1US5A

Putative glur0 ligand binding core with l-glutamate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
297
structure length
297
Chain Sequence
AQEFITIGSGSTTGVYFPVATGIAKLVNDANVGIRANARSTGGSVANINAINAGEFEMALAQNDIAYYAYQGCCIPAFEGKPVKTIRALAALYPEVVHVVARKDAGIRTVADLKGKRVVVGDVGSGTEQNARQILEAYGLTFDDLGQAIRVSASQGIQLMQDKRADALFYTVGLGASAIQQLALTTPIALVAVDLNRIQAIAKKYPFYVGFNIPGGTYKGVDVTTPTVAVQAMLIASERLSEETVYKFMKAVFGNLEAFKKIHPNLERFFGLEKAVKGLPIPLHPGAERFYKEAGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Thermus Thermophilus Putative Periplasmic Glutamate/Glutamine-Binding Protein
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Receptor
molecule keywords PUTATIVE GLUR0 LIGAND BINDING CORE
total genus 103
structure length 297
sequence length 297
ec nomenclature
pdb deposition date 2003-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16868 NMT1_3 NMT1-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1us5A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1us5A01
2Q2AA 3HSTA 2QSXA 3G3IA 5H8HB 1Y20A 3PUYE 1NFTA 2ZYKA 1B5HA 2V84A 3IB1A 1PC3A 3IOWA 4NF4B 2DSFA 5EYFA 5KZTA 2OJTA 3C31A 3QIMA 2F5XA 2OZZA 4QFOA 3TDJA 3V89B 5BUUA 2Z22A 5I59A 2H25A 4G8NA 4N13A 2Z23A 1S9TA 2RCAA 4OFJA 3QXMA 4TQUQ 4EXLA 1B0HA 2I4BA 4QFKA 3QUFA 2RCBA 3A09A 2NUVA 1LB9A 2UVHA 4IY6A 2ZYMA 3MBPA 2UVIA 4MBPA 4ZS9A 5AE4A 3OO8A 1UTHA 2LAOA 3B6WA 3O6GA 2VOZA 1LAFE 4O3AA 5CMCA 1HSEA 3MQ9A 5DVJA 2Q88A 3MWBA 1MXUA 5CMBA 4PP0A 3FIRA 1FTMA 4AB6A 5DTBA 4QRZA 4H67A 3C35A 3CR9A 3I3VA 4H5GA 1FQEA 3VVFA 3IK6B 2IEEA 4LZ5A 1B7HA 2I3VA 4ZZEA 3C32A 1SW4A 2REGA 3N6UA 1DTGA 3HN0A 4BDNA 3EF7A 1MXZA 2DVCA 3HV1A 2XX7A 1H76A 3KJTA 3PU5A 4YICA 4PFYA 1IXIA 4C1TA 4KHZE 3TPAA 3USDA 4F19A 3VLVA 5H8NB 5I56A 4KD5A 2X7QA 1AMFA 3SEVA 5I58A 2DWIA 3Q26A 1D9YA 3CIJA 3O9PA 4G2ZA 3MZ9A 5M2VA 2I58A 4FIMA 2CZLA 4H6DA 3PUVE 1A7LA 4KPTA 4U2RA 5HBCA 3RTWB 4DCYA 3LSWA 4DXBA 3VLUA 4R72A 3SDFA 3QSLA 2DOJA 1MDQA 3E13X 1FTOA 4POXA 4UA8A 1US5A 3KN7A 3MAMA 3MP6A 4ELRA 3U92A 1LCTA 3KEIA 3FXQA 4QSCA 5DVFA 1A55A 4ZE8A 3W15C 2DE2A 5DEXB 1ELJA 1TWYA 1J1NA 1NNPA 1YAEA 3CRBA 3FVGA 1QULA 2NVUB 1DTZA 4F3PA 4XIGQ 4Z7EA 1OLCA 2DWHA 4ELPA 3GXAA 1JW4A 4YKPA 4AB5A 1OVTA 3F11A 4IY5A 