1URZA

Low ph induced, membrane fusion conformation of the envelope protein of tick-borne encephalitis virus
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
400
structure length
382
Chain Sequence
b'RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE PROTEIN
publication title Structure of a Flavivirus Envelope Glycoprotein in its Low-Ph-Induced Membrane Fusion Conformation.
pubmed doi rcsb
molecule tags Virus/viral protein
total genus 79
structure length 382
sequence length 400
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1urzA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 1urzA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 1urzA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 1urzA03
4GSXA 2ALAA 3UZVA 5LCVA 2R69A 3N42F 4UT6A 4AM0Q 5B1CA 5KVEE 5IREA 2H0PA 3UZEC 5KVGE 3N44F 4UTCA 4AL8C 1Z66A 2JV6A 5JHLA 4UTBA 2V33A 3N40F 3UZQB 4UTAA 1S6NA 1OK8A 5AAWC 1Z3RA 1UZGA 5AAMC 1SVBA 5JHMA 3UC0A 2JSFA 5KVFE 1PJWA 3MUUA 4ALAC 4FFYA 5LBSA 1RERA 5KVDE 2HG0A 1ZTXE 2I69A 1OANA 3UAJA 4GT0A 4X42A 1URZA 5GZOA 4L5FE 3I50E 5LBVA 2GG1A 3C5XA 2JQMA 3P54A 3N41F 3N43F 5IZ7A 4BZ2A 3VTTA 4FFZA 3WE1A 5H37A 4UT9A 2R29A 3C6EA 1TG8A 3G7TA 3UYPB 5GZNA 1OKEA 3IRCA 3J2PA 3J27A 4FG0A 4BZ1A 2P5PA
chains in the Genus database with same CATH superfamily
2R2CA 1FFNB 5D7LE 5B1JA 3GHEL 1D9KD 4Y16C 4N90E 4KGLA 3ATEA 3QZWB 1EHLL 1X7TA 4FCAA 1XCTB 1PAMA 3FB8A 3WKMH 1LO5B 1F90L 1TTGA 4OZFG 4PREB 3VXMB 4N9OB 3DX2A 1WT5A 4XMPL 3PHOB 3NP3A 4P4KB 3F7RA 1AE6H 3O2DA 4KDTA 2APWA 2E9GA 3OG6B 4FDWA 5CEYA 4D8OA 4P5KA 4XP5H 3FB5A 3IVKA 4Z7VF 2WLIB 3ARGC 4UAOB 4QRSA 4OZHA 3HG5A 1OSPL 1OTUD 3K81A 2CBQA 4HIEB 1JGLL 4D94A 4JK0D 1VEPA 4R8WL 1JFQH 4WI0B 3QZWG 1MCQA 3FCGA 3S3PA 1NLDL 3CXDL 3LNDA 2H0JA 5DJCB 4QNPE 3NBNA 1UUSA 3EGDB 3VXMA 5DXWA 5GHWH 2CCLA 1OAQL 1OXYA 2DJMA 4G42B 4GEJA 4CDHA 5GRYA 2VM4A 4HXBH 2KZBA 1Q4NX 4P3WA 2H1XA 4GW4B 1CTNA 4PV8B 5A2BA 2YFNA 2WLIA 3BN9D 4Z77A 1ET7A 4FXLA 4M6NH 2H32H 4HIEA 3VYPA 4TUOB 2X38A 3APNA 5DLMH 5EDSA 1TO4A 4WI0A 5LQBH 2DMHA 1IKNC 3C5ZD 1OF2B 5IM7A 4Y5XB 1L3WA 1IAIL 3KXFA 2VDRB 2CIKB 4FG6D 4HIXH 1QW8A 1UOVA 5TGBA 5DJCA 3FXIC 5HHVL 4MHHG 4CNIB 5HDBE 2YZ1A 7PCYA 2XV3A 3O8XA 1RHHA 1XXDC 4GPVA 4EOWL 2VR7A 4X0KB 3VI4B 5H35B 2VC2H 3MXWH 4GW4A 1Q9OB 3LCYA 4LGSB 2GJRA 5I15L 4PJBE 4ZFOB 3ZDZB 4GFXA 1QP1A 2AJUL 4PJGE 5CKAA 1PZBA 3L1OL 1NZRA 4YE4H 3F7PC 4TUOA 2X05A 4HKBB 3NFNA 4AKPA 2KZ1B 3D12B 4NQEA 4WI9A 4Y1TA 3GLZA 2Y1YA 3VWKD 1OF2A 3K80A 4Y5XA 2E6JA 2NY1D 2XPGB 3HS0B 3ABLB 2CIKA 4HOXA 3X17A 2QGCA 1JUFA 3TWCH 5B3JE 2W80C 4KHTL 5HI5C 1BV8A 4K2UH 4X0KA 4LLQB 3WXVL 5F9OH 2WTOA 5H35A 5EHFA 3BIBX 5J56B 4TVPH 2FZ3B 1I31A 1ZVSB 4MZ3A 1RZKL 2P5WD 4ZW3A 4OF8A 3N43B 1SFDA 3QWQB 3RU8H 4H25B 4HKBA 1BVNP 2MNJB 3A23A 3H3PL 3JTBA 4DH2A 1CFBA 4QXVA 5FO8B 1Z0NA 3QDJD 2NY5C 3FB7A 3MLXH 2BJMH 5TPWH 1F2XK 1DJXA 1KLUB 3HS0A 1KJMA 3OKKB 5EBWA 2VLRB 2YHGA 1ZLSH 1P0SE 1WZ1L 4KKZA 4UDUB 4DAGH 2ZCKH 3EO9H 4S1RH 3TO4D 3DV6B 5C07D 1TNNA 2RMNA 4HCIA 5T33L 3GB7A 4I4WB 3U1SL 3GS7A 1WTGT 2UZPA 4JFDE 1ZVSA 4ANVA 1OP3K 4J6RH 3H0TB 5T1DH 1PIGA 2WKGA 1OTTD 4MQ7A 5MI0C 1EHXA 5JXEA 2V2XB 1UURA 3BT0A 4NP4H 5EU5B 3IMVA 4S11A 3JV0A 1BZDA 1FIGL 2E86A 3O4LD 1IC0A 2BWQA 2QPUA 1Z3RA 4JQVA 4GUQA 3NACH 5E1AB 5KANI 3VMPA 5I71C 4UDUA 3BEVB 3D0AA 4LVEA 2MOVA 4EIZC 5A3ID 5F6HJ 4AH2B 3DV6A 5JPNA 1GS6X 5DC4B 3RY4A 1U8LB 4I4WA 5KJRL 3IKKA 5JW5B 4JFZH 3KWUA 2CO6A 1NGPL 5J9PB 3I6GA 4L8DA 1TJHL 1R75A 3PAVA 4LLVA 4U3CA 5EBMB 3T6XA 4K3EL 1SBSH 1G9NH 2FT8A 4Y9CA 1DVSA 3B4NA 5GSRB 2V2XA 2E7BA 4U1JB 3UJJH 1A3RH 1D5RA 3WFBL 4KJQD 1JV2A 2D0GA 4ZMLA 5JZ7D 5J6GA 4JO5A 3E0GA 1WAAA 4PJHE 1MLBA 2K6ZA 2BFGA 1VFMA 2H2SD 2XG5B 4FZ8L 4LOFA 4N6QA 4ODHL 5J13C 1U8LA 2W59A 4AUYA 1EX0A 3KPSE 5J9PA 3MRBB 1A5FH 3LPWA 4LL9A 4Q52A 5EBMA 3B56A 3RZWA 5A6LA 5GSRA 2W0KA 2ZYSA 5JPMB 4U1JA 4IGBB 5ANHA 2DTMH 5BS0E 3KGSA 4HPOL 1CFVL 1A14H 3CSGA 2Y69B 5CILL 3Q8BA 3QNFA 2XV6B 2EDRA 2B5IC 5DFVC 1IQDB 1ZS8B 3QIBB 4ONHB 5ISZA 3FT2A 5EUOE 4MB3A 3FQNA 3CH8A 3FFDA 3M8OL 1D3CA 2AZUA 4HULB 2AJSH 4P2OC 5F1NA 2P52A 2J8UB 2YQGA 4M6MH 3ZKNC 3QZLA 5EG6C 5I76A 1KEGH 2P80D 1HAUA 1SF5A 4OFYD 4CUCA 1S7RA 2MPAL 2OZ4L 5DHVH 4BQBA 4WGKA 3EYOB 1MFAL 4Y2DD 4K94C 3I2CH 1KIPA 4ONHA 1QFWL 1AHWB 1TCMA 3U46B 2VAAB 1N64H 1FO0L 3AZUA 4EUPB 1JVLA 1CT8A 2P8MB 3CIAA 4RGOH 5HHXH 4BSJA 5B7FA 1ZA3B 1CFTB 2NW2B 4OLWH 4PWJA 8FABB 2FL5A 2BOCB 2FIKB 1CXHA 5AKVA 2DM2A 3W56A 4P23C 1C1EH 2PWGA 4XBGB 2ICWA 4Y0GA 3EYOA 2XVGA 5HHQB 5CIPH 5AAMC 2GCYB 4HZ1A 5IOPB 3VFUA 1JTOA 3U46A 2HA1A 2VZ1A 1XTMA 4EUPG 5CZVH 4WI7A 1RJZB 5T1JA 1M05A 4ZAKC 4A1RA 4QAMB 2ESVB 4PJEB 4OAWB 3R18A 4HU8A 5IJVB 1CFTA 2NW2A 8FABA 3V4VH 1IEHA 2FIKA 1LXMA 4WI6A 2J88H 3IDXH 1URZA 4FA8A 1M7DB 2F54B 4YSQA 4XBGA 3IMBA 2YWZA 3P9LA 4LHJB 2OSLA 3KLDA 5HHQA 1I8KB 3ARDD 2GCYA 4JHZA 4X6FA 5IOPA 1IE5A 4FQHB 4TN9A 1QABA 3HNVL 3ECQA 4JZJA 4F8PA 1KCWA 1XIWB 4RVBA 3GUFA 3CC5B 4YN3A 2QVIA 1JXGA 1SM3L 3IWUA 3LN5B 4HWBL 3WSQL 2WJ5A 4ELME 5C92A 2YK1L 2Y72A 4XNMA 3PQYD 3APMA 1HC1A 2ESVA 1I3RB 4QTIL 4GSRA 4NYLB 4OAWA 