1URQA

Crystal structure of neuronal q-snares in complex with r-snare motif of tomosyn
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
58
structure length
58
Chain Sequence
b'GIEGVKGAASGVVGELARARLALDERGQKLSDLEERTAAMMSSADSFSKHAHEMMLKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords M-TOMOSYN ISOFORM
publication title Structural Basis for the Inhibitory Role of Tomosyn in Exocytosis
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 28
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2003-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1urqA00
3RK3D 5CCGA 1N7SC 1JTHB 1URQA 5KJ7A 5CCHA 2NPSA 2XDJA 1N7SB 3HTKB 5CCGD 3B5NA 2PP6A 2YMYA 1URQD 3P8CE 5KJ7D 3RL0D 2N1TA 5CCHD 1SFCA 2WZ7A 3RK3B 1KILA 5CCGC 3B5ND 4W7YA 2HG5D 4W7ZA 3RL0C 2N1TD 1SFCD 1KILD 1URQB 3RL0B 2KOGA 3RK3C 2H8PD 3HD7A 1GL2A 3B5NB 1L4AA 1XTGB 1T3JA 3M0DC 2N1TB 2NPSD 3KYQA 1SFCB 3HD7D 1KILB 1GL2D 1URQC 3TSIA 5KJ7C 5CCHC 2NPSC 3RK2D 3B5NC 4N78E 2N1TC 2NPSB 1SFCC 3HD7B 1KILC 1GL2B 4WY4A 3RK2C 4JF7A 1JTHA 2M8RA 3RK2B 4WY4D 1L4AD 2HFED 1N7SA 3HD7C 1NHLA 3PP5A 1GL2C 4WY4C 4W80A 1L4AC 1N7SD 4LGDE 1HVVA 4OH8B 4WY4B 3VOPA 1L4AB
chains in the Genus database with same CATH superfamily
1Y8AA 3VN0A 5H2FE 1SQBE 2P67A 2GUSA 2KXPB 5B66E 1MUUA 4LLHA 1PV3A 2KZJA 2YMYA 2AXTH 3D71A 3RL0D 3A5TA 2P1JA 4HB1A 3CCQP 1FZCB 1G1IA 2WZ7A 3SWKA 1DH3A 1P84E 5APTA 1M57D 4W7ZA 5KLVK 2WPRA 3CPWO 2K37A 2YXRB 1URQB 4B86A 5KAIE 1FJKA 3HD7A 5TISE 3H25A 2K9JA 2FYUK 1N73A 3EFFK 3OW2O 2KS1B 1VQ7P 1PP9J 2KLUA 3TF5A 1KC8Q 1LTSC 3WU2H 1ZW0A 4C7RA 2P10A 3MHVA 1SQXD 2UWJE 3D6ZA 1NTZD 2IBZG 3CC4P 3D6YA 3L74G 4WBAA 2K1AA 2ZVNB 2RN0A 3HD7C 3H1JD 1FDMA 2QJYC 1DD3A 1N73C 3CX5I 2ZYAA 1OVUA 2JO1A 1HWTC 1NU1K 2IZ0A 3A7OA 3RK3E 2XU6A 3HE5B 4PV1D 1SQXJ 3CCVP 3P8CE 1NTZJ 1Q82Q 1EDJA 3GF3A 3EQ2A 2QM7A 3L71D 3L70E 5CCGC 4TT3H 3A3YB 3AE9C 1KILD 2V4HA 3NMDA 2WPSA 1T2KD 3CXHH 3CLQA 3IF4A 3RK3C 3MD0A 1X22A 3H1JJ 4OWFA 5AVUB 3ABVC 3I56P 2E74C 2QEXP 1Q86Q 1SFCB 1PGJA 1J1DC 5AVTB 1ZV8A 1SQXG 4UB8E 3PLNA 2D2CD 4H13C 1NU1D 5AVXB 1RH5B 3V6IA 1FU1A 2OYHB 1Y47A 1HF9A 1EDIA 3EFGA 1MFTA 2R32A 2WSEJ 1SQQD 2GUVA 1FDIA 1LTJB 3HE4A 3TYYA 4WY4A 4ZNCA 3L71J 2QA4P 1L0ND 3AEBC 2QG4A 5DJTB 2HFED 2O01J 1KFNA 3G71P 3B4SA 3SSUA 3CWBD 3MUDA 1NKNA 1HGVA 1FZCA 1HVVA 3WUTA 1CZQA 3IN6A 2Y9ZA 1JO5A 2BASA 4DZOA 4WWIA 2Z5HA 5BU5A 1R8EA 1LNQA 1NVOA 1URQA 1NU1J 2B9BA 2CPBA 1EZVD 1JMMA 1NTMD 2P7JA 2H7HA 3RGUA 3GLMA 4D6TG 2W6JH 1KB9E 1SQQJ 2KS1A 1S5LX 2P2UA 5AVVB 3B5ND 1L0NJ 2G8YA 3MUDC 4DJGA 3CWBJ 1U7JA 3CXHI 2Q9IA 3GG2A 2YIUC 1L4AA 5H2FH 2N1TB 1RHZB 3L35A 1NU1G 3S4RA 5B66H 3LW5H 1URQC 4GT1A 5M1BA 1ZMEC 1SQQG 1NTMJ 1SQPK 3HTKA 1P84H 1MV8A 4N78E 4N3YB 5AVZB 2W6BA 1HJ0A 4YTPC 1RQVA 2JKVA 2JP3A 1MFZA 1L0NG 1GL2B 1JUNA 4U3FD 1IZNB 1R5SA 3G9RA 5KAIH 1YJ9P 3HE5A 1X79B 5TISH 2KYVA 3CWBG 1YTZI 1EXIA 4C46A 2QVAA 2JJLA 1L2PA 1JY2P 5APXA 3L37A 1KYOD 1YI2P 1L4AC 5KKZB 1IO4A 1VPCA 2H89C 2IDBA 2YKQA 1EZVG 1NTMG 1BGYD 3HRNA 2K3RA 3FXEA 3S9OA 5AVYB 1S72P 1NO4A 1VQ4P 3H1LE 1OWAA 1L0LD 3IR9A 3USSA 3N4XA 1YJWP 1SFCA 2WVRA 2C9LY 4U3FJ 1NKZB 4BWNA 2WTYA 1CI6B 2OYHA 4YXWH 2Y0CA 3BASA 1BDCA 2H8PD 1LTJA 1S5LE 4JYBA 1FS0E 1BGYJ 1J2JB 1W2BO 4RKUJ 2J58A 2C9NY 3L74E 3IFMA 1L0LJ 1NTKD 1P84I 1VQPP 2Q6QA 4U3FG 1SFCC 3FX0A 1UIXA 3Q5PA 2OYHC 1HJBA 1IFJA 3V2NA 3BRTB 1LTJC 4JBZA 4M3LA 4DT0A 1JY2O 3R4YA 4UB8H 5APVA 1AV1A 4EI2A 1L0LG 3CCLP 1IFPA 2KK7A 3MP7B 4H44D 1GU5A 1E79H 1QVGO 1NTKJ 4YPCA 3AE6C 2CPSA 3S1KA 2N1TA 5CCHD 1OFCX 4EYYQ 1BCCD 1OW8A 1QX8A 4ASVA 3L75G 3RL0C 2KI7B 1BE3D 3G4SP 2R44A 1N8RQ 2JDIH 4IFMA 5AW8B 5CBNA 2KOGA 5B5EE 3MGNA 2V7QH 3KZIE 1GL2A 1VQKP 1QL1A 4YXDC 1QGKB 1SS1A 4RO0A 3CX5D 1KB9H 1H0TB 1NTKG 2E74B 1TU3F 4PD4E 2Q5UA 4IFFA 4DOJA 1J1DB 2JWDA 3G3ZA 1EXJA 4H13B 4ZMDA 2N1TC 2ZT9D 1GK6A 3PHLA 2KNCB 3AE7C 1BCCJ 2FYUE 3L73D 3ITKA 3KHUA 3VTPC 3ZDMA 1XTCC 2IZ1A 4AYCA 1BE3J 4H0LB 5AW3B 2OTKE 1OVVA 4IL6E 1GL2C 2I1JA 3C9IA 4NPDA 1CSBA 1YBKA 4D6TE 