3TQWA 3PV0E 1VFDA 3MW0A 1PB8A 1N0TA 1B1XA 4WEPA 5H8FA 4NF4A 2VD2A 4H0WA 3EPEA 1JVYA 1WVJA 2OWSA 2RF1A 4BDRA 3U1OA 2XXHA 2YLNA 4WXJA 3Q28A 5L9SA 2R71A 3H7MA 2Y7RA 3FVOA 5F7VA 4ZZAA 4EDPA 3EHTA 3TZAA 2DXYA 3QUJA 3JYRA 1TFDA 2HAUA 1B6HA 4JB7A 1UTBA 4O3BA 4PFTA 3OO9A 4LUBA 2RINA 2V25A 1VR5A 1MM7A 2AL4A 5H8NA 2Q89A 1AOVA 3R6UA 2AL5A 1MDP1 4YKJA 5FTHA 3GZGA 2QRYA 1AL3A 5I57A 1B05A 4GFRA 5I58B 4LZ8A 4X48A 3B6TA 4TLLB 3V5AA 3CSBA 1SBPA 1I6AA 3FZVA 4GVOA 1LAHE 2RKMA 3QK6A 1NMUA 1MY0A 5DEXA 1N3XA 3O6IA 3GLBA 3OEMA 3Q27A 2D5WA 3U94A 4THIA 3T9HB 1EU8A 2DXRA 3PPPA 3D4CA 3HHGA 3KG2A 3MUQA 5K2XA 3O6HA 1MY4A 1MXYA 4ESWA 1B0LA 4OERA 3SEXA 2W7YA 3TODA 4N07A 1OVBA 5AA2D 1TT1A 1B5IA 4RPNA 3C36A 3TKDA 4EF2A 3IL1B 1FTKA 5CMMA 2Z8EA 2GFEA 4WKMA 3OO7A 3K0VA 1LB8A 4LQ2A 3MJNA 1A8FA 3V83A 4RA1A 3TTMA 4HCWA 4MF3A 3VXBA 2ESNA 4F1YA 2ZNUA 1MQJA 4IB2A 3A3CA 4U21A 3S9LC 5A5XA 4FORA 5HPQA 2V3UA 4JWOA 5CBSA 1GTKA 2GHAA 4KQPA 4R74A 1R1NA 2O68A 5H8QB 2I0BA 4OYVA 2UVGA 1IXHA 3PPNA 5DT6A 3RLFE 3JV9A 2XX8A 4ZEFA 4PE5B 2XXPA 2O7IA 3CFZA 1D3KA 1BP5A 1A40A 1N84A 1QUKA 1B3LA 2R9JA 1MPDA 3DP8A 3ZS6A 5IAIA 1PB9A 1JW1A 3L6GA 4GF8A 3H3GA 1P1OA 4MLQA 3M3FA 3OENA 5H8FB 4YMAA 4C0RA 4KI0E 3IJOB 3KSXA 1EH3A 5JTYB 3VVDA 4DLDA 1LBCA 5CBRA 5I57B 3VDFA 4ZE9A 3VE1B 4MFIA 3OSRA 1JEUA 4IGRA 4OVJA 4EQBA 4YMBA 4JSDA 3S9MC 4HCYA 3KOSA 3EN3A 3CVGA 2QPQA 4GXSB 3RPWA 3BFUA 2CMOA 2OCUA 4LVQA 2G29A 1ZU0A 3O2AA 3FVNA 2HCAA 1UTBB 1JEVA 1PBQA 1DSNA 1FTLA 2O84X 5H8HA 3SEWA 3CG1A 2ZNSA 4XKPA 3N94A 5CI5A 1PEBA 3ZKKA 4ELQA 4H1XA 4NWDA 2ONRA 1Z7ME 2I49A 2ZYOA 1P1QA 4FECA 4GL0A 4L17A 4LP2B 3K1PA 3W9WA 3LUYA 3CSGA 4OMBA 4E0XA 5AA4A 3RT6B 2HEUA 3IO6A 1IXGA 1USYE 4H8IA 2FNCA 4F3SA 4AQ4A 5DVIA 3IOTA 3U72A 4EQ9A 2I6EA 4G8MA 4LZ7A 5I2NB 3LSLA 1EZ9A 4OTEA 1Y4CA 4ZEIA 3DP6A 4KYEA 1Y3QA 1XHYA 4GL8A 2UYEA 3FVKA 4I8CA 1QJMA 3H06B 4ZEKA 2THIA 2YJPA 1AH5A 1MXWA 2HAVA 3PPQA 1N76A 4XXUA 1IXCA 2D21A 4OFOA 4PFWA 1MH4A 5J1DA 4YB7A 2F6GA 1QUIA 4H65A 2Q2CA 3DELB 2XXWA 3LR1A 3IO4A 4M1VA 3UA8A 2UXAA 3N5LA 3E3KA 3ILTB 2H9BA 1ZTYA 2O69A 4JBZA 3O28A 2HQ0A 2B3FA 1MXVA 1ATGA 2DWJA 1IUDA 1OIBA 1RYXA 3OMBA 1UIVA 2DVZA 4GWOA 1IQ7A 1FQAA 2QMWA 2QS2A 2PYYA 3VXCA 4F3GA 4NF8B 3RQTA 4YU0A 3OOAA 4GOTA 