1URZA

Low ph induced, membrane fusion conformation of the envelope protein of tick-borne encephalitis virus
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
400
structure length
382
Chain Sequence
RCTHLENRDFVTGTQGTTRVTLVLELGGCVTITAEGKPSMDVWLDAIYQENPAKTREYCLHAKLSDTKVAARCPTMGPATLAEEHQGGTVCKRDQSDRGWGNHCGLFGKGSIVACVKAACEAKKKATGHVYDANKIVYTVKVEPHTRKTASFTISSEKTILTMGEYGDVSLLCRVASGVDLAQTVILELDPTAWQVHRDWFNDLALPWKHEGAQNWNNAERLVEFGAPHAVKMDVYNLGDQTGVLLKALAGVPVAHIEGTKYHLKSGHVTCEVGLEKLKMKGLTYTMCDKTKFTWKRAPTDSGHDTVVMEVTFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIENNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSIGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Flavivirus Envelope Glycoprotein in its Low-Ph-Induced Membrane Fusion Conformation.
pubmed doi rcsb
molecule tags Virus/viral protein
molecule keywords ENVELOPE PROTEIN
total genus 79
structure length 382
sequence length 400
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00869 Flavi_glycoprot Flavivirus glycoprotein, central and dimerisation domains
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1urzA04
2.60.98.10 Mainly Beta Sandwich Tick-borne Encephalitis virus Glycoprotein; domain 1 Tick-borne Encephalitis virus Glycoprotein, domain 1 1urzA01
3.30.67.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 2 Viral Envelope Glycoprotein, domain 2 1urzA02
3.30.387.10 Alpha Beta 2-Layer Sandwich Viral Envelope Glycoprotein; domain 3 Viral Envelope Glycoprotein, domain 3 1urzA03
3C5XA 3J2PA 5B1CA 1TG8A 4BZ2A 5KVDE 5KVEE 3UZQB 1OK8A 1URZA 2ALAA 1ZTXE 2R69A 3N41F 4ALAC 1Z66A 3IRCA 1OKEA 1S6NA 2V33A 3N43F 4UTCA 3UZEC 3MUUA 2H0PA 4L5FE 5GZNA 5IREA 4FFYA 5JHMA 3VTTA 2JV6A 4AL8C 4FFZA 4UTBA 3UYPB 2JSFA 3P54A 5KVGE 3WE1A 5LBSA 2JQMA 3N42F 1RERA 4GT0A 3G7TA 5LCVA 5AAMC 3J27A 3N40F 3I50E 2R29A 4AM0Q 5GZOA 1UZGA 3N44F 5LBVA 2HG0A 5IZ7A 4X42A 1PJWA 2P5PA 5H37A 1Z3RA 5JHLA 3UZVA 3C6EA 4GSXA 4BZ1A 3UC0A 2GG1A 3UAJA 5KVFE 4UT9A 2I69A 4UT6A 5AAWC 4FG0A 1OANA 4UTAA 1SVBA
chains in the Genus database with same CATH superfamily
5M7QA 3H42L 4F2MA 5L0QC 3MBWA 4X7EC 1FC2D 4NQEB 4H44C 5LNEA 3PXHA 3E2HC 3DETD 4HC1L 1JHTA 3LSOA 3EJYD 3GM8A 3ABMB 1L9PA 2VRKA 1ADQH 1CTMA 4IOFC 1IBHA 4UMGA 1SJXA 3P4NA 1UD6A 3UTPD 5K9JH 4H0IA 3VXSB 3NJNA 3C9NA 3MCYA 1P5UA 1J5HA 2CHXA 1NUGA 5IQNA 4JDZB 3GTNA 4XBMA 1MCRA 3F2LA 1TVBB 3DX7B 5DRZA 3L2NA 2HWZL 1QABA 4BUGA 3A23A 3PNWA 3UYPA 4JZNA 2QQKH 5KVDE 5CJXC 2B77A 5TQ0H 5SWSB 3NJKA 4Q6IA 1DSFL 4KRMB 3QUZD 4O2CB 5I1JH 3NABH 2MWCA 3QDMB 2B20A 3LEYL 5CIPH 1NDMA 3ZKNC 3HC4H 1JGEB 2BSSB 3MV9D 3L9YA 1QOKA 5EUOA 3WFEH 1MH5A 3ILDA 3FBQA 5KOVC 2BERA 3KPMA 4K07A 3J27A 3US1A 5AALA 3BVNB 2YXFA 4UQ3A 4AEIH 2A9DA 5C6TL 2PCYA 3O6KH 1F6FB 1UA3A 1WFIA 3GB7A 3OF6A 1A6VH 5DRXB 1NEZB 5F1SA 1OM3H 3WL9A 2BP3A 2X09A 2BVUA 3L4UA 3SYCA 3MTRA 1SVCP 1AC6A 1ZT1A 4FQXB 2QHRL 4XWOC 2QFPA 3DUUA 1NDGB 2OXHA 1D5BA 1IB5A 4R4ND 4AEHL 4QAMB 1LD9B 4HUKB 4YXHL 5BXFA 2ICEB 4JN2A 3HBZA 4LK4A 1MF2H 2KL6A 3MRBA 2XQ0A 2XKNA 4IRJD 3PWPB 4NNYB 4PJGE 3T77A 3MJ9A 4GSXA 5CN3A 3B3IA 1BVNT 1OAXL 2W1NA 1KNOA 3DO7A 1Q90A 1X7TA 4JQIA 5I18L 4MJIE 3TBSA 1OGAE 1SY6L 1JMXA 2VQTA 3GSOB 5IGXH 4BSWB 4U1NA 1MUJA 2NY1B 2NZIA 3OKKB 3Q9PA 3QNZB 2PYEE 3K74B 5BOJA 5F96L 4WTZG 5EEVA 3K5SA 5KBMA 3GTVA 3DX3A 3Q44A 3EOYG 4KKLC 3SODB 5HBBA 2V0AA 3VRLF 3DVNB 1FNFA 3INUH 3GSXB 1INQA 1UC6A 1ZJAA 4KK8D 3OX8A 4UIMB 3ZTNH 2A9BA 2PO6B 4HX1B 4KROC 5DYOA 2GIMA 3MC0A 1IJNA 3RU8L 2ZAGA 5KSAB 4XN7A 4CSSA 2NX5B 3G5ZA 4FNPA 2WWMC 3BVTA 1KB5A 2HRGA 2BO0A 4ZMWA 3VX1A 1JVKA 2EDFA 5HVHB 1QBLH 3BAJA 2GJZB 1GJWA 2FO4A 4JHBA 1QFWM 1TETL 2HTKC 2K1MA 3L9BA 4NNYA 5J56B 3DX8B 1EX0A 4P23D 4X6BB 1FC1A 1AS7A 3OHMB 4JQXC 2FD6H 2W0LA 4UM8B 3WIAA 1HEHC 3DGGB 2YQ2A 5FGRA 3EHBB 5GRYA 4KXBA 3WTYA 2CHDA 1N9PA 2Y22A 4AQ8C 3LAFA 3ZUCA 3OHXB 1T89C 3DBSA 1VZGA 3IEAA 3GMRB 1NCUA 5AW7B 3SYPA 3VA2C 2WBJB 4HKJA 3QQ9C 1KJVA 4PB0H 5DVPA 5I8OH 5J1TC 2C4FT 1CR9L 4PD4K 3V9EA 2ZXCA 2W0PA 2KH2B 1AKPA 1R3HB 4GRLD 4NFCA 1V8HA 3FAXA 3QQ3B 4DETA 4FD0A 2HG5A 1JZGA 1CXIA 3GI9H 2WLNA 2Z35B 4MA8H 2XIDA 2N7BA 5BUGA 2VQUA 4BV1A 1MFCL 1MJ8H 1TQBC 2WZ5A 4QHMA 4RNRA 5GISH 4HJTA 4NHCL 5EN3A 3SO5A 3VWJB 3FFCB 1KTLA 2NPLX 4YHKL 5FB8A 3L9EA 2HFFA 3LIZA 3QPXL 3SCMA 1JV5B 1Q1JH 5FW6A 5AOZA 2H7WA 1ANUA 4LMQE 4OKDA 3VFPB 1H3PL 1NGPL 1OAXH 2H6PB 2MSPA 5F3HA 2JWYA 3BEWB 4HGWB 2N0KA 2WBKA 3KLQA 3RL1A 5I1CH 3VRIA 4L37B 1OGPA 2DLGA 1GS6X 4WEMB 1NCJA 1TJIH 3LN5B 3AS0A 2MOQA 4CMMA 4B60A 4POZD 5DUBB 4NB7A 1KLUB 4X0NA 4AI7A 4OBRA 2ED7A 5C8JA 3VXRA 3FPYA 4H26A 3TEUA 1IUZA 2DD8H 4KC3B 5ALBH 4KZCA 1X5GA 4KTEH 3PP4L 1PLGL 3FSZA 4H20H 1AAJA 2DQIL 3BWAA 1F6AB 2O6FA 4GIOA 5DD1H 4MGXA 2D03H 3H56A 1OM3L 2FWUA 3GI8H 3W38A 3BGAA 2PCPB 1KB5B 3LS5H 2PWEA 2YJLA 4PJAF 1VZIA 1N8ZB 1G1OA 2BIPA 3QIUD 4MX7B 3LPOA 5H37G 5IROC 5KYXA 4FYQA 4PGDB 3H4HA 1L9TA 4OFDA 5LGKA 2ZWLT 1QFWL 3HE6B 2E9BA 4APQD 4Y7MA 4WV1C 2OJEA 3MLXL 4GP4B 4ZXBD 3L3JA 1Z9NA 2RCSH 1KCKA 4ZK8A 4BZ2L 1E67A 4JDVA 1PNCA 4J1UA 1RUQL 3NIFB 3RPIB 4FQQB 4RCAA 1SRDA 1YEJL 5K59F 1D5IH 4N1HB 4M93C 5B1KA 1E4WH 2XWBA 3FOLB 3MRGA 4JFSA 3FRPB 4QYOA 3PJNA 3VYOA 4QF1A 