1URZA

Low ph induced, membrane fusion conformation of the envelope protein of tick-borne encephalitis virus
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
400
structure length
382
Chain Sequence
RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Flavivirus Envelope Glycoprotein in its Low-Ph-Induced Membrane Fusion Conformation.
pubmed doi rcsb
molecule tags Virus/viral protein
molecule keywords ENVELOPE PROTEIN
total genus 79
structure length 382
sequence length 400
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1urzA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 1urzA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 1urzA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 1urzA03
2P5PA 3IRCA 4X42A 4FG0A 5B1CA 5KVFE 3UAJA 5JHMA 1OANA 3I50E 5KVEE 3C6EA 1OK8A 3N41F 5KVDE 2I69A 2JQMA 4BZ1A 3MUUA 2JV6A 5LCVA 4AL8C 3N40F 3P54A 1ZTXE 5H37A 3VTTA 3N42F 1SVBA 1OKEA 5LBSA 2V33A 4FFYA 3UYPB 3UZVA 1TG8A 4L5FE 5AAMC 4UTBA 5JHLA 3J27A 5IREA 3UZEC 1URZA 2R29A 4ALAC 4UT6A 3UZQB 1PJWA 1Z3RA 2JSFA 1RERA 3G7TA 3C5XA 4GT0A 1UZGA 2HG0A 4FFZA 5AAWC 4AM0Q 5GZOA 3N43F 2H0PA 4GSXA 2ALAA 1S6NA 1Z66A 5LBVA 4UT9A 4BZ2A 2GG1A 5IZ7A 3UC0A 4UTAA 3J2PA 5GZNA 4UTCA 5KVGE 3WE1A 2R69A 3N44F
chains in the Genus database with same CATH superfamily
4LHUD 2VH5H 2GC7C 4K0OA 4O4YH 4OGXL 1AZBA 1GR7A 1NOFA 1QNZH 2WIIA 1KJ2A 4K71B 5FA3A 4FRWA 4Z0XA 4KAQH 4DP1X 1CLZL 2FBJH 2W9DH 2NTSP 3ZR6A 3KNBB 1BXXA 1SBBA 4UOZA 4WTZG 3NIFE 3B7TA 4DGIL 4NKDB 1BXAA 1A6UH 4G43A 3DJSA 1JZGA 4MXVE 1KTLB 4ALAH 5ICYB 5DRNA 4JRXD 4P4RB 1ACCA 1KBWA 2KPWA 2ZWYA 2IDQA 1HHKB 1I7ZB 1Q9WB 4HSAC 3K1KC 3ZO9A 1IAOA 4U1HA 4ZSOB 3M1CA 4XP9H 5CN1A 3S37L 1TU2B 3FH5A 1RHFA 2UVFA 1CGTA 4PV9A 4DESA 1CBJA 5FYKH 4JHVA 1OARH 3L54A 4N0RA 5J13C 3P11H 4XXWA 3I02A 2Y7OA 1MCSA 1JWUA 1EXHA 2YAPA 1JD7A 4WGWB 2RALA 3N1FC 3NIGB 3H7BA 3N2JA 1WA1X 2WZAA 5DVLA 1FI8C 2GJ6B 4GBXD 2ITDB 2C3WA 5HGDA 4Z7IA 1INDL 5IHZA 3QW9A 3CK0L 1TETH 1NMBH 1N4XH 2QV2A 3VXTA 1NIEA 5GGTH 1G0YR 1KYDA 1FYTE 3PL6A 4OZFH 3PJNA 5DUPH 5GS1B 1OL0A 5ID1B 1XZ0B 1Y6NR 1FN4B 3LNHA 2Z6FA 4M7JL 1TCRA 1SOXA 3A3YB 3SGDI 4AW4A 4NFBA 4AH2A 3DURB 3L3GB 3QC6X 3VXUB 2R69L 1ID2A 4KKNA 2B0SH 2P8PB 2ICWJ 2FIRT 2XV6B 4LP8A 3PABA 1P1ZA 2GKIA 2D7MA 4P3DA 5CR8A 3QUYA 3VI3B 3I75B 4H0LC 4OJFL 1EO7A 2IV8A 4NUGL 3TO2A 5TE4H 5E2WH 1A7RH 1ZJAA 1VFUA 4HK0A 4ODTH 5C7XH 5E4IA 4MS8D 4PJ5A 4Q6IB 5DJDA 4JFFD 3MA7A 3DMMD 5JUEH 2H45A 1QOKA 5E9DB 1UG9A 4MQSB 1U8HB 2XDHA 3GIVA 4LSUL 1ZPLA 5D1QC 3K7UA 3PWVA 1NLDH 4XBEL 3VRIA 2CHZA 4IOFC 5FWQA 4JFDA 4GRLB 4P5MA 4HC1A 1B90A 1O6TA 4X6DE 5C0BB 5K9JH 1E4XH 1KZQA 4NNYB 5F9OH 3ULVF 3ALPA 1IGCH 1OVZA 1YQ2A 5E6RB 4GRLC 3RWEA 3ZO0A 3MOAL 4R8WH 1SFDA 1JWMA 4IJTA 3VXQB 2JB5L 2QHRL 4XBPB 5JQ6L 3L3KA 4R5XA 3QIBD 4JG0L 3W56A 2XWJA 4Z7OE 3SGJC 4DUXA 4JMNA 1IGJA 5TGBA 4HCGA 5FECA 4OT1L 3VGAC 1HT6A 1E3FA 1SHXA 3H3PL 2FYVA 2UV3A 5TDNB 3IS0X 5IVXB 3HG0A 3T0EA 2V2TB 3GB7A 3ZE0E 3BH9B 5MEQA 3GSNL 3TONA 4Y2LA 4WTXA 1CYXA 1TQSA 4YGVB 3WEXB 2JI1A 1RUPH 4M7ZB 2IOOA 1CTOA 3U6RA 4ZFOL 1Z1WA 2BZ7A 5GQBA 3C6LC 3IXTB 3D9AL 1K8IA 5F7HA 3AG1B 4OKVA 1BREA 1IGFL 1J1PH 1KXQE 1NGPH 3DIVA 3EFFA 3T0WA 4YHZL 3BUDA 2ITDA 4XBEH 5F7DB 3MRDB 3DV4A 3TT1L 4NZTL 2YKKA 4EDXB 3HG1B 3ILPA 2A4CA 2B2XH 3DI2B 3FB7B 5B1JC 5CN2A 1FNFA 5SWQB 4QUOA 2DLFL 5IIEB 4PJDA 3DYMA 3MLTB 1MCWW 1WLGA 3ZL4H 3M1OA 3FU7B 15C8L 2Y69B 4Y8AA 3MRPB 1WIPA 2XBZA 1AE6H 5T1LB 3UZEA 1BQKA 5A7BA 1WISA 4NQXB 4LLAA 2VDLB 1HL5A 3N43F 3KPRA 3IGLA 1BF8A 4PJBB 1E67A 5CZRA 3I9AA 1SMOA 4PLKC 2WUCH 1ASPA 4C83A 3IFOA 3UO1H 3X1EA 3SDXF 4AM0B 5EA0L 1PFCA 3PNWA 1XH3A 3Q05A 4FQQB 1FYHB 2ADFL 4DUVA 3Q3GB 9CGTA 2PW2A 1XGTB 1PW3A 4IDJL 4PY7A 4P48A 3QG6A 1MELA 1AANA 3WY3A 4N9GA 3V55A 4NS0A 5I15H 1NAKL 2IBGA 2JCCF 3B4NA 2QDVA 5DMGC 2P5EA 4X9GA 5CR1A 1LP9E 1MH5B 1HSBA 2XWTB 3BESR 4PI0A 3HC3H 1PKQA 2AV7B 1UQSA 3AMKA 3O3AB 5DEFA 1YMMA 3IJ8A 2RAMA 2IPKB 4GSDH 3N91A 2NY6B 3RL2B 5A2CA 2AEIT 2VR7A 4W70A 1P5UA 5HHXL 4Z3HA 4NZFA 1HU8A 1KYAA 5D7IE 1BAGA 2DQDL 2P8LB 3JT0A 4R96B 3TPUA 3BPNB 3HMWL 4PJGA 2F53B 4W6WB 4JGNA 2P5ED 4JO1H 3UYRH 4YHYC 3SKJH 5IWLC 5AVZB 1AQDB 1WFNA 4XR8C 5E8NA 3BPNC 5CEZD 2R0KH 5JNYA 5GJSH 1HCZA 4RWHA 1ZLVH 3SE6A 2Z7YA 2MMXA 3LRSA 4U1LA 3SKNB 1GZHA 2NR6A 4J3BA 2FQFA 4F8OA 1HJBC 3BLPX 3JUYA 1J1XH 1GY1A 5F6HI 1ZT7A 3X3GL 1ADQA 1NOAA 2HFFB 2XA3A 2W65B 4M48H 5D9SB 4E41B 1U8CB 2WVTA 2I7SA 1SHWA 5HI5D 1J8HA 2B1AH 3KPRD 4WDIB 3QQDA 3UTSA 3CXDL 5DHVB 3CHPA 4KC3B 4JFQB 4JNXA 1QX1A 1K4DA 3MR9B 3WD5H 2K6ZA 1BYOA 1C7SA 5D8JH 4UILH 4EI5B 3SPVA 4IGBC 5EO9A 4PS7A 5ENWA 1ROCA 1XX9C 3V6ZA 2NY5L 3TURA 1ZWIA 4MXVF 4YXHL 1GGIH 4BDVA 1QW8A 1M6UA 5IVOA 3L2LA 5D7LA 3KCPA 3QEQA 5H2BB 1MCEA 1ZDSA 4PRIA 1RUAL 1X5JA 4BHUA 2V3DA 5ITBL 2G2RB 4DETA 2ZUTA 3A4DA 1RULH 1T1ZA 4OD2B 1U8JA 2BH0A 4FP8L 4S0HA 4UZUA 5L2JB 5EZIH 1G7LB 1CGXA 4B0MB 2EIKB 3FMGL 3LEVH 4X99B 1RAMA 2OK0L 2J44A 3KLKA 1L9OA 4ZAKD 5TPWL 3ZY7A 1RUQH 5C0AB 3FU6A 4YHNB 1CK0L 2F15A 4PGDA 4X4ME 1JXFA 4GEJA 5M94B 3FTGB 2DBLL 4HT1L 2XN2A 2IH3B 1R34A 3QUHA 2IQ9L 5AVVB 3BVXA 4BWTA 