3SWFA 3V5BA 1ZRTD 1CI6A 2RH0A 4GODA 4DCKA 3O6QB 1JNMA 1BCCG 1W5CE 5KJ7D 2W8ZA 2QE7H 3A0BE 3R2PA 1JY3P 3L73J 3AE5C 1RQUA 2Q1KA 1NU1E 1PZQA 1S2EA 1SQXK 2K9YA 2FXPA 1A02F 3AE8C 2CK3H 3KXDA 1YJNP 1IK9A 1NTZK 1SQQE 1K9MQ 1X0TA 3M0DC 1T2KC 4QMAA 2WPQA 1IJDB 2YIUB 3TSIA 5AW9B 1KB9I 4HJGH 1VQ6P 3V2QA 2E76D 1LTBC 3H1HD 3RK2D 4LC1A 3CWBE 5AVWB 2WQYC 3BCCD 3Q2YA 3H1KE 2KZIA 5GTHE 2E75D 1OZHA 4JF7A 1LP1B 1S5LH 1M8OB 1Q90D 3HUSA 3AEDC 1NTME 3AEFC 1NJIQ 4Z1MH 1M56D 2OTJP 3AECC 1NHLA 1N7SD 1MZ9A 3H6PA 3CXHD 3U59A 2HODB 1L4AB 2WSFH 1RY3A 5CCGA 5KAFE 2FYNC 2ZAEB 3H1HJ 3VYIA 3HTKB 2PP6A 3BCCJ 2MKVA 1PP9G 3RBXA 1H0TA 2B89A 2IPPA 1YTZT 3HUSC 1DX7A 3MZWB 2FBWC 2IFNA 4ZKUA 4RJTA 1SQQK 4JQ0D 1KD1Q 5EFWB 2KNCA 5AW5B 1QL2A 3F89A 2W90A 4U3FE 4EOTA 5BVZA 1G2CB 1L0NK 5APYA 1K73Q 2E5TA 3L36A 2FFDA 2R5BA 2YXQB 1KN7A 4GKGA 2YKOA 1VF5B 4JYCA 5AW0B 1FAVA 1EDKA 5B5EH 3CCSP 3KZIH 1NTMK 1YYCA 3O6QA 1L0LE 2PGDA 1NTZG 1SQPE 2IFMA 4IFDK 2QJPB 2O01N 3A0HE 2M5AB 5CHXA 1LGHB 3W68A 1Y9BA 4N6JA 4PD4H 3V2RA 3VP9A 2KSJA 4OH8B 4H0LC 1FBMA 1OMIA 5APQA 1JTHB 2FFDC 1PGOA 3KQGA 1GK4A 3H1JG 1VQLP 1UIIA 3L75E 3CD6P 3D70A 3VMZA 3GF7A 3CI9A 1SQVD 1P84D 2J59M 1ZR4A 4PJ0E 4IL6H 4W7YA 2R3SA 2HG5D 1FZFA 2C0WA 2WT7B 1PPJD 4L73A 4WVZA 4I2LC 3Q3DA 5APSA 2JEEA 3RL0B 4OVNF 1LT9B 3L71G 1N86A 1JY3N 2O01H 1LP1A 1FZBA 1NH4A 2NPSD 3HD7D 1EDLA 4K35A 1PIXA 1S9KE 1VQNP 1SQBJ 2KP8A 1U7MA 3VMXA 3A0BH 2O1JA 2BCCE 1GDTA 2HODA 1SQVJ 4MN4C 2KB7P 3FXDA 1M7LA 3V2PA 1FZGA 1L0LK 3WUUA 1H8AA 3H1ID 3E7KA 1IK7A 3QWOC 3PTZA 4EIJA 2I1KA 4HKZH 1BCCE 3TDKA 4PD4I 3RK3D 1WMKA 1MKMA 4KHXA 5GTHH 2H43A 1OX3A 2WSCJ 1SQVG 3P8CD 1U57A 3FWLA 1G2CA 4H44C 2WITA 3JCUE 3L70D 1PPJG 3CCEP 4PV1B 4GOFA 2I8DA 3NXSA 3H1IJ 1NTKK 1JEKA 1IFIA 3GHGB 3P8MC 5KAFH 1N7LA 1XTGB 1T3JA 2KSEA 3KYQA 1KILB 3OJAB 2HLOA 1M1JA 2RKLA 3JC22 3TNUB 2M5AA 3PRJA 1FZAA 5AW6B 5BU8B 2QSIA 3M0AA 3WMM0 2OARA 3L70J 2XV5A 1ZRTE 2W27A 2D2CB 4EDFA 1GMJA 3H1IG 4A7PA 1JTHA 2IBZE 1AVOA 2ZT9C 4XE5B 4WY4D 1DEBA 1FOSE 1VF5C 3TGUD 1VQ8P 1OW6A 4TLFA 3TK1A 1JB0J 2ITAA 1D7MA 2WT7A 1PP9E 1LJ2A 2A45H 5AW1B 1M1JC 1KMIZ 3LIEA 3PJSK 2QJPC 1YQ4C 1LT9A 1KB9D 3GMAA 3L70G 2FYNB 2JR8A 2NRGA 1URQD 2HPCB 5AW7B 1JCDA 1BGYG 3AEGC 1LT1A 3A0HH 1YHQP 1S4XA 4JPZB 1H88A 1VDFA 3HUSB 3TGUJ 1ZXGA 3B5NB 3NTNA 1FZEA 1KQLA 2QRXA 1JMBA 3M9HA 2V7QJ 5AW2B 2KIKA 2AEJA 3MTUE 2IX7C 5AVRB 1LT9C 2AEFA 2YKPA 4PJ0H 1SQXE 1RF1C 3F5HA 2ZYDA 1NTZE 4R4LA 2YO3A 3RK2C 3I55P 1R5LA 1W2EA 2HR3A 1ZR2A 2WPVB 3C1LA 3TGUG 4XA4A 3UIAA 2SPZA 1RE3A 3H1JE 3AE3C 2XNDH 1RF0A 2Y0DA 1NAYA 3Q5RA 1N7SC 3CCUP 2A45I 2LXBA 3H1LD 1YIJP 1EC5A 3GHGA 3BVHA 2QIWA 2XNXA 1CW5A 2PFXA 2FFDB 1WRGA 4O9BA 1KILA 3RBZA 3L71E 2M3EA 3AEEC 3M0DA 2PRRA 3TNUA 1SFCD 1M90Q 5KTBA 1KILE 1OW7A 2PAJA 1RE3C 1RF0C 4PV1C 4Y99C 3K5BA 4L74A 1BE3G 2M0BA 2ZYGA 2RMZA 3L74D 3H1LJ 1Q2NA 3GHGC 3JCUH 2MJZA 4NPFX 3OA7A 1K05A 1KILC 3L4FA 3H32B 2ZXEB 3T97B 3SFEC 1L0NE 2J5UA 1FOSF 1QLED 3LIDA 3I5CA 1A02J 4WB4A 2Q3IA 2HPCA 2D2CC 4C7NB 3L73G 1SQVE 3H1LG 2Q3EA 2W83C 2WSSH 3L74J 1BSHA 1PPJE 4GDOA 2GM4A 1EZVE 2WSFJ 2NPSA 3E1IA 1OVRA 3B5NA 1AVYA 2ZVOB 2R3CA 1ZOYC 1NOHA 1T8ZA 2G3AA 3RL0g 2KLVA 3CCJP 3O8ZA 4H44B 3U1AA 2N1TD 2GA1A 5KLIC 2WWWA 5CBOA 4KT0J 3NFQA 1AQ5A 1VQMP 3W67A 2HYNA 3V4QA 1EQ7A 3CMEP 1GL2D 1KFMA 4PD4D 1JY3O 5KLVD 4OGQD 3H1IE 2NPSC 3IAOA 3B5NC 1Q7YQ 2M3BA 3QH9A 1VL2A 3L72D 2JWAA 2FYUD 2XZRA 1T6AA 4NPEA 2A06D 1KZUB 1SQBK 5GTIE 1S3JA 3H1HG 2FXMA 3E1RA 3BCCG 3JSVC 5CMZA 1PGPA 2ZT9B 1KYOE 1KV4A 4D6TD 2ZFCA 1SQVK 1HTLC 1PL5A 1ZN5A 1BDDA 1BGYE 5KLVJ 1M1JB 1GD2E 2XDJA 1AJYA 3M91A 4XFJA 1K8AQ 2IBZI 4GOEA 3L72J 2FYUJ 2OQQA 2QJKB 5E79E 1KORA 3M06A 2OYIB 1SQBD 4AQRD 2L5GB 1GZLA 1HBWA 1AA0A 1FE6A 4I7ZB 4D6TJ 2VRSA 2WMMA 3H32A 3T97A 5KLVG 3KPEA 1ZLLA 2WSEH 2XKMA 1J1EC 3MIWA 1KQGB 2OTLP 3TGUE 1NTKE 3L72G 4C7NA 1DIPA 2O1KA 4L75A 2FYUG 3H1KD 2A06G 1RF1B 1GW3A 3CCRP 2BEZF 1PGQA 4I1LA 4ZKPA 2POHA 2E76B 2LR2A 2M8RA 3RK2B 3Q5SA 2E75B 3LW5J 4WY4C 2Z4EA 2LKMA 1JCCA 4HH2A 1VQ5P 