4AIOA 4I3SH 4UQ2A 4ZUWA 3SDAD 5EU4B 2RAMA 3O6FB 1SXSA 5FS5A 5FYLD 4DO4A 3L3OB 4KITB 4PRNB 4WENB 1S3KH 4RMWA 3QORB 2CIIA 4HUXA 5I1GL 1GIGH 5H35A 3EH5B 3W57A 3RILA 3MLXH 1LO4L 3H7BB 3WNKA 5EBMA 1UWXH 1FF5A 1IGCL 4D8PB 4ANXA 5ACZB 1JGVL 4PB0L 5I8OL 1IJ9A 1G7HB 1QFWI 1FNGA 3FQNA 1HCYA 3MA7A 3NPZB 1YECH 2V17H 5I6PA 1F3JA 2I5YL 4F7CA 1CCZA 3TN0B 2P42B 4XP1H 3Q6GL 1L6ZA 3PDDA 3DO4A 1GGBL 3BKYL 3OC5A 1MLCA 1EJFA 3CC5B 3KLDA 4P2QE 3SJVD 5JNYB 3KNBB 4MCYB 5D7IA 2HLFC 2WWMD 4N2MA 4UF7C 3G9AB 3O4LD 3QNXA 1E0OB 4QXGL 4ZMTA 4H1LB 1WBYA 5E2JA 4P2QD 5D1QA 3UAJC 4MA7L 5E7BA 1L3NA 2X0UA 5A3IC 4GB9A 1KC5L 4UINH 4JJOA 2C1PA 1NPNA 3R4RA 1BQ5A 2WXFA 3RVXC 2IVFC 3EYOA 2DS4A 1V05A 4KUCD 3JWDC 3T6XA 3WFZA 2XTSA 3O0RL 3QIUC 4G6FB 2RQ8A 4FP8L 1F00I 1OK8A 2BNUB 4GRWH 4WJ5B 5HGDB 2PO6C 1JVLA 5HGHA 4JCMA 1A7PH 4OM1H 4ANKA 3FT3A 3BIKA 1J5CA 1AXIB 1FG2B 4WO0A 4DUWA 4XGZA 3BUTA 4WW1B 3UGUA 2HWZH 4Y4HB 1MVFA 1KTCA 5ICUA 4X9BA 1EO5A 1OLLA 2VR7A 3ESMA 3MZTA 1R19A 3F58L 1AZBA 1CTOA 7FABH 3RNQA 3MYJB 1F97A 5GIRA 4NAMA 3HC2A 4ZMLA 4P57A 3MLRH 4NQVB 1DLHB 1G5GA 2FECL 2JJSC 4RFEB 1OTSD 4BSVB 4D9RD 1IC4H 3I74A 3E7JA 4IHOA 2YD0A 1U36A 2G2NA 4X7DC 5CR8A 3HG0A 3TNMA 2J20A 4K0OA 3NFNA 4LARL 3DTXB 3FUNA 5JW3L 2WLJA 4Y5VB 1TJHH 4MJ6A 1BF5A 3EYUH 3PFQA 4KKZA 4Y1AB 3IU3B 4JKKA 3OB0K 3MXVL 3SDCD 2Q76A 1OP9A 3KWUA 1TJGL 3ATAA 3LRGA 5CD3B 2NTFB 4DP4X 4QNPF 5C6PB 2VO5A 4XPGL 3GSQB 1DQQB 1L7TL 4Y4KC 3RDTB 3BUQA 1S7UB 3FO0L 3TJEH 3NEXA 2BMKA 1YEIL 5D2LA 5AWNH 1KPVB 5F2FA 1CK0L 1UZ6F 3CC5A 2M8XA 1ROWA 4ZUSB 2CGZA 3AG4B 3EO1B 4I5BA 4YZWA 1I8AA 4NRYB 1GS8A 3S5ZA 1MREL 3C6SA 2EKSB 4AYEC 3I75B 1ULVA 3VXQB 1N19A 1SEQL 2JIXB 2HRPH 1U0QA 4AG4L 5C2BL 1Q9LA 2WM0A 1OGAB 5BOZG 3VGAB 1HILA 4HIXL 1HZHH 2CLZA 4HIEB 5EBMB 3EYOB 2WQAA 2IH8A 1BOGB 4LE8A 5EA0L 3V6OA 3IMBA 3PL6A 4LAQH 4O4YL 3F04A 5EO1B 5DVMA 3EYSL 3CDZB 2EDMA 2DWTA 4G80A 5I16B 2ETWA 2VLJD 1F56A 5E4AA 3QI9A 3VE0A 1KJ3H 4RFOH 1K3ZA 5IUCA 3QR2A 4NKQB 4YHPA 2WTRB 4S1QH 1RSYA 4PGCB 2YK1H 1ZGLM 3DX0A 4YOKA 5AOLA 3FCGA 5D7HA 1GXEA 2WPGA 5JNYA 4EN2A 4XZUB 1NGXA 4L3EE 3MFFB 1SXBA 5GGTL 1ZIBA 3U9UB 1HINL 1I1AA 5MERA 4K7PX 2WTOA 1PCXA 2I7OA 4YHMH 1OAUH 4PRIE 1MFAL 2CKBL 4QHUA 1ZTXL 3T04D 4MRBA 1J8HA 1GOHA 2ZX8A 3B9KD 1OSZA 3G6DL 1MN4A 2ZG1A 1D7FA 1IU1A 3MKGA 3QWRA 3TNNA 3BXNA 3HJ0A 2TSAA 4MWFA 4N2BA 4Y19E 1RHFA 4LFHD 2XTLA 3GXTA 4NKMA 1YUKB 2ATKB 3FUFA 4NNPL 3HMXA 1K6QL 5KVEL 3O2DA 2W9LA 1T83A 2H8PB 3OAYK 1DJHA 2DEWX 1AGDB 1CU4L 2CJUL 4PV9A 3M17B 4Y4KD 3TIDB 4TNFA 1PY0A 1ITBB 5E4OA 1P7QD 1UHVA 1WTLA 2VN3A 3PU7A 4R8WL 4E68A 4I13B 4U05A 5DFWH 4F58L 1CD1A 1I8UA 2ZXGA 3SBWC 1E2ZA 2H47C 3JVGC 1TVHB 3QUGA 1IQDB 1GHFL 4M48L 2BFVH 1SJEB 2W65A 1U8LB 2VITA 3PXLA 4CADB 5JW4Q 5GIRB 5LBVA 4EEEA 1A9BB 1WFOA 3TONA 1BMGA 4ODBD 3EFOA 1FNSL 2C9SA 1YUHA 1U8PA 1UKQA 3WELA 4OQ1A 4DP1X 3ZYZA 1AHWC 3RGHA 3LVTA 5F3FA 3EOTH 3Q2WA 3RWEA 4Y19D 1NWOA 1AZNA 3K8KA 3WUWG 3JTSB 4ODWB 1BJMA 1BAGA 2NQ3A 1RJZA 4YC2C 4HJIA 3ZK0A 5C9JB 3GHBL 3LKPB 1I9JH 1VB9A 3E8VA 3E1ZA 2J8UF 1FNHA 2CBPA 1XCQA 4F15B 4ZW3A 5D1XA 4HJ1A 4TRPH 2VLRB 2VR5A 1KELL 3T6ZA 5DHXB 4MMZC 4N0RA 7TAAA 3MRKA 3BAYA 1C12A 2E27H 3FQYA 4FTVD 2VMFA 2OTPA 1EWHA 3IMRA 2J5WA 1GTFA 3ARBD 3UTZA 2Q2EB 1DLHA 5DC9B 2L7EA 4HCRH 3MMEB 1OE3A 1OK0A 2J44A 2PYFB 3G6DH 4UOW1 5IWLA 4V11A 3CCHA 3OZ9H 4KPHH 3UBXB 1ZA6B 3X17A 3B83A 1QSFA 1PDKA 1A3LH 2OR9H 1A47A 2CO6A 3ZO0A 4OGXH 1SHXA 3TO4C 3MLZL 3MRNA 3U1PA 3VRJA 1LDSA 2BVQA 1RZJC 4HKBA 1FO0L 1NMBL 2HFEA 4PJFB 4A7QA 5EN2A 2JB6A 3SGKA 4WFHE 4QT5A 2WJ7A 3EFFB 3S8WA 5CJOL 4E2OA 1E7UA 3T0AA 1ZGLP 1I1YB 4DKFL 2EE2A 2HKFL 4CNIA 1ACZA 4TTDD 4FQJL 5TQ2H 4GUOA 1WWWX 2EAEA 3P0YH 4S11A 1H3XA 3GMRA 4LP8A 4B3EA 1VACB 2UXGA 4OKVB 2JXMA 2KDGA 2E8ZA 3VQ1C 3Q7JA 5F7KC 5KSVA 4KY2A 3UH8A 1D3CA 3LMJH 5EOTB 4HIXH 2NNAB 3O6ML 3U9WA 1RQ5A 3CX2A 1MLCB 3W0WE 2EEDA 4P23A 3PG2A 4DGIL 1OW0C 4EDXA 4D7PA 4MA7H 1CU4H 2V2TB 3BLKA 3KBPA 5HGAA 3NMEA 1W0WA 5GGVY 5LGJB 3CIQA 5IW1B 3BAWA 2Q3ZA 1ZLDA 1EV2E 2YD2A 4ZUVA 2JJUA 5I1LB 4JCLA 2XZQL 3QEHA 1A8JH 1KBVA 1N8ZA 4MX7A 5SV3A 3DJZA 3SGDI 2D2CC 2J57A 3IDMB 5E8PB 5IBTL 1V7MH 1GGBH 2HLEB 1OAKH 3HI6H 5IMLA 2A77L 3QZBA 2MKLC 4W9FC 5I0DA 4S0HA 1NAML 2HT3D 2ZAHA 1P6FA 4WNSA 2WVTA 4K5OA 3C5JB 4PR5A 1HXMA 4E9TA 1MWAA 2WSPA 3HCVA 1HOCB 3KZ8A 2R1YB 4L4VE 4MD5B 4N0FA 5I1DB 4U6YA 3WU1A 1H9VA 1OB0A 4PLNC 3PWUA 2ZKWA 3P02A 2PP7A 1PZSA 3L3KA 4WW2B 1KLGA 2UX7A 5D7JC 3F7YA 2G4EA 3SGKC 4MMYA 5FGCE 1HWGB 2AQ3A 2DH3A 3L3HB 4GUPB 4WGVB 1TCRA 3RP1A 4BFIA 4JREB 4JFZH 3RNKB 5GJSH 1UD8A 1X5ZA 5JPMB 1CL7L 1T7XA 3BP6A 3LN4B 5J8OA 1F4XH 1ZV2A 4Q58C 2VAJA 4HIJA 4U4BA 4UQ3B 5D6DA 4F2EA 5A7BA 4W9CC 5H2BA 3U7YL 2VDKH 4NOFA 3NK4A 3MROB 5E1HB 5EO0B 2CO1A 1U8NA 4PJFA 4GIAA 4LPCA 1AFVH 1F13A 2C9UA 2B1OA 2OCJA 3T6WA 3VACA 1A21A 1THCA 5I15L 3G5XA 3I2CH 1T5WB 4MMXC 4ZUUA 4BZ2H 2ICEA 2K6YA 4FG4A 2YUXA 4L4TB 4KNQA 4EXKA 1BVZA 2DQTL 4XC3H 1BIIA 3P77B 1YEFH 3FFDA 3GRWL 2PW2A 3V0DA 2YKLL 1T7ZA 3SPGA 2A3TA 4DO6A 5CXPA 3FPXA 3VYPA 3NN8A 4IMLB 3QDMD 5EBLB 5TPWL 1G6RL 4BFEA 4Z7QE 4L8CA 2GI0A 3LKOA 3MLUH 2XKUA 4UM9A 3TA3D 3VXRE 3M8OL 3HBQA 3ARBB 2DQDL 2IQAA 4NI6A 1RJYA 4XX1G 2Q6WA 1FSKB 2NNCA 1UM5H 1WGVA 4M00A 3S4SG 1SOKA 1U91A 