3UG3A 3QNZA 4K7PH 1PZ2A 5DD1L 3BWAA 2I32A 3OPZH 4XT1C 4ADIA 3G6JF 5KZCD 3MJ9A 2R29H 4GMSH 1S5IH 2HVJA 1VGEH 4TQPA 4ECNA 1RY7B 2OW7A 1QR1B 1KC5H 3WDHA 4FI7A 3TO4D 4XCCH 3SE8L 1GYCA 4AEHL 1SBSH 2WINB 4C56E 3BP4B 5IROD 3CFDB 1IAIH 3Q2LA 1SPDA 2EYTB 2YXVA 1UUNA 1LMIA 4HJIA 4PRNA 4U2YA 3FB5A 1WAPA 2YA0A 3GIZH 4G42A 4QOKE 3KPRE 3OR7A 3OGCA 3RGVA 1R3IH 2CK0L 3RZWA 3RVWD 2XZCL 2YXWA 7FABL 2FLMA 1E4JA 2AQ3A 3L4UA 4P05A 5DQ9B 3ZR5A 3MVSA 3FO9A 3MJ8A 3V0DA 2WAQA 3QRFM 1XIWD 5F0MB 2AJXH 4PJ7B 3P0VH 1KJ3L 2V2XA 3IJ9A 1L3NA 4JFHD 5DHVA 4F7KA 1NFIA 4I0KA 4U1NA 4L48A 4OZIF 4D9QE 5C0JA 2AXFB 4OJEH 4MCZA 4WTWA 1BBJA 1FO0A 2IALB 1P53A 2UZIH 1DBMH 4JDVB 3QORA 1GGCL 1MCRA 1W72L 1KTDA 1BQHA 3EDFA 3Q13A 3V0JA 4FTDA 3AGVA 4M00A 3WKML 3DVGA 5DC2A 3GGWB 5E5UB 4NHUB 1THCA 2Z7ZA 1WAAF 2I9TB 3INOA 4NQED 1U3YA 1PEZA 1SXAA 2CO2A 1L7TH 3K4DA 3KW7A 2KYIA 4NIKB 1AO7B 3U46A 1YQVH 2H2PD 2IAMA 3VD5A 2BFVH 4HWZB 1OLZA 2QVKA 3ZKMC 4UQEA 1FLRH 2DYPB 4FYRA 4LSDA 4JDTH 5C0EB 2OTWA 2A9MH 3EADA 1D2PA 5D72L 1HKLH 3HI6H 3T3ME 4GLRH 2EVJA 4IOFD 3QS2A 1D5MB 1R5IB 3ARGD 4OLVH 4JB9H 1YMHA 3DETD 2QPUA 4JRYE 4NDMB 1OSPH 2DQUH 1U2CA 2VZ3A 2KKQA 3D2UB 1MCKA 3CBRA 4MJIE 4N8VA 4U4BA 2VJ0A 4MJID 1XAUA 3BZFB 1KB5H 4K3JL 2E59A 5AB2A 4GUOA 4UINL 1DQDL 3MUZ1 1A9VA 3B9KD 3W1ZA 5J3HC 4APXA 5F6IB 3EDDA 1G6RH 4AUUA 3RFZA 2NY1C 3ZZSA 4KRPC 4KZCA 1WSST 3EJTA 1OB0A 1RZGB 2ZX8A 2XVGA 3DRTB 3VU1A 2X4UA 4W9JC 1IGFH 3K2MC 3R0MA 1NCCL 2ORBL 3Q2WA 2JKLA 3MBXH 5IFAL 2J4WL 5F89A 1VEOA 1AI1L 3WTVA 1OAJA 4RMQA 1I1AD 4JHAL 2IPTL 4PJAB 4WSGA 5FYLH 4NRZB 3T71A 4A04A 5E5RB 1S9YB 3OV6A 5DS8B 5FFGA 4H88L 3WG7B 3ZXAC 4XMKH 1PTZA 2ESVE 2G2PA 2QQNH 2HB0A 3QQNA 1CXFA 3S5ZA 4GW1B 5ETUA 3A21A 3ZQ9A 4QF1B 4DGYL 4JQIH 2Z4TA 2Z65C 4HGMA 2ZCHL 4B9GA 4JHBA 4F7CB 4Z9KB 4CJ1A 4S10A 1QYGL 4HQQL 1RFDH 5EN2A 5HGAB 1OAXL 3LKOB 5L2JA 3EYFA 4JN1H 5DEJA 4HJGB 3A6OA 2LQRA 3PIQA 5F88A 2DI9A 3FU9A 4XMXA 5JXEC 2QR0A 4JHAH 3TH4T 1DQJA 3EYVA 4G7SB 1A8ZA 3L9RA 4ZUUA 3S37X 2NY5H 4PRAA 1OP4A 3QS3A 2NCMA 3ETBJ 3HUJB 1KYFA 1F6LL 3GMRA 3IB4A 5CUSL 2JLPA 1AJ7H 2XNAA 1Q0XL 1KPVB 4Y4FD 2WBWB 2KQNA 5GGRY 1K72A 2N7SA 1TEFA 3RZCA 4KV5F 4NWTL 4KKCD 3WFCL 3G9VA 3UP6A 2DM4A 1FE8L 2XOTA 3JZ7A 4EMZA 2ESVB 5IQOA 1MWAA 3BIAX 1H3WM 1CD1A 1C8PA 5GRJL 1D3CA 4M5ZL 3PDOA 4KO5A 3S88H 2ZF8A 1M7DA 1ML0A 3QQ9D 1S8DA 2EVFA 1PSKL 4G42B 3IJ7A 4HXAH 5IJCC 2JVUA 1BEYL 2F1BA 4LL1A 3MCLH 4DCQB 1N8ZA 2B5IB 4U49A 4FZ8H 1YZZA 5GHWH 4UU9B 1CFBA 2DD8L 4UV7L 1E9PA 1UD5A 3L3KB 5IVXE 5HBBA 3ELQA 2NW2B 2XUWA 1KYUA 2VDKH 3O3DB 3UYRL 1XR8B 2DBJA 2EH8L 4AIEA 4QRPA 3FN0H 3HBGA 3DXAA 3K2IA 2V7HA 4PCKA 3PWPA 1C5BH 3DC0A 3EH2A 1WUZA 3T2NH 1SZNA 3N55A 3QORB 4XOCA 5D1XC 5DD5H 5JW4M 2NNAA 1VZIA 2OJ1A 1I7RB 4DO4A 1TZOA 4EXKA 5IB3A 1WAEA 3LQMA 3B2VL 4JR9H 1HH9B 1OY3B 1OTUC 3FSWA 1MFDH 3RL2A 5J1TC 1KEGH 4ZG1A 3KPMA 1OAYL 5IR1B 3L08A 4LSVH 4LESA 2P3YA 3MCYA 5DK2B 1MCQA 2VERN 3V5KA 4DZBA 2ZPKL 4Q14A 2ESVA 2DQFB 4TQ8A 3UXFA 3K5SA 1T20B 5A6LA 5E9DE 3WV0A 1N7ML 1T04B 2C9QA 1JUFB 2CBPA 2X53A 3COOA 4XMWA 3GIZL 1OSZA 4JY6A 3VXUA 1MFUA 5DFTA 3UO8B 3O9WA 3LPFA 3Q8EA 2MQGA 1G1OA 3WY4A 2VM9A 3D30A 4G9FB 1RZ7L 5F9WB 3ZLQC 2F54D 5EN3A 2H0JA 3QUMA 1PZ3A 2PWEA 2O6CA 5HGAA 1BD2B 5MHSE 2E4TA 4NSKA 4BK5C 1H6UA 2V7NB 2VKWA 2J6WA 3C08L 3G6AA 4FTVA 2YRPA 5F7WC 1AE6L 1QTPA 5BS0E 4A7VA 4BFBD 3IDJA 3UH8A 3EJUA 3S35X 4MB1A 2GUYA 3BEVB 4I3RH 3ALWA 4X83A 3UERA 3WFHA 2XTSA 3APDA 3K72B 3UBFA 4IOSD 1CICC 2EIZA 1E8ZA 4ABVA 3L13A 4UM8B 2I07B 5ANMB 5EWIH 5ENWB 5BS0D 4K7PL 4KPHH 2VDQH 1X5LA 4RSVA 1KBPA 1AGEB 2VRKA 3TBWB 3U9PL 4DZ8A 5CCKL 4KRLB 1RJZB 4QRQA 4M6OL 2P7TB 2IH8A 4HDIA 4HIPA 4LAQL 5TTRA 1RUQL 2ETWA 2JE8A 4HIXH 4HSCX 4JDEB 3WN5A 4CMMB 2CO6A 3CAFA 4R7DA 1A4BA 4U1JA 5DK0B 3C2AH 2HYMA 2CM5A 2OXGA 1BZOA 3ML8A 4LCCC 3REWA 5A7EA 4HIJA 3NYKA 2Y23A 5T1LA 3JWOC 4UTBH 4PJGB 2ICES 5FM4A 3ESNA 3ZZLA 5TF1L 3C5JA 3EOYG 1XSJA 5I9QB 3HAEG 3ZT7A 1N59A 2VDRH 4ES8A 1NBYA 3GSXA 1TZGL 2OTWB 4JFPB 1EGJA 3VXMA 2FSDA 5SWSA 3S36H 4JO8A 5FYKD 2FEJA 1GS8A 1S7SB 4TL4A 5JIDA 4YQXL 2PXYB 4MJIB 3MACH 3WJLC 4EN3C 4QRRA 4ZT1A 1ZHLA 4E41A 3EJZD 4CSPA 4DVRH 4HUXA 4EN3B 5I5MA 1FP5A 5GSRA 4BGLA 4D0BA 1DLHB 2VTFA 2CLVA 3DV6A 5HHQB 3LHAA 5HTSA 4CBPA 5F21B 2X4TB 4KKLC 3KWWA 2X2UA 2YGQA 2QFRA 5B3NA 2CH8A 4ZFFB 1TITA 4WJ5A 1SGKA 3PGFH 2VUOA 4MA8L 2O72A 1CLOH 1TOXA 3GDCA 4PG9B 1EZSA 5SX5H 4FQQA 4G3YL 2ZYSA 2B59B 3TPUB 5H35B 1OGSA 4KJQD 5ERWB 3SBWC 1E0OB 2HRPL 3CU1A 3INUL 1ED3A 4JDTL 3GSVA 4NBYB 2EICA 4C4BA 4HZLB 2DLGA 4OGZA 2LU3A 1LLAA 1D6EA 1J9CT 1PX8A 3SPHA 2CU9A 3MRKB 5K9KB 2K9FB 2C9SA 5KBPA 1FZOB 2IDCA 4E68A 4TS6A 5F9DC 4JFEE 4P59H 4UQBA 4O02H 4ELMB 2Q7YA 1QBMH 1UH2A 2FGZA 1UCBH 1HYSD 2EAEA 3GRWH 4PJGF 4ZX5A 1T03H 5AD0A 4RIRA 4Q9CA 1CGYA 1EAPB 2FBOJ 3MX0B 4QRUB 1MFDL 2CDEB 3IE9A 2Q9OA 3JUZA 2VW4A 5LB1A 3TEUA 2EEAA 2PW2B 3QORD 4QOKB 5FO2A 1Q1JH 3IXTA 4DK3A 1NSNL 1JS4A 4XVSL 4JRXB 4HAKA 4LP4A 1P4BL 2BOLA 3ZYOA 4B60A 4H0GA 4ZS7L 4IKIA 3KPNA 5AW2B 3AT0A 1XF5A 3QUMB 2L3BA 3TEXA 3TP4A 2GK0B 2PCXA 1SEQL 3IDMB 1IE4A 3SJVA 2WYZA 5IMOB 2XBTA 5EA0H 3IJYB 2VDPL 1SMDA 2HG0A 3SOBL 