1URQA

Crystal structure of neuronal q-snares in complex with r-snare motif of tomosyn
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
58
structure length
58
Chain Sequence
GIEGVKGAASGVVGELARARLALDERGQKLSDLEERTAAMMSSADSFSKHAHEMMLKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords M-TOMOSYN ISOFORM
publication title Structural Basis for the Inhibitory Role of Tomosyn in Exocytosis
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 28
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2003-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1urqA00
4WY4A 1GL2D 1L4AA 2PP6A 4W80A 3B5NA 4WY4C 4WY4D 2HFED 2XDJA 4WY4B 1KILA 1L4AC 1L4AD 3HD7A 1L4AB 2HG5D 3B5NC 2N1TA 3B5NB 1KILC 1KILD 1SFCA 3HD7C 4OH8B 2KOGA 3HD7B 2N1TC 2N1TD 1GL2A 1SFCC 1SFCD 1SFCB 1HVVA 3VOPA 1GL2C 3KYQA 3HTKB 1GL2B 5KJ7D 4W7YA 3RL0D 4LGDE 5CCGA 1URQD 1KILB 2YMYA 2N1TB 5CCGC 5CCGD 5KJ7A 3RK3D 2NPSA 4JF7A 3RK2C 3RK2D 1N7SA 3RK2B 2WZ7A 5KJ7C 3RL0C 3RL0B 2NPSC 2NPSD 3P8CE 1URQA 1N7SC 1N7SD 1JTHA 1URQC 1URQB 5CCHD 1JTHB 3RK3C 3RK3B 1T3JA 4W7ZA 2M8RA 3PP5A 3B5ND 2NPSB 3HD7D 1N7SB 5CCHA 1XTGB 2H8PD 3M0DC 1NHLA 4N78E 5CCHC 3TSIA
chains in the Genus database with same CATH superfamily
2C9NY 3KHUA 1MV8A 3PJSK 1JNMA 2HPCA 3FX0A 2QVAA 1P84D 3OJAB 2BEQD 2ZYDA 2YIUC 2J5UA 1OWAA 4GOFA 4ZNCA 3H1JE 1SQQE 1IFIA 1KILE 3AEGC 2Q5UA 5AW3B 4GKGA 4RO0A 4BRYA 2PAJA 2W6JH 4IOIH 1QEXA 3VP8A 1EDIA 4H44B 2IZ0A 3M06A 1L0LG 1PZQA 5B5EE 4ASWA 1SQPJ 3Q5PA 5CJ0A 3BVHA 1KV4A 1VQMP 1CW5A 1URQB 1FZBA 1SQPD 1W2EA 2BCCG 2KNCB 2W6AA 2QJPC 2PFXA 2H7HA 2M8RA 2W6BA 3L75E 4RESB 2WQYC 1LTJB 2Y0CA 4IL6X 3CMAP 2W27A 1LTIC 5CBOA 1JY3O 2LXBA 3B8EB 1NOHA 2ZJSE 3L71E 3LIDA 1CZQA 3CX5H 1VQNP 2YMKA 3O6QB 3L70J 4WY4C 2XDJA 1AJYA 1KILA 1LWUA 1VQLP 4EOTA 3AEFC 3L70D 3FXEA 2A45I 3N7NA 1FZAA 2N1TC 3L74E 4U3FG 1SFCC 1HF9A 3BASA 4IFMA 2WT7A 4JBZA 4L73A 2JR8A 2E43A 3A0HH 3D71A 3MUDA 1JO5A 2AEMA 2OYHB 1CI6A 2XV5A 4K35A 1L0LD 4L75A 1RQUA 5KAFH 5KJ7A 2YNYA 1FOSF 1VQ6P 1SQVK 2K88A 4H13B 1IFPA 3RL0B 3CXHI 1IK9A 1N7SC 2AXTH 1IFDA 1NU1K 4HYTB 5CCHD 3OW2O 1JOCA 4BXLA 2FYUE 2OQQA 3CCLP 2NPSB 1RF1C 3FWNA 3NXSA 1HTLC 2WPQA 3KQGA 3HUSC 3E7KA 1S9KD 1MKMA 3CLQA 2E76B 3IAOA 5APUA 3CX5E 3H1LE 2C0WA 4WY4D 5B66H 4U3FD 1NYHA 2JKVA 1EXJA 1RF0A 2N1TD 3O8ZA 2RH0A 3CI9A 1SFCD 1HVVA 4WVZA 1RHZB 3M9BA 5AW2B 2FFDC 3TK1A 3WMM0 5APVA 5KLVK 1ZMEC 1EZVI 3KZIH 3A3YB 1ZN5A 3A0HE 3MIWA 1UIXA 2QA4P 2YMYA 3RK3D 2NRGA 1SQXK 1L2PA 4HH2A 1N86A 5KAFE 1OMIA 4GIFA 2WMMA 3CCMP 5AVQB 1A02J 1N7SD 2A06G 5GTIH 1USDA 1LJ2A 2AXTE 1SQVG 3GMAA 3GHGA 2IYPA 2XNXA 2YO3A 3OAKA 2KUBA 1T2KC 2OYIB 1J2JB 1NU1G 1Y9BA 1R5SA 3TNUB 3U59A 1SQPE 3MZWB 2QG4A 4QMAA 2H8PD 1U57A 1NHLA 1MUUA 5AVUB 1M7LA 3L72J 3QWOC 3NTNA 3B5NC 5GTHH 3GW6A 3L72D 5C39A 5B66E 2E75C 3PH0A 3RL0g 1MFZA 1NTZJ 1PIXA 2P1JA 2HPCB 1OVRA 2ZFCA 5AVRB 1GL2C 1KMIZ 3TGUJ 3L70E 2YKQA 5APSA 1IFJA 2IBZI 2QE7H 2A45G 2Y9ZA 3TGUD 3KZIE 1WMKA 3RBXA 1HJ0A 3BATA 1GMJA 1LT9A 4Y28J 1J1DB 3WUUA 4BRYB 5KLVG 4D6TG 2ZT9C 4Y99C 3S1KA 1FDIA 2AEFA 3WUTA 1FZCB 1JMMA 3JSVC 1BE3G 3AE3C 1NU1J 1OX3A 1SQXG 5GTIE 1HWTC 1OIPA 1NU1D 4AUWA 1KB9I 1JCDA 1Q90D 2POHA 1T2KD 4N3YB 2C0XA 2KLVA 1YJ9P 3PLNA 3HD7D 4MN4C 1OFCX 5AVWB 2E74D 3IR9A 4I2LC 3TSIA 1RQVA 4OGQD 4NPEA 2WITA 3VMYA 3H1HG 2PP6A 4W80A 1GDTA 4PV1B 2HFED 3R4YA 5DJUB 3BCCJ 1ZOYC 3CCJP 2E75D 3V2RA 1LWUB 5GTHE 2FXMA 1BCCG 1NTKJ 3WU2H 2KYVA 2MJZA 1T3UA 1KYOI 2JDIH 1PPJD 2ZXXA 2WT7B 3II6A 3E1IA 2Q3IA 1G1JA 4HKZH 3D6YA 3VN0A 1CI6B 1S3JA 1SQBK 1BE3D 2ZT9D 3V4QA 2P10A 2WZ7A 2KIKA 1LTJC 4EIJA 3V2PA 2O01N 1PP9G 2BEZF 1JTHA 3RK3E 1YTZI 5KLIB 1QVGO 2YO2A 2V7QJ 3L73J 3H1IG 1RE4C 3CL3D 3L73D 3HE5B 1YIJP 5AVZB 5APQA 3HTKA 3W67A 4EI2A 1YQ4C 1VDFA 2O01J 2KSEA 2BASA 4WY4A 3H6PA 1DIPA 2D2CC 1OVUA 1BCCJ 5AVTB 3NFQA 3IF4A 2FYNC 4GODA 1ZXGA 1NKNA 2DW3A 1L0NK 1WRGA 1BCCD 2N1TA 2R44A 1SFCA 2JEEA 4DCKA 1J1EB 1ZRTD 3L36A 3VOPA 5AW0B 3KYQA 1QX8A 2FXPA 1JB0J 1HUCA 3K5BA 3WU2E 2E42A 3L72E 1RE3C 