1IGFL 4XB3A 1YMMD 3P3UA 3ULUD 1N4XL 4XNAA 1CLOL 2DIEA 1IAKA 2YD8A 3V4VH 4PBWD 3MRFB 4FABL 3HBPA 1OZTG 3JT2A 4HUUB 3BH8B 2ITCB 3HPLB 2BFGA 3QDJE 4H8UA 1EANA 2MPAL 4NUMA 3NT0A 4GMTL 1JF5A 5C0IA 1N6QL 5B1JC 3I6LD 4ODXB 3WEOA 4PTTA 5C7ZA 1GGIL 1ZANL 4NM4L 2OPCA 1XIWA 1P7KB 4OIFA 1RPQA 3GPEA 3DRQA 5HGAB 3D3VD 4FQHA 2COVD 3U2GA 2ARJB 1JFQH 1HKLL 2G5UA 4H1LG 3VM5A 5DURB 1IRAY 3DMMC 4ZTEA 3SZ6A 4DNLA 4X50A 1WAAE 5LCVH 4R2GB 3VD0A 3MRCA 4P9HL 3CDGB 3D30A 3K6IA 5L6YH 3MRDB 4FC3E 5ID1A 4XT1C 5IEHA 3RWFB 2EXSA 5FOBB 1HL4A 4HZAA 1MUJB 2WB7A 2BC4B 2DQFB 3QRLA 3UAFA 1G7PA 1XD0A 4A37A 4NCC2 3L6FA 1OARL 1R5WA 2FATL 1WT5C 2C1OB 3B8SA 5I1EH 1MAJA 4KGJA 4QHLA 1YEKL 1QRND 2EC9T 2JKRM 4TN9A 1NA8A 1GJUA 4XBPA 4BFFA 5E1QA 4HU8A 4X5RA 2YPVL 4JFED 2HLFD 2I60H 1DBJH 1LO0L 5HYJD 2J43A 3TZVD 3GXNA 2ZWYA 4PG9B 4AXWB 4KX8A 4JS7A 4KDTC 5IB4B 2GK0B 4NZTH 3SDCC 4PWJA 2XPZA 5FUOL 4L8SA 4YSOA 1L6XA 5B1JA 4TQPA 1DUYA 2ESVA 2UZYB 4L9LA 4WTZA 3B2UD 1CBJA 4QXVA 1KGXA 1KBBA 3T4YB 4JRWA 4HWEH 1DHKA 3NEEA 3R0MA 4HETA 3BKYH 3IWUA 2BNQB 2JTYA 2NY0C 2VLRE 5DMJB 1AHKA 3RIAK 4L1SA 2F19H 3RZWA 2QSTA 5BVPH 4N87A 5KBNC 4GT0A 4NO2B 4I9WE 4OZGF 2EEXA 4O2EB 3ZLQC 2N4IA 4JM4H 3GDBA 4PB9L 1Q9KA 1FYTB 1TFPA 3TBWB 1MCLA 2JELH 2CUMA 2WZPD 2WJ5A 1MQKL 3IMWA 5IFAH 2Y5TB 2Z92B 1A7BA 3K2UL 3OWRA 2Y36H 3BVVA 4ZQTA 1HKLH 3P4MA 4XP9L 1CIUA 2P7TB 5TH2B 4HWBL 3CH1B 1I82A 4M43L 4OLYH 2X1OA 5FDYA 3HKZA 4G8IB 4HJGA 4IKIA 2VC2H 3RGVD 3D4ZA 3VXOA 4JHVA 4KTDH 5GISL 4JFZL 1GPOH 1X9RA 5JTWA 4NRYA 5LGHH 2IWKA 4ZPTB 4JDZA 1E40A 2Y5QA 4N2NA 4CVUA 2I85A 1KYFA 3L4VA 1K5WA 3TYFB 2J25A 4KTYA 1KG0B 2P5WD 4R5TA 3WTUA 2DBLH 1NCNA 4U1IB 4Z7NE 4EI5D 5FWQA 5IVXF 4A2EA 4PJCA 2Y69B 5EUKB 4N8PA 1KN2L 1S7SB 2Z65C 5C0BE 1DQDL 2BY2A 5D2NE 1TTAA 2FH6A 5CP7B 4YGAB 3DPBA 1K5NB 1T3FB 3K0YA 4HK0A 5SV4A 5I66B 2I32A 2ZCKH 3MGAA 2DD8L 2ATKA 4TNEA 4X7CC 4AC4A 3VFNB 2YPLA 4ZPVA 3QQNA 1DQVA 1XAUA 2X53A 3ZKXB 2YD9A 6CGTA 3D3VA 4J2QA 3E38A 4PY8J 2W95A 3NA9H 3AREC 5HJBA 3UZQB 4U1SB 7PAZA 4LL4A 4JANA 3HPJB 4HV8A 3EFOB 2Z91B 3LMJL 4LLWA 1NDTA 1YEDA 4WTWA 2VITB 3U2HA 4OGYH 1LWRA 3THMH 3D25B 1MDAA 1MPAH 1V54B 3VU1A 2YD7A 1IBZA 5E6SB 1G9MH 2O93L 1Q1JL 3VSQA 3VDBA 3K6OA 4YBQC 1OTTC 2BNQD 1H15A 3K80A 1AS6A 3OTTA 2C8NA 3KWVA 1T1WB 2P4AB 3S6CA 5IW6A 3I6KA 5D71H 3CZLA 2EACA 3QS2A 4BUHA 4ZUTA 1MFVA 3U36A 2CRYA 2WQRA 2F61A 3CVCA 3DOIA 2AZUA 3GI9L 4MA8L 4AVIA 4YDLB 2KZKA 4A7UA 5FDWB 2C1OA 1F8TH 1RK1B 2L7JA 1BFSA 4XO3A 3K1KC 3MUJA 1JNHB 2JCCA 4EZLA 3X2QB 4FNRA 1B3JA 1AQHA 5BW7C 4R7DA 4FQIH 3ZHDA 1EAQA 1E9OA 4NQXB 1FO0H 3AUVA 3B9KA 4IDLA 4ENEC 3KDMB 3NRPA 3P4OB 4OT1H 1CDBA 3EDFA 1QRNB 2A6JA 2Q5BA 2H1PL 4UB0L 2KC0A 4N0UB 4HSCX 3SKJL 2DH2A 2ZXBA 3C5SA 2L04A 5DJ2B 4CVWA 2VL4A 5D96B 3CHOA 3D25A 3NZHL 3UJJH 1VPOH 3KPPB 3V0AC 4XN5A 3X11A 3PQYD 4ZFFB 2EIJB 3BMWA 5D93B 4BFGA 5C0DB 2Y7MA 4R7NB 1EZUA 1JIBA 3NG5A 3V4PH 2XBDA 4WFEE 2E7HA 5FYJL 2IDUA 4W4NA 5GS0H 1LO5A 3MV9E 2B39A 4ZYKB 4JRFA 2Z7UA 4BGLA 4HWZB 5CAYB 2X1QA 4BA8A 2VSCA 4TRPL 5FDWA 1AIFB 4L0PB 3VH8A 3LIZH 2NY0B 9CGTA 1S9XA 2WXGA 3GF8A 4HXAL 5ELIA 2YMTA 1JZ6A 3CFDB 4A6YA 4LCCB 1JWUA 1RZJL 3QZOA 3R06B 3VXMB 4ERSL 1ODAA 4A2LA 5DF0A 3BRFA 4AZ8A 4EI6B 2VXSH 3MRJA 2UZIL 5I2IB 1DSYA 1CLZH 1SJMA 1G0YR 4NZ8A 2BHYA 3PY9A 1JRHI 3BUYA 1JNLH 1TYEB 3VD4A 2BP8A 1U33A 1YEDB 4HEMA 2QQKL 5DK0B 5DS8B 3HZKB 1H5BB 1AGBA 2DZEA 2E86A 4P2RA 5D4JA 3V5KA 4PJIF 1DVYA 5AZ2L 2BS9A 3QH3B 4Q52A 4F7KA 4ELMB 5F88A 5CD3A 1HEJC 2OMZA 3SGJC 3OMZA 3IJ8A 1MAKA 5AQ0A 4LMQI 5D9SB 3VXUD 4FFTA 1YJDH 5C09E 4S0SD 1U91B 3QFJE 3GBEA 5B7MA 4WFED 3PDGA 1RUKL 2BP0B 5L9DL 5BCAA 2VDLH 4CVXA 2K6WA 2CGRH 3C6LA 1MFDL 3GBNH 2AJSH 1GJIA 5C0AB 5IVZB 1HHHB 4M9PA 2YD1A 2BVPA 3LN5A 5BVJB 2VCOA 1TCRB 3RHWK 3L4CA 4OGQC 2WGXA 3SKOB 1YC8A 1NCBL 1HCVA 4UAOC 2Q3AA 3V9FA 1KSRA 1HH6B 2CBQA 4GYBA 3CNKA 2Q86B 1PKOA 4IKLA 1VGKB 3LEXA 2EDXA 1KIPB 2XZQH 4ABVA 2H2SD 4NN6B 5DZOA 3FQRA 4GXVH 4S1QL 1WIPA 3HMWL 4OGAD 2ZPKH 1E8WA 2EDTA 1UFGA 4MQSB 2FCBA 4Y1AE 4ZAKB 1H8SA 4G8EB 32C2A 1EAPA 3C2AL 3GKWL 1MNUH 2D7MA 2Z4QA 1UM6L 5AZEH 2J55A 1X5FA 2I25N 3U4EA 1BZ7A 3DX1A 2DTSA 3Q8FA 2E74C 4Q2ZA 3U2JA 3DK0A 4WSGA 3FTUA 1FZOA 4OIIH 4LHUB 5HHMD 3TA4D 3GLDA 4X6FA 3RKDC 1D2PA 4U7SA 4GRLB 5IVNA 5ICZB 1RERA 3BH9A 4FL4B 4LEXL 2R2BB 5TF1L 1IILE 1YNTF 3CVHL 2QLVB 3FQXB 2DJ4A 4C83B 2VKWA 1C8QA 2WBJD 5ETUA 3QBTB 1EFQA 2LE9A 4UTAH 4E42A 4TULL 2CALA 4G43B 4AM0B 2QVFB 3GLEA 3T2QA 3U46A 3OKLB 4P4KD 5E2UL 3TJEL 4KFZC 2GJ6E 4AUJA 5AVWB 3TCLA 2BM3A 3LH9A 4IM8A 1A3RL 4XWGL 3ARVA 4JO5A 4D8PA 2A9AA 4FZEH 4JO8A 3VXPA 2BWIA 1PJ9A 1AOHA 2EO9A 2Y1VA 3WS3A 3WTXA 1JG9A 3B9EA 2D0FA 3TLRA 1FORL 1FYHB 5FM4A 4BH7B 4F7MA 1G1KA 1MJUL 1X44A 4KROD 3ARFC 4EN3B 1AACA 1RCYA 4KO5A 3BVDB 4B9CA 4JKNA 4ZTPL 5FV1L 4K8RH 1KELH 2NQCA 1EFXA 4I85A 2BWQA 2K0RA 3PHQA 3CCHB 4KQ4H 4YC2B 1PIFA 1CF1A 3QR1A 2D7OA 1UYWL 5DUBA 3CSGA 1G9MC 3CHQA 3RWDA 4DVRL 3CFTA 2FX8H 2D4FA 3O3BA 4XCFL 4JBSA 3IRZA 5I76A 4BGDA 1R24A 2VXVH 3N9GH 3EG9B 4HJJL 4X6CB 3WD5L 4QRRE 4AOFA 2MOVA 4NN7B 3STZA 4OIIL 2IIJA 3FONB 4A7SA 5J4MA 1I1YA 1DCLA 2H1XA 5DI8B 5LBSH 2VDQL 3BKJL 3HZ3A 5D1XB 1LMIA 2E9IA 3O0RH 3RHWF 2M26A 3SGDH 3PABB 2OSLA 2CO7B 3W11C 4UZSA 2GJ6B 4UINL 3WNOA 