1OIPA 2H88C 1LWUB 3KDPB 1KTMA 5CCHA 3BRVB 3II6A 1FZCC 1T3UA 1N7SB 5CCGD 1QVFO 5AVQB 1USEA 3H1KJ 1JOCA 3V4WA 2KUBA 4BRYB 2LXCB 2E42A 3WUVA 1SQBG 3PH0A 2OGUA 4U7JA 1BE3E 2E74D 2AEMA 3OAKA 3GW6A 4H13D 3P7KA 1DEEG 2ZXXA 4OGQB 2Q7CA 1Z56A 1VQOP 3CX5E 4Y99B 5CCHC 1FJPA 3H1KG 1IC2A 4IOIH 3VMAA 4H0LD 3P32A 2AXCA 4UB6E 1NGMB 2WSCH 1DD4A 5C39A 3L73E 3AE2C 1SVFA 3M9BA 1VQ9P 2AXTE 4I6MC 2B87B 2C0XA 1NAFA 3EWKA 1SQPD 1E5WA 1HH0A 4RESB 3Q1MA 2Y0EA 3VMYA 1LTIC 2N9BA 2OYIA 1RE4A 4L76A 1LTTC 2FKWB 5KJ7A 1N2DC 3L75D 5APUA 1GU4A 5TJHA 1SP4A 3N7NA 5GTIH 3WU2E 3AEAC 3CCMP 1AQTA 1WT6A 4K3AA 1KYOH 2P58A 1M1KQ 2DW3A 2ZJSE 2YNYA 1SLQA 1SQPJ 1ZP0C 4IL6X 1IFNA 5KLIB 3BATA 2QJKC 1OXZA 1RF1A 1PFIA 2NZ2A 2OYIC 1EZVI 5AW4B 1RE4C 3CL3D 1S9KD 2FY8A 5KJ7C 2A45G 2W6AA 3L75J 4I7ZC 5E79H 3H1HE 2BCCD 2NPSB 1KQSO 3BCCE 3HD7B 1LWUA 1YITP 2QJYB 2K9JB 1N73B 3G6EP 3AE4C 2FXOA 2BEQD 2IYPA 2OYOA 1SQPG 3U1CA 2E43A 1L4AD 1AFOA 1JM0A 1N7SA 2E5YA 4N78D 3PP5A 4ASWA 1LTGC 2Y9YA 1Q81Q 4BRYA 3C8VA 4LGDE 2E76C 1FC2C 4KJMA 3CXHE 3B8EB 1NWQA 2E75C 1YQ3C 3SFDC 1S1CX 1GW4A 2BCCJ 3FGAD 1LWUC 4HYTB 3CMAP 1LTAC 1HGZA 2N9YB 3RK3B 3B71A 5DJUB 3M9QA 1G1JA 1FDOA 1HUCA 3CC2P 1KYOI 1X9VA 5CJ0A 5KLVE 5L8RJ 4GIFA 1X8YA 2L91A 1K04A 1H89A 3FWNA 3L72E 3AE1C 3VP8A 3SWYA 1VF5D 2O3JA 2B87A 2A06E 2YO2A 2BCCG 1IFDA 2R5DA 4AUWA 4Y28J 4BXLA 2QM8A 5CJ4A 1J1EB 3A2AA 4OGQC 4CPGA 5AVSB 2IBZD 2Z5IA 1JY2N 5K5GB 1USDA 2K88A 5APWA 4R4MA 5KKZC 1BSNA 2FYZA 1QEXA 1IFMA 3CC7P 1GTWA 3CX5H 4W80A 2YMKA 1NYHA 2IYOA 3HE4B 1PP9D 4WY4B 2B88A 3VOPA 1KQFB 4UB6H
chains in the Genus database with same CATH topology
3RK3D 3VN0A 4KHXA 2H43A 1GU5A 1M1JB 1GD2E 2P67A 2GUSA 2XDJA 3M91A 1MUUA 4LLHA 3P8CD 2YMYA 2CPSA 3RL0D 2N1TA 2P1JA 5CCHD 3A5TA 1FZCB 1G1IA 1G2CA 2WITA 2WZ7A 1DH3A 5APTA 4W7ZA 3RL0C 5KLVK 3M06A 2OYIB 3NXSA 2WPRA 4AQRD 1NTKK 4IFMA 2L5GB 1URQB 5AW8B 4B86A 1IFIA 3GHGB 1GZLA 1FJKA 2KOGA 1HBWA 3HD7A 3MGNA 1GL2A 3P8MC 1QL1A 2VRSA 2FYUK 1N73A 3H32A 1N7LA 1XTGB 1T3JA 3KYQA 3T97A 3KPEA 1KILB 1ZLLA 1LTSC 3OJAB 2HLOA 2WSEH 2XKMA 1M1JA 2Q5UA 1J1EC 4IFFA 4C7RA 4DOJA 1J1DB 3TNUB 3MIWA 3G3ZA 4C7NA 2O1KA 1FZAA 5AW6B 5BU8B 2N1TC 1GK6A 3M0AA 3WMM0 2OARA 1RF1B 1GW3A 2XV5A 2W27A 3VTPC 4I1LA 1XTCC 1JTHA 4ZKPA 2POHA 4AYCA 4WBAA 4XE5B 2M8RA 3RK2B 4WY4D 5AW3B 1DEBA 1FOSE 3HD7C 1GL2C 2I1JA 3C9IA 1FDMA 4WY4C 1N73C 2Z4EA 2LKMA 1CSBA 1JCCA 3SWFA 4HH2A 3V5BA 3TK1A 1LWUB 2WT7A 1CI6A 3KDPB 1HWTC 2A45H 5AW1B 1M1JC 1NU1K 3A7OA 3LIEA 2XU6A 3HE5B 5CCHA 3BRVB 3II6A 1LT9A 1FZCC 1T3UA 1N7SB 1JNMA 5CCGD 5AVQB 1URQD 3P8CE 2HPCB 5KJ7D 1JOCA 3V4WA 5AW7B 1JCDA 3EQ2A 2QM7A 3R2PA 2E42A 1JY3P 5CCGC 3A3YB 1KILD 3NMDA 1SQXK 1H88A 2WPSA 1A02F 1VDFA 3HUSB 1T2KD 3CLQA 3RK3C 3MD0A 1IK9A 1NTZK 5AVUB 3OAKA 3B5NB 3NTNA 1FZEA 1KQLA 3M0DC 1T2KC 3P7KA 1SFCB 2WPQA 3M9HA 2Q7CA 1Z56A 1J1DC 1IJDB 5AVTB 5AW2B 1ZV8A 4Y99B 3TSIA 5AW9B 3MTUE 5CCHC 1FJPA 5AVXB 2IX7C 5AVRB 3V2QA 1LT9C 1FU1A 2OYHB 1LTBC 1IC2A 2YKPA 3RK2D 4LC1A 1RF1C 3EFGA 5AVWB 3P32A 2R32A 2GUVA 1LTJB 3HE4A 3TYYA 4WY4A 2YO3A 3RK2C 2WSCH 4JF7A 1W2EA 1ZR2A 1SVFA 3M9BA 4I6MC 2C0XA 2HFED 3HUSA 1KFNA 1NAFA 1NHLA 4XA4A 3MUDA 1NKNA 1HGVA 3UIAA 1E5WA 1FZCA 1HH0A 1RE3A 1RF0A 1N7SD 4RESB 1HVVA 3VMYA 1CZQA 1LTIC 1MZ9A 3H6PA 3U59A 2BASA 1JO5A 2HODB 1L4AB 2WSFH 2N9BA 4DZOA 1RY3A 2Z5HA 2OYIA 5BU5A 5CCGA 1RE4A 1N7SC 2A45I 1URQA 1LTTC 2FKWB 5KJ7A 2CPBA 1JMMA 1N2DC 2P7JA 3GHGA 2H7HA 5APUA 3BVHA 2XNXA 1GU4A 1CW5A 3VYIA 3HTKB 2PP6A 2FFDB 1WRGA 1SP4A 3N7NA 4O9BA 1KILA 2P2UA 1WT6A 5AVVB 2IPPA 3B5ND 3M0DA 1YTZT 3HUSC 1DX7A 3TNUA 1SFCD 5KTBA 2YNYA 1SLQA 2PAJA 2IFNA 4ZKUA 1IFNA 1SQQK 1RE3C 3BATA 1RF0C 2Q9IA 5AW5B 1OXZA 1QL2A 1RF1A 1PFIA 1L4AA 4Y99C 2N1TB 4EOTA 5BVZA 1G2CB 3L35A 2OYIC 1L0NK 5AW4B 1RE4C 3CL3D 5APYA 3LW5H 1S9KD 1URQC 5KJ7C 4GT1A 2A45G 3GHGC 3L36A 3HTKA 1SQPK 2W6AA 2FFDA 2MJZA 1MV8A 4N78E 2R5BA 4N3YB 2W6BA 5AVZB 3OA7A 4GKGA 2NPSB 2YKOA 3HD7B 4JYCA 1KILC 1LWUA 1MFZA 1GL2B 3L4FA 1JUNA 5AW0B 1N73B 3H32B 1FAVA 2ZXEB 3HE5A 