1NTMK 1X9VA 3LIEA 3T97A 4H0LB 1URQD 1SVFA 1JY2N 5AVXB 1NTZE 1EZVD 3A2AA 1XTCC 1QL2A 1N7SA 2IBZG 3TGUE 2XU6A 2M3BA 2NPSC 2IPPA 1EXIA 1SQBG 2E76C 1Z56A 2W8ZA 2KSJA 1YJWP 1U7JA 3AECC 1JMBA 5DJTB 2GM4A 1VPCA 2FKWB 3N4XA 1RF1A 3HUSA 5AVYB 4ZKPA 2K3RA 4U7JA 5CCHC 1M8OB 2V7QH 2NZ2A 1AFOA 3CCUP 2D2CD 3AE7C 1L4AC 3CCSP 1G1IA 1N8RQ 2ZVNB 1BGYG 2O01H 4PD4I 2WTYA 1OZHA 2OTKE 2FFDA 1L0NG 1S72P 1UIIA 1Q86Q 2Q3EA 3CD6P 1N7LA 3RL0D 4AQRD 5H2FH 4EDFA 3W68A 3BCCE 3P8CD 1DEBA 5AW8B 4YXDC 4I7ZC 2Q7CA 1LTGC 1RH5B 1NTKE 1NTMG 2YKPA 3IN6A 1PPJE 4YTPC 1LT9B 4BWNA 2OYIC 3SWYA 2ITAA 1P84H 2NPSD 2Z5IA 1L0LJ 3M9HA 2IZ1A 2OYOA 2E76D 1HH0A 3VMZA 2KK7A 5APYA 1VF5B 2QJKB 2YKOA 3RK3C 1SQQK 2ZYGA 1BDDA 2BCCJ 3H32A 5AVVB 5KKZC 2IFNA 2WPVB 3H1KG 3PP5A 2BCCD 2IFMA 3CWBG 3Q2YA 3UIAA 2KS1A 3L73E 3S9OA 3B5NA 1K04A 3GF3A 2B87A 1L4AD 4IFFA 2KP8A 3A0BH 3MGNA 2B9BA 3G71P 1GL2A 2WSSH 1IK7A 1NAYA 1YJNP 4O9BA 2GUVA 2YIUB 1PGJA 4U3FJ 2M5AA 1FZCC 1BSHA 3BRTB 3GF7A 2K9JB 3CCRP 1FDOA 1KYOD 5H2FE 1ZRTE 4WWIA 1EDLA 1IC2A 1SS1A 4L74A 3CX5I 3VMXA 2W83C 1FJPA 2H43A 4I1LA 3RK2C 1H88A 1VQ4P 2O1JA 1M1JC 3H1KJ 1P84E 3HE4B 2K1AA 1EZVE 2WSEJ 2LXCB 2KI7B 5BU5A 3H1KD 4TT3H 2M0BA 3F5HA 1JTHB 4PV1C 2QJPB 4AYCA 1VQ7P 3CC7P 4DZOA 3TYYA 3EFGA 2W90A 2Y0EA 3PTZA 3H1JG 1SQQG 3M0DC 5APWA 2H88C 2XKMA 3WUVA 4LLHA 4UB6H 4LC1A 1VQOP 3ZDMA 4WY4B 4C7RA 2WVRA 3SWFA 3HD7C 5AW6B 3A0BE 3G3ZA 2E74C 4OWFA 1SFCB 1N73C 4OGQC 1N2DC 1W2BO 1JY3N 4HJGH 4ASVA 2CPSA 1NH4A 3C9IA 3I55P 2FYUK 5AVSB 2HODA 1VQ8P 1HJBA 1A02F 2KNCA 3Q3DA 1YHQP 3T97B 1Q82Q 3CC4P 3L75G 1X22A 1GW3A 1LTJA 1KFNA 1KYOH 3RK2D 2G3AA 1LNQA 3L71G 2ZXEB 3P8CE 3CMEP 1HGZA 2FY8A 1RE4A 2YXQB 1GTWA 1SQVJ 4PV1D 1DEEG 2I8DA 2A06D 2PRRA 3L74G 1SQQD 1YBKA 4NPDA 2Q9IA 1SQVD 1RF1B 2WSEH 3I56P 1L0LE 3HUSB 1KTMA 1K8AQ 3JCUH 3P32A 1JUNA 1D7MA 3V4WA 4UB8H 1H0TA 4UB6E 1FU1A 3AE9C 2BCCE 4GDOA 3AE2C 4ZKUA 2KLUA 2WPRA 1H8AA 4OH8B 5AW9B 3CPWO 2LR2A 3SSUA 1M90Q 1H89A 2RMZA 3AEDC 1EDKA 3BRVB 1RE3A 3VP9A 3NMDA 1OW8A 5KJ7D 1FJKA 4PD4D 2FFDB 1K73Q 3QH9A 1M1KQ 1SQPK 1S9KE 1S5LH 4JPZB 1KQFB 2V4HA 1KILB 3OA7A 1AVOA 1GU5A 2FYUG 4H44C 1IZNB 2NPSA 4U3FE 1OW6A 5KLVJ 2HYNA 5AW5B 2RN0A 1KYOE 4D6TJ 1W5CE 3ITKA 1M56D 1NJIQ 5KLVD 3H1LG 1URQC 3LW5J 1BE3J 4D6TD 3G4SP 2E5YA 4WB4A 2O1KA 4N6JA 1SQXJ 4JYCA 1NVOA 2XZRA 1U7MA 3GLMA 1Q2NA 4W7ZA 1GU4A 3PHLA 3TF5A 1SQXD 1YITP 1AVYA 1ZV8A 5CCHA 1EDJA 2CK3H 3E1RA 3AE6C 3CXHD 3JCUE 4L76A 1L4AA 5KAIH 1KFMA 1K05A 1IFMA 4YXWH 4UB8E 3H1HJ 4EYYQ 1LTBC 2YXRB 3B5NB 4H0LD 3C8VA 2B87B 1ZR2A 3H1HD 1GD2E 3KXDA 1KD1Q 1GL2B 1WT6A 1PGPA 3B71A 1GZLA 1G2CA 2M5AB 2OYHC 2P67A 1S5LE 4PD4H 2QJKC 2QSIA 2OYIA 4JYBA 5EFWB 4H44D 1SQPG 4JF7A 3A5TA 4H13C 3RL0C 1YQ3C 1S4XA 3MD0A 2QIWA 2A45H 3F89A 3AE1C 4JQ0D 1ZP0C 1PP9J 2KB7P 3AEBC 2OGUA 4XA4A 3AE4C 1PP9D 2VRSA 3MTUE 3H1IJ 1AA0A 2C9LY 1JM0A 3LW5H 3A7OA 3SFEC 3H1ID 3L70G 2A06E 3G9RA 3SFDC 1NAFA 2JWAA 3Q1MA 3KPEA 2LKMA 1SQVE 4KHXA 3GHGB 5KAIE 1Q7YQ 2FXOA 1IJDB 3HRNA 3USSA 2IDBA 3CXHH 2Q1KA 1LP1A 1NU1E 2JP3A 2QEXP 3I5CA 1FZCA 4DJGA 1OW7A 2J58A 1YTZT 1VL2A 3Q5SA 1S2EA 1M57D 2HODB 2QJYB 2Y9YA 2O3JA 3V2QA 1KZUB 5CCGC 1VF5D 2WPSA 1BSNA 1SP4A 2R5BA 4PD4E 3FXDA 5AW4B 1M1JA 1SLQA 4YPCA 4H13D 1IFNA 2E5TA 3B4SA 3CCQP 3D6ZA 4NPFX 4IL6H 4RJTA 3AEAC 3TDKA 1VQKP 5KTBA 3ABVC 5BU8B 1SQBJ 2IBZD 1KQSO 1X8YA 3CC2P 1SQBD 5KLVE 1EQ7A 1E5WA 4D6TE 3M0DA 3FWLA 1DX7A 1NTZK 2WSCJ 1BE3E 3FGAD 4XE5B 2ZAEB 3D70A 5TJHA 2D2CB 1LTAC 1SQXE 2L91A 2FYNB 3HD7A 4C46A 1H0TB 2WWWA 4DOJA 1KB9D 4XFJA 2WSFJ 4RKUJ 2CPBA 3H25A 1N73A 3CXHE 2KZJA 2M3EA 1X79B 3L37A 3AE8C 2KXPB 1KC8Q 2OTJP 1FZEA 1BGYJ 1R5LA 1DD4A 4R4LA 1NO4A 1L0NJ 2I1JA 1BGYD 3H1HE 5TISH 1L0ND 3L4FA 5CCGD 1J1DC 1GW4A 4GOEA 1AQ5A 3VYIA 3HE5A 2IX7C 2QRXA 1PGQA 5E79H 1BCCE 3S4RA 4GT1A 1NTMJ 1PL5A 1FZFA 1NTMD 4IL6E 4PJ0H 4IFDK 2HR3A 3R2PA 2UWJE 4N78D 1JY2P 1OVVA 1Y47A 2FYZA 1MFTA 5AW1B 2OARA 1XTGB 4C7NA 1T6AA 3L72G 2SPZA 1QLED 5APTA 2QM7A 4K3AA 1NTKK 1PP9E 3C1LA 3CWBJ 3V6IA 1P84I 3MP7B 2ZVOB 1L4AB 