1DQKA 3U1SL 2GJPA 2P8MA 4PP1C 2VZTA 5KVGE 3UBXA 5BXFB 4ZOAA 5E2WH 3HMWH 3OAWA 3TPUA 4IRJB 3QUXD 4YO0B 3VAEA 2QPDB 5E5RB 3H9SB 5C9KA 1TZOA 1M7IB 2FT7A 3UAEA 1DFBL 1GAFH 3L48A 2W0KA 3MMEA 3F7LA 2OP4H 3RWGB 3PPEA 5IESH 4K3JH 2D7NA 3L45A 1CF8H 2HX8A 3O8XB 1P53A 4JPQA 4OBSA 1M2VB 2DYSB 1MCIA 1ZTXH 3OGCB 1MFAH 4Y16C 3BVNA 5IP4A 2X1XR 2Z31D 3NGBC 3F5WA 5DZJA 2VLRA 4N5EC 3F7VB 3LQMA 5AYTA 4F2MB 1RULL 5IOPB 5L9DH 1CFVH 2VIRB 3IDJB 4DN3H 3EHBC 2A74C 5DJXB 3WDHA 3EYQD 3UJIL 3FU0A 3MRRA 4Y5XA 5I6NA 1HFUA 2CO7A 2IANE 3ZIYA 2DJSA 3TVMB 3CHXA 1F4WH 5B21A 1URLA 2OJZL 4JZJB 2XQBH 1WISA 5IQ9B 3ARYA 3FCSA 3L7EB 4KO7A 1LK3H 3KWWB 5F8QC 5IW1A 1FZMB 4LT7A 1GZPB 1GGYA 4J6IA 2UUDK 4JHWH 1A7PL 1W91A 4OM1L 2DMKA 5FYJE 5D1ZD 4E42B 5IY5B 3U4BH 2AEQH 4XZUA 3PAUA 1JNNL 4GMSH 3IJ9A 2JKSA 4BZYA 2X1PA 4BKLB 2CUHA 4MZIA 2YPVA 4GRLC 5KN5B 1XGUA 1TXKA 6PAZA 2UZIH 2R1YA 4MD5A 4N0FB 4MQ7A 2F53A 1O5PA 5BV7B 2WXJA 2ESVD 5EEUA 5I74B 3IDUA 5AWNL 3OAUH 3WGUB 3CFCL 2DJUA 3TJHD 2JE8A 5E8PA 4YL9A 5ALBL 1FV1A 3MNWB 3MU3A 4HZLA 4ELDA 5IKCB 3NSYA 3HI5L 4C4KT 3U4KA 3GSNA 4GMSL 4MMXA 5HPOA 1WBZB 1JS4A 5FYJH 4JG0H 2BSEA 1IGTB 3W39A 4M6AA 3FUJA 1IE4A 4TUJB 3QUMB 3U6XS 2GYSA 4Y2NA 1S7WB 4OGZA 5F1IB 2W9EH 2A73A 4FG6D 4IRZL 1AO7D 5HHPB 3OD3A 2YD4A 3CDFA 2AMUA 4EIZC 3FFCD 4I1RA 3AT0A 4BKTC 1HSAB 4HHAB 1ZPUA 4G80B 4Q9RL 3ZL4H 1OPGL 4NUJB 1VFBB 2OX5A 2JCCB 1JNHA 1MHEA 1F4HA 1IKOP 2ADJA 1XSOA 2CD0A 3X1FA 4PYGA 1RMFL 3EJRA 4WHDA 2OSYA 2XFXA 1WA1X 3SJVA 4LLYB 4TOYH 1YEJH 4JO4H 2F2HA 4KX7A 4ZZKA 1NGQL 2HP4A 4Z23A 1UM4L 1DE4A 4LLMB 2VJXA 1MLBA 3IU4H 3QHZL 4PCSA 4ONHB 1P69B 3UTSB 2KYIA 1JPFB 3PAYA 1PKQE 4IW4C 4KH2A 4D0DA 4JE0A 3DV6A 1TZHA 4DP5X 5FPIA 3O2VL 2EDHA 3MBEB 2BSTB 2GUOB 3EHBD 4X98A 4LSTH 1A0QH 3BPNC 3UG5A 5CS7A 5DRNB 4GRWF 3PREA 2E7LA 4DERA 2E75C 4R7VA 2DJMA 5EIVA 1ADQA 3CU1A 2RTTA 5DMYA 4W9ZA 3GINA 3T0ED 2E7LC 1OOAA 4XMPL 3HN3A 2XFGB 4A6YB 3D5OF 2ZOKA 3KPQB 4JRYE 5EEXA 5FGBA 5EIQA 5KSBF 3T0BA 5ISZE 1A6WH 1JI2A 2VT0A 1WZLA 1YPZF 5E99H 1NC4D 4QD2E 2EYSA 1TLMA 1MIMH 3JWOC 2J8UA 3DHPA 4NUJA 3WAJA 3TFKC 2ATAA 3JT0A 3GK8H 2X4SB 3GMLA 2WKOF 3QZWA 4JFFA 3UTTA 5DRZB 4G6FD 2X4UB 1D7CA 2OZ4L 1XBRA 2ICWI 5C0DA 2XY2A 5H94B 5E4IA 5DZAA 4ATTA 1E8ZA 3X11B 5A6LA 2AAAA 3WS6A 4BA0A 5HI4C 1AQDB 5D7SH 5BUPA 3WDJA 1NBZB 4ZTPH 3LSOB 1GIGL 1O9ZA 4L3AA 2BVEA 2R7EA 1GC1C 4WAFA 1NICA 2JI1A 1KUMA 4DCQA 4R26H 4FJZA 2QDVA 2FH8A 4JRXB 5B39B 4UDUA 1ILUA 1M05B 3QDJB 3ULSA 1WP6A 4GBXA 1MCDA 2XFXB 5AOMA 4KRPB 4M43H 5SWQB 2BX5A 2QSCL 3VI3E 4MJIA 2BJML 1DFXA 4URKA 2AERT 4UU9B 3KYMA 3AAZA 4X8XA 1OCWL 5GRZA 4TULH 1CFBA 4J3TA 5I28A 4OD2B 4QDGA 4Z7QB 4QY8B 4U3SA 3ISWA 1HZLA 2FD6L 2CDEB 3BFWA 3FSOA 4U0RB 5HHOE 3MRCB 1HU8A 2FJFB 5BRZB 1T0PB 4MCYA 4NQQA 3L1GA 1TETH 4IJ3B 3IBOA 4KTEL 4V2BA 1XB6A 4DEUA 5L7XL 2X38A 2ED9A 4JRXD 4GO9A 5E4EB 4HW6A 2BVTA 4BCZA 4NZUH 1EVUA 2FR4B 4MXVF 2O5ZH 2DL9A 4OIBA 3NFPA 3BZEB 1KN2H 1FV1B 3MNWA 1Z2KA 5BZZA 3WFEL 4HU2A 1M3IA 1LO2L 1KIUB 2QBWA 4KVNL 5GS0C 2ZX7A 3VD1A 4AEEA 3B6SB 1QWNA 2J6WA 3INUL 1A0QL 5E4EC 3KBHE 1RUMH 5K9KA 4AQAA 1LEKA 4LRNH 1MCWW 2AW2A 3F64A 3E6FB 5IEKA 3CMGA 4RX4A 3RG1C 3FRPA 2DOCA 1QBMH 3OR7A 4B9KC 5E8EA 1QHQA 3BDYH 1FVCA 3QNFA 4RFNB 2J88H 4YS4A 2WOBA 3B2VL 5IGXL 4N68A 1DN0B 4ZUSA 1AQDA 2QMJA 4F27A 1AO7E 4RGOH 1R5VA 3D4YA 2MHAB 3T0EC 4OV5B 3AW5A 4P0DA 4Y8DC 3FB7B 3L3GB 4XMWA 4I87A 4HG4K 2GABA 4HEME 1S9KC 3CSYB 2OMXB 2FYYA 4HSQA 2VN4A 2XTJD 3WUZA 2I69A 3KJ4B 5C0RH 1MRCL 1DQLL 2WGNB 2J73A 1FI8C 1HL5A 1WBXA 1P7QA 1MLBB 1W0VB 2GIXA 4NQEE 2A1WH 1MJ7L 2YPLB 4U1JB 4ZPVB 4I0PC 5BZWA 4A7GA 1JRHL 1VENA 4X5LA 1MI5B 2EVJA 1XMEB 1K5NA 4YSPA 3D33A 4MA3A 5A2LH 1ET7A 2DDQH 3I6GA 3QFDA 4AGMA 5FO8A 2Y23A 5CEXA 4P2AA 2VUKA 2W0FA 4NZTL 1H19A 3QYNA 4KHTH 1KJMB 1WZ1H 3OBAA 1Z9SB 3QXUA 2G3ZA 1FJ1A 4GLRI 1T7YA 5FYJD 3TS8A 4OSUL 5JZ7C 1UQSB 3P3RA 4K3EL 5L2JA 3C6LD 4BZ1L 5CJXA 3DJRA 1WQVT 5E56A 2OCFD 2CMRL 4LQFL 5EZLA 1EHXA 2FB4L 1IZJA 2LLLA 3LEYH 3QJVB 5DUJA 4PW4A 3LPGA 4I3RL 3QXAA 2W5PA 3I2CL 4DKEL 1KTLB 3ORJA 2WC7A 4NZJA 3MLWH 4HHGA 4OLVH 3QQ9D 3VD3A 5EC2A 5GS2H 1HOCA 1S7TB 2VXQL 5IF0B 1PGRB 2BVOB 5C07D 3U2IA 3DBXB 3APDA 4QHLB 2R0LH 1DJSA 2W92A 2JCCE 4Z7UE 2P24A 5C0GA 4HYTB 1QPPA 3QJHB 2FJUB 1ADQL 1TSRA 5MENE 2WUBL 1AGCB 2EEBA 4FYTA 5DEJA 5LGJA 4JO2H 2EUWA 4XMZA 4EUPB 4UQ2B 4ZUWB 4DF9A 3VGAC 4TS6A 4Z1PA 3IGFA 3RB7A 4GMTH 1CQKA 4HISA 5E2VL 4XBEH 4JPIA 2ESVB 1CYXA 4L9LB 4IRZH 2APTA 1KN4H 4NHUB 5DMIL 3C8DA 1DQLH 2KLSA 2YQBA 3QUMA 5AVQB 3VFSA 1UKSA 2JXMB 1A4KA 1VCBC 1AC0A 5BV7L 5K1VA 2I7SA 3Q2LA 2OXGB 4LOVA 5LO7A 5KYYB 3TF7C 2NY5L 5F9WC 4FCAA 4XMUA 2CIKA 2FWOB 3JUZA 3MRQB 5I0YA 1A65A 3ZKMD 1G6RH 2NY4B 4PVBA 3TV8A 5D5MF 2WP3T 4YK4B 4ADJA 2FEEI 5AAMC 4Q74A 3TVMA 1HKFA 8FABA 5IBLC 4OCYH 2YQGA 3RKPA 4F8TA 5HGGS 3ARBC 1IAMA 2VNCA 3GMOB 5F9WB 4KI5F 1RJYB 2WYHA 1E4KA 3RY4A 1QACA 2MOGA 2R0ZL 1JPGA 4HIHA 3T2NL 4YGVA 4NBXB 4LSSL 4IRZA 4L8CB 4APQC 2C26A 3TURA 2QPFA 3WYRA 2WXIA 3NQKA 4L2YA 1RLBA 1FH5L 1J8KA 3L95A 3BZ5A 1QLEH 3LEVH 5GGUB 4AW7A 4PJIE 5D1ZC 2H9GA 1YQVH 4NS0A 3GKWH 5HVHC 5FFLA 4TUOA 3IJEB 4BHUA 5DFVD 5GZND 3ALXA 5INCB 3P0YL 5IJKC 1KEGL 3WN5B 2AEIT 4P2CG 3EJYC 1ZLVK 4GG8A 1R75A 4IJ3C 4MB3A 3IPEA 4WCYL 5CJQH 