2XZAL 1T6BX 3TA3A 1DSWA 2WQVA 1BIHA 3BD4A 5TGBB 1JF1A 4Y5XB 5IJBC 3X11A 5IHBA 5GSVB 2BNQB 1GY2A 3BXNA 1L9TA 1TJHL 4FF9A 3B2DC 3VD9A 4ADGA 3VI4E 4JPSA 2J56A 2L7QA 5D2NE 1DZ0A 5CZXC 5FYJD 1CI5A 1YPZE 3MV7A 4F93B 3L8QA 3G5YB 1B4JL 1NCDH 2GK0A 4M3HA 5CXPA 3SJVB 2ZSVA 1OAQH 2NNFA 4A1RA 3QSKB 2J8HA 4PTUA 3TO4A 3TCTA 5EOCJ 4OV5B 4X0KA 3IMRA 5CP7A 5DEZA 4JAMB 5FF6B 5INDB 3NIFF 4S1QH 3G5VB 1GOGA 3ARZA 1XR9A 3FSZA 3U2HA 3TIDB 1I1CA 2VDOH 4QRUA 3NJGA 3AMLA 3E3QE 3Q6FA 2Z35B 3PAUA 1M2VB 3C8KA 5D7SL 3RWIB 5CP7B 1KEMH 4FJYA 2BY0A 2JJTA 2DBLH 3CFQA 2E74C 4KKLD 3D0LA 2BHUA 3ILQC 1IC0A 1NA8A 3QJVB 4ETQA 3T0EE 1CXKA 4X7SH 5L2KA 3U6XA 4HK0B 2D2OA 4CMHC 3MMEA 1BOGB 2F58L 3GBNL 4K5NA 2HJLA 4YHPA 3OSVA 3ZVVA 4HK3J 3UTPD 3PRZA 2VXQL 4Y1AB 1GCYA 3TA3B 4J3OG 1I4FA 2MKWA 3AU0A 3L3JA 5KYNA 4MXWH 2BXYA 4NJ9L 2QGBA 4R8WL 1P9MA 3OZKA 5MENB 4JW3A 4HS6B 1FN4A 4HUKB 5I1IL 1AI1H 1Z0NA 4LSRL 4XPAH 3ATBA 3VXPA 2EIEA 4HYTB 4UOW0 3OF6A 4K55A 4OLXL 1JHKL 1R1CA 3M1BB 2VERA 4MD0A 2NOYA 1TZAA 2M2DA 4GRWB 2ZOLA 4YK4C 4AYSA 4OV5A 3O8XD 1DE4B 1TKWA 4KHXL 5KYUA 4HZAA 3EJQA 2AGJH 2F5AL 3QUYC 3PUUA 3RY6C 2YOCA 2Q1EA 2VT0A 3NSCA 1OANA 2G75B 1A4JB 1E9QA 1MH5A 1P6AB 1DEDA 4TVPE 4JPIA 5HDWA 3JWNH 1GZQB 1QQDA 3HS0A 2ZYHA 4ZO8A 1I8AA 2X4PA 3VXME 2OCCB 1A7PL 2P8PA 4NN5B 4TNFA 4YLBA 2FH8A 3TWCL 5D1QD 3WGVB 3AY4A 1T0OA 2OTUB 3CXHK 3PL6C 4PRHB 5DMGD 1UZ6F 5HD8D 5C07B 1PLBA 1MFBH 3GK8L 1OPGH 2QMJA 4LOUD 1HHKA 3NIFB 1X7TA 1XH2A 3DWTA 4FS0A 4NSKB 4JLRB 2AP2A 4F8QA 3FO1B 4JO1L 1V3LA 4BXVA 1EJOL 3EO0B 5BNXD 5DK0A 4X6DF 1ZHKB 3FB6A 5E8EB 1PDKA 4MXQD 1IARB 2BRRH 4HUWA 1KV7A 4OUOA 4PRHA 5C07A 5IQ7L 2DM3A 1R9FA 4ODHL 4TF4A 4AGNA 4NRXB 1MCIA 4U6YA 1DVZA 1BWWA 3NJXA 4OCRH 4U2ZA 1KJ2B 1DJSA 2WQRA 3LH2H 4KITB 2B3IA 1CXEA 4G7YL 3RFZC 4NZUH 1A3LL 4MS6A 4APXB 1GYVA 5L2KD 4KVCL 1EXUB 4U3SA 5C0GA 3VB8A 2XG4A 1EHLH 4P4KD 5DR5L 3DPDA 4JRLA 5F7DA 1NUDA 2X6MA 5HHOD 4QHKI 5C08A 2DV6A 2D7NA 1NKRA 1ADWA 3PQYA 4RAUB 4BFJA 1PLAA 3RVUC 2E8ZA 2GJ6E 1GTNA 1TZIB 2V33A 3BHBA 1BD2A 5CEYA 3VXMB 3GUFA 2YARA 2K3TA 2A6JB 4F2MB 3N6YA 3KPTA 4RDQG 4NZ8A 1XXDC 2BVYA 4F80A 3RKDC 2H2SC 2KLTA 4NC1C 3WEXA 1HDMA 5JDJA 1CLOL 1MFBL 4LSTL 3DX8A 4FZ8L 2JWYA 2Z0UA 4DKTA 1J5HA 3FAWA 4Z0XB 1T66C 4XCCL 3CNKA 3SE8H 1MREL 3T6XA 3WXWL 1SHSA 2CR3A 1TO5A 4XZUB 1LEGA 2YBRA 2XXMB 3F7VB 4AL8C 2ATAA 2UZXA 3U6XS 1CVRA 1A6TB 1MFMA 1RLBA 1SLVA 1QEXA 5CEZE 3FT2A 4LVNB 1BMWA 4UCFA 4JE4B 3UABA 1TUPA 3K6FA 4NQCE 3FFOA 3WO4C 4Z7NE 3VXQA 3IRZA 5H37A 2VZOA 3NFNB 3VFGH 3ABMB 2HJFB 2LTQB 3C5ZD 1QFWI 4PIRF 3HVNA 2P5WA 5I1AA 3ASNB 5IB3B 2YAEA 1FFRA 4ZOCA 2BIQA 4MAYC 3CDZB 5E99L 5AEAA 3ZZQA 3DDFA 3SDXE 1HH9A 3OLIA 5DGRA 5C8JA 1OV8A 3CDGB 1A7BA 2YFNA 2BVTA 4LSRH 1YEHL 3LH9A 4F20A 3TJHD 2NYYC 3WFHB 2NY7L 4PJXB 1E5AA 2X0UA 1XGRA 3WNPA 3ZJAA 4LLWB 2YN5A 1K4CA 2VN5A 1YA5A 3RWJB 1F3JA 1OF2A 3PL6D 4M1DL 5BV7H 1RMFH 3U9UB 1DBAL 1KY6A 4TQEL 1QZ1A 4OGYL 2N4IA 2VR4A 3V7AG 3V4UH 1WZKA 1Z0MA 1XL6A 3FCTA 3ZE2B 4PV8B 1K6QL 4CKQA 2GFBB 1BQSA 2F74A 3IGAB 5J4MA 1OE2A 1B0RA 1KLGB 2FTAA 4HIXL 3ML9A 1F5WA 3AQZA 5I8EB 2PW1A 4S1SH 4HLEA 4JG0H 3FO2B 4WCYL 3ESMA 4PJGE 2MTAA 3W5NA 2P24A 1TCRB 5JZ7D 3BGMA 2YUZA 3B2PA 3NFSL 5F1IB 4AYFB 4IHOA 1XF5B 5A40E 5EUKB 2AW2A 4G7QB 2BO0A 3MBXL 4BD4A 2Z91A 3X2QB 1WD9A 3IXAB 2VZTA 4BXSV 5LKNA 3K72A 3BQVA 3MOBH 4RISL 1J0IA 4E0RB 1EHAA 1EUTA 1UFUA 2DQTL 2F54A 5FLUA 5AG8A 1UH3A 2YMXL 4I87A 4WW2A 4PY8J 1SYSB 2IV9A 3O9WD 3VXUE 1O7DE 5LCVA 1F3DJ 3MDJA 1QFHA 2CKBH 1CDCA 3JWNC 4NKIH 1JWUB 2FNBA 3LKOA 3ZHLA 1IQWL 2J21A 4I77H 2EDXA 5C6TL 5DJYB 4YUEL 3KYNA 1KN2L 2IQAA 3A6CL 4EUPG 3QFGA 5HVHB 1K5NB 3BUBA 3DROB 4RQQB 4PIBA 4TPRL 4G83A 3JBG7 3SKJL 4OVUA 1C5DA 1ASQA 4MDIB 2AAAA 4XPHH 4M61B 3BVNA 4P57B 3ZUNC 4LRIA 1X5GA 3SOBH 4PP2B 3O4OB 3W37A 1C9SA 4UOW1 1YQVL 3QIWD 4JM4H 2OCJA 3ZKSD 2NTFB 1IKFH 5CSGA 3F7YB 3KPMB 3L6FB 4ZW5A 1BLNA 2TRHA 4Y16B 3ATDA 2Z31B 5F89B 4ISVB 1R75A 1GGCH 2DM2A 2ICWB 3ARDD 1PD6A 2P48B 4LEOA 4LEXH 3NZ8A 4N8CL 4Q0XL 5DRXA 5CWSB 5T33H 1OAZH 2E9GA 3IU3B 4LARL 4Y8DC 5AW3B 3P0GB 1T89C 2AQRA 3GMRB 4ZUVB 3K71B 2JV6A 3U4KA 2WCSA 2EEDA 3O3DA 1HI6B 1AG6A 1CZ8H 3VD3A 5HPMA 3K74B 3OAWA 3TZVC 1UB6B 3JXAA 2FWOA 4HEME 3H7LA 1YC7A 4LB8A 5DJAB 3T09A 2VDKL 2CDFB 1CFQB 1IZJA 3NFPB 2ZXBA 1ZGLP 4NUQA 3E2HC 1PMYA 1ORQB 3T5WA 1WV7T 1S6NA 4XPHL 3TNMB 1UYWL 2V9RA 5GS2D 1XIWB 3IT8D 1LWRA 3EZJB 3X3FL 1TFHA 3BRDA 3BIBX 3QRBA 5KBMA 1PSKH 3QDGD 4HXAL 3CTTA 1NCGA 4WNSA 1WIUA 2ZOTA 3PWUB 4C56D 1CFQA 5DA4A 1IC5H 3MV8A 4B97A 3I9IA 4RFNC 4D7BA 3NP3A 4JM2B 5TH2B 1FRGL 1UZ8A 4P5KA 3WIIL 5I1LB 4YSCA 1OKEA 5LDSA 1JG9A 2BZCA 5DJ2B 3HZYA 3V4VB 3NGBC 1DVFC 1E5YA 3LOWA 3RZCD 1FYTB 1UVQA 4RFNB 1SJHB 4Y2DA 1J5OH 4PJ7F 2Z4QB 3LPOA 4HDIB 1J1PL 5KYWA 2Q3AA 4LHUA 4OM0L 1G7MA 3LEXA 3QR2A 3QWOB 4QRQB 1MWOA 3IN0A 2OMTB 5E8OA 2ZAGA 4ZZKA 2K9UA 2NY1B 5E00A 4F92B 1JZDC 2XKNA 3D3VE 3Q3GA 4ZW7A 4YQXH 5L4MA 1E4KA 1HKFA 4KQ3H 2VSKB 4HLJA 2R0LH 5I1HL 4PREA 5E24E 1RIUL 4MX7B 4Z77A 4F27A 4G72B 4RNRA 2FJGB 4KTYA 4HQQH 5TF0A 4PRNB 4JFXA 1XH0A 4R90H 3OAZH 3W0WB 1A3RL 1UOLA 3OHXB 5CJXC 1X6LA 4MD4B 5A2BA 3P77B 4F58H 3BRGC 