2HG5D 1NTZG 4DT0A 3H1IE 1KILC 1ZW0A 1LWUC 3CWBD 2KOGA 1LTTC 2I1KA 3EFFK 2K9YA 1NKZB 2WSCH 1PFIA 1LGHB 3TGUG 1OXZA 3HTKB 1KB9H 1S1CX 3U1AA 3P7KA 3VTPC 1YYCA 2WSFH 1DH3A 3MUDC 1G2CB 5TISE 1LT1A 2N1TB 3P8MC 2R5DA 4I7ZB 2Z4EA 3CCVP 1MZ9A 5APXA 2IYOA 2B88A 5KJ7C 1LTSC 4M3LA 1URQA 5E79E 2PGDA 4TLFA 1AQTA 1E79H 1FS0E 5KLIC 1KQGB 3M0AA 4PJ0E 1ZR4A 3RK3B 1QVFO 1HBWA 5KKZB 4ZMDA 3KDPB 2KZIA 3L35A 1VQPP 1N7SB 3V2NA 1YI2P 3G6EP 2IBZE 2AEJA 2JJLA 3O6QA 5CHXA 3H1JJ 5M1BA 2FBWC 1Y8AA 1SQQJ 1NTZD 1SQBE 3BCCG 2QM8A 2P58A 4WBAA 1FOSE 1K9MQ 1KORA 3M9QA 3H1JD 5CJ4A 1KILD 1JY2O 1NTKG 1PPJG 1J1EC 2GA1A 2Q6QA 1BDCA 1FZGA 1RF0C 1LP1B 2ZYAA 2R32A 1KN7A 2OYHA 1KB9E 2N9YB 4B86A 1IO4A 4H0LC 2N9BA 1R8EA 2K37A 1VQ5P 1FC2C 3VMAA 3IFMA 2G8YA 1BGYE 4Z1MH 5L8RJ 3RK2B 3L75J 1JCCA 2Z5HA 1L0NE 2AXCA 1M1JB 5BVZA 1JEKA 1S5LX 1EC5A 3L75D 3L73G 3AEEC 3L71J 2J59M 1KQLA 2GUSA 3EWKA 3JC22 1USEA 3L71D 1FBMA 3GHGC 2RKLA 1PGOA 2L5GB 2JWDA 3B5ND 1ZLLA 1NTME 2Y0DA 1PV3A 3M91A 3L74J 5CMZA 3BCCD 4N78E 5K5GB 1VQ9P 1GL2D 3L74D 2K9JA 4KT0J 1QL1A 1CSBA 1FDMA 1NTKD 2R3CA 1NGMB 2QJYC 3H32B 5CBNA 3HD7B 4OVNF 2P2UA 3H1KE 2E74B 3Q5RA 1N73B 4OGQB 2B89A 3PRJA 2R3SA 4KJMA 1EZVG 3HE4A 4W7YA 3CWBE 1DD3A 4A7PA 1Q81Q 2KS1B 4LGDE 1L0LK 5CCGA 2E75B 1GK4A 1RY3A 4R4MA 2XNDH 5AW7B 3EQ2A 3CCEP 1LT9C 5B5EH 2FYUJ 2JO1A 1GK6A 4CPGA 1JY3P 3AE5C 1AV1A 1TU3F 2HLOA 1T8ZA 2FYUD 3V5BA 1NWQA 3RBZA 1FAVA 1VF5C 4I6MC 1FE6A 3H1LJ 3RGUA 2H89C 1T3JA 3TNUA 2ZT9B 4Y99B 3SWKA 3GG2A 3CX5D 3H1LD 1HGVA 4HB1A 1X0TA 3U1CA 2MKVA 2P7JA 2OTLP 3MHVA 1QGKB 4C7NB
chains in the Genus database with same CATH topology
2WITA 4LC1A 2C9NY 3VMYA 1LTAC 2PP6A 4W80A 1GDTA 2HFED 4WY4B 3HD7A 1MV8A 4C46A 2WWWA 1JNMA 4DOJA 4C7RA 2HPCA 3SWFA 3V2RA 3HD7C 5AW6B 1LWUB 2CPBA 1N73A 3G3ZA 2FXMA 3OJAB 1X79B 1SFCB 3L37A 1N73C 1N2DC 2KYVA 2MJZA 1FZEA 1JY3N 1T3UA 1OWAA 2CPSA 1NH4A 3C9IA 2FYUK 5AVSB 1IFIA 2HODA 1NO4A 2WT7B 2Q5UA 1HJBA 5AW3B 2I1JA 3II6A 3E1IA 4GKGA 2Q3IA 1A02F 1G1JA 2PAJA 3L4FA 3VN0A 5CCGD 1J1DC 1CI6B 3VP8A 1GW4A 1AQ5A 1SQBK 3VYIA 1GW3A 3HE5A 2IX7C 1LTJA 1KFNA 3V4QA 3M06A 3RK2D 2WZ7A 4GT1A 1LTJC 4EIJA 3P8CE 2ZXEB 5CJ0A 3BVHA 3V2PA 1FZFA 1HGZA 1JTHA 1CW5A 1URQB 1FZBA 1YTZI 1W2EA 1RE4A 4IFDK 2YO2A 3R2PA 1GTWA 2W6AA 1RE4C 4N78D 1JY2P 3CL3D 2FYZA 2H7HA 2M8RA 2W6BA 3HE5B 4RESB 1LTJB 2Q9IA 5AW1B 2W27A 2OARA 1XTGB 2WSEH 5AVZB 4C7NA 1RF1B 3HUSB 5APQA 1LTIC 3HTKA 1JY3O 3P32A 1JUNA 5APTA 3B8EB 1NOHA 1VDFA 2QM7A 3LIDA 2BASA 1CZQA 1NTKK 4WY4A 3H6PA 3V4WA 5AVTB 3NFQA 4WY4C 1FU1A 2XDJA 1KILA 1LWUA 1NKNA 1L4AB 2HG5D 1L0NK 4ZKUA 4EOTA 1WRGA 2N1TA 2WPRA 1KILC 1LWUC 1SFCA 4OH8B 5AW9B 1H8AA 2KOGA 2A45I 1LTTC 3N7NA 2I1KA 2JEEA 1FZAA 1H89A 2N1TC 1NKZB 1J1EB 2WSCH 1PFIA 1SFCC 1LGHB 3L36A 3BRVB 3VOPA 1RE3A 5AW0B 1OXZA 3KYQA 3VP9A 3BASA 4IFMA 3HTKB 2WT7A 1HUCA 3NMDA 2E42A 1RE3C 1FJKA 5KJ7D 3U1AA 3P7KA 3VTPC 2FFDB 2E43A 1NTMK 1X9VA 3MUDA 1JO5A 3LIEA 1SQPK 1S9KE 1YYCA 2WSFH 3T97A 1DH3A 2OYHB 1CI6A 1URQD 1KILB 2XV5A 3OA7A 1G2CB 1GU5A 1SVFA 1JY2N 2N1TB 5AVXB 3P8MC 2R5DA 2Z4EA 3A2AA 1XTCC 1MZ9A 5APXA 1QL2A 5KJ7A 2YNYA 2NPSA 1FOSF 1SQVK 1N7SA 5KJ7C 2HYNA 5AW5B 1LTSC 4M3LA 2XU6A 3RL0B 2M3BA 2NPSC 1IK9A 1URQA 1N7SC 2IPPA 1IFDA 1NU1K 1URQC 4HYTB 1Z56A 5CCHD 3M0AA 2KSJA 4WB4A 2O1KA 4N6JA 1ZR4A 1JOCA 2GM4A 1VPCA 4JYCA 3RK3B 2XZRA 2FKWB 3N4XA 1HBWA 1RF1A 4W7ZA 1GU4A 3HUSA 3KDPB 5AVYB 3L35A 2NPSB 1RF1C 3NXSA 1HTLC 1N7SB 1ZV8A 2WPQA 3HUSC 3KQGA 3V2NA 4ZKPA 5CCHA 1S9KD 2JJLA 3CLQA 5CCHC 1AFOA 5CHXA 5APUA 1L4AA 2QM8A 1KFMA 4WBAA 1FOSE 2C0WA 1IFMA 4WY4D 1L4AC 3M9QA 1LTBC 5CJ4A 3B5NB 1G1IA 1KILD 1JY2O 1J1EC 1RF0A 2N1TD 1ZR2A 3O8ZA 2O01H 1GD2E 2WTYA 3CI9A 1SFCD 1FZGA 1HVVA 1RF0C 2FFDA 1GL2B 2R32A 1WT6A 3M9BA 5AW2B 2FFDC 1N7LA 3TK1A 3RL0D 5APVA 3WMM0 5KLVK 2OYHA 1GZLA 1G2CA 4AQRD 3A3YB 4B86A 2OYHC 1IO4A 1ZN5A 3MIWA 2P67A 3P8CD 1DEBA 2N9BA 2YMYA 5AW8B 2OYIA 2Q7CA 1LTGC 4JYBA 3RK3D 2YKPA 1SQXK 1LT9B 4HH2A 1N86A 3IFMA 2OYIC 4JF7A 3A5TA 3SWYA 4GIFA 3RK2B 3RL0C 1JCCA 2NPSD 