1X79B 2KYVA 1YTZI 3U1CA 2E43A 1L4AD 1NTMK 1YYCA 4C46A 1AFOA 2JJLA 1FOSF 1N7SA 1JY2P 3LIDA 5APXA 3I5CA 4N78D 1A02J 4WB4A 3PP5A 2IFMA 2Q3IA 2HPCA 1LTGC 3L37A 4IFDK 1L4AC 5CHXA 1LGHB 4C7NB 1IO4A 4N6JA 1VPCA 4LGDE 3V2RA 3VP9A 2KSJA 4OH8B 2YKQA 1FBMA 3B8EB 3HRNA 1NWQA 5AVYB 5APQA 1JTHB 1NO4A 2GM4A 2FFDC 1OWAA 3KQGA 1GK4A 3IR9A 2NPSA 3E1IA 1GW4A 3B5NA 3N4XA 1LWUC 4HYTB 3VMZA 1LTAC 2R3CA 1HGZA 1SFCA 3CI9A 2C9LY 3RK3B 1NOHA 1T8ZA 2J59M 1NKZB 2KLVA 1ZR4A 3M9QA 1G1JA 4W7YA 2HG5D 2WTYA 3O8ZA 1FZFA 2C0WA 2WT7B 1HUCA 3U1AA 1CI6B 2N1TD 2OYHA 2WWWA 1X9VA 5CJ0A 4I2LC 3BASA 5APSA 4GIFA 1X8YA 2JEEA 3RL0B 2H8PD 1LTJA 1LT9B 1N86A 3NFQA 1JY3N 1AQ5A 1H89A 4JYBA 2O01H 1FZBA 2HYNA 3V4QA 3VP8A 1NH4A 2NPSD 3SWYA 1EQ7A 3HD7D 1GL2D 2YO2A 1KFMA 1J2JB 1S9KE 2J58A 1JY3O 2C9NY 3IFMA 1IFDA 2KP8A 2NPSC 3VMXA 2R5DA 4AUWA 3B5NC 2M3BA 2O1JA 2QM8A 5CJ4A 1GDTA 1J1EB 1SFCC 3A2AA 2HODA 2XZRA 5AVSB 2KB7P 2Z5IA 1M7LA 2OYHC 1JY2N 1KZUB 1SQBK 3V2PA 1HJBA 1FZGA 1L0LK 2FXMA 1H8AA 5APWA 1IFJA 3V2NA 5CMZA 2FYZA 3BRTB 1LTJC 1IFMA 4M3LA 1GTWA 1JY2O 4W80A 4EIJA 5APVA 2ZFCA 1SQVK 2I1KA 1HTLC 3HE4B 4WY4B 3VOPA 1ZN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RK3 D;  5CCG A;  1N7S C;  1JTH B;  1URQ A;  5KJ7 A;  5CCH A;  2NPS A;  2XDJ A;  1N7S B;  3HTK B;  5CCG D;  3B5N A;  2PP6 A;  2YMY A;  1URQ D;  3P8C E;  5KJ7 D;  3RL0 D;  2N1T A;  5CCH D;  1SFC A;  2WZ7 A;  3RK3 B;  1KIL A;  5CCG C;  3B5N D;  4W7Y A;  2HG5 D;  4W7Z A;  3RL0 C;  2N1T D;  1SFC D;  1KIL D;  1URQ B;  3RL0 B;  2KOG A;  3RK3 C;  2H8P D;  3HD7 A;  1GL2 A;  3B5N B;  1L4A A;  1XTG B;  1T3J A;  3M0D C;  2N1T B;  2NPS D;  3KYQ A;  1SFC B;  3HD7 D;  1KIL B;  1GL2 D;  1URQ C;  3TSI A;  5KJ7 C;  5CCH C;  2NPS C;  3RK2 D;  3B5N C;  4N78 E;  2N1T C;  2NPS B;  1SFC C;  3HD7 B;  1KIL C;  1GL2 B;  4WY4 A;  3RK2 C;  4JF7 A;  1JTH A;  2M8R A;  3RK2 B;  4WY4 D;  1L4A D;  2HFE D;  1N7S A;  3HD7 C;  1NHL A;  3PP5 A;  1GL2 C;  4WY4 C;  4W80 A;  1L4A C;  1N7S D;  4LGD E;  1HVV A;  4OH8 B;  4WY4 B;  3VOP A;  1L4A B; 
#chains in the Genus database with same CATH topology
 1Y8A A;  3VN0 A;  5H2F E;  1SQB E;  2P67 A;  2GUS A;  2KXP B;  5B66 E;  1MUU A;  4LLH A;  1PV3 A;  2KZJ A;  2YMY A;  2AXT H;  3D71 A;  3RL0 D;  3A5T A;  2P1J A;  4HB1 A;  3CCQ P;  1FZC B;  1G1I A;  2WZ7 A;  3SWK A;  1DH3 A;  1P84 E;  5APT A;  1M57 D;  4W7Z A;  5KLV K;  2WPR A;  3CPW O;  2K37 A;  2YXR B;  1URQ B;  4B86 A;  5KAI E;  1FJK A;  3HD7 A;  5TIS E;  3H25 A;  2K9J A;  2FYU K;  1N73 A;  3EFF K;  3OW2 O;  2KS1 B;  1VQ7 P;  1PP9 J;  2KLU A;  3TF5 A;  1KC8 Q;  1LTS C;  3WU2 H;  1ZW0 A;  4C7R A;  2P10 A;  3MHV A;  1SQX D;  2UWJ E;  3D6Z A;  1NTZ D;  2IBZ G;  3CC4 P;  3D6Y A;  3L74 G;  4WBA A;  2K1A A;  2ZVN B;  2RN0 A;  3HD7 C;  3H1J D;  1FDM A;  2QJY C;  1DD3 A;  1N73 C;  3CX5 I;  2ZYA A;  1OVU A;  2JO1 A;  1HWT C;  1NU1 K;  2IZ0 A;  3A7O A;  3RK3 E;  2XU6 A;  3HE5 B;  4PV1 D;  1SQX J;  3CCV P;  3P8C E;  1NTZ J;  1Q82 Q;  1EDJ A;  3GF3 A;  3EQ2 A;  2QM7 A;  3L71 D;  3L70 E;  5CCG C;  4TT3 H;  3A3Y B;  3AE9 C;  1KIL D;  2V4H A;  3NMD A;  2WPS A;  1T2K D;  3CXH H;  3CLQ A;  3IF4 A;  3RK3 C;  3MD0 A;  1X22 A;  3H1J J;  4OWF A;  5AVU B;  3ABV C;  3I56 P;  2E74 C;  2QEX P;  1Q86 Q;  1SFC B;  1PGJ A;  1J1D C;  5AVT B;  1ZV8 A;  1SQX G;  4UB8 E;  3PLN A;  2D2C D;  4H13 C;  1NU1 D;  5AVX B;  1RH5 B;  3V6I A;  1FU1 A;  2OYH B;  1Y47 A;  1HF9 A;  1EDI A;  3EFG A;  1MFT A;  2R32 A;  2WSE J;  1SQQ D;  2GUV A;  1FDI A;  1LTJ B;  3HE4 A;  3TYY A;  4WY4 A;  4ZNC A;  3L71 J;  2QA4 P;  1L0N D;  3AEB C;  2QG4 A;  5DJT B;  2HFE D;  2O01 J;  1KFN A;  3G71 P;  3B4S A;  3SSU A;  3CWB D;  3MUD A;  1NKN A;  1HGV A;  1FZC A;  1HVV A;  3WUT A;  1CZQ A;  3IN6 A;  2Y9Z A;  1JO5 A;  2BAS A;  4DZO A;  4WWI A;  2Z5H A;  5BU5 A;  1R8E A;  1LNQ A;  1NVO A;  1URQ A;  1NU1 J;  2B9B A;  2CPB A;  1EZV D;  1JMM A;  1NTM D;  2P7J A;  2H7H A;  3RGU A;  3GLM A;  4D6T G;  2W6J H;  1KB9 