4PJEA 3U9PH 3CFJB 3UC2A 5IJVA 3WEXB 1G9ML 1EAQA 3GD1C 3T8XA 1M7DA 2F54A 1DQTA 3QRBA 4HWEH 5K1JA 4KDWA 3H9SB 5T3XH 4H40A 1TLKA 2VDPL 1JCKA 3DJTA 1E43A 1GPOL 3AU0A 3QCVL 3R4DA 3VFWA 1CE1H 2CLZB 2QADD 4HJJH 4LVHC 1XIWA 1X5MA 1OZTG 1PZ5B 3L5XH 3N41B 2YD5A 3MUZ1 4R90L 3LN5A 2Z91B 5EO0B 1FO0B 1NFAA 2F74A 3DVGB 5JUEL 1OHQA 3FZUC 4TOYL 5AB1A 1VCAA 3BFQG 3KYMA 5G4MA 3V8OA 4FFVC 2E56A 3DGGB 2J3SA 3ZYIA 2Y06H 5L88L 4M02A 3NFSL 1M6OB 4C56D 3MRPB 2VSDA 5BV7C 2OZ4A 3IM1A 1WQVT 3SOBL 5EZOH 4QOKD 1W0WA 1XF5B 2VDMB 3OAUH 2ERJC 3QUXC 3MLTB 2CAKA 1OAZL 1LMKA 5I17B 2VDKL 4WW2F 5DGQA 2CLZA 2EE0A 3UDWC 2DEWX 1BG1A 5JIPA 1FFQA 4MXQC 3X13B 3S35L 4FA7B 3H9ZA 2LHAA 2IQ9L 3GMMB 4JFYB 5EF2A 5EO0A 1ITCA 4FL4B 1RZGB 3WLBB 1FO0A 2BO0A 4KZEL 1GMIA 3H9YA 3BAXA 4TVPE 4FNTA 4M43L 3C6SB 1WWAX 1Z7JA 2HG5B 4XC3H 4NC2B 5D2NB 4R5XA 1K4DB 1G6RL 4F2EA 2R2HB 4DN3H 3C08H 4F8NA 1TJMA 3WNLA 1VFBB 5EOQL 1NIDA 3FOLB 5FIEA 3OWRA 4QGYA 3QWRD 1XF5A 3QFDB 3MLTA 3VXUD 5I17A 1TQCC 4YDKH 7TAAA 2XN9A 5DR5L 1AXTH 1V3LA 2ADFH 3X13A 5F7AA 3F7KA 4XN1A 3CX5J 3GMMA 3QA3A 4NO0D 2PP7A 4ZNEA 2J73A 3W3BA 3QG6A 3WLBA 2BSTA 3IMRA 1ZTXE 4X5XB 5DEFB 4NP9A 4LMQI 4RCAA 4XPTH 2WCPA 2QPSA 3C6SA 5CSBA 3OGCA 1REIA 1DVFC 2P24B 4EXKA 1X4YA 4HW6A 5D2NA 3BDXA 3D4CA 5J5EA 1J5OH 1R6VA 4YPJA 3LPOA 4UYPA 4AEIL 1UC6A 2R2HA 1VJSA 4XXDA 2X1QA 2GG1A 4XRCB 1IGFH 1VFBA 5I74C 4AOFA 4K7PX 3TT1L 3B9EA 1ID2A 2W8CA 1V10A 1Y7VA 3IU4L 2KLTA 3GZPA 3NUKA 4N5EC 4Q9CA 2HTLC 1OP5K 4JZOB 1Q72H 4LDEB 4TVSa 4GIAA 4J4PC 4B9GA 3IKCA 3MFGB 4X5XA 1FZMA 1MRDH 5IEHA 1ZLDA 4HWBA 1FSKC 3JUZA 2P24A 4XWGH 1NCDL 3G5WA 1CLCA 5HPOA 1C12B 3UYPB 3EYSH 4R7NA 3ZDXF 4I87A 5C2BH 1I9EA 4Y19E 3T9WA 4XRCA 3WD5L 1GRWA 3NQKA 4GG8B 5D7LA 2VXQH 3WJJA 3EYQC 3L3OB 4M56A 1H9DA 2JTDA 2WUBH 2CK0H 4HWZA 2QSVA 4JZOA 3HZKB 4FF9A 4NC0B 3B34A 4TSCL 1E3FA 2IDSA 5E03A 3U6RB 3JTTA 1E2WA 3G6DH 4L3CB 1J8RA 5D9SB 2W88A 4Z0BL 4MAYB 1BA9A 1X5ZA 4O02H 4LFHG 1Q9LA 2GBUA 1I7TB 4HUXB 1JZHA 3BAJA 3LS5L 4GXVL 1NDMB 3ZL1A 2VRAA 3E1F1 3LB6D 4APQB 3UP6A 4A39A 1CG9A 4K7PY 3V0DA 2N0KA 1HI6B 1WAPA 3AFLA 4EI6A 4O5LH 3LTVA 1MREL 2RR3A 4NPKA 2EIBA 1IT9L 3OLIA 4PJ8C 3Q2WA 2GJ6D 4JFFE 4U3SA 2NX5B 3OB0K 2FWUA 2YOCA 2ZAIA 4YHZH 3S36H 1Q0XL 4QYAA 3BPOB 3U6RA 2A4CA 5CJQL 3QWOA 4JJOA 4FERA 3D2UB 1UD8A 1Q9KA 2YFOA 4HA1A 1ZT7B 3MJWA 4MJ2A 2EEFA 4PG9A 1I7TA 1WBXB 1G6RA 2C3WA 3S37H 1R19A 1QLEH 2F19L 3P0VL 5A6MA 2EDFA 3OZLA 2EDTA 4YDNA 3K6DA 1NIBA 1OE3A 2NDGA 3MUY1 1NDTA 5JA9A 2DKMA 4I85A 2OXHB 4P46D 4MMXA 5C8JB 1B4TA 1E90A 2FYVA 3KLAB 4BFKA 2AK4E 4W9GC 4YPGB 2DBLH 2WSPA 5F3FA 4MKTA 4ZMPA 4UDTB 2VJXA 1P1ZB 3DX4A 4ZFGL 1TZ8A 1FLRL 3IJ7A 3GSQB 4O9HL 3TEWA 5HHNA 1A02N 2E9WA 4LNVA 3GHBH 3ZYOA 1KYDA 3B9DA 4WNJA 4AUUA 1ZT7A 4NN5C 4PJBA 3MBED 3IAPA 1D2OA 1WBXA 4LCWB 4PJGA 4CC4A 4BFGA 5F3BB 3F3HA 4YAQA 4K15A 3AC0A 3K5SA 3R06A 1MKFA 1ZE3H 1AR2A 4WEBL 1JXJA 1G7PB 2H2PD 4NLHA 4RFOL 3COOA 1GIGL 1THCA 1UB5B 5EIVA 2J12B 4YPGA 3TBTB 5L6YL 1TEGA 3A4FA 4FQIL 4KY2A 1A7PL 1BEYH 4PWKA 5DK2A 1P1ZA 1QAWA 4WY7H 3ZKMC 1UD4A 2EECA 3NPSB 5IBTL 3VWJB 1J05B 4NJ9L 2ATPB 4JFDB 2JB5H 4L9DA 5AYTA 3UJIL 5I19L 3GZQA 3CLEH 1VACA 4P5TB 4Z78A 5FV2A 1TVDA 2WZPA 4G8GB 1TMCB 5F3BA 1KB5H 2WIMA 3E80A 1N5YH 4GIOA 3ARBC 4Z95H 2JXMB 2APVA 4IRJD 4LDLB 1H19A 2DQDH 5K9KA 3T8MA 2F2HA 3FN3A 2E7CA 2GSMB 4J3XA 4G3YH 3TBTA 4KXCA 1FQ9C 1GGIL 3LKNA 2YUXA 3V7AG 3IDIB 2V3EA 3GJFK 3U4BH 1KIRA 3VWJA 1J05A 4LDCA 4QXWA 2ATPA 4JFDA 4KTDL 3ASNB 3QPQC 1C7TA 1EZUA 1AQKH 1WO2A 1ZLUH 2L04A 1PZUB 2G3XA 5T3XE 3N91A 2C3HA 2EEAA 3I85A 4AM0B 4HS6A 4OCXH 4TUKH 5C0CE 3NIGE 5I16B 4PY7B 2O5YL 4JM2B 4QWWD 1U2HA 2A7BA 1P7HL 2AXGA 1OT2A 1AE6L 1KBPA 2QZQA 4FLOA 4MJ6B 1MVFA 1MCOH 3SJVB 3VD3A 3EAKA 1DUZB 4DOHB 1OSZB 3DX3A 3JWNC 5ICZB 1TYJA 3KPSB 4TNGA 4H88H 4ES8A 5KAQF 3KEHA 1JGDB 2EDMA 4HV8A 3ZE2F 5GJTH 4AM0A 1Z9NA 1YQ2A 2FUQA 2KZKA 1W16A 2RQ8A 3FW6A 4HIJB 2P49B 3B2UC 1UXWB 2K9UA 5B8CC 5C70A 4UCFA 1OB0A 5GHWL 4YHOH 5IMMB 5GRVK 5EUOB 3K8MA 3T0EC 4PJHA 4HXBL 1HKLH 1DUZA 4MD0B 1NMBL 3HG2A 1OSZA 3KPSA 3FFOA 3PIQB 3B43A 1VFOA 2FO4A 4Y8AA 1P4UA 4M61B 3O0RL 3QORC 3EHBC 5CU9A 4QPEA 5DLML 4IBVA 1JGDA 4F8QA 5LQBL 5BS0A 5E8OB 3DO3A 3B6SA 4HIJA 4HIXL 4IBUA 4X6DE 2LW3A 4PJIF 15C8H 2HT4C 2XZCH 1UH4A 2N01B 2X4TA 4HHGA 3KMDA 4I0PD 4JW3A 4I1NB 5EUOA 3S2AA 2Y25A 4KXDA 2NZ9D 4ZMVA 3SCMB 1CD0A 3AXLA 4A55A 2MCMA 2VC2L 1HEZB 3F7VB 3MXWL 4J28A 4MD0A 1NMAH 1J1OH 1PZSA 3ES6A 1TCRB 2DDQH 5JOPE 5GJSH 4M61A 1D6EB 4DUXA 4NNXB 2VXTH 1F0LA 4JFSA 1XQ4A 2EEBA 1PIFA 4V2BA 3KLSA 5DUBB 2Y5EA 1XBRA 2DQCH 3BIAX 3VGDA 1DEEA 4JKPH 1T04B 2ZUSA 2WJ7A 2WYIA 4BA0A 1QBBA 4K2UL 3FTYA 1N3NB 2PWEA 5E4IA 5F9OL 3BQVA 1A1MB 1HEZA 3LQAH 2E75C 1QRNE 2ALWA 4TVPL 4J8RA 2OCJA 3B3BA 5D7IE 5C0ND 4KZDH 3FTWA 3UC0H 4NENB 2DEYX 3VXMD 4NNXA 3RU8L 2AMGA 2WAQA 2ORBH 1F41A 4KVCH 3BPCB 5DUBA 3MLXL 2BJML 5TPWL 4N5UA 4H8WH 4FHJA 1VERA 2VR3A 1DSWA 3BLPX 1FJ1A 2O4EA 2VM9A 3SO3C 5L4IA 1T04A 2ZCKL 4DAGL 1YEKH 3HVDA 4Z7NB 4S1RL 1PYWA 3HE7A 2L0DA 4WTXA 4A7VA 4FQJH 1N3NA 3EIFA 1B9KA 1ORSB 1ZTXL 3NDZE 4XE5B 1A1MA 3LN4B 4XMLH 4ELMB 4NUJA 3TF7C 3KXFD 3MR9A 5T1DL 3L9YA 4X6BB 