2Z5HA 2Z5IA 5AVQB 1A02J 1N7SD 3M9HA 1M1JB 3MD0A 5BVZA 2A45H 2J59M 1HH0A 1KQLA 3VMZA 2GUSA 5APYA 3GHGA 2KB7P 2YKOA 2XNXA 2YO3A 3OAKA 3RK3C 1SQQK 1FBMA 3GHGC 1T2KC 3H32A 5AVVB 4XA4A 2OYIB 1J2JB 2IFNA 2VRSA 3MTUE 2L5GB 3PP5A 3B5ND 1ZLLA 2C9LY 3TNUB 3M91A 3U59A 3LW5H 3A7OA 5CMZA 2IFMA 2H8PD 1NHLA 4N78E 1MUUA 1GL2D 3UIAA 5AVUB 1M7LA 1NAFA 1QL1A 1CSBA 1FDMA 3B5NA 3KPEA 2LKMA 4KHXA 3GHGB 1L4AD 2R3CA 4IFFA 2KP8A 3NTNA 1IJDB 3HRNA 3B5NC 3MGNA 3H32B 1MFZA 3HD7B 2P2UA 2P1JA 1GL2A 2HPCB 3I5CA 1N73B 2ZFCA 1FZCA 5AVRB 4O9BA 1GL2C 2GUVA 2J58A 1FZCC 1YTZT 3HE4A 4W7YA 3BRTB 2YKQA 5APSA 4LGDE 1IFJA 2A45G 1L0LK 2HODB 5CCGA 1GK4A 1RY3A 1IC2A 3BATA 1LT9A 5AW7B 3V2QA 1KZUB 3EQ2A 5CCGC 1J1DB 2WPSA 3VMXA 1SP4A 1LT9C 2R5BA 1FJPA 2H43A 4Y99C 5AW4B 4I1LA 3RK2C 1M1JA 1SLQA 1H88A 1IFNA 2O1JA 1FZCB 1GK6A 1JY3P 1JMMA 2HLOA 1M1JC 1T8ZA 3HE4B 3V5BA 1NWQA 5KTBA 1HWTC 5BU5A 1FAVA 4I6MC 5BU8B 4AUWA 1JTHB 1JCDA 2POHA 1X8YA 1T3JA 4AYCA 4N3YB 3TNUA 1T2KD 4Y99B 2C0XA 2KLVA 4DZOA 1EQ7A 3TYYA 1E5WA 1HGVA 3M0DA 3HD7D 3EFGA 3U1CA 5AVWB 1DX7A 3IR9A 2P7JA 1NTZK 3M0DC 5APWA 4I2LC 3TSIA 2XKMA 4XE5B 4C7NB 4LLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WY4 A;  1GL2 D;  1L4A A;  2PP6 A;  4W80 A;  3B5N A;  4WY4 C;  4WY4 D;  2HFE D;  2XDJ A;  4WY4 B;  1KIL A;  1L4A C;  1L4A D;  3HD7 A;  1L4A B;  2HG5 D;  3B5N C;  2N1T A;  3B5N B;  1KIL C;  1KIL D;  1SFC A;  3HD7 C;  4OH8 B;  2KOG A;  3HD7 B;  2N1T C;  2N1T D;  1GL2 A;  1SFC C;  1SFC D;  1SFC B;  1HVV A;  3VOP A;  1GL2 C;  3KYQ A;  3HTK B;  1GL2 B;  5KJ7 D;  4W7Y A;  3RL0 D;  4LGD E;  5CCG A;  1URQ D;  1KIL B;  2YMY A;  2N1T B;  5CCG C;  5CCG D;  5KJ7 A;  3RK3 D;  2NPS A;  4JF7 A;  3RK2 C;  3RK2 D;  1N7S A;  3RK2 B;  2WZ7 A;  5KJ7 C;  3RL0 C;  3RL0 B;  2NPS C;  2NPS D;  3P8C E;  1URQ A;  1N7S C;  1N7S D;  1JTH A;  1URQ C;  1URQ B;  5CCH D;  1JTH B;  3RK3 C;  3RK3 B;  1T3J A;  4W7Z A;  2M8R A;  3PP5 A;  3B5N D;  2NPS B;  3HD7 D;  1N7S B;  5CCH A;  1XTG B;  2H8P D;  3M0D C;  1NHL A;  4N78 E;  5CCH C;  3TSI A; 
#chains in the Genus database with same CATH topology
 2C9N Y;  3KHU A;  1MV8 A;  3PJS K;  1JNM A;  2HPC A;  3FX0 A;  2QVA A;  1P84 D;  3OJA B;  2BEQ D;  2ZYD A;  2YIU C;  2J5U A;  1OWA A;  4GOF A;  4ZNC A;  3H1J E;  1SQQ E;  1IFI A;  1KIL E;  3AEG C;  2Q5U A;  5AW3 B;  4GKG A;  4RO0 A;  4BRY A;  2PAJ A;  2W6J H;  4IOI H;  1QEX A;  3VP8 A;  1EDI A;  4H44 B;  2IZ0 A;  3M06 A;  1L0L G;  1PZQ A;  5B5E E;  4ASW A;  1SQP J;  3Q5P A;  5CJ0 A;  3BVH A;  1KV4 A;  1VQM P;  1CW5 A;  1URQ B;  1FZB A;  1SQP D;  1W2E A;  2BCC G;  2KNC B;  2W6A A;  2QJP C;  2PFX A;  2H7H A;  2M8R A;  2W6B A;  3L75 E;  4RES B;  2WQY C;  1LTJ B;  2Y0C A;  4IL6 X;  3CMA P;  2W27 A;  1LTI C;  5CBO A;  1JY3 O;  2LXB A;  3B8E B;  1NOH A;  2ZJS E;  3L71 E;  3LID A;  1CZQ A;  3CX5 H;  1VQN P;  2YMK A;  3O6Q B;  3L70 J;  4WY4 C;  2XDJ A;  1AJY A;  1KIL A;  1LWU A;  1VQL P;  4EOT A;  3AEF C;  3L70 D;  3FXE A;  2A45 I;  3N7N A;  1FZA A;  2N1T C;  3L74 E;  4U3F G;  1SFC C;  1HF9 A;  3BAS A;  4IFM A;  2WT7 A;  4JBZ A;  4L73 A;  2JR8 A;  2E43 A;  3A0H H;  3D71 A;  3MUD A;  1JO5 A;  2AEM A;  2OYH B;  1CI6 A;  2XV5 A;  4K35 A;  1L0L D;  4L75 A;  1RQU A;  5KAF H;  5KJ7 A;  2YNY A;  1FOS F;  1VQ6 P;  1SQV K;  2K88 A;  4H13 B;  1IFP A;  3RL0 B;  3CXH I;  1IK9 A;  1N7S C;  2AXT H;  1IFD A;  1NU1 K;  4HYT B;  5CCH D;  3OW2 O;  1JOC A;  4BXL A;  2FYU E;  2OQQ A;  3CCL P;  2NPS B;  1RF1 C;  3FWN A;  3NXS A;  1HTL C;  2WPQ A;  3KQG A;  3HUS C;  3E7K A;  1S9K D;  1MKM A;  3CLQ A;  2E76 B;  3IAO A;  5APU A;  3CX5 E;  3H1L E;  2C0W A;  4WY4 D;  5B66 H;  4U3F D;  1NYH A;  2JKV A;  1EXJ A;  1RF0 A;  2N1T D;  3O8Z A;  2RH0 A;  3CI9 A;  1SFC D;  1HVV A;  4WVZ A;  1RHZ B;  3M9B A;  5AW2 B;  2FFD C;  3TK1 A;  3WMM 0;  5APV A;  5KLV K;  1ZME C;  1EZV I;  3KZI H;  3A3Y B;  1ZN5 A;  3A0H E;  3MIW A;  1UIX A;  2QA4 P;  2YMY A;  3RK3 D;  2NRG A;  1SQX K;  1L2P A;  4HH2 