E;  1SQQ J;  2KS1 A;  1S5L X;  2P2U A;  5AVV B;  3B5N D;  1L0N J;  2G8Y A;  3MUD C;  4DJG A;  3CWB J;  1U7J A;  3CXH I;  2Q9I A;  3GG2 A;  2YIU C;  1L4A A;  5H2F H;  2N1T B;  1RHZ B;  3L35 A;  1NU1 G;  3S4R A;  5B66 H;  3LW5 H;  1URQ C;  4GT1 A;  5M1B A;  1ZME C;  1SQQ G;  1NTM J;  1SQP K;  3HTK A;  1P84 H;  1MV8 A;  4N78 E;  4N3Y B;  5AVZ B;  2W6B A;  1HJ0 A;  4YTP C;  1RQV A;  2JKV A;  2JP3 A;  1MFZ A;  1L0N G;  1GL2 B;  1JUN A;  4U3F D;  1IZN B;  1R5S A;  3G9R A;  5KAI H;  1YJ9 P;  3HE5 A;  1X79 B;  5TIS H;  2KYV A;  3CWB G;  1YTZ I;  1EXI A;  4C46 A;  2QVA A;  2JJL A;  1L2P A;  1JY2 P;  5APX A;  3L37 A;  1KYO D;  1YI2 P;  1L4A C;  5KKZ B;  1IO4 A;  1VPC A;  2H89 C;  2IDB A;  2YKQ A;  1EZV G;  1NTM G;  1BGY D;  3HRN A;  2K3R A;  3FXE A;  3S9O A;  5AVY B;  1S72 P;  1NO4 A;  1VQ4 P;  3H1L E;  1OWA A;  1L0L D;  3IR9 A;  3USS A;  3N4X A;  1YJW P;  1SFC A;  2WVR A;  2C9L Y;  4U3F J;  1NKZ B;  4BWN A;  2WTY A;  1CI6 B;  2OYH A;  4YXW H;  2Y0C A;  3BAS A;  1BDC A;  2H8P D;  1LTJ A;  1S5L E;  4JYB A;  1FS0 E;  1BGY J;  1J2J B;  1W2B O;  4RKU J;  2J58 A;  2C9N Y;  3L74 E;  3IFM A;  1L0L J;  1NTK D;  1P84 I;  1VQP P;  2Q6Q A;  4U3F G;  1SFC C;  3FX0 A;  1UIX A;  3Q5P A;  2OYH C;  1HJB A;  1IFJ A;  3V2N A;  3BRT B;  1LTJ C;  4JBZ A;  4M3L A;  4DT0 A;  1JY2 O;  3R4Y A;  4UB8 H;  5APV A;  1AV1 A;  4EI2 A;  1L0L G;  3CCL P;  1IFP A;  2KK7 A;  3MP7 B;  4H44 D;  1GU5 A;  1E79 H;  1QVG O;  1NTK J;  4YPC A;  3AE6 C;  2CPS A;  3S1K A;  2N1T A;  5CCH D;  1OFC X;  4EYY Q;  1BCC D;  1OW8 A;  1QX8 A;  4ASV A;  3L75 G;  3RL0 C;  2KI7 B;  1BE3 D;  3G4S P;  2R44 A;  1N8R Q;  2JDI H;  4IFM A;  5AW8 B;  5CBN A;  2KOG A;  5B5E E;  3MGN A;  2V7Q H;  3KZI E;  1GL2 A;  1VQK P;  1QL1 A;  4YXD C;  1QGK B;  1SS1 A;  4RO0 A;  3CX5 D;  1KB9 H;  1H0T B;  1NTK G;  2E74 B;  1TU3 F;  4PD4 E;  2Q5U A;  4IFF A;  4DOJ A;  1J1D B;  2JWD A;  3G3Z A;  1EXJ A;  4H13 B;  4ZMD A;  2N1T C;  2ZT9 D;  1GK6 A;  3PHL A;  2KNC B;  3AE7 C;  1BCC J;  2FYU E;  3L73 D;  3ITK A;  3KHU A;  3VTP C;  3ZDM A;  1XTC C;  2IZ1 A;  4AYC A;  1BE3 J;  4H0L B;  5AW3 B;  2OTK E;  1OVV A;  4IL6 E;  1GL2 C;  2I1J A;  3C9I A;  4NPD A;  1CSB A;  1YBK A;  4D6T E;  3SWF A;  3V5B A;  1ZRT D;  1CI6 A;  2RH0 A;  4GOD A;  4DCK A;  3O6Q B;  1JNM A;  1BCC G;  1W5C E;  5KJ7 D;  2W8Z A;  2QE7 H;  3A0B E;  3R2P A;  1JY3 P;  3L73 J;  3AE5 C;  1RQU A;  2Q1K A;  1NU1 E;  1PZQ A;  1S2E A;  1SQX K;  2K9Y A;  2FXP A;  1A02 F;  3AE8 C;  2CK3 H;  3KXD A;  1YJN P;  1IK9 A;  1NTZ K;  1SQQ E;  1K9M Q;  1X0T A;  3M0D C;  1T2K C;  4QMA A;  2WPQ A;  1IJD B;  2YIU B;  3TSI A;  5AW9 B;  1KB9 I;  4HJG H;  1VQ6 P;  3V2Q A;  2E76 D;  1LTB C;  3H1H D;  3RK2 D;  4LC1 A;  3CWB E;  5AVW B;  2WQY C;  3BCC D;  3Q2Y A;  3H1K E;  2KZI A;  5GTH E;  2E75 D;  1OZH A;  4JF7 A;  1LP1 B;  1S5L H;  1M8O B;  1Q90 D;  3HUS A;  3AED C;  1NTM E;  3AEF C;  1NJI Q;  4Z1M H;  1M56 D;  2OTJ P;  3AEC C;  1NHL A;  1N7S D;  1MZ9 A;  3H6P A;  3CXH D;  3U59 A;  2HOD B;  1L4A B;  2WSF H;  1RY3 A;  5CCG A;  5KAF E;  2FYN C;  2ZAE B;  3H1H J;  3VYI A;  3HTK B;  2PP6 A;  3BCC J;  2MKV A;  1PP9 G;  3RBX A;  1H0T A;  2B89 A;  2IPP A;  1YTZ T;  3HUS C;  1DX7 A;  3MZW B;  2FBW C;  2IFN A;  4ZKU A;  4RJT A;  1SQQ K;  4JQ0 D;  1KD1 Q;  5EFW B;  2KNC A;  5AW5 B;  1QL2 A;  3F89 A;  2W90 A;  4U3F E;  4EOT A;  5BVZ A;  1G2C B;  1L0N K;  5APY A;  1K73 Q;  2E5T A;  3L36 A;  2FFD A;  2R5B A;  2YXQ B;  1KN7 A;  4GKG A;  2YKO A;  1VF5 B;  4JYC A;  5AW0 B;  1FAV A;  1EDK A;  5B5E H;  3CCS P;  3KZI H;  1NTM K;  1YYC A;  3O6Q A;  1L0L E;  2PGD A;  1NTZ G;  1SQP E;  2IFM A;  4IFD K;  2QJP B;  2O01 N;  3A0H E;  2M5A B;  5CHX A;  1LGH B;  3W68 A;  1Y9B A;  4N6J A;  4PD4 H;  3V2R A;  3VP9 A;  2KSJ A;  4OH8 B;  4H0L C;  1FBM A;  1OMI A;  5APQ A;  1JTH B;  2FFD C;  1PGO A;  3KQG A;  1GK4 A;  3H1J G;  1VQL P;  1UII A;  3L75 E;  3CD6 P;  3D70 A;  3VMZ A;  3GF7 A;  3CI9 