4M61A 1KFAH 3QIBB 4QHMA 3UTTA 1ADQL 4A55A 1S9YA 3WFDH 1JZFA 2FX7H 2KH2B 2VSDA 4G5ZH 1U4FA 5EU6B 1KIUA 3LZQA 1FL3B 4JO3L 3TN0C 4GRLD 1G6RB 2D3JA 5F96L 3FTWA 5I16A 2VDPB 5C0BD 1GGIL 1FFNB 3S9DB 4XCFH 2DWDA 1U92B 1DVQA 3HJ0A 3NOIA 4A6YH 3GINA 5KN5A 1IE5A 5LBVA 3ZE1F 4IHOB 2XQBL 4GUPB 2NY4B 4DOHB 3HFFA 5KVDL 4UYQA 1UXWA 3X14A 5C0RL 1V27A 1HN1A 1Q4NX 3ZHKA 3BLKA 3MO1A 2O5NA 3F7PC 5IEKA 3SGEH 4LSPH 5I1KL 1H5BC 4ONHB 3DIFB 4EI5D 1TTBA 3FT1A 4OQ1A 4AV0A 2VXUL 1F6FB 3K2UL 2UY7B 4PJ8D 4Z7UB 2DQGL 4AKOA 2A1WH 3MRBB 5T3XD 2A9ML 5HVGB 2HFTA 1MJ7H 4Y2OA 1U3NA 4MHHG 1XGRB 3IRCA 1U8QA 3U4AA 4DGUA 4PPTA 1OF2B 4BDVB 1XGYH 4G9DA 1FNHA 1OB1B 1ZIAA 1BVZA 1KTDB 2E46A 3S8WA 5GS3A 4EZJA 1U21A 3BC9A 3OD3A 3GNMH 2X6VA 2CALA 2TSAA 4FFYH 4J8QA 4F57H 1Y18A 3WJJA 4K5PA 1XCQB 2V4LA 4MDJA 4U1NB 3EYQC 1LE9B 1UWYA 3IDGB 5JR1H 1MHHA 2X87A 5D1QA 1Q72L 3LIZH 2D9QB 1TQUA 5GGQL 5KYXB 4G5AA 4QAMB 2E27H 3BUIA 3K6NA 3C12A 3WE1A 1A5FL 3DGDA 4NWUL 3QK0A 3P11L 3N1GC 4C59B 3RWFB 3QG7H 4TN9A 3VNZA 2RA1A 5J1AB 2MPAH 4OCRL 3UG5A 2AJUL 1I1AA 4XVJL 4K3GA 4JZOA 7FABH 1J12A 4PJDF 2VIRA 1SN2A 2XY1A 1F90L 3L5WB 3STZB 5AAPA 5CBAB 6FABL 2YD2A 1KFGA 2DDQH 4JCWA 2HTLC 2JIXD 3M86A 4Y5YC 5DD0H 1Q9OB 3EYFB 4I89A 2GJPA 1WITA 5HP5A 2X6BA 5KS9A 2D0FA 1KENL 1FNSL 1UT1A 4WIQA 3RILA 3EOTH 3LB6C 3MLYL 1KJ2H 1KIPB 2ZP8A 1A2YB 1MJUH 5I8KL 1QLRA 5HHOA 5J57B 2F54B 5CD3B 3N40F 4OI7A 2BSEA 3TZVD 3P69A 3EGDA 4EQ3A 4I1NB 4NQSB 2ZT9C 2E75C 8FABB 1CIUA 5EUKA 4MSWA 1Q8MA 4G80B 3LV3A 2IPKA 3KVQA 1KB5B 2XQBH 2H1XA 3FONB 3ZSSA 1DJWA 3EYOA 4Z7UF 3OKLB 3VFUA 4PGDB 4JFQA 2E8YA 3AACA 1G7MB 1MJJA 5DRZA 3O4LB 4KQ0A 2Z7UA 1CGUA 5IMMA 1GJIA 4FNTA 4E9VA 4XCFL 4F2FA 1TF4A 1AQKL 4KJYA 5D7LD 3QFJE 5D9SA 2WSKA 1ZGLA 4L8CA 4GEIA 4UBDC 3MLVH 4HPYL 2NY0B 4LU5L 1INQA 3Q7JA 4F7TA 2ZG1A 1KCBA 3KCPB 3QEQB 5H2BA 2HKFL 4DP6X 1ASOA 4JFXB 4W9DC 2P4AB 3TYFB 1HNGA 4F58L 4APQB 3D05A 3KLSA 5KJRL 2ZKHL 1EFQA 5EZJA 4RAHA 4DTGL 2DIAA 3OLDA 1T21A 5GGTA 4ODBD 1P7KA 5C0AE 4OZFA 1XF3A 1A9BA 4EIZC 2N56A 2HZHA 4XXDA 2ENSA 5IWLA 1N67A 2BW5A 4P5SA 1M57B 2NDFA 1WEJL 2NZ1A 2WLYA 5EO1B 1XXFC 2C26A 5CIPA 2NLJB 5D7EA 2VLRE 1T6WA 2ITCB 1NCCH 5PCYA 4L3ED 4KNQA 1TQCC 3FT2B 1QD0A 2OX5A 4HWEL 2QL1A 2OR7A 1A6TA 4D0DB 1PKQB 2YQGA 5DJ2A 1TTFA 5CWSA 3MV9B 4NM8H 4ODVL 3CBJB 4WV1C 5IB4A 3F58H 2F19L 3QEUB 3QQ9C 3GBEA 1V10A 3A67L 5D1ZB 5E95B 1QVOB 3BQUD 2AAVA 4OV6F 1U36A 4NENA 2FDBP 1B0IA 4FQJL 1XHHA 1SLWA 2ODIA 5E7FA 3GMOB 3K1DA 2Y6TE 1JPTH 1ORQA 4CDGC 1OHQA 1DN0A 3RURA 4ANWA 4WFED 1PZSA 4OH2A 4U1SA 1R24A 3NCYS 3TJPA 3C87A 5F7UA 3W0WD 3PABB 5SV4A 5I28A 4EZKA 3PDDA 1KCSL 1IGJB 2EABA 1G4RA 3BZEB 3BP7B 2BHFA 3GEWB 4Y1AD 4N90E 3AS2A 4HGKC 3U7WH 1OGAD 4PJ7E 5DRXB 2BVUA 3VW3L 4FABL 2E7LA 3RWEB 3LXAA 3UZEC 2XN0A 2X1XR 4OFIA 1AMYA 3FO0L 2F53E 2FVNA 3VGDA 1MNUL 5I0DA 4KX9A 35C8L 3ME0B 3MLUH 4QHNB 3F6IA 2RTTA 1CE1H 3MJWA 1ICTA 3VYPA 1MCPL 5KW9H 3O3EA 2BINA 3POHA 4JFDB 1MEXL 1DQVA 4P5MB 3SB3A 3X12A 1NDGB 1DBJL 2XV3A 1FHGA 3VFWB 1LE5B 3MNVB 1U8MA 2A4EA 5KWYC 4BKLB 4D9RD 4Q9QH 4O02L 1XH3B 5CMAA 4BINA 4JLRA 5G4NA 4RFEA 2R1WA 4ZMQA 5DEGA 3SDCA 2XZCH 4UV4L 3VQ2C 3B7UX 4HC1L 4PGCA 4IKNA 4X7FC 2QHLA 1UOKA 5TFSL 4UMSA 5TQ0L 1ITBB 4L37B 1JF1B 4U6VL 2AHIA 3PYCA 4LDLB 1IAOB 2WBJA 3RKDD 5E5MB 1JGDA 4MAUL 5DEGB 1MLBA 4HWBL 4N87A 3ES6A 3QHFH 2RJMA 4B9PA 2ZOKB 2QQLL 1IM9D 2FEEL 3ROLA 4CADB 1FH2A 1FZKA 1T1WB 2BJMH 2DWYA 2AEPH 5T1MB 1DE4A 4E36A 4XTRD 2OSYA 4MB5A 4WFFD 5IGXH 1CL7H 2BIMA 4OKVB 4HSQA 1AXIB 2GITA 1VENA 4NQEB 4NERA 1THAA 3G3LA 2H26B 4KKQA 3HC4H 1DR9A 3C5ZC 4ZFOB 5KSAB 3ROLB 1H8NA 4MCYB 1NCHA 1K4DB 4H26A 3P4NA 1J11A 1MW3A 4E42A 5BO1H 2XBDA 4J27A 1WS8A 1MF2H 4U1HB 5E2JA 4KMTH 4PJEF 4PCSA 1VF5C 3QJHB 2K1MA 4V11A 1TU2A 4HJTA 4WUUE 1NICA 3L3DB 5H35A 1BOGA 1U3HC 1ZRUA 2IG2H 4JY4B 1NWPA 4ZUTA 4IRJA 3NP4A 1BMGA 4PMEA 3SQOH 4HJSA 4GG8B 1SDYA 2CBTA 2FJUB 2DMCA 1BAFH 2Y5QA 4KJQC 5IJVA 3T4AA 1QSFB 1IEBA 4BUGA 3CN0A 4RFOL 2HAZA 1J1OL 4IDLA 4RWYH 3SY0B 4HEMA 4KJWC 2F53A 4W68A 3V2AR 2VN7A 4JKNA 5BXFB 4M5YH 1RL1A 3V0WH 4MCMA 5DLLA 5FKAB 1DJHA 2LGNA 4EUPH 5I8CB 1JI1A 1UJTA 4BV1A 1MIML 1RHHA 3M88A 3TO4B 5BQDA 4FD0A 2O30A 3QUYD 4F3FA 2F5BH 3IJHB 5JW4R 4OFYD 1TZ8A 1E43A 4G8FB 1UXLA 1ACYH 4CRPA 2FB4L 3EYSL 4FQIH 1IBYA 2ZF9A 4YK4B 2WYHA 3GSQB 3WGUB 1AQHA 4H8UA 4HJUA 5IG7B 4IIQC 3QUYB 2PXYD 2ICWI 1MY7A 1JZHA 2ZQKA 2D4DA 3WNJA 5ES4B 5CSZA 2GUOA 1MRFL 3OXSB 3ASWA 4NX0A 3IN2A 5D6DA 1J1XL 3THMH 3X3GH 4PGCB 5ILTH 2HX9A 2FGWH 5ESQB 3TFKC 4Y4FC 2ZWSA 4OD1L 4QXUH 2GAZB 3OKOA 2C9XA 3V0EA 1KPUB 1XL4A 1RZ7H 4H8PA 2A9NL 3W2DH 4EJ1C 5IKCA 1YNLH 3AT9A 4Z7VA 3VAEA 1N2RA 2IANE 3DJTA 1YY9C 3PL6B 5HHVH 4DW2L 3DECA 1INQB 1J9SA 1VLXA 2LFGA 3CQQA 3DXAD 3JWDL 4R4BA 5DUPL 1MW2A 4G1MA 4G43B 3APMA 5ESQA 2VQUA 5C7ZA 1REIA 1EMTH 2NY5C 4GO6B 2AJSL 1BQLL 1LK3L 3ARWA 4XP6H 4XVJH 2WCPA 5ESAB 3CMOL 4FERA 4BFIB 4KDWA 3WO3B 1FH5L 1B2YA 1QQDB 3AS0A 5DTFA 3JV4B 4Z8FH 1BDYA 4G80A 3GSOB 1EHLL 4ELKB 3D33A 2YA2A 3IVKB 3GO1L 1KEGL 3RHWK 1TSHA 2VAJA 3CLEH 3OAZK 4YIQA 2Y06H 3QHTC 4NPJA 4OBSA 5KYUB 1L0YA 1P0SE 2EDOA 2OMYB 4Y4KB 1AC0A 3OG4B 4GKNB 3FUHA 1CDUA 