A;  1N86 A;  5KAF E;  1OMI A;  4GIF A;  2WMM A;  3CCM P;  5AVQ B;  1A02 J;  1N7S D;  2A06 G;  5GTI H;  1USD A;  1LJ2 A;  2AXT E;  1SQV G;  3GMA A;  3GHG A;  2IYP A;  2XNX A;  2YO3 A;  3OAK A;  2KUB A;  1T2K C;  2OYI B;  1J2J B;  1NU1 G;  1Y9B A;  1R5S A;  3TNU B;  3U59 A;  1SQP E;  3MZW B;  2QG4 A;  4QMA A;  2H8P D;  1U57 A;  1NHL A;  1MUU A;  5AVU B;  1M7L A;  3L72 J;  3QWO C;  3NTN A;  3B5N C;  5GTH H;  3GW6 A;  3L72 D;  5C39 A;  5B66 E;  2E75 C;  3PH0 A;  3RL0 g;  1MFZ A;  1NTZ J;  1PIX A;  2P1J A;  2HPC B;  1OVR A;  2ZFC A;  5AVR B;  1GL2 C;  1KMI Z;  3TGU J;  3L70 E;  2YKQ A;  5APS A;  1IFJ A;  2IBZ I;  2QE7 H;  2A45 G;  2Y9Z A;  3TGU D;  3KZI E;  1WMK A;  3RBX A;  1HJ0 A;  3BAT A;  1GMJ A;  1LT9 A;  4Y28 J;  1J1D B;  3WUU A;  4BRY B;  5KLV G;  4D6T G;  2ZT9 C;  4Y99 C;  3S1K A;  1FDI A;  2AEF A;  3WUT A;  1FZC B;  1JMM A;  3JSV C;  1BE3 G;  3AE3 C;  1NU1 J;  1OX3 A;  1SQX G;  5GTI E;  1HWT C;  1OIP A;  1NU1 D;  4AUW A;  1KB9 I;  1JCD A;  1Q90 D;  2POH A;  1T2K D;  4N3Y B;  2C0X A;  2KLV A;  1YJ9 P;  3PLN A;  3HD7 D;  4MN4 C;  1OFC X;  5AVW B;  2E74 D;  3IR9 A;  4I2L C;  3TSI A;  1RQV A;  4OGQ D;  4NPE A;  2WIT A;  3VMY A;  3H1H G;  2PP6 A;  4W80 A;  1GDT A;  4PV1 B;  2HFE D;  3R4Y A;  5DJU B;  3BCC J;  1ZOY C;  3CCJ P;  2E75 D;  3V2R A;  1LWU B;  5GTH E;  2FXM A;  1BCC G;  1NTK J;  3WU2 H;  2KYV A;  2MJZ A;  1T3U A;  1KYO I;  2JDI H;  1PPJ D;  2ZXX A;  2WT7 B;  3II6 A;  3E1I A;  2Q3I A;  1G1J A;  4HKZ H;  3D6Y A;  3VN0 A;  1CI6 B;  1S3J A;  1SQB K;  1BE3 D;  2ZT9 D;  3V4Q A;  2P10 A;  2WZ7 A;  2KIK A;  1LTJ C;  4EIJ A;  3V2P A;  2O01 N;  1PP9 G;  2BEZ F;  1JTH A;  3RK3 E;  1YTZ I;  5KLI B;  1QVG O;  2YO2 A;  2V7Q J;  3L73 J;  3H1I G;  1RE4 C;  3CL3 D;  3L73 D;  3HE5 B;  1YIJ P;  5AVZ B;  5APQ A;  3HTK A;  3W67 A;  4EI2 A;  1YQ4 C;  1VDF A;  2O01 J;  2KSE A;  2BAS A;  4WY4 A;  3H6P A;  1DIP A;  2D2C C;  1OVU A;  1BCC J;  5AVT B;  3NFQ A;  3IF4 A;  2FYN C;  4GOD A;  1ZXG A;  1NKN A;  2DW3 A;  1L0N K;  1WRG A;  1BCC D;  2N1T A;  2R44 A;  1SFC A;  2JEE A;  4DCK A;  1J1E B;  1ZRT D;  3L36 A;  3VOP A;  5AW0 B;  3KYQ A;  1QX8 A;  2FXP A;  1JB0 J;  1HUC A;  3K5B A;  3WU2 E;  2E42 A;  3L72 E;  1RE3 C;  1NTM K;  1X9V A;  3LIE A;  3T97 A;  4H0L B;  1URQ D;  1SVF A;  1JY2 N;  5AVX B;  1NTZ E;  1EZV D;  3A2A A;  1XTC C;  1QL2 A;  1N7S A;  2IBZ G;  3TGU E;  2XU6 A;  2M3B A;  2NPS C;  2IPP A;  1EXI A;  1SQB G;  2E76 C;  1Z56 A;  2W8Z A;  2KSJ A;  1YJW P;  1U7J A;  3AEC C;  1JMB A;  5DJT B;  2GM4 A;  1VPC A;  2FKW B;  3N4X A;  1RF1 A;  3HUS A;  5AVY B;  4ZKP A;  2K3R A;  4U7J A;  5CCH C;  1M8O B;  2V7Q H;  2NZ2 A;  1AFO A;  3CCU P;  2D2C D;  3AE7 C;  1L4A C;  3CCS P;  1G1I A;  1N8R Q;  2ZVN B;  1BGY G;  2O01 H;  4PD4 I;  2WTY A;  1OZH A;  2OTK E;  2FFD A;  1L0N G;  1S72 P;  1UII A;  1Q86 Q;  2Q3E A;  3CD6 P;  1N7L A;  3RL0 D;  4AQR D;  5H2F H;  4EDF A;  3W68 A;  3BCC E;  3P8C D;  1DEB A;  5AW8 B;  4YXD C;  4I7Z C;  2Q7C A;  1LTG C;  1RH5 B;  1NTK E;  1NTM G;  2YKP A;  3IN6 A;  1PPJ E;  4YTP C;  1LT9 B;  4BWN A;  2OYI C;  3SWY A;  2ITA A;  1P84 H;  2NPS D;  2Z5I A;  1L0L J;  3M9H A;  2IZ1 A;  2OYO A;  2E76 D;  1HH0 A;  3VMZ A;  2KK7 A;  5APY A;  1VF5 B;  2QJK B;  2YKO A;  3RK3 C;  1SQQ K;  2ZYG A;  1BDD A;  2BCC J;  3H32 A;  5AVV B;  5KKZ C;  2IFN A;  2WPV B;  3H1K G;  3PP5 A;  2BCC D;  2IFM A;  3CWB G;  3Q2Y A;  3UIA A;  2KS1 A;  3L73 E;  3S9O A;  3B5N A;  1K04 A;  3GF3 A;  2B87 A;  1L4A D;  4IFF A;  2KP8 A;  3A0B H;  3MGN A;  2B9B A;  3G71 P;  1GL2 A;  2WSS H;  1IK7 A;  1NAY A;  1YJN P;  4O9B A;  2GUV A;  2YIU B;  1PGJ A;  4U3F J;  2M5A A;  1FZC C;  1BSH A;  3BRT B;  3GF7 A;  2K9J B;  3CCR P;  1FDO A;  1KYO D;  5H2F E;  1ZRT E;  4WWI A;  1EDL A;  1IC2 A;  1SS1 A;  4L74 A;  3CX5 I;  3VMX A;  2W83 C;  1FJP A;  2H43 A;  4I1L A;  3RK2 C;  1H88 A;  1VQ4 P;  2O1J A;  1M1J C;  3H1K J;  1P84 E;  3HE4 B;  2K1A A;  1EZV E;  2WSE J;  