1UWYA 3F58L 1MH5B 2W9DL 3A6CH 4NENA 1YA5A 2F8VA 1ACXA 1I75A 1FE8L 2P3YA 4NP4L 3LKOB 3O8XD 2QPFA 2OLDA 1RUQH 2NYYD 3LPFA 1GCFA 1RQ5A 1WE5A 2ZXWB 2ED6A 4L0ZA 2V2TA 3NACL 4HGMA 1OPOA 3P3RA 2A4EA 4Z18A 1KV3A 1ZLEA 4TF4A 5FB8B 1OD7A 4GXUM 5I73C 4NQED 4R4ND 1ORSA 2MSPA 3LN4A 4JFZL 4P59H 3RZCB 1II4E 4ELMA 4OLZL 1FNFA 3WLWC 5IT2L 1NQBA 1NEPA 4YXHH 4X6BA 3BRGC 1MH5A 2XJLA 1DCEA 3P54A 3QFGA 4G7VL 4X7FC 5AW5B 1SBSL 3P4LA 3UJJL 4ORZC 2D7NA 1XL6A 2H32A 5KJ4A 5JQ6H 3F6LA 2QZ5A 4HF5L 1N4XH 1OCRB 2EE6A 4DWHA 3PGCA 4FNQA 4CGUB 4FG2A 4YO0A 3WTXA 3QFJE 3P77B 4X4ZA 3ULUD 3BH9A 5F71A 4XNXL 1NICA 1N2RA 1BWMA 5FB8A 2JJSA 1E4XH 3ARPA 3B2XA 1J9CT 4UINH 3VJ6B 5LN8A 1T21B 3RZCA 4I8DA 4KROB 2QQNH 5DS8B 2CKBL 3KW7A 2B9BA 2YS4A 1NCBH 2TRHA 5CJOH 2D03H 4XO9A 1LILA 2EIEA 5AD0B 1XH3B 3G6AB 5EOCJ 5DD5H 3ET9F 3L5JA 1DDHB 1WBYB 4HZAA 4L1LA 4B0MM 5D96C 3T65B 1BCIA 2JE8A 3N1MC 1NC2B 5ACLA 5CFAA 1V3JA 1P6AB 3L3IB 2IWFA 3BXNA 1TT6A 3U9UB 1KACB 5LAPA 3BC9A 3K74B 3O3EA 1VGEL 3BGMB 5KYNA 1KCUL 3HZ3A 3CSFA 3MCYA 3VJ6A 2MQCA 2XQYA 5DS8A 3QDME 3N06B 1W72L 1CTOA 2V7NA 1UT1A 4APXB 2G5UA 1A6VL 2D7OA 3LIUA 2GSGB 5AD0A 4CGTA 1XH3A 3TFBA 4KNUA 3TCLB 1H3GA 1DDHA 1WBYA 1WVZA 2HRPH 4BCYA 2WQSA 3DOIA 3GYRA 3UTTE 1H3XA 4XVOA 2ADIB 1LD9B 4NAJA 3G5YB 2DQJH 1N6UA 3NJGA 4YDLB 4AJVA 1IGJB 2PNDA 1A2YB 3BGMA 3QJOA 3WHE0 4FFYL 2LQRA 4RGOL 2FYYB 3IDGA 5HHXL 3L1EA 4NO3B 4OLWL 5DC0A 4Z7AA 3ZDZF 3ULUF 1C1EL 1U8NA 4Y5VA 1MLCA 3UAJA 1S7TA 3RGVC 3MO1A 2CJSA 4D3CH 4RZKA 2B1AH 1XGPB 5IQ9A 1LD9A 4B96A 1PKQE 3I50E 3FRPB 5E6IC 1BDYA 4FMFA 4NUGH 1A2YA 4JLRB 3RE0A 5CZVL 1J9SA 4IDJH 4AVJA 4AMWA 3TJEH 2MTAA 1J87A 4PJDB 5E7BA 4ADIA 3NCBB 2ADGB 5ISZD 4M5SA 2CKBB 4NO3A 3EO0A 3V4VL 3N43F 4PJ7E 3IDXL 3W39B 2WVTA 1SMDA 3MAWA 1RUPH 4JFXB 5EIIB 5T1LB 5E6YA 2CRZA 4Y19A 1JI1A 2BSEA 2CNZA 3HHSA 1O9VA 4NXKA 4EZKA 3QUYB 3FRPG 2DQIH 4KKAC 2H6PA 4UT6H 2NSXA 2FX7H 4L4TB 1T0OA 5AVWB 2Q6WB 1WEJL 3X1EA 1C7SA 1PD1A 2LLNA 3FQUB 4RA3A 4LASH 5ESQA 3KLHC 4IGBD 1FPTH 1F4XH 1MHHB 4FG0A 4JFFB 1HYSD 3EDEA 2H7WA 2IGLA 2HT3D 3TA3B 2IMNA 4FJ6A 2ADGA 5FV1L 3U9PL 2ZUWA 2CKBA 1W72B 4E42B 2ITCB 3PP4H 4POUB 4LSRH 5EIIG 2MOQA 2ZSWB 4TNEA 4XNZB 4JFXA 4N0CC 3RWEB 4HWEL 3KZ8A 4FQ2H 3O0LA 3PV6B 2PCXA 4MDJB 5T3XL 4QF1B 3QUYA 2OTWB 1PVHA 2P42B 3HB3B 4LSVL 1FGNH 2VXUH 1ACYH 4HJJL 3D1MC 5K9JH 4U6YB 2IH1A 2MNWA 3FQUA 35C8H 1WAAF 3L5XL 3MBXH 4X4XA 3B9KC 3U0TA 4JFFA 2QHRH 4PS7A 3VNYA 1AOZA 3BDYH 2BOBA 3BFOA 3GLDA 1ZCRA 5D1XC 4GKZB 4E42A 3S6CA 1JGUL 2C26A 2ITCA 3ZHFA 4BFEA 2Y24A 2ZSWA 4N2FA 2IEPA 1OTSC 2EXWC 1BSIA 2PTTB 4IS6B 4MYPA 3RWEA 4HEPG 3V79C 3MV7B 4MDJA 5DHVA 3V95A 2GY7B 5IVXE 4YHNB 1BVLA 1GR7A 4OI9A 4HEPA 4LVOB 2OTWA 3DX8A 2A0LC 4L9LB 4TQEL 1EJFA 1W80A 2VN4A 4WLCA 1AGCB 4D9LH 5LAXA 1N67A 1OQXA 1UFUA 3WIFB 2AK4A 4FQLH 4XCCH 4EIGB 4LSSL 1AGFB 1M53A 1I7UB 1BQLH 3MYZA 4FFYA 5AZEH 4XC3L 5EC2B 5D6DC 1XF1A 4C58B 2AQNA 3KLQA 2NUPB 4GKZA 3T2OA 4YX2H 5I1IL 1YYCA 2GPZA 4DN3L 3C6LC 3RWIA 2PTTA 3TV8A 3A5VA 4FJYA 4M8RA 2EICA 4G1EB 3QZPA 3PPEA 3PWUA 3MN8A 1RL1A 2ESVD 4XPFL 1EO7A 4JRXB 5ENWB 3KHOA 4RIRA 5GS2D 1AXTL 5ICXB 4XBEH 2ADFL 1RIVH 3DPDA 5DS2A 1LE5B 2F54D 3SDCB 2B15A 3MRRB 4G70B 3WO4C 4XPTL 4PH8A 2WLZA 4LRIA 1I7UA 1KPRB 5B3SB 4UQCA 2A1WH 3HG4A 1V55B 5EC2A 2J8UF 2YUZA 3IRZA 5T3ZD 1J5OL 3EZJB 4OCRH 3FT3B 5F89A 2EDEA 1XIWD 3O81A 3V4VA 3VGHA 4HJTA 1IGFL 4KKLD 4GRMB 2PWHA 4LQ1A 4KK6D 4KZCA 3L2LA 1K72A 2E6QA 4UQ2B 1UWXH 1EO5A 2ZUTA 3VVVA 4GI9A 4AEHH 2DEXX 5ENWA 3RA7L 5HYJB 3N9GL 3NIGB 4NX0A 3WY2A 5F7YC 3EZ8A 2W65B 1Q72L 1LE5A 2NW3B 2X4SA 3BZ4B 1RU9H 3WJLC 1F3JA 3TNMA 3V6OE 1KPRA 5DJAB 2JKWA 3LKPB 3UTQB 3CFBB 4L18A 1T1YB 3DECA 4XWGL 2IPKA 2O72A 1JHLH 1CFNB 3FT3A 1QBAA 3PV7A 3EYSL 4L0PB 5KUMA 3ZRFC 4JFUA 5C2BL 2NZIA 3FT0A 4KMLB 4N4YB 3KNBB 4XGZB 2F58H 3H9HA 3CSYA 3IDNB 4TLTA 1YC7A 2VXQL 4NFDA 5DRZA 1WGVA 3H4HA 2IOOA 2YGPA 2PPEA 5C0CA 2EQDA 3MXVL 2WUBL 5DJDB 3SKJH 2Q3AA 5IEKB 1EJ6A 3F12B 3ABMB 3H2WA 4RLDA 4UBDD 5IHLB 5DJAA 3G6DL 3FONA 1T1YA 5FHBH 4P4KC 3VD1A 3GI9L 4O02L 4PJEF 2Y6SD 4JFPB 1U9KA 5CGYC 3DX6B 1ETZB 4WO0A 3DMMB 2MRYA 1UACH 2FR4A 1LWHA 3B5HA 4ZBJA 3Q9QA 4GQQA 1J5DA 4UU9B 1YNLH 1NUNB 4O5LL 4KAQH 3VFVA 4IBLT 1CL7I 2AV7B 2WQUA 1NJ9B 4HJ1A 3BW9B 3ZTEA 3F12A 4YEEA 1I8IA 3PCYA 1QSFE 3S36L 3WBDA 4Q9QH 3KBFA 4GUOA 4ZO8A 2YSSB 1YG9A 2FIRT 4ENZA 1IVLA 4LCCB 1JMXA 3HPJA 3HPLA 3S35X 3VD5A 4CU8A 2F1EA 1OGAE 3DJ9A 4QTHA 3DMMA 4L4JA 1CVRA 4ZMOA 1H8NA 4QJ4B 1EEUA 5A6IA 2WWMC 3FT1A 2NZ1A 2YXFA 3D85B 4Y2LA 1XV8A 5IWLC 3JVGA 4R4NC 4F91B 1UGNA 3FH5A 3LN9A 3QE5A 1CXKA 4X6DA 4HALA 5E1HB 2YUVA 3UO1H 5AFAA 4U0RC 4HMCA 1N18A 2DBLL 1T5WB 3GMPB 1UB6A 4OF7A 3BW9A 4C8XA 2CMRL 1GGCL 2H41A 2AKRB 3N41F 3OMZA 3S3SA 4KGJA 1K3ZA 2A77H 1DJZA 3DROB 2W07B 4IW4C 1NKGA 3GHBL 4MFHA 1AZBA 3C8HA 4LCCA 4N90D 4PIBA 3SIKA 1E5CA 4P07A 5D7IB 3K1KC 4OFVA 1LNUB 1W0YT 2EXYD 3MKKA 2X2HA 5D7JB 2ITEA 4OGZA 4B7IA 2WNWA 3P69A 4K9EL 3KVQA 4A7GA 1PLGH 1CGXA 3D87B 1FNGA 4XMKL 1MW1A 4BK8A 3IT8D 3ZE0E 2AKRA 1BEYL 4LB8A 5ID1B 4WY7L 4Y16A 3BVUA 4NCDA 3PP3H 3DROA 2W07A 4IBWA 2VUOA 4E9YA 4PRPE 4NO2B 2LABA 1OM3H 1ACZA 1QRNA 2JB5L 