A;  1SQV D;  1P84 D;  2J59 M;  1ZR4 A;  4PJ0 E;  4IL6 H;  4W7Y A;  2R3S A;  2HG5 D;  1FZF A;  2C0W A;  2WT7 B;  1PPJ D;  4L73 A;  4WVZ A;  4I2L C;  3Q3D A;  5APS A;  2JEE A;  3RL0 B;  4OVN F;  1LT9 B;  3L71 G;  1N86 A;  1JY3 N;  2O01 H;  1LP1 A;  1FZB A;  1NH4 A;  2NPS D;  3HD7 D;  1EDL A;  4K35 A;  1PIX A;  1S9K E;  1VQN P;  1SQB J;  2KP8 A;  1U7M A;  3VMX A;  3A0B H;  2O1J A;  2BCC E;  1GDT A;  2HOD A;  1SQV J;  4MN4 C;  2KB7 P;  3FXD A;  1M7L A;  3V2P A;  1FZG A;  1L0L K;  3WUU A;  1H8A A;  3H1I D;  3E7K A;  1IK7 A;  3QWO C;  3PTZ A;  4EIJ A;  2I1K A;  4HKZ H;  1BCC E;  3TDK A;  4PD4 I;  3RK3 D;  1WMK A;  1MKM A;  4KHX A;  5GTH H;  2H43 A;  1OX3 A;  2WSC J;  1SQV G;  3P8C D;  1U57 A;  3FWL A;  1G2C A;  4H44 C;  2WIT A;  3JCU E;  3L70 D;  1PPJ G;  3CCE P;  4PV1 B;  4GOF A;  2I8D A;  3NXS A;  3H1I J;  1NTK K;  1JEK A;  1IFI A;  3GHG B;  3P8M C;  5KAF H;  1N7L A;  1XTG B;  1T3J A;  2KSE A;  3KYQ A;  1KIL B;  3OJA B;  2HLO A;  1M1J A;  2RKL A;  3JC2 2;  3TNU B;  2M5A A;  3PRJ A;  1FZA A;  5AW6 B;  5BU8 B;  2QSI A;  3M0A A;  3WMM 0;  2OAR A;  3L70 J;  2XV5 A;  1ZRT E;  2W27 A;  2D2C B;  4EDF A;  1GMJ A;  3H1I G;  4A7P A;  1JTH A;  2IBZ E;  1AVO A;  2ZT9 C;  4XE5 B;  4WY4 D;  1DEB A;  1FOS E;  1VF5 C;  3TGU D;  1VQ8 P;  1OW6 A;  4TLF A;  3TK1 A;  1JB0 J;  2ITA A;  1D7M A;  2WT7 A;  1PP9 E;  1LJ2 A;  2A45 H;  5AW1 B;  1M1J C;  1KMI Z;  3LIE A;  3PJS K;  2QJP C;  1YQ4 C;  1LT9 A;  1KB9 D;  3GMA A;  3L70 G;  2FYN B;  2JR8 A;  2NRG A;  1URQ D;  2HPC B;  5AW7 B;  1JCD A;  1BGY G;  3AEG C;  1LT1 A;  3A0H H;  1YHQ P;  1S4X A;  4JPZ B;  1H88 A;  1VDF A;  3HUS B;  3TGU J;  1ZXG A;  3B5N B;  3NTN A;  1FZE A;  1KQL A;  2QRX A;  1JMB A;  3M9H A;  2V7Q J;  5AW2 B;  2KIK A;  2AEJ A;  3MTU E;  2IX7 C;  5AVR B;  1LT9 C;  2AEF A;  2YKP A;  4PJ0 H;  1SQX E;  1RF1 C;  3F5H A;  2ZYD A;  1NTZ E;  4R4L A;  2YO3 A;  3RK2 C;  3I55 P;  1R5L A;  1W2E A;  2HR3 A;  1ZR2 A;  2WPV B;  3C1L A;  3TGU G;  4XA4 A;  3UIA A;  2SPZ A;  1RE3 A;  3H1J E;  3AE3 C;  2XND H;  1RF0 A;  2Y0D A;  1NAY A;  3Q5R A;  1N7S C;  3CCU P;  2A45 I;  2LXB A;  3H1L D;  1YIJ P;  1EC5 A;  3GHG A;  3BVH A;  2QIW A;  2XNX A;  1CW5 A;  2PFX A;  2FFD B;  1WRG A;  4O9B A;  1KIL A;  3RBZ A;  3L71 E;  2M3E A;  3AEE C;  3M0D A;  2PRR A;  3TNU A;  1SFC D;  1M90 Q;  5KTB A;  1KIL E;  1OW7 A;  2PAJ A;  1RE3 C;  1RF0 C;  4PV1 C;  4Y99 C;  3K5B A;  4L74 A;  1BE3 G;  2M0B A;  2ZYG A;  2RMZ A;  3L74 D;  3H1L J;  1Q2N A;  3GHG C;  3JCU H;  2MJZ A;  4NPF X;  3OA7 A;  1K05 A;  1KIL C;  3L4F A;  3H32 B;  2ZXE B;  3T97 B;  3SFE C;  1L0N E;  2J5U A;  1FOS F;  1QLE D;  3LID A;  3I5C A;  1A02 J;  4WB4 A;  2Q3I A;  2HPC A;  2D2C C;  4C7N B;  3L73 G;  1SQV E;  3H1L G;  2Q3E A;  2W83 C;  2WSS H;  3L74 J;  1BSH A;  1PPJ E;  4GDO A;  2GM4 A;  1EZV E;  2WSF J;  2NPS A;  3E1I A;  1OVR A;  3B5N A;  1AVY A;  2ZVO B;  2R3C A;  1ZOY C;  1NOH A;  1T8Z A;  2G3A A;  3RL0 g;  2KLV A;  3CCJ P;  3O8Z A;  4H44 B;  3U1A A;  2N1T D;  2GA1 A;  5KLI C;  2WWW A;  5CBO A;  4KT0 J;  3NFQ A;  1AQ5 A;  1VQM P;  3W67 A;  2HYN A;  3V4Q A;  1EQ7 A;  3CME P;  1GL2 D;  1KFM A;  4PD4 D;  1JY3 O;  5KLV D;  4OGQ D;  3H1I E;  2NPS C;  3IAO A;  3B5N C;  1Q7Y Q;  2M3B A;  3QH9 A;  1VL2 A;  3L72 D;  2JWA A;  2FYU D;  2XZR A;  1T6A A;  4NPE A;  2A06 D;  1KZU B;  1SQB K;  5GTI E;  1S3J A;  3H1H G;  2FXM A;  3E1R A;  3BCC G;  3JSV C;  5CMZ A;  1PGP A;  2ZT9 B;  1KYO E;  1KV4 A;  4D6T D;  2ZFC A;  1SQV K;  1HTL C;  1PL5 A;  1ZN5 A;  1BDD A;  1BGY E;  5KLV J;  1M1J B;  1GD2 E;  2XDJ A;  1AJY A;  3M91 A;  4XFJ A;  1K8A Q;  2IBZ I;  4GOE A;  3L72 J;  2FYU J;  2OQQ A;  2QJK B;  5E79 E;  1KOR A;  3M06 A;  2OYI B;  1SQB D;  4AQR D;  2L5G B;  1GZL A;  1HBW A;  1AA0 A;  1FE6 A;  4I7Z B;  4D6T J;  2VRS A;  2WMM A;  3H32 A;  3T97 A;  5KLV G;  3KPE A;  1ZLL A;  2WSE H;  2XKM A;  1J1E C;  3MIW A;  1KQG B;  2OTL P;  3TGU E;  1NTK E;  3L72 G;  4C7N A;  