2LXC B;  2KI7 B;  5BU5 A;  3H1K D;  4TT3 H;  2M0B A;  3F5H A;  1JTH B;  4PV1 C;  2QJP B;  4AYC A;  1VQ7 P;  3CC7 P;  4DZO A;  3TYY A;  3EFG A;  2W90 A;  2Y0E A;  3PTZ A;  3H1J G;  1SQQ G;  3M0D C;  5APW A;  2H88 C;  2XKM A;  3WUV A;  4LLH A;  4UB6 H;  4LC1 A;  1VQO P;  3ZDM A;  4WY4 B;  4C7R A;  2WVR A;  3SWF A;  3HD7 C;  5AW6 B;  3A0B E;  3G3Z A;  2E74 C;  4OWF A;  1SFC B;  1N73 C;  4OGQ C;  1N2D C;  1W2B O;  1JY3 N;  4HJG H;  4ASV A;  2CPS A;  1NH4 A;  3C9I A;  3I55 P;  2FYU K;  5AVS B;  2HOD A;  1VQ8 P;  1HJB A;  1A02 F;  2KNC A;  3Q3D A;  1YHQ P;  3T97 B;  1Q82 Q;  3CC4 P;  3L75 G;  1X22 A;  1GW3 A;  1LTJ A;  1KFN A;  1KYO H;  3RK2 D;  2G3A A;  1LNQ A;  3L71 G;  2ZXE B;  3P8C E;  3CME P;  1HGZ A;  2FY8 A;  1RE4 A;  2YXQ B;  1GTW A;  1SQV J;  4PV1 D;  1DEE G;  2I8D A;  2A06 D;  2PRR A;  3L74 G;  1SQQ D;  1YBK A;  4NPD A;  2Q9I A;  1SQV D;  1RF1 B;  2WSE H;  3I56 P;  1L0L E;  3HUS B;  1KTM A;  1K8A Q;  3JCU H;  3P32 A;  1JUN A;  1D7M A;  3V4W A;  4UB8 H;  1H0T A;  4UB6 E;  1FU1 A;  3AE9 C;  2BCC E;  4GDO A;  3AE2 C;  4ZKU A;  2KLU A;  2WPR A;  1H8A A;  4OH8 B;  5AW9 B;  3CPW O;  2LR2 A;  3SSU A;  1M90 Q;  1H89 A;  2RMZ A;  3AED C;  1EDK A;  3BRV B;  1RE3 A;  3VP9 A;  3NMD A;  1OW8 A;  5KJ7 D;  1FJK A;  4PD4 D;  2FFD B;  1K73 Q;  3QH9 A;  1M1K Q;  1SQP K;  1S9K E;  1S5L H;  4JPZ B;  1KQF B;  2V4H A;  1KIL B;  3OA7 A;  1AVO A;  1GU5 A;  2FYU G;  4H44 C;  1IZN B;  2NPS A;  4U3F E;  1OW6 A;  5KLV J;  2HYN A;  5AW5 B;  2RN0 A;  1KYO E;  4D6T J;  1W5C E;  3ITK A;  1M56 D;  1NJI Q;  5KLV D;  3H1L G;  1URQ C;  3LW5 J;  1BE3 J;  4D6T D;  3G4S P;  2E5Y A;  4WB4 A;  2O1K A;  4N6J A;  1SQX J;  4JYC A;  1NVO A;  2XZR A;  1U7M A;  3GLM A;  1Q2N A;  4W7Z A;  1GU4 A;  3PHL A;  3TF5 A;  1SQX D;  1YIT P;  1AVY A;  1ZV8 A;  5CCH A;  1EDJ A;  2CK3 H;  3E1R A;  3AE6 C;  3CXH D;  3JCU E;  4L76 A;  1L4A A;  5KAI H;  1KFM A;  1K05 A;  1IFM A;  4YXW H;  4UB8 E;  3H1H J;  4EYY Q;  1LTB C;  2YXR B;  3B5N B;  4H0L D;  3C8V A;  2B87 B;  1ZR2 A;  3H1H D;  1GD2 E;  3KXD A;  1KD1 Q;  1GL2 B;  1WT6 A;  1PGP A;  3B71 A;  1GZL A;  1G2C A;  2M5A B;  2OYH C;  2P67 A;  1S5L E;  4PD4 H;  2QJK C;  2QSI A;  2OYI A;  4JYB A;  5EFW B;  4H44 D;  1SQP G;  4JF7 A;  3A5T A;  4H13 C;  3RL0 C;  1YQ3 C;  1S4X A;  3MD0 A;  2QIW A;  2A45 H;  3F89 A;  3AE1 C;  4JQ0 D;  1ZP0 C;  1PP9 J;  2KB7 P;  3AEB C;  2OGU A;  4XA4 A;  3AE4 C;  1PP9 D;  2VRS A;  3MTU E;  3H1I J;  1AA0 A;  2C9L Y;  1JM0 A;  3LW5 H;  3A7O A;  3SFE C;  3H1I D;  3L70 G;  2A06 E;  3G9R A;  3SFD C;  1NAF A;  2JWA A;  3Q1M A;  3KPE A;  2LKM A;  1SQV E;  4KHX A;  3GHG B;  5KAI E;  1Q7Y Q;  2FXO A;  1IJD B;  3HRN A;  3USS A;  2IDB A;  3CXH H;  2Q1K A;  1LP1 A;  1NU1 E;  2JP3 A;  2QEX P;  3I5C A;  1FZC A;  4DJG A;  1OW7 A;  2J58 A;  1YTZ T;  1VL2 A;  3Q5S A;  1S2E A;  1M57 D;  2HOD B;  2QJY B;  2Y9Y A;  2O3J A;  3V2Q A;  1KZU B;  5CCG C;  1VF5 D;  2WPS A;  1BSN A;  1SP4 A;  2R5B A;  4PD4 E;  3FXD A;  5AW4 B;  1M1J A;  1SLQ A;  4YPC A;  4H13 D;  1IFN A;  2E5T A;  3B4S A;  3CCQ P;  3D6Z A;  4NPF X;  4IL6 H;  4RJT A;  3AEA C;  3TDK A;  1VQK P;  5KTB A;  3ABV C;  5BU8 B;  1SQB J;  2IBZ D;  1KQS O;  1X8Y A;  3CC2 P;  1SQB D;  5KLV E;  1EQ7 A;  1E5W A;  4D6T E;  3M0D A;  3FWL A;  1DX7 A;  1NTZ K;  2WSC J;  1BE3 E;  3FGA D;  4XE5 B;  2ZAE B;  3D70 A;  5TJH A;  2D2C B;  1LTA C;  1SQX E;  2L91 A;  2FYN B;  3HD7 A;  4C46 A;  1H0T B;  2WWW A;  4DOJ A;  1KB9 D;  4XFJ A;  2WSF J;  4RKU J;  2CPB A;  3H25 A;  1N73 A;  3CXH E;  2KZJ A;  2M3E A;  1X79 B;  3L37 A;  3AE8 C;  2KXP B;  1KC8 Q;  2OTJ P;  1FZE A;  1BGY J;  1R5L A;  1DD4 A;  4R4L A;  1NO4 A;  1L0N J;  2I1J A;  1BGY D;  3H1H E;  5TIS H;  1L0N D;  3L4F A;  5CCG D;  1J1D C;  1GW4 A;  4GOE A;  1AQ5 A;  3VYI A;  3HE5 A;  2IX7 C;  2QRX A;  1PGQ A;  5E79 H;  1BCC E;  3S4R A;  4GT1 A;  1NTM J;  1PL5 A;  1FZF A;  1NTM D;  4IL6 E;  4PJ0 H;  4IFD K;  2HR3 A;  3R2P A;  