5ERWA 4UOJA 2Y3NA 4ZOEA 5KS9B 1JNNH 2PMZA 3H55A 4FULA 3Q6GH 1XGUB 3WELA 3EF4A 4GG6E 1DBBH 1M1XA 4LLUA 4Y4FA 1S7TA 2RFXB 3BQUB 1YUHB 1J48A 4D9LH 3L3JB 2ROXA 2DDQL 3HZMA 5SV3A 3SYQA 4D0BB 1XV8A 3VJ6A 5JIPA 3K2UH 4GIAA 2VDLH 1D5ZB 5IJDC 5KVEE 4G9FD 1E3ZA 4UQIM 1S3KL 4LL9A 4RGMB 3OKKA 2EUZA 1VCAA 4WQOA 1I8IA 3F7LA 3GMNB 2CUAA 5JHDA 1NDMA 1KCKA 3QJRB 3P02A 1ES0A 5FO8A 3TS8A 2SEBB 3IMSA 4NWUH 4G7VH 3CVIL 1ZHNA 4L1DA 5FGSA 1ULVA 4ZX4A 2J25A 2XKUA 5FUOL 2F5BL 1XF1A 3MRQB 3UGXA 5IF0B 4NO0A 2ZOOA 1MIMH 4W9EC 2N0MA 3N0AA 4FFYL 1NCBL 2Y3AA 1ETJA 1OHZA 2UXGA 1AJ7L 3T3PF 4CSSA 3WYRA 5IESH 2Q6WB 3CXFA 3O6MH 4MDJB 4NP4L 1TPXB 3BO8B 3QZWB 2CDGB 2CUMA 2WB1A 3IBEA 3JWDH 3LEYL 3G08B 2V5YA 2MH4A 4PTUB 2DQHL 1SF3A 4DSYA 2W07A 2VE6A 4LO9A 1INEL 2LW3A 5I0VA 4RGND 5L4JA 2C7UA 5HYQB 4A7UA 4Z7WF 2NT1A 2XRAL 1N8ZB 2A6IB 4JY4A 2FGWL 2CJUL 5D4QA 3DUUA 3BT0A 3QJUB 3THML 3EJCA 3QZLA 4F7EB 4WW1B 4DCQA 5E2TL 5CO1A 2BWIA 5I1KH 5E03A 1UEYA 4N2CA 3NZSA 4OF0A 3BWZA 4DO5A 4ZMTA 1XB8A 4TNWF 4WO4C 1AD9B 3VXSE 5KVDH 2EE6A 4GUPA 3BAEL 4RFEB 5HY9A 2JSFA 3P30L 1VERA 1UXWB 1YEGH 4HP5A 4OM1L 3F7QA 3MRGB 1U93B 4ONFH 1YY8A 5C0IA 3AROA 2AZUA 2VZVA 3VH8B 1VKXB 2RR3A 2GHZA 5TE7H 2FRGP 2JKSA 2SODB 3M8OL 2PR9A 3L4WA 4DAGH 3MX0A 3U7YH 1ZK9A 5E08H 4JN2B 2AZAA 1HHGB 3CDYA 1DVTA 5FYKE 3ISRA 5D5ME 3B8SA 4JY5H 4KTDH 4NKOB 1N3NA 1G6RA 5MHSD 5EFIB 4JB9L 3ZKND 3QULB 1KXTB 1K8DA 2FCBA 4P5TB 2IANA 4Z7NF 2WWKO 4CVUA 4H7VA 1G9NL 1PLGL 5L6YL 3ARED 1SEQH 2BSDA 4L4VA 1AKJB 3V6OA 2AQPA 2QTVA 4FXGC 4WTQA 1ONQA 4PJAA 4PUBL 2ZONA 1JJUA 5D2NA 4JQIA 1S5HB 1U58B 1ZANL 3CIAA 1T7YA 1W72H 1XZWA 4LEEA 4OAWA 5AAWC 2DWEB 3S0PA 3MGOA 2NNAB 1MFVA 1AMXA 1SQ2N 3H9SB 4JZJC 1CL7L 4WWNA 2VN3A 4IBLT 4UM9D 5IK3B 3V4VA 4F24A 1GS7A 5C0BE 5E2VH 1PGRB 3EJRA 2Y7LA 4Z7WB 4O51A 1A25A 1S7RA 1G7QA 2J1XA 3VFOA 5JPMB 4X80L 1BX2B 2ATKB 4JZJB 3EFDH 3RKPA 4L1LA 4JO5A 5CJ5A 4CJ0A 3MLSL 1W8EA 3S37H 1K2DA 4H8HA 1U8OA 2CK0H 1QLEL 2L0DA 2X9XA 5J12C 4ZQKA 1N68A 1B3IA 5EBGA 3IDNA 1ZE3H 1B0GA 2DH3A 2BIOA 3HS0C 3TZVB 2GJZB 1NINA 1C12A 2AEQH 5AVUB 1AGFB 4HVBA 3QAZC 1TEYA 2MRYA 5FC9A 1MIEL 3B2XA 3J8F7 4L5FH 3OC5A 1I9RH 1YAIA 2APVA 3GMOA 3U0PB 1ZY9A 2R15A 4XP1H 1YECL 5DJAA 1XIWC 2WNXA 3BKYL 5C97A 1MWAB 2A74A 1TO4A 3GDBA 3S4SG 1X5YA 2B14A 1F42A 1WS7A 2NY2C 3QDHA 2UWEE 4ZUVA 4IMLB 4N8CH 3QDGE 4Q0XH 1FFTB 1FO0B 1BW8A 3MJ6A 4PGBA 4AGPA 4TVPD 5DI8A 3OPUA 1GKEA 5DD6B 3UC2A 3FO0H 3QGVA 4LMQE 5I76A 4XVOA 3LN9A 4NQCB 5J6HB 3MV11 5FFLA 3OMIB 3FJTA 2RQ8A 3P2TA 3TCLA 2EIBA 3NIGE 4LBEA 5GRYA 1RCYA 1XEUA 4QD2E 1Y6MR 3IDGA 5KAQG 2BSRB 3SE3C 4X6CA 1JRHL 1UM4H 2GI0A 2I5YL 1T7VA 3SBPA 4APQA 4AENA 3VM7A 4HUMB 3VSTA 3SD5A 2WIMA 1JGIA 4G9DB 4OCWH 4WHDA 5D1ZI 3CX5J 3WI9A 1L5GA 1NLBL 1UJ3A 3BFOA 3RYMA 4AEFA 4I77L 1USQA 1G9HA 3IAPA 3LKRA 1YEDB 1F1AA 2AJ3A 4DP5X 3WKQA 3QI9D 4HWBA 3MLWL 1LMKA 3KJ6L 3CDFA 4G59C 2ED6A 1NUGA 4IEFB 4IRSD 4P8QA 1R3JB 4ODVH 3OKNB 3QWQB 1S5HA 5TE6H 3ZTDC 2GSGA 4JG5A 5T3ZL 1WFTA 2GCYA 5MI0C 5A2LH 5F2FA 5C08D 3V0VB 5C0CD 3IPBA 5C0CE 5DYOB 5IZ7A 5D96C 3TJEH 5IOPB 1A14H 4RGOH 2WNKA 1VADB 4KK9C 2X3AA 5EUOA 5D6CA 3D85A 4PP2A 3ZDWA 1JPFB 1IQDB 4KBPA 3GT6A 4L3EB 5IB2B 3G6AB 1B0RB 1KLGA 1A7OL 5FYKU 3WNMA 2NX5E 2ITEA 5KJRH 1EO5A 3O8XC 5ICXA 1R5VA 1URZA 2XKSA 5KBDA 1X7SA 3B9EA 4AQ8A 2HKFH 3SY6A 3NA4A 1T5XB 2YZ1A 4LLQA 1N3NB 4TQEH 1KCUH 3O9WB 2DLEA 4X7DC 3SYPA 1DO6A 4HU2A 2QTEA 3HHSA 2D0GA 2HPOA 3PP4L 1AIZA 1S7XA 2VLKD 3AG3B 4F5CA 1D9KA 1I8MA 2E3VA 3O6FB 2E6PA 1RURL 1ZVNA 3LKPB 3FFCA 5LNDA 4GI8A 5IB5A 2WKLA 1FJ1B 2FX8H 3CCHB 5FDWA 1WJ3A 3SE9H 2IALA 2GBUA 3RUGE 3PJSA 1VACB 1D5XA 1CGSL 3G04A 4PJ9B 1FGVH 1MAMH 3BYTA 2XN1A 1KYOJ 4I13B 4Q6IC 2ALAA 1SUJA 5F7LB 4AWJC 1NGZA 4TOYL 3ULUD 3JV5A 5IF0A 4QI3A 1ZVYA 2W8CA 3K8KA 1QFUL 1GJWA 3RG1C 4EQ2A 2X9WA 4XODA 3ATEA 1ECYA 5EBLB 3NFNA 1EDYA 3RIKA 2R2BA 4R7XA 4UMGA 4MKTA 4S1RL 4JVPA 4PW9A 4PJ9A 4CMHB 2B1HL 3D2TA 4X8XA 4N2NA 4IK7A 5J3HD 2CIIA 1DVUA 3BVNB 4OIIH 1E8XA 2VDLL 3SDYL 5IQ7H 1MREH 3QQ4B 1KGUA 1IFRA 3JYCA 3A4AA 3O41A 4KJWD 2X12A 2C9UA 2WLIA 1DCLA 3CJJA 4JM2A 1E9PB 1AFVH 2YA1A 2H47C 4EBQL 3SDAB 5HSFA 1KIUB 1MJ7L 2UY7A 1PZAA 4JJHA 2WMPA 4W9ZA 4HV8B 5FGCB 4YDIL 3VGAB 1A1OA 1HYRC 4U6HB 2QVIA 2O5ZL 3O11B 5AL0A 1NIBA 3PHQB 4XWOC 3ZL4L 1RU9H 1SLUA 4OGAD 4ONHA 2VQ1A 4S1RH 1LJMA 4M3KB 2R39A 3B37A 5DR5H 5AZUA 2PETA 3BH8B 4N5ED 1DSYA 3GHEL 5CFHA 3IWUA 2E7MA 4TOYH 4ZTEA 3ZDZB 1XGQA 4HHGA 1TEGA 1FH5H 4NAQA 4DERA 1PZDA 4N90D 4ACTA 2Q86A 5L9DL 4IKKA 3TBYB 2GSMB 1A7QL 3JV4A 5D5MF 1DANU 3GTTA 4NN5C 1SM3H 1AHKA 4I18B 1YEIL 4NNPH 4A6YL 5LLIC 4RZKA 4P46B 1BPVA 3T6QC 4NZJA 2EILB 2Z3FA 5ITFA 3Q2VA 3GXMA 2ENPA 3NJKA 2A9NH 3NTCL 2AJ3B 3HG2A 3P0YL 4IRZH 4K3DH 4Z7VE 4JMXA 1EFXA 1KBGL 2R9HC 3AY4C 3OHXA 4PRPD 1RLWA 1PCSA 1TTRA 3AM8A 3U25A 2YKLL 1BG9A 12E8H 3VYOA 4L4TA 4MYWB 1U3ZA 3JV6A 3MJGX 5GRWA 2GAZA 3OKOB 3RLSA 2F9BT 1QKZH 3SPJA 4ZK8A 1E4KC 1JPEA 3RDTD 1QW9A 5JHLL 2GC4C 3T3PB 4GKZB 2HSIA 1BPLB 1GXEA 1SVBA 2CDFA 2R0LL 2GEQA 4HKBB 4BKTC 2FWOB 5AW6B 1Q1PA 1NANH 4OGAC 3TC9A 4BEIA 4XZ4A 4C4UA 4WEEA 2VLRD 1TJGH 1FG2B 3TASA 3V9EA 2JI2A 5B4MD 3RBGA 3TV8A 