1S7VB 2VR6A 3CLEL 5D7IA 1D5XA 1ND0B 2F5BH 4XXCA 4LLWA 1VEOA 5DVMA 1JPEA 2OYPA 4F2FA 1LNUA 2FE0A 3BAKA 3L5HA 1XDTT 1PY0A 1JPFA 4XC1H 4Z95L 4L1TA 1TZGH 2EKJA 2E7MA 4FYQA 5FGBA 2VXQA 1IGIH 4LSQH 1HINH 2X53A 1AQ8A 3WTYA 1O9WA 1DUYA 5CBEA 1ECZA 4Q58C 4AGPA 5ID1A 1KGCE 1ML0A 2ZG2A 4UQ9A 4E9LA 2MHAB 3T4YB 4F3FB 2WUCL 1S7VA 1AQKL 2NY3B 4O02A 5AAWC 5DRWB 1F45A 3CHXA 2TRYA 2B4CH 2OBGA 1YPZE 3WFDH 1RZ8A 3VFRA 4WO4A 1OB1A 2CU9A 4OCXL 4TUKL 4WI3A 1Q94B 4U6HB 3PWVB 2Y1ZA 3V4PH 3QXAB 2YMXH 3I50L 5DHMC 1F6AB 4IMLB 2KPWA 3QFJB 3TPKA 2VUKA 4JPIA 1A3LL 1QNZH 4PLJC 3F5WA 3GEFA 1MCOL 4LLDA 4AYDC 4JG5A 2I69A 5FYJU 1MVUA 2FJHB 3DHMA 1EHKB 1UXLA 3KR3H 2VMEA 4F3FA 2OA9A 4H88L 1U6AH 5KSBB 1CU4H 3INUH 4JPWH 2VRKA 3ZMNA 3KPOB 5FKAB 5GJTL 4BH8A 2ZXQA 5FA3A 2Z8WC 4U6HA 3PWVA 4MA7H 5I1HH 3NCWA 2EZ0D 1GZHA 5BO1L 5J3HC 1OGSA 3K71B 5ID0B 4YHOL 3QFJA 4LCWD 2WZPD 1SRDA 4QNPF 5F9AC 4BSWA 1FNSL 1EFXA 1HKLL 4TQPA 3CZGA 2I24N 1JRHL 4G6JL 2CBMA 1PF3A 3EBAA 1S8DA 1YMME 1YC8A 5JTWA 4YHPA 4LOVA 3T77B 4KXBA 4AYBA 1UXSA 5AQ0A 5F21B 1KYOK 4GB9A 1YNKH 4FJZA 2EDQA 2A6DB 1W9XA 2RJMA 3NT0A 2XKUA 3VWJD 3MLWH 3T04D 3UTTB 5D2LE 3RP1A 1UCTA 1AVAA 4JFDD 15C8L 4YC2B 4XXWC 3K71A 2DIEA 5ID0A 4DP7X 3KGTA 4NQXA 3A47A 4G8GD 4JZNB 4XO4A 3QIBC 1LDPH 1T80A 5HDBF 3MMEB 4PLKD 4P2RE 2WVVB 1NMAL 4HSCX 5JO5B 1AIZA 1OPGH 4H8QA 3QDMA 5GJSL 3T77A 5F8QC 4AJ0A 2VXTL 4AZUA 1YY8B 2QKIB 4PJGF 3C60B 3VRIB 2JKTM 2FX8H 3GMRA 3M86A 1XGQB 3LOWA 3UTTA 3X1BA 3B83A 2DQCL 2ZONA 3K4DA 4Q8BA 1TVBA 1P84J 1S9XB 4KI5E 2JJTC 1LMIA 3WIHH 3K0YA 1J0YA 1XR8B 1AHWC 5B3JF 2C5DC 2V33A 1AZNA 4DW2L 1Q9WB 2AK1H 1HCFX 3DYOA 3LQAL 3ZKSD 1N6QH 2C3XA 3NIDE 3EGSB 2V6HA 5AOJA 1KBKA 1UM6H 4L8BB 1CB4A 3GC3A 3TU6A 4KZDL 3UC0L 5CD3A 1ZA6A 3F62A 1ZVYA 1YY8A 1ZAGA 3OR7A 4BKLA 1IIIA 2ORBL 4ODWB 4KVCL 3RAJH 5C09B 3C60A 3CBJB 2DZEA 1L7IL 3OKLB 1XGQA 4H8WL 4NKIL 2RALA 2LAAA 1Y0LA 2V3DA 3ILQC 3KPSD 2ZE0A 4XVJL 5DLLA 1PKQA 1S9XA 3MRNA 1L0XA 1QLFA 4FQJL 1ZXKA 2Z65C 3AW5A 3E6HA 1Q9WA 3EW3B 1JHTB 3I3BA 1DE4B 3PF2A 4N2LA 1SOXA 1UOWA 1I8UA 3P73B 5BS0D 2QV4A 4WZ9A 3U4AA 4L8BA 4JY5H 5BZWB 3QI9B 3A6CL 3DSNB 3HC3H 4PBWD 3LEYH 3B7TA 5C09A 1GJUA 3OKLA 1HHJA 1RUQL 3QIUA 2BNUA 4NDMA 3LY6A 2LU7A 1A6AB 5C0BE 3HLKA 1FGVH 3JSSA 2LGNA 1MDTA 1O5PA 3EYFB 4CVZB 3BQUB 3FPYA 4AQAA 5TE7H 3WDHA 3OKYA 4BXVA 5KVGH 5AB9A 3D51A 1DE4A 3QT2A 4P59L 3RB7A 3P73A 2XA3A 2B3IA 2ZX9A 3ZQ9A 2HWZH 3Q1SH 3QI9A 4FQCH 5FUCE 4KH2A 2WBWB 4PGJA 3PDDA 1LO0H 3GDBA 5HYEA 4HX1B 3WNIA 5JQ6L 2IAMA 1GCYA 4IBQA 1GSMA 3JYBA 3SCMD 5DO2D 3OL2A 1MWOA 4YDVB 5EZPA 3GMQB 2XVKA 2ICWJ 1ZK5A 2Q10A 1GVIA 2R69L 5CJ5A 2YKLH 1VFAB 2VZVA 2R1WB 2QELA 3PHQB 4PJHF 4BDVB 4Q89A 5LGYA 1PZ2A 2Y36H 2QQNL 4WKZB 1ODAA 1AZZC 5BNXD 3BKYH 1NCBL 3GINA 1HNGA 4MNQE 5EO1B 5HJDA 3VXRB 5CJOL 1DQKA 1WJ3A 3D5OF 3T2QA 4A6YH 3B3IA 2ZAHA 1M3IA 4GG6E 2G3ZA 1YEGL 5DD5L 4GQ9H 5G5DA 3HE7D 4MHHI 4K7FB 5IF0B 3NJFA 2WYTA 2VW4A 3ZYZA 4H5SA 2BY3A 4N9GA 5IVXA 5J1SC 4P2CG 1QBLH 5K9OB 4RMQA 3BGFC 2A6IB 2XIBA 3L3HB 2I5YH 1KIQA 3WHXB 9PCYA 2AQPA 2Z7ZA 5EUOF 4N87A 3TLRA 1FBIH 3PHQA 3TCTA 4BDVA 1YY9D 2QFPA 3L17A 1T6WA 3P2BA 3RUGE 3WJMB 1DLHA 4FD0A 2YN5A 5EO1A 5DJYB 3UC0A 5GRWA 5HYQB 3CZEA 4Y9FA 4Z7WE 1YUHB 2PKDA 4K7FA 2HRPL 4KMQA 1NCUA 4CA4A 3DUSB 4UANA 4QLWA 1NINA 3VSTA 3S4SB 1ZDQA 2CSPA 4Q6IC 4Y89A 2FQGA 2MTPA 2DQJL 2FT6A 1E4KA 3RIFK 4M7LH 1B0RA 2J4WH 2A6IA 4KO9A 4OI7A 2FWOB 4M1GH 1T7XA 3S2CA 3B9VA 3KPQB 4MAZA 4XCFH 5TK2A 3OXSB 1J0HA 2OI9B 3WN5C 4P5MA 4TM9A 3BP7B 5LKNA 4H8HA 1IU1A 1EDHA 3WJMA 1NBQA 4KHXH 4F7KA 1FVCB 3V8CA 1F3RB 5A2JH 5HYQA 4R26H 1N7MH 4RZCA 3S4SG 1HEHC 3DUSA 2VXSH 4XO3A 4ZOEA 3U0PB 1E7UA 3D18B 3RZCD 4A63A 5HPMB 2B1AL 5F7EH 4A2LA 2EDXA 5EBLA 1IL1A 5GS1B 4U0QB 4BGDA 4NUGL 4XI5D 4Q97A 4ZW5A 2B0SH 1JK8B 3KPQA 4IDJL 5F0LB 5BCAA 5C71A 4POYA 5ADPH 1E5BA 1AMXA 3V6OA 4IHOB 4UOQA 2K6YA 5IMOB 1U91B 1A9EB 2V8LA 1NDGB 1I8MA 3EFFB 1G1YA 1QEWB 5AALA 1ESOA 4FQQB 4N1EA 3U0PA 1UD2A 3SY0B 3D18A 5HPMA 4UT6L 5ABZA 5TQ2H 2D31B 5GS1A 1G4RA 3GRWH 4HXAH 1FH5H 4AT6B 1CDCA 2OCCB 2R69A 5KSAC 4B95C 3A4EA 5JHBA 2V9TA 1F4XL 1JK8A 3HG0A 4WEEA 4HC1H 4BFNA 3MUHL 3F65A 1QSFB 2X4OB 4FXGA 4KJPD 3THMH 5DMKB 3G5ZB 4IHOA 2A74B 5DHDA 4ELMF 3QUZB 1IAII 4L8CB 3DHUA 2ZOOA 1FL3A 3PP4L 1U91A 4LSRL 1HCYA 2UY7B 4Z3JA 1NPUA 4ZYKB 1HWGB 4K23H 3PS6A 1K8IA 1NDGA 3MLSH 4AE1A 5BOJA 4MAYC 1DYZA 1QEWA 3LV3B 1KJ3H 5F96H 4PJ5E 4FQQA 1VZHA 4NRYA 3QUKB 4PLNC 1I1AB 2E4FA 1AXSB 1WYJA 4ZMZA 3GS4A 1FGNL 2D31A 1ACYL 2VXUL 2ZP0T 3GSNB 4KO5A 4Y2OB 2HYMA 4APQC 4DGIH 4JJ5B 1QSZA 35C8L 1WLGA 5CHNB 4NHUB 5E4EB 2ZXEB 2QHRL 4AENB 3CDGB 3UAJD 2JCCB 1QSFA 2SEBA 3BDYL 3DYPA 4DEPC 2XXGA 4Z3FA 1HCZA 1ZGLA 3QUZA 2HAZA 4QYOA 2BVPB 4JE0A 4X7SH 1INEH 3FTSA 3OD3A 2XT1B 3BPOC 3IETA 2CK2A 4ZYKA 3CSPA 3RFRA 4YSCA 5BXFB 3TASA 4JFVA 4M8QB 4DQOL 3LV3A 4YL4A 1OGAA 3IFOA 4MMZB 4PCYA 1UTDA 1TVHA 4MVBD 3A21A 1GAFH 4NIKB 4Y2OA 4AUJA 4KTEH 2H3XC 1UA3A 3EYVB 3R0MA 1XEUA 4LIQH 4D9LL 5L2JA 4E36A 1DSFH 2OJEB 4NHUA 4FQLL 3T3PB 2AQSA 2B8OT 1JPSH 2VQ1B 4FHKA 3IFPA 1BQLL 3MJ9H 2CUHA 2IGFH 1AACA 3EJUA 2UXFA 4HJSA 5AZEL 4YX2L 1P9MC 5D70L 3RPBA 2CJUH 