1DIP A;  2O1K A;  4L75 A;  2FYU G;  3H1K D;  2A06 G;  1RF1 B;  1GW3 A;  3CCR P;  2BEZ F;  1PGQ A;  4I1L A;  4ZKP A;  2POH A;  2E76 B;  2LR2 A;  2M8R A;  3RK2 B;  3Q5S A;  2E75 B;  3LW5 J;  4WY4 C;  2Z4E A;  2LKM A;  1JCC A;  4HH2 A;  1VQ5 P;  1OIP A;  2H88 C;  1LWU B;  3KDP B;  1KTM A;  5CCH A;  3BRV B;  3II6 A;  1FZC C;  1T3U A;  1N7S B;  5CCG D;  1QVF O;  5AVQ B;  1USE A;  3H1K J;  1JOC A;  3V4W A;  2KUB A;  4BRY B;  2LXC B;  2E42 A;  3WUV A;  1SQB G;  3PH0 A;  2OGU A;  4U7J A;  1BE3 E;  2E74 D;  2AEM A;  3OAK A;  3GW6 A;  4H13 D;  3P7K A;  1DEE G;  2ZXX A;  4OGQ B;  2Q7C A;  1Z56 A;  1VQO P;  3CX5 E;  4Y99 B;  5CCH C;  1FJP A;  3H1K G;  1IC2 A;  4IOI H;  3VMA A;  4H0L D;  3P32 A;  2AXC A;  4UB6 E;  1NGM B;  2WSC H;  1DD4 A;  5C39 A;  3L73 E;  3AE2 C;  1SVF A;  3M9B A;  1VQ9 P;  2AXT E;  4I6M C;  2B87 B;  2C0X A;  1NAF A;  3EWK A;  1SQP D;  1E5W A;  1HH0 A;  4RES B;  3Q1M A;  2Y0E A;  3VMY A;  1LTI C;  2N9B A;  2OYI A;  1RE4 A;  4L76 A;  1LTT C;  2FKW B;  5KJ7 A;  1N2D C;  3L75 D;  5APU A;  1GU4 A;  5TJH A;  1SP4 A;  3N7N A;  5GTI H;  3WU2 E;  3AEA C;  3CCM P;  1AQT A;  1WT6 A;  4K3A A;  1KYO H;  2P58 A;  1M1K Q;  2DW3 A;  2ZJS E;  2YNY A;  1SLQ A;  1SQP J;  1ZP0 C;  4IL6 X;  1IFN A;  5KLI B;  3BAT A;  2QJK C;  1OXZ A;  1RF1 A;  1PFI A;  2NZ2 A;  2OYI C;  1EZV I;  5AW4 B;  1RE4 C;  3CL3 D;  1S9K D;  2FY8 A;  5KJ7 C;  2A45 G;  2W6A A;  3L75 J;  4I7Z C;  5E79 H;  3H1H E;  2BCC D;  2NPS B;  1KQS O;  3BCC E;  3HD7 B;  1LWU A;  1YIT P;  2QJY B;  2K9J B;  1N73 B;  3G6E P;  3AE4 C;  2FXO A;  2BEQ D;  2IYP A;  2OYO A;  1SQP G;  3U1C A;  2E43 A;  1L4A D;  1AFO A;  1JM0 A;  1N7S A;  2E5Y A;  4N78 D;  3PP5 A;  4ASW A;  1LTG C;  2Y9Y A;  1Q81 Q;  4BRY A;  3C8V A;  4LGD E;  2E76 C;  1FC2 C;  4KJM A;  3CXH E;  3B8E B;  1NWQ A;  2E75 C;  1YQ3 C;  3SFD C;  1S1C X;  1GW4 A;  2BCC J;  3FGA D;  1LWU C;  4HYT B;  3CMA P;  1LTA C;  1HGZ A;  2N9Y B;  3RK3 B;  3B71 A;  5DJU B;  3M9Q A;  1G1J A;  1FDO A;  1HUC A;  3CC2 P;  1KYO I;  1X9V A;  5CJ0 A;  5KLV E;  5L8R J;  4GIF A;  1X8Y A;  2L91 A;  1K04 A;  1H89 A;  3FWN A;  3L72 E;  3AE1 C;  3VP8 A;  3SWY A;  1VF5 D;  2O3J A;  2B87 A;  2A06 E;  2YO2 A;  2BCC G;  1IFD A;  2R5D A;  4AUW A;  4Y28 J;  4BXL A;  2QM8 A;  5CJ4 A;  1J1E B;  3A2A A;  4OGQ C;  4CPG A;  5AVS B;  2IBZ D;  2Z5I A;  1JY2 N;  5K5G B;  1USD A;  2K88 A;  5APW A;  4R4M A;  5KKZ C;  1BSN A;  2FYZ A;  1QEX A;  1IFM A;  3CC7 P;  1GTW A;  3CX5 H;  4W80 A;  2YMK A;  1NYH A;  2IYO A;  3HE4 B;  1PP9 D;  4WY4 B;  2B88 A;  3VOP A;  1KQF B;  4UB6 H; 
#chains in the Genus database with same CATH homology
 3RK3 D;  3VN0 A;  4KHX A;  2H43 A;  1GU5 A;  1M1J B;  1GD2 E;  2P67 A;  2GUS A;  2XDJ A;  3M91 A;  1MUU A;  4LLH A;  3P8C D;  2YMY A;  2CPS A;  3RL0 D;  2N1T A;  2P1J A;  5CCH D;  3A5T A;  1FZC B;  1G1I A;  1G2C A;  2WIT A;  2WZ7 A;  1DH3 A;  5APT A;  4W7Z A;  3RL0 C;  5KLV K;  3M06 A;  2OYI B;  3NXS A;  2WPR A;  4AQR D;  1NTK K;  4IFM A;  2L5G B;  1URQ B;  5AW8 B;  4B86 A;  1IFI A;  3GHG B;  1GZL A;  1FJK A;  2KOG A;  1HBW A;  3HD7 A;  3MGN A;  1GL2 A;  3P8M C;  1QL1 A;  2VRS A;  2FYU K;  1N73 A;  3H32 A;  1N7L A;  1XTG B;  1T3J A;  3KYQ A;  3T97 A;  3KPE A;  1KIL B;  1ZLL A;  1LTS C;  3OJA B;  2HLO A;  2WSE H;  2XKM A;  1M1J A;  2Q5U A;  1J1E C;  4IFF A;  4C7R A;  4DOJ A;  1J1D B;  3TNU B;  3MIW A;  3G3Z A;  4C7N A;  2O1K A;  1FZA A;  5AW6 B;  5BU8 B;  2N1T C;  1GK6 A;  3M0A A;  3WMM 0;  2OAR A;  1RF1 B;  1GW3 A;  2XV5 A;  2W27 A;  3VTP C;  4I1L A;  1XTC C;  1JTH A;  4ZKP A;  2POH A;  4AYC A;  4WBA A;  4XE5 B;  2M8R A;  3RK2 B;  4WY4 D;  5AW3 B;  1DEB A;  1FOS E;  3HD7 C;  1GL2 C;  2I1J A;  3C9I A;  1FDM A;  4WY4 C;  1N73 C;  2Z4E A;  2LKM A;  1CSB A;  1JCC A;  3SWF A;  4HH2 A;  3V5B A;  3TK1 A;  1LWU B;  2WT7 A;  1CI6 A;  3KDP B;  1HWT C;  2A45 H;  5AW1 B;  1M1J C;  1NU1 K;  3A7O A;  3LIE A;  2XU6 A;  3HE5 B;  5CCH A;  3BRV B;  