2XWCA 1EIBA 4HW6A 4NRXA 4OM0H 3ABKB 3MRDA 5T3ZH 4KNSA 2JKRM 3H53A 4K2UH 4MD0B 1JV2B 3UAJA 1XBRA 4LSUH 1R46A 3PLYA 1OXYA 3RVTC 1T1XB 2HWZL 2WWKT 4HKJB 3KJ4C 3KW8A 1DQDH 1YYML 3GS4A 4S11A 4NJAH 1A6WH 4LOEA 2F7QA 4Y0GA 4QWWC 2JH2A 4XN9A 4NJ9H 3B3BA 4UF7C 3DVNA 5T1KA 1X7QA 3D8MA 1MOEA 3TWYA 5MENA 4L5FE 1YNTA 5H4ZA 4QXVA 1DDHB 4F2ME 2HH0L 1W0YT 1BAFL 1WC7B 3KJ4B 4U31A 1ADQH 2R2EB 1CURA 3QUZB 1B0GB 4OIFA 1XGPB 3ULVE 1HCVA 2IH9A 2X4PB 1AGFA 1DEEA 1JN6B 5IW6A 1KULA 3QUZC 4G6AD 4Z7UE 5HPMB 4UT9L 4QKXB 3BAWA 2I24N 3ALXA 4X4MA 5L2KB 1MQKL 1L7TL 3ECVA 5AENA 1CZ8L 3IDUA 3QEGH 2B08A 4IOSA 4WFEE 7PAZA 5GZND 3HI5H 2VDRB 3ARYA 2VNCA 3G5ZA 2XICA 1TT6A 3F5WA 4FG6D 4JFDD 1U3HD 1V05A 3MRLA 1Q1JL 3FNKA 4AK2A 1QAWA 2Q7AA 3TCXA 1T2QL 2YSTA 4LHUG 1U8HA 1GGTA 4Y16A 4LEXL 1CICA 5IGXL 2JI3A 5JYLA 1YMME 2LLGA 2EDEA 3GEFA 3D5OF 4IU3A 5T5FL 1I7TA 5E9DA 4F9LC 1OAKL 4WSKA 5G5DA 4POYA 1A47A 4DHLA 1QHPA 1BV8A 2X4NA 2OQJB 2MPVA 4WJG3 3TBSB 1T2JA 3IDXH 2PF6A 4LRIC 1EO8L 2YD9A 4GG8A 2JCWA 2WY3B 3UTTD 2ZCKL 2G5BA 4EI6B 3MJ7A 5AKTA 4Z7QF 3O2DA 3TTSA 1TIUA 5ELIA 4ZUTB 2GSIA 3TT3H 1A1NA 4QRAA 3TOPA 3INUH 2VLLB 4LFHD 1ZV9A 3BPCA 3HNTL 4ZOAA 3VJ6B 1YDPA 1EX0A 5I24A 3IFPA 5E6IC 4M62L 3ZYZA 2FJHA 1F86A 3E1F1 4L4JA 3C5SB 4MA8H 3HG1E 4YR6B 4I5BB 5F7EH 3Q43A 1JNLL 4HZ1A 4TYUA 4GBXB 1HXYA 5CHNB 2O61B 3AXIA 1GMIA 1F4AA 2BK8A 2MNJB 4KAQL 3LYRA 3ARFA 2ZE0A 4NOBA 5AW0B 5IT2H 2H7WA 3PWPD 5I1JH 2FECL 3CZSA 2LAGB 3IWVA 1T2QH 2AXJA 2E56A 3NEOA 1JCVA 4AVIA 35C8H 1YJDC 3N85L 3SDDB 3H3KA 4DIXA 2CSPA 4QOKA 1MLCA 3OPZL 4YHOH 4ZUSB 4FDWA 4KI1A 1KWKA 4GBXA 1MI5E 2V37A 3I6LE 4BFKA 1BZEA 3CX2A 1CL7I 3SDDC 1BXVA 2IWGA 4M7LL 3EXJA 4G6JH 4WO0A 1I7UA 4WU7A 1WGVA 4C56A 1Y6KR 3CV5A 3PDGA 4N2KA 5MEQB 2BCKB 2WBJB 3AW5A 4UT9H 3C5ZB 5ADPL 3SBRA 1QMUA 2F61A 5I1EL 3UBXB 5IQMA 2OXHA 2Q20A 4OSUL 4QHLA 5F0LB 3BKCL 2HRPH 3VGFA 1NKGA 5CCGE 1M4KA 1UC6A 5HI3C 2PABA 5E9AA 4NZDA 2ZSWB 3MJ7B 5IVZB 1I53A 3QI9B 3WNIA 3K8LA 3SKMA 3SGDH 3HPLB 4LLWA 1QG3A 3FZUC 4O5LL 4OGYH 5DHVH 2BSTB 2X4OB 3OR6B 4J2QA 4WUUD 4BKLA 5JO5B 4YFLI 5D7IF 1FO0H 4XRCA 5E8DL 3FQUB 2Z31C 1UGNA 4WJ5B 3VG9C 4U05A 3ME0A 3ZX1A 4L4VD 1ZHLB 3G5VA 5I0YA 4FQPA 4M6OH 1TTCA 4HS8H 4P23C 1Z6JT 1BZDA 5D2LE 3EHBD 3WJMA 1M71B 2WN2A 1HL8A 4AYEC 2VL4A 2O26U 5KVFE 3L3HB 4R5TA 5DFVC 2H8PA 5LGHL 4GYBA 2AV7A 2B1AL 4W81A 2KHAA 2VUKA 5AVYB 3CPLB 3TV3L 4Z6AT 3D25A 1DVFA 1G9MC 5GSVA 3A6BL 3P54A 3FTYA 4J23A 4JG9A 5DLMH 3MGTA 4UTAH 5E8DH 1RUML 3B8YA 3MCKB 4HGWA 4K5MA 3VDCA 4XN8A 3MLPA 3KYKL 5LWYL 5E8NB 3D34A 5DO2C 3S3CB 4MHHI 4YOKA 5I6OA 5D7HA 5LBGA 3ZKXC 2OL3L 4M6MH 1PYWA 1YNTB 4ZNEA 2UUDH 5IROC 1DBAH 4ANXA 4N2GA 3DHUA 1SY6H 3T2OA 3ZMRA 5GGSB 3C60B 3O3BA 2UXFA 1RZFH 4AE1A 4AM0A 1NH6A 4LLUB 2VC2L 3DIDA 3MNMA 4QRRE 4V1DE 4Y4FB 3QWNA 5EZPA 1M9SA 2DJUA 4WFHD 3GKWH 4L0YA 1GH7A 2CGRL 3QDGA 3SSGA 4WFHE 5EEUA 2QKIC 3KM1A 5IW3A 2E7BA 4MZIA 5E99H 2CDEA 5FM5O 4R0LC 4GY4A 5KTEL 4MTMA 5DJ0B 2E76C 1OW0A 3NSDA 1BCIA 2X7LA 3DPBA 3WEOA 4QRSB 5AYQA 2MQ0A 3DJZA 3N85H 2E6JA 4N2LA 3I3DA 1QATA 2IWFA 4OVVA 3AU1A 1C16A 1P7KB 2NSMA 2I07A 4Y4HC 2MOQA 2AF2A 4JFFE 3OHXC 4CA4A 3BSZH 4X0KB 1N2RB 3EOTL 3H9SD 3PHAA 3QJFB 4GRWF 3QIBC 1HAUA 5GRUH 4WF7A 1DUZA 2E4FA 2GVYA 4WEUD 1VFMA 4JPKH 3QWRD 4UT6A 4HS6A 5EU5B 3U6RB 2WXMA 5A6IA 3SJVE 1ZGLB 2WUCL 3QHZH 3J7HA 1BQHG 2NZIA 2N1KA 3BD5A 3W38A 5LGJA 2DLHA 4G7RB 4E9QA 3TWCH 3BPCB 3BQUC 1E40A 3PGCA 4X4ZA 1VGKA 4X7TA 2QMKA 2VLJB 4PJFA 5JYMA 2MIZA 3TH2T 3QXAA 3HG1A 3ILPB 2G5BB 4EI6A 2XWJB 5JOPD 4F91B 4KXAA 4WKZB 4NO5B 4ZW6A 4F3FB 3QDMB 2CNYA 4AQAB 1OP3K 1JWMB 4LOVA 5L2KE 4G8FA 1CDGA 2EYRA 2JKWA 3DGCR 4B9ZA 2X1OA 4YBQD 2WB7A 1R6VA 3I2CH 5I66B 1JNJA 1BQLH 3BUYA 5CCHE 1W80A 3VG0L 3FT0A 2V7HB 4M4PA 1XF4A 2V7NA 4XPAL 1WIOA 3FQ4A 4ZXBA 2ARWA 1I3RA 1EBPA 1C1EL 4YE0A 4OTXH 3T0DA 2HRHA 5DU7A 5IREA 2HKAA 1R5WA 3C6SB 3CQFA 3Q48A 2PYFB 4KTEL 1H3GA 3VYNA 4I1RA 4MA3A 4UV7H 3KPSD 1QYGH 4CNIA 2A1WL 3CVHL 3FUMA 5IBUG 2IFFL 4FLOA 1QFWM 1A7PH 4AXWB 5FO9B 3MNDA 1WRFA 1VB9A 1WAAE 4PJIF 3AUVA 5AVSB 3QCTL 3P4NB 1UWEL 4ONGH 2PYFA 2AMGA 2FX9H 3RX8A 3CBKB 4KVNH 1T5WB 2NW3B 1ACZA 2PLTA 1NBZA 2W80C 5ANME 5ADOL 4KKZA 1HEZA 4PJ8C 1XCQA 4KJPC 3WEMA 1E4XL 5F9OL 3T3MF 2ITFA 1D7FA 4GAGL 4NM4H 3PJSB 1RPQA 1KPVA 3NSXA 1A6AB 1IILE 3FXIC 3KL0A 1JGEB 3QA3B 4L3EE 2O6FA 4HMEA 3HBQA 3KDMA 1KTBA 2IVFC 2FWUA 4PJ8B 4OZHB 1OEZW 1DO5A 5DSCB 5JO5A 2XPGA 1XQ4A 4CILA 1L6ZA 4URKA 5ACZA 5IJKC 1FORH 2VDNH 1J1OH 4RWYL 2HN7A 3NZHH 3JWDC 1L7IL 1T1WA 4JN1L 4PVNA 1UWEH 2VR9A 4IIZA 1ZGLM 3GXNA 5FO7B 5C0AD 1Q0YL 1WWWX 1N5YL 1X9LA 2EIDA 1HL9A 4R4ND 3RGVD 3DIFA 1C5CH 2BVEA 3HI6L 4L4TD 3SDCB 3ZUCA 4DEPB 5BOJA 4X7SL 4Y19A 4W9FC 3Q8BA 4NHCL 2EE9A 4Z78A 1DL7H 1G7JB 3MN8A 4GS7B 4PJHA 3QO1B 3KPNB 4N20A 4P4RA 3DARA 1EFXB 3EXLA 4GSQA 1OWRM 1GOFA 4JKPH 2K6WA 1LDSA 1HIML 3E6FA 3PP3K 3PQYE 5E6ZA 1JXGA 1PG7X 4B9KC 2F0CA 3E7JA 5INCA 4HJ0D 4Q6YA 1A4AA 3QCUH 2YD1A 3LN5B 3MNZB 4QXWA 1MRDL 2WZ0A 3N44B 1NMBL 1MZZA 2FHFA 3LIUA 4GXUN 4H0HB 2EE0A 3V9FA 4YPGA 1ZLSL 1ZS8A 1BG1A 1IV8A 1OGAB 2CBOA 2UZYA 5DHYA 1JZ7A 1F2QA 4A7SA 2CUHA 5EC2B 3PHSA 4QRSA 4PSRA 3BW9A 