4PRPB 1FL5B 1TIUA 3MV01 3O2VH 2D7MA 3WDIA 5BXFA 5ITBL 2DOCA 3H42H 5DJ8B 5HYSB 4MMZA 4MSWB 4U4IA 1IAOA 1UASA 2DH2A 4OFQA 5FO9B 4ERSH 2NXZC 1DQJB 2DQTH 2ENPA 3MRGB 3ZR5A 1NM9A 2FECL 3CVHB 1AHKA 1FL6B 1TQBB 3KGUA 4U7KA 1TQWA 3CSBA 5T1LD 3US9A 4OR1A 2PW2B 3PWPB 3VRJB 3O9WB 2A1WL 3QUYD 2O5NA 4MA1B 1IBZA 3FQ1A 4OCRL 4PRPA 1FL5A 1BZ7B 5E08H 1EZLA 1OVZA 5B4MD 3KWXA 3NPSC 5KYXA 3PAUA 5HYSG 3GBNH 4GSXA 2PABA 4WU5B 4AYMC 5DJ8A 5F70A 5HYSA 2GJPA 1NCOA 1DVYA 4JFFD 4MSWA 3W9DB 4YJZL 4P5TC 2V4LA 5FO9A 3OHXC 3ZKXC 1KN4H 1TETH 1J48A 3G5XA 5ACZA 1RURH 4UT6A 4AEHL 3MRGA 2BY0A 4XCEB 3RTQA 1R0AH 2A6JA 3EOBB 1WZAA 3EUDA 5CZXD 4HHAB 1RU9L 5KVGE 4D0DA 3TIDA 2HUEA 4MJ5B 3PWPA 4KBPA 1F2QA 1FV1B 2K4AA 2P5EE 1GYUA 5LJYH 1G7LA 3HB3D 3LH8A 4YZWA 1VLXA 3R7RA 4E9RA 4UV4H 2BP8A 4PGDB 5IVZB 4M4RB 4Z1PA 2AK4D 3ZO9A 1Q0YL 4PRIE 2F58L 1E3ZA 4NNYA 3SPVB 1QUPA 1AGDB 1I9IH 5ERWB 2A73A 5A2FA 2BIHA 1IMHC 4XCEA 4YNYA 4QHUB 1E4WH 4UZUA 3SKJL 2VLKE 1R33A 2OXGB 4ELKB 3Q43A 2NR6C 1QWUA 3FUKA 1XH0A 3RKPA 1A3QA 3RWFA 2Z93A 4BEIA 4JM2C 3MACL 4URTB 1FV1A 5FHBL 1MJ7L 2WINA 4XVUC 4PJDF 1RUMH 5IB2A 3WFEL 4JGMA 3ZQXA 1YMMB 3GIVB 5BOPA 3DVIA 5ESAA 4PGDA 1NCNA 4M4RA 5IVZA 4J3OG 5L4FA 3OXRB 3TN0B 1YNLL 4G80B 1AGDA 1XF4A 5ERWA 1B2YA 1T66C 5AWNH 2VNCA 3VFSA 4HUUB 2OXGA 3D3VE 1V27A 4L8SB 4ELKA 1IC7H 3C5JA 1QQDB 4UNVA 1IAKB 5J7CC 1MRCH 1URIA 5BV7H 3ML9A 1EK3A 2CGZA 3O3DB 3U2SB 1I53A 1YMMA 3GIVA 3MCLH 4HOMA 4GP8B 4TTDC 3NVQA 1QLRB 1YSOA 3L2NA 5BO0D 3WKNA 1BFVH 1G1CA 3EJZC 5AKSA 3MLZH 3FUEA 1CF8H 2XICA 3TN0A 5ALBH 1I4FB 4G80A 4S1DC 5E4AA 1N8OE 4E9XA 2EUVA 1NBCA 4N2NA 3UO1L 2UY6B 2IJ0C 5D2LA 5ANMB 1OLZA 4L8SA 4BCZA 2DM4A 3Q6GH 3N5AA 3SE4C 3RWCA 4TPRL 4LQFH 4PTUB 4D7PA 1QQDA 1IAKA 5T3XD 2WK2A 4GXUN 3RILA 4R97B 1AI1H 3U2SA 4UQDA 5HYJD 1HL8A 3FK3A 5I1AB 1F18A 3LD8C 2AJZA 3ZO0A 4FYRA 1QLRA 2G0LA 3FF7A 1PG7L 4FEMA 4S1QH 3BWSA 4DZBB 4H13C 4CC1A 1KJ2L 1XCWA 3JV4B 3S96B 4ZODA 1G7MA 1PLGL 3VM7A 2MFNA 5DC2A 1X9UA 3Q7JA 2ZOWA 3RWHB 2VLJE 5E5MA 2YD2A 3FO2A 3KCWA 1UYWL 4HDIA 2NNAB 3QHTC 4PTUA 4AEFA 1TEFA 1ZANH 1OM3L 5DA0B 4D8PA 2GAZB 3VUAA 1KCKA 3LVTA 2OMYB 5I1AA 1P5UA 4DP6X 5FKPB 1GH7A 4YDJB 2V5SA 1KBBA 1A7NH 3H6JA 4NT6A 5DURB 1GW0A 1TZGL 1U8MB 3GFUA 3QNZB 4KNTA 4QRRB 1SPDA 3JV4A 1IGIL 2ZNXA 4LSQL 4Q9RL 3QH3A 4TUUA 2DLFH 2AXFB 4H0LC 1NFKA 1G0DA 1IEAA 4M1DH 3ARQA 5CWSA 4GAYA 4QRPE 1CICC 2VMDA 1PY9A 3DMMD 2PCFA 4TUJB 4U2ZA 5CD5D 2NNAA 4EE2A 3ZYJA 1PU0A 4ALAC 3AMKA 3LZQA 3UABA 4UOJA 4WU7A 5C0JB 1HKFA 1F56A 3AB0B 4GBXB 2RD0A 5FKPA 4YDJA 5J6HA 2E8ZA 1UH3A 3QZMA 3TZVC 2Q86A 3MTXA 3M1BB 2DMBA 5AL0A 2B4CL 1QSEB 1ZIAA 4ZXBB 1R5IB 1PSKL 3CX5K 1PEZA 1U8MA 3QNZA 4HOZA 1FHNA 4F8LA 1PGRB 4MD5B 2E6PA 3NQIA 4PRNB 3V4PL 2YMXL 5C0BA 3ELQA 1WBZB 3L9RB 3LRMA 5J11B 3NIGF 4AJWA 1I1CA 1QNZL 5EC1A 2WXNA 1MQKH 4TUJA 3ZZQA 1NIFA 3SQOH 4RMSA 1TTAA 1EQWA 3D85D 2O61B 5T1MB 5C0JA 2IWGA 2VR8A 4F1ZA 1U6AL 4GBXA 1GGTA 3INUL 2FCBA 2AV1B 3DIFA 4NRZB 3S36X 5CEZE 1JTPA 2HCZX 3M1BA 3MCKB 4DVBB 3T08A 3CXFA 2XU9A 2PYFB 4MA7L 3QIWA 2YQ2A 4MD5A 1KJ2B 4PRNA 4F7TB 1QRND 1BIIB 1WBZA 3L9RA 5B7EA 5F7DB 3QO0B 4JE4B 1NEZB 2XKNA 5IROA 4IEFA 1LQSR 5LCVL 4XWOC 2CG9X 3X3GH 1SEBA 4JRWA 4RA0C 3MPCA 1U8HB 2BP5M 2Y7MA 4C4KO 4MNQA 3L08A 4KROC 3SZ6A 2X6BA 4GG6A 2AITA 1G0XA 2J1ZA 4DVBA 2XI9A 1YNKL 4FFTA 4KWUA 3VXSB 1KJ2A 2A9AA 3SKNA 3BAIA 3WKQA 3ALXA 1JWMA 1NEZG 1GC1C 2JKJA 4X6DF 5F7DA 3UTZB 3QJXA 1GZQA 2CDEB 1NEZA 4GJTB 4BUQA 3IJ9A 3V9CA 1NIEA 1PBYA 2H3KA 1F11A 1KGWA 1P7KB 2PYEE 3UACA 2OYMA 1FDLH 4XN2A 4X6CE 1OPGL 4YXKL 2BLFA 1KELH 1QBMH 3I6KB 3RUGA 3RY6C 3RVTC 5F7NC 4JFHD 1UXMA 3QJFA 4U1LB 2ARJQ 2FX8L 4Z7WA 3VFPB 1SN5A 2YEZA 5FF6A 3S5YA 2EDOA 1OW0C 2NT1A 4P57A 2J7LA 1X5LA 1SMAA 1G43A 4A7GF 1SJEB 2NY3D 3UTZA 1QFOA 2I07A 3MUUA 4LARL 4AMKH 1I8LA 4WGVB 1A4KB 1N6QL 1T6BX 3VW3H 2Q8AL 1YEEL 4Z7VE 2P7TA 1SJVA 1SUHA 3IE9A 1INDH 1UM6L 4G6MH 2GHWB 1RIHL 3GBDA 4IIQB 3KPNA 2ROYA 1S78C 3VXOB 1T03H 3WUWG 5TQ0H 5I1EL 1WD8A 2NY6B 2OMUB 1JYNA 4LF3A 3QFJD 5D7IF 3P40A 2PR9A 5ES4B 3RAJL 4GRWH 5FS5A 2UZIH 2PO6B 1EFXD 2G3MA 4I1RA 4OZ4A 2SODB 3PWJB 3GRBA 4U1IB 1ZVNA 3M45A 2Y4SA 4P05A 1EXGA 3V4PA 1PDKB 1QASA 1SJEA 2F15A 4NQCE 4LGRB 5HYFA 1N5AA 1C08B 3FO9B 2YRZA 5I1KL 1AXIB 1E27B 4AWJC 4Y2NA 4RFNB 12E8H 2UVFA 1IQWH 1CK0H 2HJKB 4P8QA 3VU1A 3OR6A 3W5NA 4JY5L 3FU5A 3VQ2C 1KCVH 1TZIA 3VXOA 2WVUA 4HETA 1YAIA 1TYRA 2GITB 2OMUA 4FEIA 3GK8L 3LEYL 4BFIB 4BH7B 4NZRH 2DIJA 3QQ4A 1IM9B 4BFFA 5F7MC 4DGYL 3HUJB 3ARSA 3VO0A 1FZOB 4U1IA 5K59E 3CZJA 1LO3H 3QDMD 4DP4X 1KJVA 1PDKA 1S4IA 4DQAA 4XE0A 1HZKA 3MJ6A 2ZJSH 4TVUA 3MRKB 1CXEA 4UQIM 3VAEA 3FO9A 2G75B 1QR1A 1P4LA 5KVGL 2AJYH 2WXFA 3F04A 4J3BA 1USZA 5LCVA 1R5WB 3SPHA 2HJKA 2HWZL 3Q1SL 5E2TH 3UTTD 1BQ5A 2D4DA 3SKOB 2DN7A 4FA6A 1LO0L 3TA3C 4ODUA 4BFIA 5EZLB 1P4BL 2QDWA 1UGKA 4I0KA 4H26B 3HUJA 1RULH 4XNZC 1D2PA 4FFWD 4PJ5A 2DQUL 5EN2B 3ZTCC 1A9BB 1UA6H 5HVHC 4D0BB 3RVWD 3HG3A 3II2A 3FTXA 3BX7C 3RJOA 4Q6KA 2WBJC 1BAFH 1FORL 3MA7A 1S9WB 3MRKA 2JV6A 3ARFC 2G75A 1LP9B 3C60D 2WXQA 5GGQH 3GBMH 1SQ2N 1T7VA 3MC0A 4XP9H 1R5WA 4Y88A 4QKTA 4S2SB 1CFSB 4TLSA 1OP9A 1WIOA 2DLIA 4NQQA 