2UWJ E;  4N78 D;  1JY2 P;  1OVV A;  1Y47 A;  2FYZ A;  1MFT A;  5AW1 B;  2OAR A;  1XTG B;  4C7N A;  1T6A A;  3L72 G;  2SPZ A;  1QLE D;  5APT A;  2QM7 A;  4K3A A;  1NTK K;  1PP9 E;  3C1L A;  3CWB J;  3V6I A;  1P84 I;  3MP7 B;  2ZVO B;  1L4A B;  2HG5 D;  1NTZ G;  4DT0 A;  3H1I E;  1KIL C;  1ZW0 A;  1LWU C;  3CWB D;  2KOG A;  1LTT C;  2I1K A;  3EFF K;  2K9Y A;  1NKZ B;  2WSC H;  1PFI A;  1LGH B;  3TGU G;  1OXZ A;  3HTK B;  1KB9 H;  1S1C X;  3U1A A;  3P7K A;  3VTP C;  1YYC A;  2WSF H;  1DH3 A;  3MUD C;  1G2C B;  5TIS E;  1LT1 A;  2N1T B;  3P8M C;  2R5D A;  4I7Z B;  2Z4E A;  3CCV P;  1MZ9 A;  5APX A;  2IYO A;  2B88 A;  5KJ7 C;  1LTS C;  4M3L A;  1URQ A;  5E79 E;  2PGD A;  4TLF A;  1AQT A;  1E79 H;  1FS0 E;  5KLI C;  1KQG B;  3M0A A;  4PJ0 E;  1ZR4 A;  3RK3 B;  1QVF O;  1HBW A;  5KKZ B;  4ZMD A;  3KDP B;  2KZI A;  3L35 A;  1VQP P;  1N7S B;  3V2N A;  1YI2 P;  3G6E P;  2IBZ E;  2AEJ A;  2JJL A;  3O6Q A;  5CHX A;  3H1J J;  5M1B A;  2FBW C;  1Y8A A;  1SQQ J;  1NTZ D;  1SQB E;  3BCC G;  2QM8 A;  2P58 A;  4WBA A;  1FOS E;  1K9M Q;  1KOR A;  3M9Q A;  3H1J D;  5CJ4 A;  1KIL D;  1JY2 O;  1NTK G;  1PPJ G;  1J1E C;  2GA1 A;  2Q6Q A;  1BDC A;  1FZG A;  1RF0 C;  1LP1 B;  2ZYA A;  2R32 A;  1KN7 A;  2OYH A;  1KB9 E;  2N9Y B;  4B86 A;  1IO4 A;  4H0L C;  2N9B A;  1R8E A;  2K37 A;  1VQ5 P;  1FC2 C;  3VMA A;  3IFM A;  2G8Y A;  1BGY E;  4Z1M H;  5L8R J;  3RK2 B;  3L75 J;  1JCC A;  2Z5H A;  1L0N E;  2AXC A;  1M1J B;  5BVZ A;  1JEK A;  1S5L X;  1EC5 A;  3L75 D;  3L73 G;  3AEE C;  3L71 J;  2J59 M;  1KQL A;  2GUS A;  3EWK A;  3JC2 2;  1USE A;  3L71 D;  1FBM A;  3GHG C;  2RKL A;  1PGO A;  2L5G B;  2JWD A;  3B5N D;  1ZLL A;  1NTM E;  2Y0D A;  1PV3 A;  3M91 A;  3L74 J;  5CMZ A;  3BCC D;  4N78 E;  5K5G B;  1VQ9 P;  1GL2 D;  3L74 D;  2K9J A;  4KT0 J;  1QL1 A;  1CSB A;  1FDM A;  1NTK D;  2R3C A;  1NGM B;  2QJY C;  3H32 B;  5CBN A;  3HD7 B;  4OVN F;  2P2U A;  3H1K E;  2E74 B;  3Q5R A;  1N73 B;  4OGQ B;  2B89 A;  3PRJ A;  2R3S A;  4KJM A;  1EZV G;  3HE4 A;  4W7Y A;  3CWB E;  1DD3 A;  4A7P A;  1Q81 Q;  2KS1 B;  4LGD E;  1L0L K;  5CCG A;  2E75 B;  1GK4 A;  1RY3 A;  4R4M A;  2XND H;  5AW7 B;  3EQ2 A;  3CCE P;  1LT9 C;  5B5E H;  2FYU J;  2JO1 A;  1GK6 A;  4CPG A;  1JY3 P;  3AE5 C;  1AV1 A;  1TU3 F;  2HLO A;  1T8Z A;  2FYU D;  3V5B A;  1NWQ A;  3RBZ A;  1FAV A;  1VF5 C;  4I6M C;  1FE6 A;  3H1L J;  3RGU A;  2H89 C;  1T3J A;  3TNU A;  2ZT9 B;  4Y99 B;  3SWK A;  3GG2 A;  3CX5 D;  3H1L D;  1HGV A;  4HB1 A;  1X0T A;  3U1C A;  2MKV A;  2P7J A;  2OTL P;  3MHV A;  1QGK B;  4C7N B; 
#chains in the Genus database with same CATH homology
 2WIT A;  4LC1 A;  2C9N Y;  3VMY A;  1LTA C;  2PP6 A;  4W80 A;  1GDT A;  2HFE D;  4WY4 B;  3HD7 A;  1MV8 A;  4C46 A;  2WWW A;  1JNM A;  4DOJ A;  4C7R A;  2HPC A;  3SWF A;  3V2R A;  3HD7 C;  5AW6 B;  1LWU B;  2CPB A;  1N73 A;  3G3Z A;  2FXM A;  3OJA B;  1X79 B;  1SFC B;  3L37 A;  1N73 C;  1N2D C;  2KYV A;  2MJZ A;  1FZE A;  1JY3 N;  1T3U A;  1OWA A;  2CPS A;  1NH4 A;  3C9I A;  2FYU K;  5AVS B;  1IFI A;  2HOD A;  1NO4 A;  2WT7 B;  2Q5U A;  1HJB A;  5AW3 B;  2I1J A;  3II6 A;  3E1I A;  4GKG A;  2Q3I A;  1A02 F;  1G1J A;  2PAJ A;  3L4F A;  3VN0 A;  5CCG D;  1J1D C;  1CI6 B;  3VP8 A;  1GW4 A;  1AQ5 A;  1SQB K;  3VYI A;  1GW3 A;  3HE5 A;  2IX7 C;  1LTJ A;  1KFN A;  3V4Q A;  3M06 A;  3RK2 D;  2WZ7 A;  4GT1 A;  1LTJ C;  4EIJ A;  3P8C E;  2ZXE B;  5CJ0 A;  3BVH A;  3V2P A;  1FZF A;  1HGZ A;  1JTH A;  1CW5 A;  1URQ B;  1FZB A;  1YTZ I;  1W2E A;  1RE4 A;  4IFD K;  2YO2 A;  3R2P A;  1GTW A;  2W6A A;  1RE4 C;  4N78 D;  1JY2 P;  3CL3 D;  2FYZ A;  2H7H A;  2M8R A;  2W6B A;  3HE5 B;  4RES B;  1LTJ B;  2Q9I A;  5AW1 B;  2W27 A;  2OAR A;  1XTG B;  2WSE H;  5AVZ B;  4C7N A;  1RF1 B;  3HUS B;  5APQ A;  1LTI C;  3HTK A;  1JY3 O;  3P32 A;  1JUN A;  5APT A;  3B8E B;  1NOH A;  1VDF A;  2QM7 A;  3LID A;  2BAS A;  1CZQ A;  1NTK K;  4WY4 A;  3H6P A;  3V4W A;  