3UADA 4M6MH 3ZSSA 5ECGA 5B3NA 3HIZA 1F90H 4CGUB 4JB9H 3DMMB 2ICWB 3LHPL 5DC2A 1T20A 4ZTOH 2RFXA 3O4LE 2K4WA 2EDYA 4HH8A 1TVBA 4KXDA 4XTRC 1H5BA 3OXSB 2K8MA 1Q9WB 5AW5B 1XL6A 1M7XA 1BZ8A 1F11A 4WNJA 5HYEA 2F7QA 3GBNL 4WJKB 4U1MA 2APBA 2IOMA 4M7ZB 2FL5B 4UT9A 5E9DB 2ZUXA 4X42A 2HLAB 4KTDL 5F3HB 1SXZA 2Z93B 5DJ0B 1FFRA 5I0VA 1C5CH 3DRTA 5LLIC 2JLPA 1JHTB 4TLUA 3QUXA 3SPCA 3Q05A 4FG6C 3W9DB 1X5HA 2WIIB 3GZQA 4QOKA 2HKHH 5AVSB 1K8DB 1AGDA 5J57B 5KVFL 5B7FA 4YDJB 1BX2A 1UURA 2QGDA 3FTYA 5HI3D 1F4YH 4CW1A 5IG7B 4TSAH 2X05A 3CFJA 4D7BA 4OR1A 1LQSR 3QIBA 4JY4A 4L0YA 1DJZA 2AQNA 3NRFA 1IFHH 4HIIA 4DSYA 3TO2B 4ELMA 3IGAA 4LLAA 5DUML 2AJXL 4YHIB 4JQVC 1HZHL 2ZYRA 5FYJU 3L1EA 4Y2LA 1HIML 1SJVA 2VXSL 1NFAA 4MCNA 5KYYA 5TQ2L 4YUEL 1YEHL 1HWHB 5T1LA 3RUGE 4NC1E 1JUFA 2FAUA 2MMXA 3BW9B 1KJ2L 4M48H 1B4JH 3HFMH 4FFWD 3TH2T 5I19H 2EILB 3BWSA 5J1AB 5DHVB 3FQ1A 5TDPA 3CXDH 5DQ9B 4Z0BL 3V5HA 1PY9A 2VJ8A 3ZDZF 1RFDL 4IU2A 1I7UB 4ZI8A 3OKDA 3MXWL 5IBLD 1CXFA 1U93A 1LQBC 4FXGA 3SE9L 1RJLA 3X12A 4F37K 4ZX4A 1GR7A 4HUVB 2FK9A 4G5ZL 4PIBA 1AQMA 2A4CA 3WN6A 1VGEH 5IMLB 4E0RB 2YKKA 2E0PA 4LU5L 4NNPH 5T5NF 4TL5A 4HDIB 1J1XL 2H45A 2HFGH 1BFOA 4DZBB 2R29A 3MLYL 3OR6A 3VXTB 2WXLA 4EKXA 4DHLA 3ZU8A 3NSXA 2KPNA 5BMFL 1TNNA 2HMID 1DANT 1PDKB 3S3CB 5B4MC 3V8OA 1NBZA 2DIBA 4GKOA 1ORQB 3FN0H 2HRHA 2BZDA 3V2AR 3UABA 5A2IH 4NWUH 2CKNA 1IKFH 4PRHA 1QYGH 1JGUH 2WLIA 3C5ZC 2YRPA 1BQLH 3S7GA 1JPTL 4GRLA 4QHPA 4HD9A 4UIKH 1L0QA 4XVUD 5A2AA 4U4IA 2X4SA 4JFFB 3S96B 3P0VH 2MFNA 2UWEF 3NJIA 5JW4R 4UU9A 5D2LF 5TK2A 2GTWA 2BWDA 1PBYA 4I77H 4IIZA 5F7EL 4F9PC 2AK1L 4W9KC 2JK5A 3IJHB 5C0CB 4YHNB 5K9OA 5EDXA 3NZSA 1EPFA 5ESAA 2EICA 1OIOA 2Q8AH 5C08B 3VXQA 5EU6B 1KGWA 1HAWA 4LXFA 3BD4A 3QDJD 1ETZA 4U1LA 3QO1A 1JZHA 3NJMA 3DJ9A 1SMAA 5E8OA 5J6GA 3RWCA 5IIEB 4AIXA 3WIIL 1GL4B 1EZLA 3ULUE 4H5SB 4J8RB 1VZHA 3DX6A 4PJXB 1SDYA 3H9SE 4LGRB 1MREH 1YEGL 3K2IA 1UTDA 5LWYL 1SNRA 3NCJH 1MCOH 2CDFA 3NUKA 2WB1A 4RGNB 4XNYL 3VXRD 2NYYC 4TSCL 4XTRD 2FQDA 3IDGB 2GSGB 2WZ0A 4UT9L 4XCYA 4NYLB 1TKWA 5CUSH 1G7IB 3SN6N 2XACC 2QSCH 4OFVA 4NQEA 1ZKAA 4N6RB 4AQAB 3WV0A 2VDKL 3G08A 1WTGT 3KVDD 4N2AA 3DK2A 2H32A 3DV4B 3O3DB 2D31A 2UXVA 3QRGL 4Q8BA 4RIRB 4RMQA 4TKWA 3MRLA 3MNVA 1WBXB 1J05A 1E5CA 4YHZH 2NXZD 1P4IH 4P07A 4J5VA 4QRRB 3CFUA 4JFFE 1L5GA 4Y4KA 2MCPH 4AT6A 3HZKA 2G0LA 3MLRL 3WJLC 1LVEA 1SUHA 4G9FD 3T4YA 4GS7B 1R5VB 2IADB 1S7WA 4MKMA 2V5YA 1OGTA 1I3RB 3ARFA 1BQHA 4KXZI 3U0PA 4X6DB 2FUTA 4R90H 1AY1L 4Z7WE 3LRLA 4NZFA 3TV3H 3FFCE 1ZAGA 3ARED 3DTUB 2P80A 1DTUA 5GZOD 2L3BA 4PWKA 2A83B 3JWOL 4XNYH 3UGEA 4G7VL 1EJOH 1IIIA 1M1SA 1HWWA 1DFBH 1GAFL 1LEKB 5IBTH 3N6YA 2PTUA 3VB9A 4K4KA 2F58H 1CDCA 1JBJA 2E47A 4Y9GA 5GGSB 3ARTA 4KUZH 1NMCB 3NVQA 1B6UA 1LNUA 5ITFB 4Z76B 1G7LA 2O5YH 1XH2A 2DLEA 3O6LH 2Q1EA 2ZG3A 4MTMA 3L3OA 5L2KD 1QKZL 3LHAA 4KKAD 4Z0BH 1XO8A 5C0BB 3EIFA 2R27A 1BECA 4XVOA 1I1FB 4HEPG 2X89D 4I77L 3B7TA 1DUYB 1OANA 1JD9A 2AJUH 2GFBB 3D1MC 4TUJA 4XPBL 5DJ8A 4WU7B 1OSYA 3WY2A 3RIFK 4ABWA 3MJ7B 4IBTA 1OAJA 1A7RH 5DFTA 1QBLL 2Q3XA 2Y4SA 2EDJA 1SY6A 2DM7A 3QHZH 5CEYA 3PWJA 4N5ED 2FX9H 3IDIA 4OFYA 3RURA 4E9XA 3M1CA 5D72H 5IHLB 4ODXA 4EE2A 4EO5A 1MEXH 2DV6A 3RPKA 1UGKA 1BF8A 5IQ7H 4LNVA 5FO9B 1NANI 2X4OB 2WXOA 3T3ME 1O5DT 4KJPC 2HRLA 3AS2A 1IBBA 2N0MA 2VDQB 5EO9B 4WWKD 4KU1A 4IMKA 5I75C 2WO2B 1S7RB 5DEGB 5SX5H 1Q0XL 1TQSA 4J3OC 2NX5D 5I1GH 1XBDA 5ENWB 1T4KA 1KULA 3WGVB 2PABA 2VXQA 2EH8H 2IH1A 4M5YH 3Q1SH 3KR3H 4N8VG 4F93B 4Y2DB 2FBOJ 1A5FL 1V7NL 1HHKA 5EC1B 1QFOA 4HMDA 2ZONA 5T1KD 3N06B 2GUOA 3D07A 4JG1H 2IH3B 4J3UA 2OAAA 3QWNA 1FFPB 4XMKL 1FPTL 5ACLA 4OQTA 1PSKH 2EDWA 3G5VB 2FGZA 3D18B 5DJYA 1GMEA 4Y4HA 5F0LB 1S7QB 4E5XA 4HJ0C 3SGJA 1NKGA 5F6HI 2P44B 1KJ2H 1OAZH 4ES9A 1JPST 1U3HD 4RIRA 1SBSL 5HYJE 1P1VA 3NJVA 1QPXA 2DLFH 4MJ5B 2IJ0C 1MRFH 4D0CA 3F05A 4XCNB 1WWAX 1OHQA 1TFHA 2DI7A 2J72A 4LPWA 4OFIA 1YY8B 5DHYA 1KCBA 5E9DD 3L5HA 2ZCKL 4MVBC 5CWSA 3C6LC 4I0KA 2EVIA 4HAKA 2Q8AL 4IHOB 2Q8BH 1KENL 3AQDA 5JXED 3LN4A 2VR8A 3KGSA 1KJVB 1W72L 5BO1H 4X6CA 1O6TA 4OLEA 4WV1A 2YEZA 4K55A 4BFIB 5GGUA 4FQ2H 2HLAA 4ZOCA 5GS1C 3VFOA 1K9TA 5IROA 3S36L 3OLIA 3CFEA 1HE8A 1MHCA 4Q14A 4F9PA 1NJ9A 3WSQL 4X4MA 1KZQA 3D4GA 4PI0A 5J12C 4FA7B 2A9NL 1U4FA 2X5PA 5AOJA 4V2CB 5LQBL 3VNZA 2ZSVB 3PJSA 2LV4A 1S3KL 4MYWB 1LEGB 4AWJC 2VW7A 3FTWA 4ETYA 1QSEE 1QI4A 1BQRA 5F7FA 1ESOA 2E7CA 2YPLE 3C5ZA 3MQIA 1FAKT 3AS1A 3R8QA 3S4SB 5J89A 1XAKA 2FT6A 1EHLH 3IMSA 1J86A 4KUCF 4LSUL 1E42A 2XQBL 5DTFA 3TTSA 1O6VA 3ZTDC 2NUTB 5AW8B 1IFGA 2R9HD 2LHAA 4ONOA 3Q9QA 3NCWA 3FONA 3BO8B 1VERA 1KGCD 2P8LA 1EEZB 2ED8A 4X99A 1R46A 5I30L 3EG9A 5I82A 4JMNA 4WFFE 2ZP8A 3O11A 4XHQA 3W2DL 1CFVL 3BCFA 1J1PL 3TF4A 4XCEB 3KPNA 1U8CA 4JFDB 4YHLH 1CGUA 1JP5A 1O6SB 5E2WL 2OZNA 1IL1A 1AI1L 4MNQD 4KKPA 4ENZA 4MBOA 4RMTA 5AYQA 1TQVA 1CL7I 5CLXA 1D2OA 1TTGA 4WI4A 2IGTA 3ATFA 4FXGC 2LU5A 1MZZA 5PCYA 5GJTH 5C1MB 2YAOA 5IJDC 4AXWA 3HE6A 2EEFA 3T1WA 3D08A 3LD8B 2W60A 3D52A 3FO1B 1DZ0A 3AQYA 4K9EH 4WKZA 3PV6A 4HDIA 1KPRA 3ABKB 5DHEA 3H4FA 4J6RL 2D73A 5FA3B 5LBSA 3UGXA 1I3GH 3P9MA 3MLTA 3RZCA 2Z7ZA 3FTVA 4ILDA 3QCTH 3PS6A 4KUZL 3KYNB 4XPFL 2RACA 3B9KC 3GS7A 3QC5X 4XNZB 4R9HA 3N42B 2NLJA 2F58L 