3CH1A 1X5YA 4OLXH 4CSZA 3NA9H 3MGOA 5KSBF 4PS4L 4GQ9L 5EZLA 1OEZW 5T1KA 1XB8A 3BD4A 3JZ7A 4RBPK 2NY0C 3V4LA 1ILSA 1A25A 3BUTA 5AVZB 5L8LB 5EU7E 2Q7NA 4PMEA 4LEXL 1UWEH 2W0LA 3CPUA 3VDCA 1IEBB 4AITA 4C4KT 4LVOC 3SDXB 2I5YL 1S9WA 4L9LC 2EH8H 3GRGA 4AGMA 5C09D 3PGDB 4MQTB 5EO9B 4F9PA 4WW1B 2CALA 2GTWA 1HE7A 1QO3B 4JREC 1KWKA 4XMUA 3MJ8B 4QR7A 4MCYA 2EYRB 4YWGH 1I1YA 3APDA 3HS9A 3FB6B 3ILEA 5C0IA 4HUWB 4ICXA 2MNUA 4WWID 5F44A 4FXKC 1ZT1A 3QI9D 4M7LL 3ARTA 3GIZL 4M1GL 3JWOC 3PGDA 3ARGB 1HHKA 4TNWF 5EOCH 4KK8C 2FQDA 2Y3NA 3IPBA 4QHMA 5C0AE 4WW1A 3SDCC 4F27A 4EZMA 4KHXL 4ANXA 1QO3A 4LCVA 3TA4D 2VT0A 2NNCA 2NY5L 3LNFA 3QDGB 2H45A 1K9TA 2TSAA 1AQMA 3BQUD 3EF7A 3MJ8A 2F8IA 4MNHB 1BMGA 4OD1H 4R26L 3AVEA 3ROLB 2VXSL 1XGTB 4F37K 3L81A 3FB6A 4OU3A 5H2BA 4D9RE 4HUWA 4XNYH 5F7EL 1BZOA 3NEXA 3EBGA 3GXMA 4BBWA 1IFRA 4OZIE 1KZQA 2DAVA 2BW4A 5LGHH 2QBWA 4MBOA 4HJ0C 3ZRCC 2VLKB 4NQUA 1LO4L 4XO8A 5ADPL 3OPUA 5HD8C 5DYOB 1ZSDB 5B1CA 1KBWA 2UX6A 4P9MH 3B2PA 4PRBB 5FM5M 2P5EA 3SDAB 2R23A 4QXGH 3VMNA 3PAZA 4FQXC 4YR6A 1D6VH 2JK5B 1JK9B 1MCPH 4GUPA 1YEDA 2GUYA 2XG4B 4W9EC 4EBQH 2HP4A 1R3HA 3FULA 4FQPA 4PRIA 3OKNB 2AZAA 3BKML 4LBAA 3NZSA 1DSYA 3LRKA 4ISVA 1FH5L 5FW6A 3VXRD 1KSRA 2NT0A 2VLKA 3D3VB 5TH2B 1R24A 2I26N 3O4LE 4HC1L 3WL9A 1TOXA 2CDFB 3THML 1KFAH 3I75A 1PS3A 3PL6C 4JUSA 3O6FC 1ZSDA 5FHAH 1AGBB 2H6OA 1CL7H 4L37B 3S3BB 3OVUB 5HP5A 3T5WA 1IKNA 4ZMWA 4K23L 2F8OA 4X5WA 3MLSL 1JK9A 5F3HB 5F96L 1H3WM 1KJ3L 4UQ3A 2ZD0A 3F83A 5I8KH 2XG4A 5D4QA 4ANWA 1NBVH 3PXHA 4YHLH 2XZQH 3MX0B 4GKSB 4DGIL 3D06A 1B2WH 4WF7A 4KK5D 4G1MA 3D3VA 1CCZA 4WJ5B 2CDFA 5H37H 4GAJL 5FGRA 3RQ3A 3IPEA 1KUMA 3QJHB 4N2KA 1AGBA 4X7SL 3ZLQC 1INEL 3ULVC 3P0YH 2BIOA 3L4WA 3SGDI 2IPTL 4HQQH 1WFNA 5MEPB 5CEZL 1FCGA 4BGLA 3F7YB 2XN0A 3HNSH 5AOIA 1XMWA 4DKEL 2YSTA 4UIMB 5IVXF 4AY0A 4EIBA 4HKXB 4CKQA 4F7EB 3BN3B 1QVOB 4AYEC 4JAMB 1H3VA 2Z9TA 4UF7C 2DLTA 5LXVA 3VGFA 2ZCLH 1JPSL 3U4EB 4IKNA 5DRNB 4K7PH 2R1YA 4RX4A 2CJUL 3LQMA 4N8PA 3S98A 3MA9H 4R4BB 5B7MA 3O2VL 4U1NB 2GT9A 4B9JA 4GRWE 2WQRA 5MEPA 2Y0SA 3H42L 3OSKA 4PJAB 5A40E 3GKWH 4BWUA 1PZAA 5K9JL 3ME0B 5I71B 1PMYA 1WC7B 2BHYA 2XWDA 5DWUH 4ZW8A 5IJKC 4ERSL 5KSUB 2YPVL 1GJIA 2DQTL 3M07A 3TVMC 5D7JC 4F7EA 1IC4H 3ZBMA 2ZICA 4MA3A 3FL7A 3D0LB 1XT5A 1UADC 1OE1A 2VLJA 3QJTB 4N2BA 5LNGA 4RQQA 4JEGB 1KFGA 4PHZA 4PB9H 2BHUA 4R4BA 2CO4A 3CLFL 4U1NA 3GBNL 4DFIA 2AEOA 4ATTA 5BZXA 3VXQB 4FNPA 4LLMA 1KGIA 3Q13A 2ZUXA 1BD2B 1QSFD 3PGFL 4XZUA 4N0UB 5FC9A 4TL4A 4YE0A 5KSUA 3QUZD 1RURL 3VA6A 3DHJA 3KPTA 3CVBA 2EO1A 3JWNE 1OAKH 1E5ZA 1JZ8A 1BLIA 4JO4L 4LSTH 4MA8L 4XNBA 4PWHA 3U36B 1OGAD 3T1FB 4QRPA 2D0FA 4HC1A 4PGBB 3QQ3A 1DL7L 4TTGA 1BX2B 4XR8C 3AQZA 4I89A 4PJXE 5B1JC 4U6VH 5KBNC 2GB2A 4N68A 2VR5A 3JXAA 1F13A 3CSTA 3MLYH 3VXQA 2B5IB 3Q9PA 1XO8A 1RERA 2X4PB 4WGWB 2E7LC 5E2WH 2DQGH 3T0EE 1B0GA 1I9IL 1X3DA 2J56A 1PX4A 1E4WL 1M2VB 4KJWC 4XN8A 4AL8H 4P2OB 1DFBH 3NIFE 2V9QA 2VH5H 4W9KC 3V0HA 2HLFD 3FO1B 4JHAL 3A3YB 3U36A 3FU6A 4QHLA 4A2FA 4XMWA 2Q3XA 2Z0UA 4BSVA 1KT2A 2PXYB 2C7UB 2Y7QB 1DO5A 1MNUH 2HFTA 1SLWA 3WFCH 4BZ2L 1RLBA 5DQDH 3QR1A 1QI4A 1NUGA 2W60A 3U9WA 1SJHA 2EVFA 3W11C 3VTTA 3IDJB 2J21A 2DYPB 1KTLB 2EIDA 4XPGL 5DZAA 4MKMA 5AWNL 2HFEB 1XGZA 4PRPD 4P2OA 1IC7L 1XF3B 4K4KA 1I8AA 2VUYA 3E9TA 4OM0H 3FO1A 3LNHA 4Z0XA 3BZFA 3FQXA 2FLRT 4JQIH 1U3HA 4XNQA 3V7MA 2PYEB 1MRCL 3IF1B 1YUKB 2AMUA 5BV7L 3N6YA 2UWEE 3MCLL 3RTQD 4DK3A 2JIXB 5D5ME 3CDFA 4OQTH 1SN2A 1BFVL 1FZJB 3TJPA 2YOAA 2CR6A 3MLZL 3BO8A 5KS9B 2C3VB 3PWPD 3IDJA 3P1VA 3Q5YA 5FYJL 2FJFB 4XCYA 1NCCH 5HGHB 1KGCD 2L8AA 2HFEA 4PW9A 3P4NB 2YPVA 5FA4B 2MQ0A 3BP6A 2FBJH 3EJRA 3HN5A 4ZW7A 4GFTB 5JDJA 4JFWA 1MZYA 4WI5A 3STLB 4MRCA 4G9FB 4QOKE 4Z3IA 4LQFL 4QRQB 2PYEA 1D5ZB 1SYVA 2XWTB 4P23A 2AGJH 1AI1L 2GBVA 4R3SB 4X6CA 4V2CB 1HOCB 3D2TA 3JV6A 1A6ZA 5INDB 5HGBB 1IC1A 4R7VA 1HH9B 2UVEA 4OCNC 1M42A 5AAMA 1FZJA 5FO7A 1E42A 4S1QL 4N2MA 2C3VA 2O5ZL 1UEMA 1JNNH 3CQQA 5EBGA 1MAJA 3IJHB 3MRQB 3NEEA 3GJFB 3SGJA 1RMFH 4ETYA 3P4NA 2AVGA 5E8EB 1ZXQA 3ZU8A 1L5GA 4A7SA 5E8DH 4ZAKA 1A0QH 3OZ9H 4P9HC 2AJXL 4GMSH 1XB3A 2WQXA 2GIXA 2OJ1A 4YQXH 3T3PF 3F05A 3HCVB 1SHWA 4J3OD 4RMWA 1ZANL 3ZE0F 2X4QB 2XWTA 3F2LA 3FS9A 4Z7VA 2YAFA 4R3SA 2LE9A 3FU8A 4NFBA 1QKZH 4JFEE 5E2UL 4LKXB 1ETJA 5INDA 5HGBA 5I66B 2EIKB 4QXUL 2VJ0A 4HAGA 1KMGA 4BFOA 1X7SA 1KB9K 4J39A 5IB5B 3IJHA 3FBKA 3MRQA 2R0KH 3UGUA 1AZCA 4BRJA 2DLFL 4K71C 4JO3L 4U6XB 1YMMD 2R7EB 5DEGA 1T89C 3L8QA 1EBPA 4OZFH 3MNMA 1CDYA 3G9AB 4NQCA 1BBDH 3O2DH 5AZ2H 3HRPA 3KJ6H 3TN0D 4FGMA 3Q3GB 4W9ZA 2X4QA 5FR3A 5JXEC 2FK9A 3QEHB 1QG3A 5BV7B 1VADB 4LKXA 1VZGA 1I1FB 3MRFB 1OAUH 2JJVA 3QUXB 1UH2A 2ERJB 4NC1E 4BZ2A 3IPFA 5I66A 4UT9L 4U1KB 1Z1WA 1HQRB 3FMGH 2OTUB 1JZ7A 3IXAB 4O2CB 3WE6B 1J5HA 5LG1A 1TTCA 2G2PA 4U6XA 2R7EA 3QQDB 4GAGL 5CCHE 1MG2C 5J12C 1MNNA 2QQKL 1NGZA 2BY1A 1MQKL 4Y1AB 5F7UA 1A7QH 2X28A 1KLFB 1TTFA 3Q3GA 4J12A 4YSPA 2ATAA 4MGXA 1U3YA 4I48A 1LTXA 1L3NA 3QUXA 1TJGH 1OE2A 4KI5D 4W93A 3DDGA 1QZNA 4PP1D 5E56A 2R9HC 3TH2T 4J3OF 3U6XS 4FRWA 3IXAA 3VSUA 3O3BB 4MLSA 3RNKB 1XGUB 1AGEB 4IOFD 4UT7L 2Q9OA 4NS0A 