OA 1UJBA 1D2EA 1M2JA 4UULA 3VZBA 2VHJA 1O96A 3JQRA 1ZNZA 4WI1A 1U8CB 3QHAA 5BMVF 5KIAA 2J3QA 1VFNA 1LW6E 2CMGA 3JQEA 5JW6A 3FPBA 5KNDH 2VPYA 1G17A 1VPTA 5IN4A 1KNXA 2BR4A 3RM3A 3BKXA 1MOZA 1TCBA 1RBQA 3R5KA 2XMRA 5FDFA 4J6EA 2BDUA 3QH4A 3QW2A 1XCOA 4I5DA 4MRAA 5F1OA 3V8PA 4XWKA 1TFRA 3DSRA 1ISGA 2FY8A 2WAAA 3O4FA 4LBYA 1NVEA 3L7BA 4W7IA 4ZEVA 3RU7A 1EWYA 4D99A 4E1BA 3CZ5A