2FHFA 2CPCA 2WIIA 3QQDA 4QOKB 5TQ0L 2CNZA 4BZ1H 4KJPD 3V5HB 2A0LD 2B9BA 3EH3B 3I3EA 2X6BA 3S35X 5HI4D 1SJHA 5AENA 5DHVA 1G1YA 1IM3A 4FXKB 1YAZA 1CWVA 4G72B 5CGBA 2ZX5A 5KBKA 4M8VA 5FM8A 1KYOJ 4KAQL 2QDWA 3ARDC 4NUQA 3ZZQA 1YDPA 2HCZX 3EJQA 2C7UB 5JLZB 3U2SB 1JCKA 1Z3GH 1OPOA 3KWWA 3VWJD 1YMHB 4JY5H 3BQUD 1U8JB 4HOWA 5LDUA 4KKNA 3QJHA 5IQ9A 5EPMA 5HPMB 1B2WL 2CBTA 4ZO7A 5IWLC 3FCTA 3TIEB 1K85A 2VH5L 2CXKA 3ETTA 4NX0A 3SKJH 2VSDA 3VI3A 4DH2A 2MPAH 5D1XD 2R9HC 3LNDA 4XMXA 4D0CB 4OZHA 5KBPA 5IREA 4WI2A 2D7QA 4L1HA 4HUWA 5I18H 1N59B 2HX9A 2Y07H 3N1QC 2X6AA 5D7KE 3KXFB 5ERWB 2J4WH 4J3SA 3ARBA 2ZUTA 1AGFA 1QSFB 4FRWA 4K7PL 4RWYH 4ZAKD 5HHOA 2PPDA 1VGKA 1NFDF 2OMXA 4ZFOB 1DLFH 1AOZA 4DP2X 1M53A 4P2RE 4JUSA 1Z6JT 1NAMH 4OCWH 3P2BA 2IAMD 5I6XC 3NSDA 4FQ1H 4R0LB 4WHYH 4DPBX 2JV6A 4TNGA 1X4YA 2WQUA 3KEDA 3QFGA 3QHFH 4NZRL 5K33A 4MAYA 4BHUI 1JWUB 4K5PA 5ISZB 4G8GB 4KBPA 2FLBT 4XVUC 3SDXE 1RZGB 2O30A 4PR5B 1LO2H 2IALA 5HYSB 2O6EA 1XF2A 5FO7A 2ZPKL 5C07E 4XAKE 4F8OA 1NCCH 8FABB 2AHIA 1ZVSA 4NJ9L 3T2NH 4HLZG 4WFHD 1B4LA 4ODUB 2QKIA 5HPMA 1LTXA 4D9QD 4BBWA 3M6DA 1OE1A 2PTTB 4DIXA 5KSAA 2EIZA 5I71B 2EYRB 1AMXA 1GW6A 5E8NB 1QR4A 4JFTA 4PP1D 2HUHA 2J1KA 3ZHFA 1CLYL 4XN1A 3KE0A 3GRWA 3DTDA 4FXKA 2AJYL 3TVMC 3RL2A 1VF5C 2F68X 3WNIA 4AE0A 5CFHA 2P5WA 3LCYA 3QJXA 5JQ6L 4PJ5D 2BSCA 1BPLB 2IOOA 2OMTA 2RB8A 4EOWL 1BVLA 1I85C 3HN8A 4KKBC 3HAEH 3EZJB 3NP4A 4OAWB 4X6FB 3V4UL 1SYVA 1R3IL 1IAII 3N91A 3UPCA 1I1AC 4F24A 1OHZA 4PJFE 1BWMA 3HNVH 3X13A 4HS3B 2BIOA 4WIQA 5I26A 3WS3B 3NIDE 1S8DA 5FO9A 4MNQE 3IYLW 3G5ZB 4I0PD 3NZUA 3QG7H 1RUKH 4U1GB 5EN2B 4LHUG 3B3IB 1DEEA 2HVBA 1O0VA 2Z31B 2ZOTA 2FECI 3MRNB 3VRJB 4N0CC 4GQRA 2PXYA 2QADC 1R6VA 4CN6A 5ABDE 3X3FL 4JKWA 1DVXA 3OM3B 5FCSH 4AM0A 4PBVC 4WWPA 2AMGA 1QI5A 5E8DL 3B2MA 3ZJAA 2G0KA 1KGCE 5T1MA 3ZDXB 2KQNA 4X9HA 4GXFA 3PGDB 1S7XA 4BFJA 2OZ4H 4NZRH 1XGYH 3OKMA 5C0AD 3OG4B 4FQXA 2Z31C 4QTFA 1U3ZA 3WHXB 3NOIA 3WFHA 1EHAA 2DQGH 5FEBA 3GSQA 5INDB 2CZNA 2EECA 1KACB 4XOEA 1I7RA 1IGML 4GQ9L 3U7AA 5IT2H 3SE4C 1E9OB 3QUKA 2ZZUT 4IOIB 4NQXA 4DGYL 4Z3IA 1FZOB 4GI9A 1X4ZA 1FN4A 4I18C 4AY0A 5HYJB 2DWXA 2MQGA 4L8DB 3W9EA 4MJ6B 5TFSL 3CE1A 1A2YB 3IDNB 3SPJA 4GG6B 1T66C 4M9OA 4Z7UA 4MJ5A 1KCUL 3BQUC 1ZV9A 4HALA 1TVDA 2MIZA 2NY5C 3QEGH 4DCQB 3CQPA 4M93B 5AG9A 3MX0B 4UCFA 2GSMB 2E5EA 4LASH 5GGRY 3FNKA 3PWLB 2XBTA 4EBQH 2WY3B 5K93A 4HWUA 1B0RB 4JR9H 1D5BB 2C3HA 4NQCD 4B9PA 3EW3B 4NXSA 1NMAH 2GBAA 4H1LH 3HC0A 1SOXA 2MTPA 4XPHH 1M6UA 2ZKHL 3E0GA 1JTOA 4FERA 1CGYA 5TDOA 1T22A 3FXIC 3DVFA 3WXWL 5CILL 1E4HA 4XXCA 1N6UA 1SGKA 2ARJQ 3NTCH 3GSNL 3VXMA 2R1WB 3M17A 3OAZH 4B0MB 3EBAA 4NKOB 4TUKL 4GRWB 3NAAL 3A0OA 3NFNB 4UAOB 5DJ6B 1FO0A 3DKHA 1W80A 3FTSA 3BVWA 2PCFB 1U30A 5HHVL 1N8OE 4OY9A 3LS4L 1ZK9A 4UI2A 2X7LB 4ZSOA 2OMZB 3F58H 4KK5D 1IVLA 3NFPB 5F7DA 2WQVA 2BY1A 1TZ8A 3A4AA 4G6AD 4HCRA 5J6SA 2UUDH 4ODVH 2AJUL 4XPBH 1CE1H 1HEZB 1P2CB 2DIAA 1FFPA 2D8KA 4J6RH 5DK0A 5DS8A 3GSRB 2A73B 3NJFA 3VQLA 2BIMA 2XOTA 5LN4A 1NLDH 5LKNA 4PJ5A 1AE6L 3PGCB 4B0MM 4X6DE 2COQA 4KDWA 3MRHB 1F45A 3FU7B 4PUBH 3NH7H 4QNPE 5I2IA 2NY7H 2GKIA 4G3YH 1N64L 2VM9A 4L4TD 2IWGA 2CDEA 4MXVE 1XHHA 2BCMA 1NOFA 2P7TA 4DZBA 2JKIS 2QMKA 3ME0B 4XRCB 4TF4A 1G5AA 2DWDB 1JXKA 2NY6B 5EU6D 3UTSE 1MCEA 5HYJA 3OPZH 3D0AA 1MFBL 2ITDB 3KPSE 1UXWB 3FRUA 3EOAB 3ZE2F 1D9KB 1I1AD 3BKCL 5HHPA 3VSUA 3LQAC 1NUFA 1WHPA 1PZAA 3S36X 2WLIB 5HHXH 4D9RE 1V7NH 1DQDH 2GTZA 5GRJH 3HUJA 1EZSA 5JXEC 4PRHB 1D9KD 4GAJL 1PW3A 4JFDE 4WWOA 4JHWL 5D5MA 1T1YA 1NGXB 3CG8A 4R96A 3ZL4L 4PJAA 4FQHB 2YPKB 2CWRA 4K5MA 5E03A 4JDVB 3L4YA 1WUNT 2FJFA 3TBVA 3GHEL 3IJYB 5IB4A 3UZEC 4LDOB 2BXZA 3FQNB 2PPEA 3N1MC 5E2VH 2HPOA 3QNYB 1D5RA 3F7PC 3O2DL 4F5CE 5DT1H 4A39A 2AEPH 1E28B 1I4FB 4U6TA 4ONGH 2DKSA 4BFOA 1AMYA 3U79A 4CSTA 1D6VL 4J8QA 2BSRB 3GIZH 3H9HA 4PAZA 1T1XB 5H35B 1QQDA 4QRPD 4AJ0A 3NFSL 2W07B 3B2UC 3QORA 4U7MA 3FTGB 1KENH 2VERA 4P48A 4UV4H 5DJ6A 5ID0B 3HJEA 5IEHB 3ZE1B 5IR1B 3GBMH 2AQSA 1Q94B 3I6LE 3N1GC 3NJXA 3OKEA 1D7DA 3ARWA 1E27A 5BJTA 4HWEL 2CDGA 4I89A 3NCCB 4ZFZA 1G94A 1M1XA 2A77H 2G2RB 2RCSL 1SN2A 2VDPB 4D3CH 2CUAA 4R4FL 4N4YB 4PGEB 1WVZA 2LT9A 3PGCA 2UY7B 1OGTB 2P47B 5E9DA 1IC1A 2M1KA 1JV2A 1CK0H 5EOQL 2EVFA 2Y25A 2CO2A 3CQQA 4CUCA 1ZLVH 3B56A 3LKNA 3D3VB 2LGNA 1A1NB 3TX4A 5DEFA 2Y1ZA 1DN2A 3BPCB 5EU6A 2VZUA 2YAMA 1UB6A 3BOVA 4E9YA 4LVOB 2H32B 1YPZB 1Z0NA 2YFNA 1A9EA 4LPXA 3G08B 5KVGH 3A67L 3HAEB 2XTJC 3QAQA 3UJJL 3ZE0E 5ICYB 4FNLL 3H9SD 3RWIA 1FYTA 2P48B 4HJJH 1UM4H 2X40A 3ZT6A 4MAUH 3C60C 1H3PH 2DQ6A 3FMGH 2I27N 5B4MD 4NN7C 2OYKA 4BQCA 3ZHNA 1UJ3C 1L9OA 4JHUA 1A4BA 4NP4H 2CO3A 5CBEB 3BGFB 1BAFH 5IQLA 1SOQA 1PQZA 2JQZA 2MRYA 1W8NA 2YWZA 3KNBA 4L4TA 1DEDA 1XTMA 3CVHA 4N8VA 3NAAH 4QRPE 4QXUH 2OZ4A 4C58B 3PWUB 3QO1B 4TYUA 4DT2A 5D7LB 3C2SA 5FB8B 4WF7A 2YEQA 2NCMA 2R23A 3QDGE 3KW8A 5CILH 5GQBA 5JIKA 2O4EA 4XVSL 4ONHA 1IE5A 3WXVH 3WY3A 3IKKA 3VU2A 2IAND 1U95A 3LQAH 4TVUA 4PWFA 2UY6A 4XNDA 3BAXA 2LQRA 3QUZC 2PMZA 3IDYC 5AB9A 2RA1A 2C3XA 4LLQB 43CAB 3WIFB 2AKRB 1PY4A 3ZT5A 3CZSA 3HI5H 4OGYL 3THML 2R56L 1TQCB 4O02H 1YEWA 5EOCJ 5JHBA 1N4XH 1QI3A 3ALPA 3CN0A 5FIEA 3AABA 3REVB 4PJ8B 3VB8A 4NPKA 1IEAB 4OZ4B 3V9CA 4UQ9A 3PHOB 