5AVT B;  3NFQ A;  4WY4 C;  1FU1 A;  2XDJ A;  1KIL A;  1LWU A;  1NKN A;  1L4A B;  2HG5 D;  1L0N K;  4ZKU A;  4EOT A;  1WRG A;  2N1T A;  2WPR A;  1KIL C;  1LWU C;  1SFC A;  4OH8 B;  5AW9 B;  1H8A A;  2KOG A;  2A45 I;  1LTT C;  3N7N A;  2I1K A;  2JEE A;  1FZA A;  1H89 A;  2N1T C;  1NKZ B;  1J1E B;  2WSC H;  1PFI A;  1SFC C;  1LGH B;  3L36 A;  3BRV B;  3VOP A;  1RE3 A;  5AW0 B;  1OXZ A;  3KYQ A;  3VP9 A;  3BAS A;  4IFM A;  3HTK B;  2WT7 A;  1HUC A;  3NMD A;  2E42 A;  1RE3 C;  1FJK A;  5KJ7 D;  3U1A A;  3P7K A;  3VTP C;  2FFD B;  2E43 A;  1NTM K;  1X9V A;  3MUD A;  1JO5 A;  3LIE A;  1SQP K;  1S9K E;  1YYC A;  2WSF H;  3T97 A;  1DH3 A;  2OYH B;  1CI6 A;  1URQ D;  1KIL B;  2XV5 A;  3OA7 A;  1G2C B;  1GU5 A;  1SVF A;  1JY2 N;  2N1T B;  5AVX B;  3P8M C;  2R5D A;  2Z4E A;  3A2A A;  1XTC C;  1MZ9 A;  5APX A;  1QL2 A;  5KJ7 A;  2YNY A;  2NPS A;  1FOS F;  1SQV K;  1N7S A;  5KJ7 C;  2HYN A;  5AW5 B;  1LTS C;  4M3L A;  2XU6 A;  3RL0 B;  2M3B A;  2NPS C;  1IK9 A;  1URQ A;  1N7S C;  2IPP A;  1IFD A;  1NU1 K;  1URQ C;  4HYT B;  1Z56 A;  5CCH D;  3M0A A;  2KSJ A;  4WB4 A;  2O1K A;  4N6J A;  1ZR4 A;  1JOC A;  2GM4 A;  1VPC A;  4JYC A;  3RK3 B;  2XZR A;  2FKW B;  3N4X A;  1HBW A;  1RF1 A;  4W7Z A;  1GU4 A;  3HUS A;  3KDP B;  5AVY B;  3L35 A;  2NPS B;  1RF1 C;  3NXS A;  1HTL C;  1N7S B;  1ZV8 A;  2WPQ A;  3HUS C;  3KQG A;  3V2N A;  4ZKP A;  5CCH A;  1S9K D;  2JJL A;  3CLQ A;  5CCH C;  1AFO A;  5CHX A;  5APU A;  1L4A A;  2QM8 A;  1KFM A;  4WBA A;  1FOS E;  2C0W A;  1IFM A;  4WY4 D;  1L4A C;  3M9Q A;  1LTB C;  5CJ4 A;  3B5N B;  1G1I A;  1KIL D;  1JY2 O;  1J1E C;  1RF0 A;  2N1T D;  1ZR2 A;  3O8Z A;  2O01 H;  1GD2 E;  2WTY A;  3CI9 A;  1SFC D;  1FZG A;  1HVV A;  1RF0 C;  2FFD A;  1GL2 B;  2R32 A;  1WT6 A;  3M9B A;  5AW2 B;  2FFD C;  1N7L A;  3TK1 A;  3RL0 D;  5APV A;  3WMM 0;  5KLV K;  2OYH A;  1GZL A;  1G2C A;  4AQR D;  3A3Y B;  4B86 A;  2OYH C;  1IO4 A;  1ZN5 A;  3MIW A;  2P67 A;  3P8C D;  1DEB A;  2N9B A;  2YMY A;  5AW8 B;  2OYI A;  2Q7C A;  1LTG C;  4JYB A;  3RK3 D;  2YKP A;  1SQX K;  1LT9 B;  4HH2 A;  1N86 A;  3IFM A;  2OYI C;  4JF7 A;  3A5T A;  3SWY A;  4GIF A;  3RK2 B;  3RL0 C;  1JCC A;  2NPS D;  2Z5H A;  2Z5I A;  5AVQ B;  1A02 J;  1N7S D;  3M9H A;  1M1J B;  3MD0 A;  5BVZ A;  2A45 H;  2J59 M;  1HH0 A;  1KQL A;  3VMZ A;  2GUS A;  5APY A;  3GHG A;  2KB7 P;  2YKO A;  2XNX A;  2YO3 A;  3OAK A;  3RK3 C;  1SQQ K;  1FBM A;  3GHG C;  1T2K C;  3H32 A;  5AVV B;  4XA4 A;  2OYI B;  1J2J B;  2IFN A;  2VRS A;  3MTU E;  2L5G B;  3PP5 A;  3B5N D;  1ZLL A;  2C9L Y;  3TNU B;  3M91 A;  3U59 A;  3LW5 H;  3A7O A;  5CMZ A;  2IFM A;  2H8P D;  1NHL A;  4N78 E;  1MUU A;  1GL2 D;  3UIA A;  5AVU B;  1M7L A;  1NAF A;  1QL1 A;  1CSB A;  1FDM A;  3B5N A;  3KPE A;  2LKM A;  4KHX A;  3GHG B;  1L4A D;  2R3C A;  4IFF A;  2KP8 A;  3NTN A;  1IJD B;  3HRN A;  3B5N C;  3MGN A;  3H32 B;  1MFZ A;  3HD7 B;  2P2U A;  2P1J A;  1GL2 A;  2HPC B;  3I5C A;  1N73 B;  2ZFC A;  1FZC A;  5AVR B;  4O9B A;  1GL2 C;  2GUV A;  2J58 A;  1FZC C;  1YTZ T;  3HE4 A;  4W7Y A;  3BRT B;  2YKQ A;  5APS A;  4LGD E;  1IFJ A;  2A45 G;  1L0L K;  2HOD B;  5CCG A;  1GK4 A;  1RY3 A;  1IC2 A;  3BAT A;  1LT9 A;  5AW7 B;  3V2Q A;  1KZU B;  3EQ2 A;  5CCG C;  1J1D B;  2WPS A;  3VMX A;  1SP4 A;  1LT9 C;  2R5B A;  1FJP A;  2H43 A;  4Y99 C;  5AW4 B;  4I1L A;  3RK2 C;  1M1J A;  1SLQ A;  1H88 A;  1IFN A;  2O1J A;  1FZC B;  1GK6 A;  1JY3 P;  1JMM A;  2HLO A;  1M1J C;  1T8Z A;  3HE4 B;  3V5B A;  1NWQ A;  5KTB A;  1HWT C;  5BU5 A;  1FAV A;  4I6M C;  5BU8 B;  4AUW A;  1JTH B;  1JCD A;  2POH A;  1X8Y A;  1T3J A;  4AYC A;  4N3Y B;  3TNU A;  1T2K D;  4Y99 B;  2C0X A;  2KLV A;  4DZO A;  1EQ7 A;  3TYY A;  1E5W A;  1HGV A;  3M0D A;  3HD7 D;  3EFG A;  3U1C A;  5AVW B;  1DX7 A;  3IR9 A;  2P7J A;  1NTZ K;  3M0D C;  5APW A;  4I2L C;  3TSI A;  2XKM A;  4XE5 B;  4C7N B;  4LLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...