3II6 A;  1LT9 A;  1FZC C;  1T3U A;  1N7S B;  1JNM A;  5CCG D;  5AVQ B;  1URQ D;  3P8C E;  2HPC B;  5KJ7 D;  1JOC A;  3V4W A;  5AW7 B;  1JCD A;  3EQ2 A;  2QM7 A;  3R2P A;  2E42 A;  1JY3 P;  5CCG C;  3A3Y B;  1KIL D;  3NMD A;  1SQX K;  1H88 A;  2WPS A;  1A02 F;  1VDF A;  3HUS B;  1T2K D;  3CLQ A;  3RK3 C;  3MD0 A;  1IK9 A;  1NTZ K;  5AVU B;  3OAK A;  3B5N B;  3NTN A;  1FZE A;  1KQL A;  3M0D C;  1T2K C;  3P7K A;  1SFC B;  2WPQ A;  3M9H A;  2Q7C A;  1Z56 A;  1J1D C;  1IJD B;  5AVT B;  5AW2 B;  1ZV8 A;  4Y99 B;  3TSI A;  5AW9 B;  3MTU E;  5CCH C;  1FJP A;  5AVX B;  2IX7 C;  5AVR B;  3V2Q A;  1LT9 C;  1FU1 A;  2OYH B;  1LTB C;  1IC2 A;  2YKP A;  3RK2 D;  4LC1 A;  1RF1 C;  3EFG A;  5AVW B;  3P32 A;  2R32 A;  2GUV A;  1LTJ B;  3HE4 A;  3TYY A;  4WY4 A;  2YO3 A;  3RK2 C;  2WSC H;  4JF7 A;  1W2E A;  1ZR2 A;  1SVF A;  3M9B A;  4I6M C;  2C0X A;  2HFE D;  3HUS A;  1KFN A;  1NAF A;  1NHL A;  4XA4 A;  3MUD A;  1NKN A;  1HGV A;  3UIA A;  1E5W A;  1FZC A;  1HH0 A;  1RE3 A;  1RF0 A;  1N7S D;  4RES B;  1HVV A;  3VMY A;  1CZQ A;  1LTI C;  1MZ9 A;  3H6P A;  3U59 A;  2BAS A;  1JO5 A;  2HOD B;  1L4A B;  2WSF H;  2N9B A;  4DZO A;  1RY3 A;  2Z5H A;  2OYI A;  5BU5 A;  5CCG A;  1RE4 A;  1N7S C;  2A45 I;  1URQ A;  1LTT C;  2FKW B;  5KJ7 A;  2CPB A;  1JMM A;  1N2D C;  2P7J A;  3GHG A;  2H7H A;  5APU A;  3BVH A;  2XNX A;  1GU4 A;  1CW5 A;  3VYI A;  3HTK B;  2PP6 A;  2FFD B;  1WRG A;  1SP4 A;  3N7N A;  4O9B A;  1KIL A;  2P2U A;  1WT6 A;  5AVV B;  2IPP A;  3B5N D;  3M0D A;  1YTZ T;  3HUS C;  1DX7 A;  3TNU A;  1SFC D;  5KTB A;  2YNY A;  1SLQ A;  2PAJ A;  2IFN A;  4ZKU A;  1IFN A;  1SQQ K;  1RE3 C;  3BAT A;  1RF0 C;  2Q9I A;  5AW5 B;  1OXZ A;  1QL2 A;  1RF1 A;  1PFI A;  1L4A A;  4Y99 C;  2N1T B;  4EOT A;  5BVZ A;  1G2C B;  3L35 A;  2OYI C;  1L0N K;  5AW4 B;  1RE4 C;  3CL3 D;  5APY A;  3LW5 H;  1S9K D;  1URQ C;  5KJ7 C;  4GT1 A;  2A45 G;  3GHG C;  3L36 A;  3HTK A;  1SQP K;  2W6A A;  2FFD A;  2MJZ A;  1MV8 A;  4N78 E;  2R5B A;  4N3Y B;  2W6B A;  5AVZ B;  3OA7 A;  4GKG A;  2NPS B;  2YKO A;  3HD7 B;  4JYC A;  1KIL C;  1LWU A;  1MFZ A;  1GL2 B;  3L4F A;  1JUN A;  5AW0 B;  1N73 B;  3H32 B;  1FAV A;  2ZXE B;  3HE5 A;  1X79 B;  2KYV A;  1YTZ I;  3U1C A;  2E43 A;  1L4A D;  1NTM K;  1YYC A;  4C46 A;  1AFO A;  2JJL A;  1FOS F;  1N7S A;  1JY2 P;  3LID A;  5APX A;  3I5C A;  4N78 D;  1A02 J;  4WB4 A;  3PP5 A;  2IFM A;  2Q3I A;  2HPC A;  1LTG C;  3L37 A;  4IFD K;  1L4A C;  5CHX A;  1LGH B;  4C7N B;  1IO4 A;  4N6J A;  1VPC A;  4LGD E;  3V2R A;  3VP9 A;  2KSJ A;  4OH8 B;  2YKQ A;  1FBM A;  3B8E B;  3HRN A;  1NWQ A;  5AVY B;  5APQ A;  1JTH B;  1NO4 A;  2GM4 A;  2FFD C;  1OWA A;  3KQG A;  1GK4 A;  3IR9 A;  2NPS A;  3E1I A;  1GW4 A;  3B5N A;  3N4X A;  1LWU C;  4HYT B;  3VMZ A;  1LTA C;  2R3C A;  1HGZ A;  1SFC A;  3CI9 A;  2C9L Y;  3RK3 B;  1NOH A;  1T8Z A;  2J59 M;  1NKZ B;  2KLV A;  1ZR4 A;  3M9Q A;  1G1J A;  4W7Y A;  2HG5 D;  2WTY A;  3O8Z A;  1FZF A;  2C0W A;  2WT7 B;  1HUC A;  3U1A A;  1CI6 B;  2N1T D;  2OYH A;  2WWW A;  1X9V A;  5CJ0 A;  4I2L C;  3BAS A;  5APS A;  4GIF A;  1X8Y A;  2JEE A;  3RL0 B;  2H8P D;  1LTJ A;  1LT9 B;  1N86 A;  3NFQ A;  1JY3 N;  1AQ5 A;  1H89 A;  4JYB A;  2O01 H;  1FZB A;  2HYN A;  3V4Q A;  3VP8 A;  1NH4 A;  2NPS D;  3SWY A;  1EQ7 A;  3HD7 D;  1GL2 D;  2YO2 A;  1KFM A;  1J2J B;  1S9K E;  2J58 A;  1JY3 O;  2C9N Y;  3IFM A;  1IFD A;  2KP8 A;  2NPS C;  3VMX A;  2R5D A;  4AUW A;  3B5N C;  2M3B A;  2O1J A;  2QM8 A;  5CJ4 A;  1GDT A;  1J1E B;  1SFC C;  3A2A A;  2HOD A;  2XZR A;  5AVS B;  2KB7 P;  2Z5I A;  1M7L A;  2OYH C;  1JY2 N;  1KZU B;  1SQB K;  3V2P A;  1HJB A;  1FZG A;  1L0L K;  2FXM A;  1H8A A;  5APW A;  1IFJ A;  3V2N A;  5CMZ A;  2FYZ A;  3BRT B;  1LTJ C;  1IFM A;  4M3L A;  1GTW A;  1JY2 O;  4W80 A;  4EIJ A;  5APV A;  2ZFC A;  1SQV K;  2I1K A;  1HTL C;  3HE4 B;  4WY4 B;  3VOP A;  1ZN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...