1ZXQA 3L95B 1B4JH 1NCDL 4U1GB 2O5XH 1UADC 3MC0A 4R7VA 2FD6L 3BAKA 4LEBA 5IHUH 5JPMC 2YAMA 3F85A 4F7CA 3CVHB 4QLWA 3HZ3A 4APQC 3U0WH 2D31A 4UUJA 3X3FH 5HYSG 2VLJD 1XAKA 3ZHNA 1MJ8H 2FJGA 4NOFA 5DRNB 2FEEI 2DYPA 1E6OH 2KZBA 4OGQC 4GRMA 3V0IA 4K8RL 2LAAA 1I3GH 2BFVL 2G9KA 1LO0H 4QYOA 3FPXA 2ED7A 4X7CC 2DZEA 1HCFX 2DQEL 3WMPA 5HVWA 2YPLA 5E94A 1DLHA 1MHEA 1ZLWH 3SDDD 3ZK0A 3HC2A 4XVSH 4AMKL 1DBJH 5D2LF 2Z4QA 1ZHBB 5KYWB 4HKZA 3VGEA 4DO6A 3Q8AA 3FTSA 3ZL2A 2AXFA 2MNWA 3VXRD 1RI8A 2ZX6A 3GMMB 3JV0A 4XC1H 1MNUH 1SYVA 1U8NA 4X6DA 3RWHB 5FPIA 3HNSH 3NCXA 5C9JB 2EUWA 2OX5B 1PX4A 4DZBB 2QR0B 3MACL 2V8LA 1FG2A 3GLAA 3QQXA 4FLQA 5E94B 5BV7B 2MOGA 2YC1B 2CPUA 1I1AC 1QTSA 1TYEB 3AREC 1E9OB 5KS9F 1UA3A 3LRKA 4MMYA 5L88H 4APQD 3H85A 4EOWL 4FFYA 4UQ2A 2ICCA 3TA3D 1I8LA 3SGJA 2BMKA 5HHPA 3SE4A 1KLFA 3S3JA 2DOCA 5FXCH 2OXGB 3I50H 3LIZA 1H8SA 1TDQA 4U1JB 2HT4C 4H13C 4M56A 4G8IA 4X8GA 5E4EC 4KUCF 2LV4A 3MRRA 1PD1A 2EINB 4UB0L 3QJXA 2J71A 4YX2L 1NEZG 3GRWA 3ULVC 3V0FA 3PWJB 3UZQA 2WJ5A 1UD2A 3GPSA 1A3ZA 3WUWB 1IB5A 1N0LA 5BW7A 1J0KA 1IAKA 4NRYA 4NPYA 1IIKA 4NQCD 4YXHH 1JDAA 4ACPA 2DQTH 1PLCA 5IY5B 2GJJA 2HLAB 3EO1A 4JRXE 4QJ3B 2H9GA 2HT3D 4UILL 4W9LC 1RD6A 1BFSA 4Y19E 4DK5A 1IC7H 1OOWA 1AR1D 2RHEA 5A2IH 3V8CA 4PGEB 3MODL 3ECBA 2W95A 2BP3A 3HN8A 5EEWA 5EG6C 5IR1A 1PS3A 2ZP0T 1II4E 5EDSA 1CK0H 4LE8A 2GSGB 3F6LA 5D96B 5BRZD 2ZKXA 2VDRL 4K73A 4W9CC 4ZI8A 3NK4A 4KKAD 3HUJE 3OQRA 4FMVA 3LEVL 4HEPA 2K70A 2XI9A 1EV2E 3QULA 4FQXD 2C5DC 4U6HA 4MLSA 4PJBE 3QRGH 4AQZA 4HJGA 1R4XA 4KTEH 4Q97A 4CGUB 2Y1ZA 1M9WA 3QNXA 4JL2A 5I2IB 5JHMA 4L3EA 3UROR 3FS9A 2CGYA 2XA8H 3IDIB 3KLAB 3O9WC 1YYLL 1ORSB 4NXKA 3ZTNH 2DQFA 2NUTB 4GO9A 4KKRA 1Z5HA 3HKZA 3B9AA 4MLIA 1FAIH 1HWWA 3HAEB 4LDEB 5B38G 5LAXB 1BIIB 1FV1B 2PP7A 3LD8C 1FCGA 3KHQA 3PXLA 2VRAA 3IETA 2VXTH 3RJQB 5AOZA 4PEEA 1BFTA 1G4MA 3AQXA 2WNGA 2H9GB 3HNSL 4XMUA 1ZLDA 4G7VL 1AKJD 3FRPA 2V8MA 4PS8A 1M7IB 1W0VB 3RX5A 5EUOE 1S78D 1IT9L 2P45B 2I69A 4WRLA 1H9DA 4YAQA 4PU2A 1U3HB 4U4IA 3RFRA 3MRLB 5H4YA 1S9XB 1MJUL 4FFVD 2FHCA 3D4ZA 4FNSA 3HHSB 3MUY1 5D5MA 1CN4A 4IMKA 4XP1L 1MFCL 1BJ8A 2FBRA 2D03L 5CIPH 1OWWA 2A74B 2ERJC 3R18A 3D2UD 1N9PA 4J12A 4KK8C 2C4FT 1XSOA 2VM3A 1NBQA 4YXKH 3PIQB 4J4PC 4A37A 4P2OB 2X1PA 2X4QB 4WEBL 1HC1A 1H3XA 2HCZX 3LZLA 4XBGB 5C8JB 5C3LD 4ES9A 3RTQC 3TA3C 1IT9H 3X14B 3CVHA 5BVPL 5E56A 3V6BR 3PQYB 3T8XB 2GT9A 1AO7E 3PDOB 1A9EA 3K71A 3CPUA 1T1XA 5CLWA 3LRMA 1GZPB 1FDLL 3H4HA 3K4AA 1UQSB 1TZHA 3O3AA 3IGKA 1OCZB 4XI5C 1U41A 1KIRA 4QO1A 2E9IA 4F57L 2PPFA 4B96A 2OMZA 1NMAL 1Z3GL 2CO3A 2P5EB 1FLTX 1D9KB 3B83A 4PY7B 1I8MB 2YLHA 2QSCH 4GOSA 3ZZ1A 3ASOB 1XD1A 2KLRA 2FYYA 5C71A 3FQ1A 5CFAA 4Y88A 3FN0L 4DT2A 1ONQB 2VR6A 3A4EA 2EH8H 5CP3H 3F7YA 3J27A 1IAIM 4JJOA 3UZQB 2CO1A 5I30H 1D5IH 3HE6B 4H20L 4PB9H 3RUGF 4AEIL 2OSLA 2P8LA 5A3ID 2DMGA 3EGSA 5KVGE 4CL7A 5ETUB 3OTTA 5AL8A 5BOZG 1HOEA 5K9OB 1RUMH 1KV3A 1TMCB 4RGNB 4PJDB 4PREB 5C08B 4O9HH 3HG5A 3NJNA 1U9KA 2XWEA 4JZJA 1SNRA 4X5QA 5T5NF 5JQ6H 3HE6A 2H2PC 3IFNH 3NCJH 1A6VL 5FYLE 4GPVA 4R3SB 4PVBA 5IIEA 3KYNB 3HNVH 4YNYB 1I9JH 3U7YL 2J5WA 3EG9B 1MFAH 4PB0H 2X4UB 3G6DH 3H42L 1F2XK 5DJ8A 4WDIA 4A2LA 3D50A 3QXVA 5IFAH 1U95A 3QPKA 4NHUA 4U1IB 4AC4A 3QWRA 3A4FA 3ARSA 2YSSB 3CZFA 3HHRB 4N28A 4WI4A 1CQKA 4KKPA 5ALBL 2EDTA 3S34H 1K8IB 2W65A 3SGEI 1DQMH 1TZHB 1PAMA 5E4AA 2ZWNA 1JD9A 5F7AA 3S8FB 1YY8B 4Y2DD 4N3TA 1OTSC 2WANA 3N40P 3QUGA 4WW2C 4ANUA 2XU9A 3CFCL 4OIBA 4RFOH 4K7FB 5TH2A 4JQVC 3QCTH 4YX2H 5E51A 3WFDL 1EAQA 2XQYA 2HT3C 3VGHA 2AXWA 3BE1H 5HYSB 4MA1C 5JQHC 3FU3A 3LXUX 2DRUA 4RGMC 1UB6A 4J3OC 4YSQA 4JO4L 1WWAX 3K8MA 1QSFE 4IU2A 3NJVA 3KBHE 4NAMA 3WO4B 1ET7A 1IBGL 4LSSL 4QJ5B 1IKNA 5F9JA 3TVMC 4WEMB 1LP9B 3VE0B 2WXGA 1SXCA 3JVGC 4K7PY 5DC0A 1QBBA 3WKMH 3X13A 4QOKD 3WN5C 5CNHA 5C0IB 1G7PA 4GRLA 5CEZL 4JQXA 3I2CL 1YEJL 3CK0H 3DBXB 1L3WA 4A39A 4S1QL 1MVUB 1NBZB 1JHTB 4PS4L 5IT2L 3SY0A 4R6UA 3CVIH 1IIIA 4ZMZA 1HQ4A 1R33A 2CBQA 2Z9TA 4WHCA 3SCMA 4ZS6D 1Y1DA 1KJ3H 5CZXD 2VYRE 2EDBA 1PJ9A 3HMXH 5E70A 3FQWB 1GHFL 1YECH 3S36X 1T0NB 3O45A 4ODTL 5DWUH 5IFJB 1Z9SB 4MJ4A 3VI3A 2DH2A 5LAXA 1KACB 4IBWA 4Z7NB 2CUIA 4D8PB 3REVB 5I6NA 2YUVA 5CEXA 1V8HA 4Z3FA 3L3DA 4NN6C 1UH4A 4LHJB 5F1OB 3P2DA 3PGCB 4HK3N 3S5LB 1R5WB 1URLA 3C6SA 4ORGA 3GXTA 4CU7A 3ATFA 3HCVB 3WS3B 1CO1A 4MA3B 1IAIL 1A66A 3IDXL 5E9DD 1UWXK 2P8MB 4MGXA 3VFOB 1UM5H 4A7GF 4N0UE 2X4RB 5ICXB 3ARXA 4HIIA 2C1OB 4RETB 3GSUA 4CN4A 3B9DA 4L8SC 5LG1A 4K9EC 2YEZA 1I85C 4IM8A 1MCPH 1JTOA 4JAMA 4MRBA 5I17B 1AXSB 3P4MA 4TM9A 4CU8A 3MROB 3VRJA 4YHIA 5B38B 1LWJA 3GPEA 4HXBL 1UCBL 1Q90A 3L9YA 1JIBA 5L0QC 3AZUA 3EJZC 2OP4H 4FEIA 3VMNA 1QWNA 2QQQA 3ULUH 4N2OA 1XT5A 1IKFL 2VRQA 4H25A 5E1AA 3VVVA 1Z5YD 3MFGB 4N6QA 4JFEA 1U8PA 4JM4L 1D5ZA 5EZLA 2P43B 3PPEA 1CUOA 5E6UB 1YEFH 1RURH 1T0PB 3MBWB 1EZUA 1B2WH 1P7QA 3LS5H 2QELA 3GYRA 4NFCA 3SEPA 4AZUA 2WPGA 2ZZUT 4HAGA 4JM2F 2IIJA 1RZFL 5FOJA 1TCMA 2FQGA 3T04D 3APFA 1BA9A 1F3JB 1I7ZA 4G1EB 3FCTB 3B9VA 4IJ3B 4K07A 3O3BB 5D7LB 1SBSL 1A6UL 1N5AA 4UIKH 5HYQA 5HVHC 3JZYA 3VWJA 2CRYA 5D71H 4YEFA 3NZHL 1T4KB 2CKBL 3C8DA 3H9HB 