4Y1AA 3X3GL 2BVUA 2VLLB 1KLFA 3MOAH 2OMZB 4OF0A 2CHWA 3RLSA 4PUBL 5ECGA 5BUGA 2XSKA 3ECUA 5I74B 3T8VA 3RKDC 3GI8H 3GSOA 3HMWH 4U6TA 5KBMA 1E6JH 1UCBH 4DZ8B 1N0XH 4RWYH 1SEQH 4BUGA 3BRDA 2YMOA 5JW3L 3TURA 4NLAA 2DWDA 1HSAB 4KRPD 4DPAX 2X89D 1FSKB 4NPYA 4X9BA 1PG7X 1DVFA 2XPYA 5EB9A 1XGUA 3RNKA 1ZEAH 2VISA 5DSCB 3KPLB 2NPLX 5EPMB 1DVUA 2VLLA 1MJJB 4QRRD 5IMLB 1RD6A 4YGVA 1FUNA 2FTAA 3HC2A 1KPUB 1VF5C 4OH2A 4QRUB 5H4YA 4ETQB 1ZGLP 1KELL 5C0AB 3ULUH 1QBML 3EYUH 4ODVL 2WGNB 3PWLA 1RSYA 4DZ8A 1QRKA 4QHKI 2QLVB 2XRAH 3MGTA 1KZYA 5MERA 3RVUC 3V5DA 2OAAA 1JFHA 2YA0A 4J4PA 5I0VA 5AVXB 4GBXD 3BIKA 1F90H 1BPLB 5E51A 4OZIB 3ULSB 4PRDB 1RY7B 2L7EA 4XMPH 1IARB 5EOTA 5DSCA 5JW4N 3KPLA 4KI5F 3VW3L 3TYGH 5EPMA 4Q2ZB 4HG4J 1INDL 4ORGA 1KPUA 3QIWD 1FG2B 4QRUA 4W9FC 5C0AA 2N59A 2CIIA 2XCMC 3L7FA 1DO6A 5TQ0L 1S7WB 4ZMNA 4ZOCA 4ABUA 1OSPH 2P47B 3DETC 5DDHB 4MWFB 1GSKA 5A2AA 4PRAA 4WK4B 2UZIL 1AOHA 1MHCB 1X7QB 1EIBA 3BOVA 5IROD 3GT6A 1E67A 1MFCL 1PTZA 4UT9A 1MHEB 2WNGA 2GJJA 3NSYA 4DPBX 4YVUA 4BQ6A 1YJDC 3ZT7A 3N1QC 2VWEC 1DQMH 3DSFL 3Q2VA 5I8EA 4FE9A 2FVNA 4MNQD 3ULSA 1MN4A 4PRDA 3M6DA 4OZIA 2AC0A 2HMIC 3ZSTA 4AK2A 1MWAB 2VABB 5CXPA 12E8L 3IDYC 1RK7A 1CK0L 3KEDA 4G9DB 4Q2ZA 3OC5A 3PNWB 4QAWA 4L29B 1ZHLA 4POZC 2BK8A 1KCVL 4LLUB 2RQEA 3MRMB 1EEQA 1YYML 3QPXL 3I6SA 1KV7A 5GZNC 4JFTA 4PSPA 2BVYA 3SDYH 4B3EA 4NZRL 3II1A 3TBBA 5L7XL 2CM5A 3FHEA 1DFXA 1MHCA 1X7QA 3NJJA 1NFIA 1W6LA 5IY5B 1IGTB 2WQAA 3EKCA 5DYFA 4PJ8A 1IAIH 5CSZB 1AQHA 3CDCA 4A2EA 1A6PA 1LO3L 4DN4L 2ITFA 3HEIB 1EJ8A 3QWNA 1OARH 5HHVH 1JN6B 1P5VA 3QAZB 5D1XE 1N59B 2V5TA 5JXAL 2WXRA 2X4UB 2XBTA 4FS0A 2AJYL 2ENQA 5J1AB 1OALA 1PNDA 2VABA 3O4LA 2EDWA 2QSCH 4NN5B 3LSOB 3MNWB 3PXLA 5E2TL 2O5XH 5DVKA 4NQSA 2G2RA 3MRMA 3PDOB 5DRXA 2VMJA 3MUJA 1FVDB 4HT1H 3ASWA 2IANE 3W5MA 3OKOA 3TYFB 5JIMA 3GM0A 1RULL 1U92B 1UA6L 4N2CA 5D1ZB 4UAHA 4LSUH 4HUNB 3B37A 1ONQA 5E0FA 4DP1X 1I1AC 3K6OA 5MENB 3FFCB 3HBGA 1JN6A 4EN3B 1N59A 3CN2A 1NOLA 1W6WA 5FM8A 4KHTH 5GGQL 1CTMA 3GBML 3FUIA 3WXVH 5AB2A 2HPTA 3MNWA 5I30H 3L16A 1KGYE 1S7UA 1XXFC 5E4EC 5HHME 4ZMTA 2APTA 1RZKH 3HLAB 4HUCA 2NQCA 3DX9A 4OLXL 3NA9L 3ARBB 2ITDA 4JN2B 1IB5A 2ZCHL 2GYSA 4B9FA 3MQIA 1GL4B 4HKZB 4E0RB 5B3NA 2ZX5A 2HTKC 3D05A 2AEWA 1UT9A 4F24A 1U92A 5LBVA 3VG0H 2GC7C 3UPRB 4W4OC 1UWEL 2K7QA 5E6SB 2Z7WA 2NY6D 5DJ0B 5EFIB 2EH8L 1WFIA 4W9CC 2PO6D 2HT2D 5LDSA 5DMIL 3U1SH 5HDRA 4XNUH 2F1BA 4PWIA 4PJCB 5H94B 2QKSA 4FADA 1MCJA 3ARBA 3VD0A 4B5ZA 4J7RA 5TF0A 2XN2A 4TQIA 4HKZA 1RH8A 4YWGL 4E0RA 4YFLI 1J9RA 3G7TA 1AIFA 2AQRA 4ZD3H 2MKWA 5JORB 3OAYK 1WSST 3QYMA 2H9GB 1L0YA 3DXAE 3GTVA 4KKPA 2AAAA 3G08B 4PGEB 1HOEA 3DK2A 1IM9D 5T8IA 6CGTA 5JIHA 1U3JA 4EUPH 3A4DA 5C3IA 5KJRH 5IV2A 1U0QA 4ZUWB 4PJ5D 2OS7A 1NGPH 3AM8C 5H94A 4WCYH 4XX1E 1ZD6A 3IXTA 3O9WC 4WV1C 3G5VA 4OD1L 3WFHB 3OHMB 4DO5A 1GYWA 4A2DA 1J8HB 2IAAC 2CE6A 4YSSA 4YFDB 3WFBH 4N0YH 1UZ8B 4XNYL 3CFEB 1LEKA 4AK1A 2ZKMX 2XOTA 3FTZA 1RZFH 1OAXH 2X6UA 1MJ8H 3T0EB 4F7CA 4TSBL 1KPVB 3QXTA 5K33A 3JWNG 2H9GA 4D0CB 2YGQA 5LGHL 1RK1B 3NABH 5GRJH 5T1KD 2ENYA 3L3JA 3CVDA 2AF2A 3Q6FB 3QORB 3EHBB 4P9ML 4LAJH 2EE3A 3D30A 1DCLA 2ZQKA 3W9EA 4QXGL 2FJGB 3WFHA 4PJXA 1D6VL 1AZRA 1U42A 4WHDA 5EZJA 1MCPL 4XB8A 4PI2A 2AFNA 4EBQL 1SJMA 4HPOH 1LE9B 1CFVH 2IALB 1UZ8A 4U1SB 5B8CA 1AHMA 2ZZUT 1IC5H 5D72L 1FG9C 1JRHI 3UAEA 3T0EA 2EDDA 4ZOAA 4PBDA 2XWCA 5ABDE 2BINA 4GRLC 4D0CA 3SD2A 1RK1A 2BVOB 2VOTA 2ZF8A 3M8OH 4LO9A 2O6PA 3BP4A 5I2IA 1C5DB 4LL1A 1PFOA 4UM9B 4LBEB 3Q6FA 1IBGL 3QORA 5HJGA 2K70A 1BQRA 5EWIL 2UWEB 2VERN 1YNTB 2NUTA 1NGQH 5D5MB 2X70A 1MDAA 3UBXB 3HUJF 4R6UA 3VD7A 5MEQA 4HH8A 4YHLL 5BPPA 1JWSB 2XZQL 1MCWW 3UCRA 3K2UL 4LU5L 3LKQA 4OJCA 4Y16D 4DGVH 5IHZB 4RGNC 1FO0H 4R2GC 1IM3A 1MVYA 1RZPA 1BOGB 3GKZA 3NJIA 3VI4E 4UM9A 1N9PA 3CFDB 3SGEI 1ZHKB 2Z1KA 2FGWL 3P0YL 3O11B 3GSXA 4O2EA 1Z2KA 2UWEA 3TPUA 1CVSC 3UBXG 5D5MA 2O6EA 2G5BA 4MMXC 3ARGD 4Y7OC 2VDMH 5CN2A 3SO3B 3IFNH 1OCCB 2XTJB 3QBTB 1XZ0B 1JWSA 2ZKXA 1TZHB 1A6WH 3TP4A 4LP8A 3L9EA 3KBPA 1NC4B 2ZCLL 3H3KA 2XJKA 5DD3H 4N8CL 3ECBB 3CXHK 4YBQC 2HVKA 4CC4C 1U8QA 4B41A 3N42F 3CIQA 2ICEA 2FEDC 4I18B 4IKKA 4MNGB 5CM1A 4JFEB 2N1TE 3JWDC 4JVWA 4TNFA 5FLUA 4BZYA 2VLKD 5HHOB 3PXJA 4KNQA 1Y18B 4WHYG 2DL2A 4XAWL 2EINB 2DWXA 1XZ0A 2VLRE 1MCNA 2C9XA 3H2PA 4M5TA 5AVSB 2ZSVB 4XMTA 3KPMB 2ED7A 1UZ6F 4OB5H 3HFFA 3T0AA 1A66A 2DB8A 2P43B 1DVQA 3KCPA 2EC9U 5E2JA 3OPZH 3QWRA 2XN1A 3ECBA 2BIMA 2YK1H 5BQ7B 8PAZA 5ITFA 5DHYB 4PB9L 2IH9A 2GTZB 4XMXA 4EQ3A 4Z7UB 2GUOA 4URKA 4QTIH 1CQKA 2WYHA 3LQZA 4PMFA 1U58B 1G9MH 2IDUA 4JFEA 4NO0A 5T5FH 1AD9A 4DKTA 5KOVC 3GPSA 3D3VD 3HI5L 4NM8H 3I3EA 2FQFA 2LOEA 5HHPB 1DQVA 1GPOH 2C1OB 3P4MB 1SDAB 2ZSVA 1OGTB 3KPMA 4PTTA 3JZYA 2AJ3B 2E0PA 4LNRA 4YZFF 1OAKL 4AQEB 4MYWB 4LSTL 4M1CC 3RPIB 5CEXB 4FABL 2JKIS 3CN0A 5FUOH 3TT3L 5BQ7A 2GTZA 4I9WE 5CINL 3MNVA 1FZKB 1B4LA 1IBHA 1P7QA 3KJ4C 5GGSB 2GY5A 2PF6A 4G8IB 4U6VL 5D96B 3KS0H 5HI5D 4E9TA 5LGJB 2P48B 2EVIA 1HNYA 3JUYA 4PHXA 4JGJA 5EU3B 3MLYL 5L88H 3NFSH 1I85C 3UXFA 1MEXH 4PCKA 1DVTA 5E2WL 2DQGL 3VQLA 1UD5A 5FX3A 3K72B 4ZXBC 3P9MB 4RX4D 3VI3E 