1PU0A 1T0NA 3QI9C 4HPOH 1KXQA 4KX9A 5EZJB 5FFGA 3BE1L 1R4XA 3MKKA 4AK1A 5F89A 3RJDA 3EOTL 4U33A 4HFUL 3V79C 4N24A 5LHDA 2QZ5A 1Y6NR 3AQXA 4L18A 2EE0A 2XG5A 1ZT4A 1GCFA 1NTDA 3JTTB 3O0LA 4NC2B 3QULA 1U8KB 3TCTA 3LZQA 4L29B 2D0HA 2NY7L 3I9AA 3O9WA 1FGNL 1NFDA 5AW3B 2AV1A 3TOPA 5G2NA 2FX8L 3KWXA 1KGUA 4K73A 3EGXB 1BFOB 2E56A 3LQZA 5AKRA 1YNKL 5F7HA 3MV9A 4MNQA 3ILEA 4TQEH 1BJ8A 1IFHL 5E8DH 3CFBA 2UY6B 2YGOA 5JQIB 5CJ8A 5KVFH 4NGHH 2GT9B 3TA3B 4PS3A 1GGUA 2VRAA 3UIYA 3F6JA 4UV7H 4E9VA 1UUNA 1KBKA 4Z8FH 3CSTA 3T4AC 1QTSA 5DJXA 3LDBC 1XXDC 3LB6C 1FZJB 2BINA 2GIYA 3BZFA 3F7VA 4UTBH 2ORBL 4UTAA 3V0EA 4UZUA 2J7LA 4Z7WB 4OCYL 4JQXA 1AZZC 5JHDD 3QQ4B 4AYDC 4QLRA 1CVSC 1XGQB 5FUZH 3RL2B 2J2ZB 4ZD3L 5IB1B 2K9UA 3NSFA 1UWGL 4EZKA 1NEZA 1UCBH 4AK2A 4AH2A 1NGZA 2Y3AA 5DD5L 2AXFB 4IRJA 3LVEA 1CXKA 4YZFE 5ABAA 1R3JB 2QKIB 3WFDL 5I1IL 1B90A 1VGEL 4NIYE 2X70B 2EE3A 1J9QA 3HAEA 4BFBD 2AJYH 2N7SA 4R97B 5AAPA 1N3NB 1Q8MA 5C08E 3BRGC 1E3XA 3EJJX 4XPTL 5C09B 4YFDB 4N2LA 1V3KA 5C9JA 5LVEA 1W0VA 2XU9A 1N64H 4HJSA 5DFVC 3H53A 1SM3H 4W6WB 4BRVA 1R17A 2HH0H 1F18A 1YA5A 2JIXD 3CSYA 4BCXA 2OL3A 3WJMA 1SZNA 2NY3C 3VRLE 3C75A 4KK6D 1ZT1B 1CLZL 2X4PA 3DSNB 2VISA 2IEPA 1Z9SA 1F1GA 5JORA 1RZ7L 2BVPB 4ERSH 2B5IB 1QUNA 1KPUB 4EI6A 5F44A 1BXAA 4HXBL 3ESPA 2XQYG 4PV1C 2WXMA 4TXVB 5C70A 2JCWA 3IK2A 5CWSB 5IVXB 1B9KA 1BZDA 3E6FA 4OCWL 5IEKB 3JV6A 4UILH 3RX7A 1QSEA 4BFNA 4QUOA 4AM0Q 3N44F 5B39G 2CNYA 5CN1A 2PWHA 3FO0H 4LO9A 1RJZB 4OF3A 1A6TB 1X5LA 3ML8A 1Z1WA 3QDMA 4FQXC 4PRPB 4WWKC 5EU5A 4HWBA 1EMTL 2Z7YA 4XPAH 3UDWA 1EEYB 2EDNA 5BPPA 3LKSA 4Z7NB 3P3YA 1CIDA 4YAQA 2GSIA 2H2SC 3CZJA 2WWOA 4LEOB 2DQEH 3KPOB 1U8KA 4QOKD 4XNQA 1LE5A 5KVDH 4OGAC 1Q0EA 1AH1A 1JZEA 3IDYB 4R83A 4YSDA 2EH7L 5E6YA 5MP6H 3ZTJH 5J9PA 1AXTL 3SE9H 4BJLA 3FB5A 3MRJB 5GSRA 1A64A 5FECB 1XF5A 2WLKA 5DSCA 3LHPH 4ZT1A 2M83A 3S2AA 5ICZA 4ELMF 1NINA 2NY1C 4X9FA 4DPCX 1ZCRA 3IFLL 3H2PA 3X1GA 5ITFA 3FF7A 4M61A 4DOHE 5KWYC 4LEEA 2W94A 3VGBA 3VXUE 1ORSB 3HLAA 4W6XB 1OVZA 3P30L 3EFFA 3B43A 2WBJC 3QT2A 1KNOB 3H8NA 1RZJH 4JFHE 3FOMA 2BVOA 2CRZA 1EAOA 3L4XA 1ZGLB 1QLFA 2FB4H 3WHE0 4XHJD 3OKLA 1UM6H 4WEBH 5C71A 4AQEB 5I8CA 3ZDXE 3EJUA 4R7XA 1J11A 5GS0D 2FQEA 3EYFB 3VFWB 1HDMB 1LD9A 1INQB 3OQ3B 5B8CC 3X3FH 4OV6F 3AROA 1T2QH 2QL1A 1A25A 4YSRA 2HMIC 4FMVA 4U1HA 3TWCH 2ROYA 1HK6A 3N1FC 5KVEH 1UVQB 3WFCL 5F7DB 4QRRA 4Z76A 5FA4B 3GSOA 2J1WA 3V8CA 4V1DD 2AK4E 4MMZB 1M71B 15C8L 1J05B 3PCYA 1ZXQA 5AL0A 4FQXD 4GG6E 3VFNA 4ALAH 5FXCH 4H8PA 2GEQA 2F53E 2W38A 3QEQE 4QTIH 3KH4A 1Q0YL 1MRCH 1ZTXE 4K9JA 1GGCL 2VDPL 4NT6B 4QRQA 1WFUA 4K7FA 3RTQB 4AV5A 5DJCB 3BPLB 4NYLA 5KUKA 3RI5K 2LABA 4EI5C 1BQKA 2O26U 1CICB 1UWEL 3I9GL 4HKXA 1ZDSA 5F93C 1MF2L 2Z7WA 4PJ5B 4LSUH 2K4AA 5C3LD 4JVPA 4LCWA 3WKYA 4A1RA 1CLYH 4O02B 1X9QA 5FUZL 1QMUA 1U8MB 3UZQA 4MNHA 4R26L 3GBLA 3RDTC 1JXDA 4AYFB 5IM7A 4PD4J 5D1ZI 2XWCA 1BBJB 2Q0ZX 1RZIA 2WZAA 5JIIA 5D7SL 4LB8A 4Z77B 1P6WA 1JYNA 2ODIA 5D6DC 5FWRA 4WW2C 3Q43A 4Y5VA 1MELA 3SD2A 4R84A 3HC3L 1ZEAL 5IR1A 4YLBA 5EO9A 1FFQA 1T3FA 5D96C 2AEOA 2F18A 4RAUA 4YSUA 2L0DA 3MLSL 1T89A 3QUMH 5I9QC 4W6YB 4ZS6D 1NGWA 1T5XA 1YNTB 3ZHKA 1FGNH 2Q7NA 2BDNH 4ZYKA 1KYUA 4JQVA 5IJVB 3MCG1 3EDKA 4P2RB 2VMJA 2G75A 3P2DA 3BP4A 2YBRB 1I3GL 3OL2A 4O9HL 4QO1A 3GFUA 4BK4A 4PRBA 3IB4A 5A2BA 1A4CA 2Q87A 1KY7A 5CBAA 4FF9A 3PWVB 2YAQA 2B4CC 3EO0A 3EZ8A 5DMGC 3C5SB 1N5YL 1WHOA 5CSGA 4ISVB 5GRUH 4Y7OC 4Z78A 3JWDH 4PWEA 1E9QA 1JPSH 2CR0A 3B2PA 2H41A 4QRBA 8CGTA 4XBEL 5BQDA 1QSFD 4FL4C 4BK8A 2EZ0D 4JE4B 3SJVE 2W07A 2VLKA 3CD4A 4R3SB 3OZ9L 4RDQF 4R5XA 2LOEA 1ASPA 2R2CA 5GGSY 2VDML 2WVVA 5CNHA 2GJJA 4FZ8L 2AAVA 3PHAA 3OJDB 4JY5L 5ALCL 5DO2D 1N26A 4XVTL 5MENA 1NBYB 1Y18B 4HWBH 1B2WH 4HLEA 2V9UA 1TTUA 3AXHA 1FYTE 2RBLA 3VMPA 4WHTA 1KXQE 1KV3A 4LBAA 1FZKA 4CBZA 3RQ3A 3QAZC 1KIQB 4YDNA 3BGMB 4L8SB 3CX5J 1AO7B 3RPIA 2X4QA 2ZWNA 3U7WL 1XH1A 4I3RH 4DKEH 3KVQA 1H3WM 2CG9X 1RJCA 3GSNB 3R8BB 4MAUL 2E6PA 4ZBJA 4PJDE 1NCIA 1DEEB 1HNYA 4JQIL 1A7RL 3KBEA 3TN0D 3ZE1F 5GZOC 5EH1A 2Q7AA 2PPFA 2XT1B 5KVGL 2PCPA 4UT7L 5SWZE 3PDOB 3GSVA 3HG4A 1K3IA 1FDLL 4F33A 1I7ZB 1JZ4A 1ET5A 1BD2D 4GW4A 4K15A 3MOAH 3TNMB 4TQHA 1JZ8A 4DAGH 3SKNA 1ACYH 5I1KH 1UOVA 1R33A 1TJMA 2ENPA 4WY7H 1DVSA 1ROCA 3U0TA 4YPJA 5C97A 5I1EL 1QKZH 4G5AA 2DWEA 3V6ZA 1Z9OA 4C4KO 2OI9B 2OTUB 5HSFA 3N40P 3Q8CA 3KHQA 4FI8A 2C4FU 4FQQA 5E5UB 5CZVL 1N18A 1XH0A 5D7IF 4D3CL 3IAPA 4WI9A 4J8RA 3KJ6L 4P9HH 4PJ7E 5LCVL 2G3NA 1IGCH 2DICA 2HPTA 4KNTA 3QZWB 1NGQH 3UEZA 3MCKB 3FAWA 2A9MH 4NC0B 3UC2A 1KTKE 1ODUA 3MX0A 3HB3D 3GS0A 2V17L 4Y4HC 4FAAB 4APQB 4NT6A 4QRQB 4UTCA 1NAKL 3I50E 1WSST 4JFPB 2VAAA 5EV7A 2PUQT 2G60H 3ZQXA 5B8CB 1QR1A 4P9MH 1L0PA 5CU5A 2R1XA 1QO3B 3OZLA 5SX4H 3T8XB 2J12B 5IFHH 4FFZL 1MHEB 2ADJB 5IMKA 4CU7A 3ULUH 1H6UA 3I50L 3DOSB 5JW5A 5L4FA 3RVTD 4PQXA 1SFHA 2C7UA 1CI3M 4U3XA 2YRZA 5D1QB 4MCZA 2R4SL 3EDEA 2VISB 4NBYB 3JWNG 4P5KA 4IHBA 4UQEA 5AZ2H 4N3TA 1QD0A 2J2ZA 2R69A 3S8GB 4Q9QL 4GAJH 5F9OL 2N01B 1QFWH 3HG2A 5FGSA 5C0CD 5MEOA 5TE4H 3FYIB 3RWCB 5IIEA 1RP8A 3D7PA 2TAAA 4HIQA 4E41B 3TBBA 1I8LC 2BW5A 3VG0H 1T20B 5E99L 1RUQH 4L0ZA 5J11B 4KZEL 4OFQA 3EFDL 2QT6A 1P5VB 3IAQA 4YPGB 5FHAL 1YZZA 3RIKA 4K3JL 1IAIL 