3OXRA 4NJAL 5B3SB 1E42A 2OTUA 1QNZL 2Q8AL 4PRPB 3KWWB 3PY9A 3O4OC 1NCOA 4CGTA 1N8OE 5DVNA 3WHE0 5TK2A 1YN7B 2OMNA 1J9QA 4DVRL 1JGVL 2BOCA 5B4MC 2RACA 4PBDA 3BISA 3SYOA 3KLDA 3WIHL 1ZEAH 4ZYKB 4KY1L 2FO8A 3DX0A 5EUOF 2ZYRA 1HXMA 2DQJL 1JK9A 5JMRA 4PBVC 2DICA 2P5WD 4Y16C 5EEZA 1NUNB 5I5RA 2PXYA 1JZ6A 1MVYA 5E1IA 1AGDB 1H8LA 3N41F 4JO2L 1J18A 1T22B 4F9PC 1E4XI 4PJCF 1TNNA 1G87A 5JW3H 1WD8A 5CCJA 3TXAA 3SQBA 1UT2A 3MLWH 5EHFA 1NCUA 2ADGA 4XXCA 1B3JA 4Z3TA 4X6FB 3LKSA 4NLAA 3K0YA 5IHHA 3HB3D 2BS71 1HINH 3D08A 3VXRE 5DZNA 3U4BL 1JPSH 5GGSA 2A6JA 5GZNA 3UFIA 3BAJA 4KK9D 5BV7L 1YNKL 4TTGA 1I3RB 3HPJB 1INEH 4TNEA 2EDHA 1TZIA 1EJFA 2WIIB 5HI4C 1FZMB 1X5AA 4M8UA 1AQKH 2DLIA 3X1GA 1UCTA 1RK1A 5LG6A 2WC7A 3ARGA 4L9LC 2ADGB 3WEAA 1YEIH 4H8WL 3ARBA 4KXCA 4DKFL 2KUTA 3HTLX 4DEWA 3LNIA 1EAOA 3FF7A 2BHYA 3VA6A 1JGUL 4HJJL 4OW6A 4L9LB 3ZN6A 1XSIA 3EDEA 4KDTA 4WI8A 4IBUA 4HXBH 2HFEA 2WXJA 3DKHA 4J3SA 3HC3L 5EC1A 5F6IC 4N2HA 5EC2A 1KCVH 1RZIB 2CLRA 3JTSA 3OKDB 5T1KD 5LQBL 4HMCA 1UEMA 3G9AB 2R23A 2YBGA 2EUVA 3MGOB 1T21B 3FQUA 3KCWA 1ZPUA 5DJ0A 1JWSA 2F6AA 1RJYB 4LP5A 4AMKH 2F1EA 4LPCA 4Y1SA 1J87A 4Q9RL 1AIFB 4OD3H 2ZCZA 3GF8A 3VWKC 1WHOA 4D3CL 2DB8A 4GAJH 3TBTB 4EN3D 2AABL 1GA2A 3HPLA 2W92A 2G9HA 3L5HA 3QHZL 4TQIA 3G5YA 2A73A 3BN3B 4H44C 4Y4KD 1JGLL 3EO0A 2LVCA 5SWZD 4N2EA 3AM8C 4XMTA 4G71B 3NIDB 4NYLA 3RIAF 3DTXB 1E4HA 2YD7A 2XV0A 3FZUD 4P46A 1PYWB 5FFOA 3BKJH 4MASA 3CVCA 3HAEH 1QLEH 1HSAB 2P7TA 4DGWC 1TQWA 5ECJE 3BWUC 4TNVK 3T2LA 3L3IA 4JKKA 1RPUA 1ZSDB 2ZOUA 1O0VA 1QI3A 2V2WB 1CFVL 2AK4B 3EFDL 3QUXD 2WNWA 2GK2A 4HAFA 4OZHE 2LLLA 3A0OA 3ZDXF 1GW6A 1A5FH 5EOQH 3FQTB 2YD0A 3GO1H 1A4JA 3VGBA 3O0RL 4NZUL 3PAYA 3VXNA 3SHSA 1LILA 3OZ9L 4LVOC 3S6CA 4G6AC 1H15A 1SVZA 4BFEA 3LH2L 3GJFB 1FGVL 4JR9L 1TLMA 1NGPL 2Q10A 3CMOH 3UACA 1YYCA 3OGOE 2EC8A 3ZYIA 1SQMA 2R56H 4KXDA 2X1WL 4H2CA 1Z7JA 2J73A 2JTDA 2XYBA 2ICEA 4FQXA 4Y5YA 3KPPA 4QTFA 3WAKA 1HOCB 3G5ZB 4ZW3A 2FJHB 1Q9OA 1EJOH 1MPAH 1JBJA 5BRZA 3RNKB 5L6YH 5C92A 1UJ3C 4OLEA 3NAAH 1W72A 3LKQB 3L4YA 4R4FL 4WAFA 4ZFZA 3KZ8A 4I1PA 3BEWA 3V4VH 2DQGH 1VFBB 4MNGA 4PCTA 4AXWA 3AB0C 2D8KA 1MRFH 1F45A 2B5IC 3L16A 4P2RB 4Q7DA 4Q89A 5KYYB 2BP0B 5J1AA 2OQJA 2WQAA 3SIKA 3AVEA 4LPUA 2ZICA 3IMWA 4J2XA 1W72B 2I60H 3GHBH 4ZFZB 3AB0B 1L7IH 3CSFA 4YSAA 3FUDA 2C9AA 3ZIMA 3EOAB 3LNGA 5MERB 1G9ML 5HGHA 3VH8G 4KX8A 3FQWA 1QRNA 3GZKA 5IFHH 4DAGL 4ZOBA 3TTYA 2YD3A 1IGCL 4TXVB 3I6GA 1PG7L 2VM4A 3SE4C 1PAZA 5FA3B 4JM2D 1YN7A 4N68A 2ZG2A 4JVWA 2I26N 4UQCA 5H94A 3DO7B 3CCHA 1Y7VA 5HYIA 2WN3A 4TNGA 3BJLA 5CSBA 1EDQA 2DLTA 2ZP9A 4WI2A 3N5AA 4F7PA 4TUKH 4XHQA 3VRIB 2XNAB 3R06B 4X5RA 4PRDA 4HX1B 4PLJC 3GZPA 4POUB 3LZRA 5C0CB 2I60L 4FQ2L 1NCTA 1ANUA 2BNQA 3VQ1C 1RFDL 2BVQB 1IM3B 2D4FA 3GUTA 2X9YA 1U6AH 3AFLA 2FR4B 1XF3B 3GMPA 4OZIA 2ZX9A 3I9GH 4Y19D 4FFWD 2VR8A 3FQXB 4CW1A 2R69H 4URTB 3UBGA 4WU7B 1EQWA 1WFIA 4Y9BA 5F71A 3VXRA 5JA8B 5KJ4A 4N3UA 1WFJA 4M4RB 2VLKA 3SBQA 4HKJA 2FT6A 3NPSC 1C1EH 5A43C 4M9OA 3MNWB 4RMWA 2G3NA 1TJMA 3L7FA 1DFBL 4L8CB 5IHZB 3FQ2A 4D0DA 1PZCA 3MLXH 4POZD 1JXKA 3HEIB 3NPSB 2YPLD 1TQBB 3OAYH 3AC0A 3O6LL 4ZTOL 5LN8A 5F0JB 1CT8A 3NBNA 1S7VA 3EG9A 4Y9CA 4YBQC 4ELMA 1I8KA 2ZUWA 5JUEL 1A64A 1TQBC 1U95B 2A6KA 2ZOKA 3GHEH 1QASA 2WBXA 4Z7OF 5AYTA 5C0DB 1A9BB 2NY0C 1IC5L 3MQIA 1DQQB 3EAKA 1DN2A 1KGIA 1OSPL 2DQUL 2QQLH 4NQQA 5TE4L 5C7XL 2J1KA 4NUGH 3T0ED 2C7FA 3OMNB 2OCFD 4PHXA 1D5RA 5D7JA 5D7IA 1YNTF 2I85A 4MD4A 3UYPB 4MA7H 1OZUA 4NDMA 3C9NA 3WTUA 3HR5B 3ZE0F 3QDGB 3PXJA 4U6VH 2G5RA 3G5XA 4YWGL 5IW6B 3O6KH 2CR0A 5E2UH 1BM3L 2AK4D 4DVBA 5C2UB 4Z95L 4HOMA 3M7FB 1V55B 2DM7A 3HZVA 5EZOL 2OI9C 4NKDA 3ARBD 5DD3H 3CUPB 2X4TA 5DJ6B 4X4YB 4QRFA 2FQEA 4HH9A 2E7DA 5AZ2L 4Q56A 5PAZA 1OAKH 4L0ZA 4ZD3H 1F11B 4NENB 3GM0A 1BEXA 3FU5A 3QP3A 1G5GA 3MCKA 2FUTA 4UM9A 1TETL 3LS4L 3ARTA 4ZPTB 1OT2A 5DYFA 3UGUA 4B9CA 1RIVH 4CC1A 1FHNA 4NGHH 2Z8VC 4X8JA 5FGBA 5TDPA 3MRMB 2A99A 2NY6C 5MEOA 3VE0A 3QYCA 4TLTA 1UURA 5BUGA 4HJJH 5DHMC 2XC8A 3VXMD 1MAJA 2DN7A 3AAZA 5JHAA 3GJEA 1J8SA 3OAUL 5H37G 5DMIH 2HG5B 1N10A 4Z7QB 2DKUA 4FG4A 3WIHA 1TJIL 2XTJC 3KDPB 2DPKA 4F33A 4NBXB 3QIUA 2QQKL 5K39A 1MW0A 1F8TH 3UTOA 3VI4B 3PP4H 4P9ML 3LKPA 5D1ZC 4FQCL 2MCPH 3C5JB 2QKSA 4UBDD 5DZLA 2PTTB 1NIFA 4HCRA 4HCFA 4NQDD 3J2PA 3P3TA 1ERNA 4PJXE 5EF3A 1QVOA 1HINL 3QXDA 4YVNA 3RUGA 4AI7A 4YGAB 4OZ4A 5AKVA 1CWVA 3SDXB 2WP3T 1UHVA 2OMXA 4AJWA 2GJRA 2X38A 2PTUA 2CJSA 2N0KA 4MJ5B 5J6GA 2ZXCA 2HPTA 1P7QB 4RISH 4U1IA 1NPNA 2BSSB 3JWOL 4YHMH 5KYXA 2NLJA 1QO3B 3DX4A 3OKMB 3UPRB 3BOVA 5L4FA 1A14L 2CLZA 4AVKA 1AHMA 1Y0LA 1IGMH 2XWRA 4N0YH 2AEOA 4XP5H 4XNAA 4HKBA 3TEWA 3OKLA 4I85A 3VFUB 1YEKH 1BIIA 4NKMB 4DH2A 1Q94B 2H6UA 1OM3H 2ZUSA 4MNQD 3LV3B 2H6PA 4P2RE 3ULUC 4LF3A 4EKXA 1NFDA 3DK2A 1M3JA 5A2KH 3QNFA 4MMXB 1J10A 4YSRA 2FEDD 4ODUA 3WNOA 2XVBA 4RDQF 1E7VA 5I17A 4P57A 4OY9A 5J11C 5F96H 3NCYP 4LCUB 3V6OC 4M7LT 2AQ1A 2GTZA 1ZVSB 1LD9B 2EECA 1UKQA 2DIBA 3O4LD 3QDJE 3X1BA 5E6IB 4ZSOE 4F7TB 5BVJB 5I1GL 2QADD 1KY7A 3QEHB 2WSPA 1FL3A 1DUYA 3U1QA 3ILEA 2R0ZH 5FOBB 3WFBH 5DGQA 7PCYA 2WQWA 2X10A 5HYEA 2J8UE 3H9YA