5HY9B 2IBZX 1U2CA 5TDOB 1KXTB 3EF4A 2CR3A 4OLUL 2AJ3A 3EFOA 2VH5L 2DWYA 4AQEA 5KG9B 3S35H 5LXGL 1VEMA 2GW5A 2R4SH 3RPIA 2R83A 2IQ9H 2CM6A 3SQRA 3T2NL 4Z76A 5CEXA 3CZLA 3GWJA 1Z9OA 1G5AA 5GS0C 2BHFA 1G7IA 5H37A 3RIAK 4XNDA 2WSDA 3VD9A 2NTSP 5GGSA 1MNUL 4G8IA 3WFCL 5LGJA 5FK9B 1JP5A 3J2PA 1G1OA 4TLUA 5EU3A 3TBCA 3MNDA 5IIEA 2BP0A 3NDYE 3VFMB 4IK6A 5D7EA 5GGUB 2F53B 3J8F7 2I7SA 5HY9A 1D5BB 1WS8A 5TDOA 1HQ4A 4U1MA 5KG9A 2OL3L 4OM0L 1GKEA 3L3GA 4J23A 4AYFB 4JQIL 5FWQA 4P04A 3Q5TA 3RVVC 4ZI8A 2J8UE 3E7JA 3QXDB 3E3QE 1MHPL 4FKKA 3UEQA 2IH8A 3UZEC 3CHSA 4GI6A 4OQTL 1KGXA 4JCMA 4JANB 3H2QA 5JHLL 4QRPD 2AXJA 3D8MA 5E6IB 5TDPB 1NCCL 2BWDA 2V17L 1KF9B 1D5BA 2BFVH 5CGMA 2IBZY 5K39B 1Q1JH 3D48R 3LHPH 1BZ8A 2X7LB 1CBJA 1Y6KR 4AYFA 1I9RH 2X9WA 2AVFA 3WEAA 3EOTH 4HGWA 3C2AH 4KJYB 3QXDA 4ZO6A 1NLBH 3TM6A 3DJRA 5SWQB 4R0LB 4G7QB 3SD5A 3MSPA 2MCG1 1AZUA 1DN2A 3CX2A 4JKWA 3AT9A 3APFA 3RGVA 3HE6C 2VR4A 3A67H 1J11A 4Z3GA 5E6IA 5LN4A 4GO6B 1BQUA 4MS8C 2DWEB 1RHFA 3OZ9L 4GMSL 5DFVD 4YQXL 5FW7A 5AAPA 1OD9A 5CEZD 1HXYA 2WWKO 4KJYA 4FI6A 2JI2A 4B0MB 3ESNA 4JPKH 1PQZB 3RHWF 1SFHA 4P2OD 2HX7A 1E65A 4IIQC 3D08A 4F9LC 3TFKC 3ZKND 4GXVH 4PJAF 4PVMA 3BSZH 4I2XE 1V7NH 1R3KB 2GFBA 1UJ3B 3VH8B 2DWEA 5I8CA 1BVNT 2DICA 4TYUA 2X0VA 4DESA 2OL3B 5D1XB 4WI4A 1TZAA 1Q0XH 2IADB 2WM0A 2ZUVA 3KJ6L 5DCCA 1RZJC 1U95B 1ET5A 4JM4L 4OJAA 4QEGA 2DYPD 5KBDA 3KLKA 3QP3A 4KKBC 2YBRA 3O45B 4G6AC 3MRDB 4RFNC 2VN3A 4G7SB 2KDYA 5SWSE 3H9SE 1BP3B 1DANT 4N2GA 3AY4A 3FMGL 3DJZA 3GSVB 2FBOJ 3VH8G 1JPST 2BPBA 2PYED 2WLLB 4X50A 4P23D 4PCTA 3B9KA 4O58L 3LZPA 5DJXB 2JIXD 2CUAA 3L5WB 3VXNA 2OL3A 5D1XA 2IADA 1A7QL 1E40A 2ED9A 2VN5A 4JQIA 3W0WB 4ZFGH 2XNAB 1GHFL 3V6ZA 3DRTA 1ZOXA 4GP5B 3O45A 5HHMB 2VL4A 4X83A 5IQMA 3MRDA 1H8OA 4ZUTA 4IU3B 3VXTB 4UTCA 1HJBC 3CHOA 4ZAKD 2GI7A 3EJQA 4HAKA 1TJGL 4OQTA 5LNEA 2WOBA 4G9FD 4PG2A 1KTJA 2IANA 5KOMC 3L4CA 3GSVA 1KDIA 5JHLA 1FYTB 2XQ0A 4XHJC 4JHBA 2BVQB 2JJSC 2BMKB 3Q2LA 2XXCB 1FH2A 2APXA 5DJXA 4DSYA 1S7SB 3TS8A 3KL5A 3KW8A 4A2MA 3L5WA 1YN7B 4HH9B 2XBDA 5DQJB 5D6DA 1LO2H 4FQIH 3QEQB 3QNXA 1ZHBA 2NTFB 1RJLB 1FHGA 2ISDA 5IBTH 3C6LA 5LBGA 1RZQA 1T4KB 4NJ9H 4YBHA 5BRZB 4KQ4L 2E8YA 1ADQH 5I19H 4IU3A 1YN6B 3VXTA 5IB1B 2FECI 5D7SH 1E6JL 2GJZB 2YD8A 5C0GA 1N0XL 4AXWA 1SEQL 4RWYL 4KX7A 2ENJA 3VSQA 4WWOA 2P44B 5FOJA 2EEDA 5HI3C 4X5RA 1UKTA 4PVBA 1E8XA 3VFTA 4OZGB 5E00B 1RZIB 4OCLC 4AIZB 1T5XB 3RX7A 1TSHA 1WAEA 5C0DA 3BUDA 2D9QB 1YN7A 4HH9A 5DQJA 1X5IA 1AD0A 2YAEA 2HSIA 2IV8A 4XP4L 2NTFA 4MJIB 2WQ8A 2A6KB 3INOA 4NQVB 3EUUA 1FF5A 3AG3B 4F7MB 3C5XA 4ZFOL 1T4KA 3NSXA 4IMKC 5BRZA 4X6CF 4WFEE 5IB1A 2WB1A 3FZUD 1QZ1A 2GJZA 5CAYB 4KUZH 2RB8A 1MW3A 2XRAL 2IBGA 5IFHH 5KS9F 4FFVD 4XMZA 4P48A 2CCWA 5E00A 1RZIA 5CGTA 3WJLA 1QA9A 2V5RA 2F9BT 4AIZA 2O5YH 3QUXD 4OZFA 3VYNA 3DXAA 3RL2B 4BD4A 1UKQA 5I1CH 2DL9A 5JW4R 2IF7A 2JCWA 3HJ0A 3TYGL 3MZTA 4JY6A 2J44A 4MXQD 3B2MA 4F7MA 5FYJD 1E3XA 4XX1G 4G2AA 4NERA 2K6WA 2XKSA 1BFOB 2A4ZA 3CD4A 2EDHA 3KYKL 1VKXB 5I1DA 4UQBA 3LKSB 1FFNA 1BQKA 4Y1AD 4DKFH 3U79A 1L7TL 1NSNH 2VE6B 1AH1A 3UTSB 3QZWA 1EUUA 2ZYHA 4CBPA 5AEAA 1DQML 1XCTA 2NSMA 2Q76B 1ZLVK 1LO5A 3STBA 1MRFL 4PREA 1Y1UA 3QAQA 4NSKB 3RFZC 4OV5B 5KN5B 5IW1B 3PHOA 4P4KA 3PUUA 1RXLA 4J3TA 3U1QA 2Q0ZX 1JTTA 1NMBH 5AVUB 1G9NC 2APFA 1T0PB 1BFOA 3SDYL 3CWGA 4ZMAT 3O0RH 2FO8A 3P2DA 4WJG3 1DVFD 2Y2YA 1PLCA 3ARRA 5TK4A 3SDAC 2QGEA 3MYJB 5EU6E 3PHSA 1KBVA 4U0RB 5F7BA 2X3AA 3G6JB 2WLYA 1D5IH 4M7ZC 4KK9C 1OARL 3O6MH 3EGDA 4D7BA 5K59F 2NX5E 3DI2B 4OV5A 2Z34A 5F97E 4G42A 2XIDA 1JV5B 2QSQA 2X4RB 1LHZA 1R3IL 2QSCL 4HISA 4JB9H 4X80H 4AW7A 3N44B 2O5XL 3BGAA 4HCFA 4N5ED 2YAQA 4GYBA 4PV8A 3U4KA 4B9YA 2HTLD 3B8YA 4DP9X 4J4PD 4PS8A 2EC8A 5C3TA 2FEEI 4HT1L 4K5PA 3FQTB 3GEWB 3KWWB 4GO9A 5A7EA 5IWLA 1JVOA 1WFTA 2GI0A 3S7GA 4JQXC 2G2NA 2DJUA 4LSUL 2X9YA 4NBYB 5I6OA 5C0AD 3PU7A 2V7HB 1X5FA 3F6IA 3SGDH 4CNIA 4TULH 4UV7L 1RV6X 3Q06A 3UCQA 1JV5A 3EYQD 1S7QB 4HK3N 3VI4A 5CN3A 5I30L 1Q9OA 1CIDA 1ZJBA 2COVD 4WUUB 5ICUA 3VGGA 4D9RD 4LCWE 4ZFOA 8CGTA 2VZOA 3IDMB 2K3HA 3I6LE 3FQTA 3ATFA 3P2TA 2CJTA 3ERXA 3CU1A 1M7IB 3WE1A 2UZYB 2FB4H 3VG0L 5LUMA 2XPGA 4PJ9B 4FG4A 1FIEA 2KKQA 2CGYA 3MI6A 4OSUH 5CP7B 2E5EA 3DLQR 2X2JA 1OKEA 2EYTB 2BCMA 1BHGA 2JWYA 3V7AE 4XT1C 2WKOA 2KC0A 1Y6MR 4LLQA 3ZUNC 1ZTXH 3KDMB 4XNUL 1T6VN 3P3SA 2FZ3A 1PW3A 4PJ8D 3O41B 1OWRM 1NANI 1SXSA 2B2XL 4R7DB 3IDMA 3F58H 2W9DH 4G8GE 1K85A 1NPNA 1FE8H 4H25A 5FO8A 5A16B 4FLQA 2H3NB 2AEQL 4K3JH 2IOMA 4OFKA 3MU3A 1SMOA 2G3NA 4ZD3L 5B39B 1WGOA 1KLUA 1MCIA 3OKKA 3KPRB 3C09B 3TESA 2VLRA 4GEIA 1MCEA 2J8OA 4Y4FB 4V11A 4NB7A 2G0KA 5DZPA 4U4BA 1YEWA 4K55A 2L4OA 1YZZA 3FT9A 3NK4A 5AAWA 1O7VA 1AKPA 5T3ZH 3K1DA 1RCYA 4OLZH 5IT2H 3H0TA 3NJLA 4ABVA 3WEBA 5SV4A 4WCYL 4R7DA 4AGOA 4PBVC 2ZWLT 2OYLA 2RGSA 4G7VH 4LK4A 1UA7A 3CE1A 2W5PA 1EANA 5EU5A 2CRIA 5A16A 5B39G 1KNOB 2CUMA 3S34L 4N0YL 5B39A 4HF5H 3ABZA 1RZFL 1OAXL 1MJ8L 1MCBA 1NAML 5E1AA 2BSRB 3VI3B 3BEVA 4XNXH 3NABL 5GRJL 4AH2A 4OZIF 1RP9A 2X1XR 3SJVE 3ETBF 5LBSL 3R1GH 1RPUA 1BEXA 2QDVA 4DOHE 2ZX6A 5JW5A 2M83A 4L3FA 2CKBH 1QX1A 2Z3FA 1I9JH 4JO1L 5KVDE