1G43A 3MJ8A 2AI0H 2D7TL 2HRPL 3GBDA 1BYOA 3TA3A 4WRLA 3ECUA 4FEMA 1PYWA 4BCYA 1JXFA 2QGCA 4I3GA 1S8DB 4OH2A 1JCVA 1YEGH 1KOAA 4DESA 5INCA 3SDAB 3VW3L 4G11A 5I1LA 4TPRH 3BPOB 3CPLB 2W9DH 3HVNA 3LRMA 3U2SA 5JLZA 4NQDE 3L17A 1CZ8H 1NEUA 3OKDB 4TNVF 3OHXA 4J4PD 1G7MB 3L3OC 1SQ2N 5I1JL 4MD4A 5KSUB 3CIAA 4D0BB 1UB5B 1JDCA 4Q6KA 3CGTA 1L7IH 4KK6C 1U2CA 5D7EA 5GGTA 2J1XA 1Z9MA 1OP3H 3W82A 1AR1D 1E4XH 2WD0A 4PJEB 1WFMA 5J13B 1XIWB 3VFGL 3MUUA 2ADGB 5I0ZA 1IT9H 3FCSB 5JHMA 2FO4B 1ET8A 2D2OA 3MUY1 1TU2A 1Q0XH 4OF0A 1NIDA 5FCUH 3P2TA 1EEYA 4HHWA 1A14L 5HVGB 4GW1A 3Q13A 3WO4C 1UZGA 2DLHA 4IEFB 2VW4A 4N9GB 2H6OA 4QGTA 2QLYA 3BWAB 4IGBD 2FSDA 4GAAA 1SXCA 1CFNA 2AJ3B 3NTCL 3B5TA 4G9FE 2VUOA 3AGVA 2MEJB 2HN7A 4G7QB 1LM8V 1K8DA 3WEMA 1CS6A 2A6KA 3FMGL 1RZ8B 3HG1E 2ALAA 4YXKL 2IPTH 2CCVA 4IMLA 4ODTL 2P5EB 1YN7A 1MFBH 2QQLH 4YLQT 5ALCH 3A67H 4L37A 2WN2A 5SX5K 2WLYA 1C8PA 3FH8A 3P77A 2MQCA 4Y4FD 5DLLA 2X4TA 1OF0A 1ZHKB 1RIUH 2H0JA 4UT9H 5E8NA 4K23H 3CDYA 4IS6B 3S97C 5JYMA 5EOQH 1CGXA 4ZW8A 3VO0A 1M9SA 1WEJH 3NCJL 5A43C 1XCXA 3DNKA 3CVIL 3WFBH 2VTFA 4PIRF 1E2VA 1WWBX 2XPGA 3K3QA 4PSPA 5E08L 4WTXA 3MRFA 3H2QA 4X4XB 3QDAA 1JE6A 2YS4A 5HYFA 1BSIA 3QXAB 4NLHA 1IGMH 1KB5H 3GSWB 3KLLA 3QH3A 4GQ9H 5BZXA 5FHBL 1ED3A 3Q6GH 4HP5A 2ZOWA 4N8VB 5HTSA 5I8KL 3RU8H 1QNZH 3UTQA 4AMKL 3N9GL 1NL0L 5JR1H 3RJOA 3V95A 4U1GC 3IMVA 1OCRB 1F1AA 1TVHA 5CSBA 3QIUA 1L9RA 4TV3A 2XN0A 4LSPH 1HHHA 1AKJA 1H3UA 2IH1B 3APFA 4F7PA 3FQWA 2AGJL 5FCUL 3PNRB 1RZ8A 1HH9A 1YLBB 4HUCA 3TL5A 2IF7A 3BN3B 4BEIA 1QWHA 1FORH 4DK3A 1IC7H 4I9WD 1NBQA 2R4RH 3ARDA 3S3BB 3RE0A 1NZRA 2ZD0A 3WXWH 3NPSC 2X4NB 3QUYA 4QRSA 1KTDB 5JHDB 5CLYA 2IFFL 1JN6B 3NESA 4DFIA 4Y9CA 2UZPA 2Z64C 3MLVH 2GBVA 3O9WB 4HF5H 3VGFA 1P5UB 1NLBH 5DLML 3KW7A 3G6AB 4X7SH 1HX0A 1IQDA 2XKSA 3II2A 1YNLL 1FLRH 5D4QA 1YN7B 3EJSA 5F6HJ 3VXSD 3CVHH 4JFDA 3B7RL 4LSQL 1KLGB 1BPVA 4ZRGA 2DM2A 2DQIH 4OTXH 4MDIB 4OKVA 4KI1A 4QRTB 2GHZA 3ISRA 2YLKA 1K2DB 2A5UA 1EK3A 5C0AE 4KZEH 4QPEA 5AKSA 1TTBA 1M3JA 1IEBB 3P69A 3TVMD 3V0HA 1BCIA 4XC1H 3W9EB 4U6HB 2GJZA 5TE4L 4JM2C 3MLTB 3RZCB 1F42A 3NACH 4GW1B 5DJAB 5GS2D 3BIBX 2XVLA 3TT1L 1AE6H 4EF3A 5D93C 3IXTA 4Z0XB 3T0XA 2EE9A 3ULUC 1M05A 4K71B 2R8SH 1XTLA 3AGWA 1MFMA 1XGTA 1J9RA 4FNUA 3TWYA 3WIHH 1RPUA 4FJYA 2A83A 5EC2B 3QZPA 5CEYB 2OXGA 1B3IA 4GQZA 3JTTA 4ELME 4M8QA 4XR8C 3KL3A 2ZTBA 2LFGA 5EU3B 2Q86A 1DDHB 1A3QA 2NW2B 1LMKA 5DK2A 4PGBA 3BP5B 2PYFA 3CVBA 2BPBA 1L7TH 4AYSA 3ZXAC 5KAQF 3HPJA 4HV8B 4C56A 4N8CH 1AHWA 4JK0D 5D7LD 3FT0A 3QXDB 5BV7H 1WLHA 3EO9L 2Z8VC 3VJ6B 1EEZA 1ZLEA 2P8LB 1CD9B 4N2FA 3VNYA 4OLXL 1B88A 1KTBA 4LCWD 4G1MB 4RFNC 5CCJA 2QQNH 2V9TA 3QYCA 1U3JA 3DTXA 1BYPA 32C2B 5CP7A 4Z95L 5A2FA 4H88L 1KJ3L 3LZFL 4OI9A 4PHXA 5DA0B 5A6MA 1ACCA 5IF0A 3L2MA 1LEIB 1A9VA 1F3RB 4Y4FC 2EXWC 4ISVA 3QCVH 4N90D 2ED6A 2PF6A 4X7TA 3T2PA 4CN1A 3SIKA 4POZC 4KKAC 3D18A 4FQCL 5DJYB 4NQVA 4LSVL 5CBAB 3QIWD 1UT1A 2APXA 2ZUSA 4PRAA 1JGIA 4IK6A 4LCUA 3CN2A 1KPVA 2X2HA 3KHOA 4MRCA 4RISH 2YR3A 2R0KH 4GY4A 4X5QA 2OTUA 1IFRA 4P3CH 4OLVL 1L5GB 5CR1A 2R15A 1NCOA 1KCRH 5CLZA 5DD0L 4JPWH 4MZ2A 1PD0A 5KYWA 1T4KB 3FHEA 3BJ91 1AS8A 2IGFL 4P2RD 4DVRH 5BJTB 3CSFA 2XZZA 4JO3H 4GW4B 2X87A 3E2HB 2R1XB 2VMEA 2E6QA 1XT5A 3DIFA 3GLZA 2ERJC 3KPLB 1ZT7B 4KZDH 3P30H 5CEZD 2WNKA 1P1ZB 4RFEA 1HXKA 4WJG3 3IM1A 1SVZA 3TO4D 3IFLH 5AB2A 5IHBA 1BOYA 4OB5L 3TBYA 1NBVL 4CN4A 3IJYA 1EXHA 4KMLB 2ENQA 3OKMB 4MD0A 4LCUB 5HDOA 4KY1H 3P4NB 2ZWSA 3SDDC 1XVSA 1AI1H 1QNIA 1JZ2A 1RURL 4PJDA 1QEWA 4P99A 3BQVA 5KANI 4JVUA 2A74A 2BNRD 2WXRA 3FUEA 3ZOAA 5MEND 1LE9B 3HNVL 3JWNE 1JHKL 4IKJA 1G4RA 3O3AA 3P9LB 4LCYA 2H32H 1S3RA 3FF8A 5CEZE 2WLHA 3HNTH 1MHHB 2B4CH 1Q0YH 1A14H 2XC8A 4X5PA 4JMXA 2E3VA 2OW7A 1I7ZA 1B0IA 1AIFA 5EO1A 3DVGB 3LIUA 4LPTA 1YVLA 4HWZA 2NXYB 3LKRB 2ZWKA 4QTIL 4HUVA 1P4BH 2P45B 4YNYB 1WE5A 1REIA 1XCTB 1OP4A 3BSGA 4R6UA 4KV5F 3EUDA 1E4WL 4RA0C 1I7UA 4HMCA 2VLKD 4DO5A 5CKAA 2V7HB 3T3PB 3L54A 3K71B 3T1FB 4YX2L 4ZS7L 4PLKD 5MERB 1JK8A 1UOKA 2A38A 2YN3A 1DDHA 1KXVC 1FL3B 5L0QB 1I75A 2YZ8A 3VG9B 3QE5A 3EBHA 3RTQC 4P46B 5TK4A 4DN4L 1TUPA 3S36H 3TPKA 3UC0H 1XEUA 1EHNA 2F5AH 1F1DA 1RHHA 4CSPA 2F8XC 4I9XA 1OO2A 3FOMB 4IBVA 4J12A 3O6FD 3LIZL 5C0IB 2XXFA 3IXTB 4Z0XA 5J0BA 1PL3A 3Q06A 4NKDA 1NIFA 5F3BB 3BH8A 4OSUH 4L3CA 5E1AB 2PCFA 1T7VA 3C5ZD 4FNTA 1G7PB 4M1CC 2B15A 4BIKA 2F8OA 4NQDD 3FT4A 4RWYL 4TVSa 3R0NA 1G7QB 5FF6B 1OV8A 3SQRA 1RZPA 4G6KH 4XO4A 1B2YA 4Q9QH 2B4CL 3DROA 1NOLA 1YY9C 1W72B 4QHNB 1Y0LB 3WN5C 5FYLH 4X5WA 4B7IA 3JUYA 3QXWA 1J48A 4GINA 1U8MA 1IGIL 1UCBL 2X2JA 3CBRA 3DSFH 4P59L 1RH8A 5JIHA 5IV2A 3SY0A 1N5AA 2F7OA 4JG9A 4F57L 1FFOA 2P8PA 2R29H 5I0WA 1C9SA 4NUGL 3X1EA 3BSHA 4NQED 5L6YL 4G1EA 3K6NA 3NIFE 3MUGA 1N10A 2ZAIA 1I3UA 3DV6B 1MNNA 1BEXA 3QJUB 2JJSA 3HPLA 1ERNA 1QPKA 3AG3B 3JV4B 4XOCA 4GSDH 4EZJA 1CBVH 3GO1L 4JGNA 2O5XH 5F72S 1CFSA 4P5TC 3P4MB 5HDQL 2CJSA 2OR7A 2ZOKB 3KPQA 5IHZA 4G7SB 4K7PY 4NQUA 1PNDA 5EPMB 1G7IA 1JOIA 2VLLB 3SDDD 4YMPA 3BAEL 3HS0A 4G6JL 2GSGA 1FFTB 3QCTL 4LVEA 4AYFA 3R19A 4NQSA 1ZD6A 3Q2CA 3HHMA 3OQRA 1KG0A 3WJJA 1L0YA 1OQOA 3U6XA 5K9QG 3MYJA 3CQFA 4GH7B 4B41A 2EP6A 2EYTA 3VMNA 5HJ3A 1Q9WA 1IBDA 3EOBA 3DHMA 1SBSH 3GJFK 2X44D