4NF5B 3S2VA 1O64A 1QW0A 2A5SA 2OLBA 4HTGA 4EXKA 2HFBA 4G68B 1SI0A 1B4ZA 3HO7A 3M8UA 3KSJA 1H3DA 2DE4A 1P1UA 4ZEDA 2O1LA 1F9BA 3G3HA 4O3CA 3RNNA 1LGBC 3M3KA 3VVEA 1LAGE 1ZBMA 3PPOA 5KDTA 5JTYA 4MH5A 2O6AA 3T9UA 2RC9A 1FQBA 1FQCA 1JQFA 4K3FA 3OEKA 4BDOA 3B7DA 4GD5A 3PPRA 3MVWA 3TFLA 1PB7A 1WODA 4RNSA 5TP9B 1POY1 2Z8DA 4DXUA 1A8EA 4IO6A 3G3KA 1WDNA 3M3LA 3CG3A 2PT1A 4Q5TA 3WAEA 1LFIA 5JEIA 4HW8A 3FV1A 1M5FA 4JDFA 4G77A 2D3IA 2H5YA 1LSTA 2Y7PA 1UIUA 2V93A 3MC2A 4NEDA 2XD3A 4G68C 2Q8JA 4DIGA 2DP8A 3KOTA 4ECFA 5I56B 1II5A 1LCFA 1SD3A 4YKKA 4XTCQ 4ZDMA 3UIFA 3U8QA 1N04A 3UK4A 4FATA 2Y7KA 1LFGA 1BKAA 1ZLQA 1VE4A 5ISUA 4IO7A 1SYIA 4H5FA 2IA4A 3MZ1A 5I2NA 3Q29A 3O97A 2Y7WA 3GBAA 1YCJA 3RTFB 1NNFA 3TCGA 4ESXA 3IORA 4YB6A 2REJA 3FJ7A 2DYXA 1US4A 1P1NA 3CI8A 4NF5A 5KDTB 3LSFB 3K1MA 4R6HA 4XKRA 4I62A 3T9XB 1NH7A 3CFXA 3FJMA 3QYTA 5KCJB 3IB0A 3IR1A 4FEDA 5F1QA 3O66A 3UP9A 2ONSA 2XXYA 2FA7A 4ZECA 5HM4B 2F35A 4LA9A 3UORA 3DLNA 3PUZE 1DPPA 3T22A 3TYHA 1NNKA 2NOOA 2DE3A 4RYAA 5TPAA 1QUJA 2QS1A 1M5CA 1N3WA 4F29A 2I0CA 1A99A 3MVXA 1ZMGA 5TP9A 1B7UA 1MS7A 3N26A 4I9DA 1B7ZA 3IOUA 3W9VA 5FHMA 2QS4A 2X7PA 3PUWE 4M4GA 5AA2B 2ZMBA 3SKPA 3TELA 5ITPA 4U1ZA 3HHFA 1EZPA 5K2YA 3G3GA 2RC8A 1XVYA 1P99A 3FASA 3LBSA 4OXVA 3V8XB 3R26A 2XXVA 3MP8A 3TTLA 3K6WA 3CFLA 2ZXTA 3OSQA 4NF6A 4YZZA 2ANJA 3E9XA 3TAJA 4EQ7A 1NH8A 3FXUA 5EHMA 5H8QA 1B5JA 1OLAA 3E4RA 3RUMA 1JVXA 1PBPA 3KJ7A 2UVJA 2XXQA 3S9EA 4ND9A 2PBWA 4F22A 2GH9A 3BFTA 4G4PA 1B3GA 3RY3A 3RT8A 3T66A 5CC2A 4U22A 4YAHX 2HZKA 3GBBA 5FHNA 1MPBA 3FUZA 2XXUA 4LQ5A 1TXFA 1LLSA 3H03A 3A3UA 4QFLA 3TMGA 1O63A 4IO3A 1Q35A 5TPAB 3EHSA 4I1DA 1UQWA 3MP1A 4R6YA 1Y9UA 4GQOA 4R9FA 5KCJA 3PD8A 1Y1ZA 3AXFA 3TTKA 4BDMA 1MXXA 2A5TB 2XHDA 4KFQA 3PD9A 4R9GA 1L5TA 4OEUA 2VD3A 2UYFA 5L9OA 1SQYA 4U4XA 4RK2A 3N6TA 3B6QA 2NXOA 3OELA 5CRYA 4C1UA 2Y84A 3PGFA 3Q25A 3JZJA 3K01A 2AIXA 3O29A 3C33A 4P11A 4BDLA 1MY3A 1SW1A 2O7UA 2AYSA 2ONKE 1HSJA 1USYH 2Z8FA 1H44A 4GRKA 3T93B 3MVZA 3THIA 5JK4A 1MG1A 2F7BA 2OWTA 3KN8A 1B32A 2B3BA 4ONYA 3ECRA 4DDDA 4ELOA 4IO2A 1Y3PA 4FAJA 4DE8A 3LSXA 4ZEBA 2F8DA 4E0WA 2HZLA 3TUSA 1ZKBA 1I6BA 3IOVA 3SEYA 1URSA 1IZ1A 2H98A 1B3HA 4Q8RA 3OO6A 1GR2A 1S7YA 1LBBA 4JWXA 3ZSFA 4R75A 2X26A 2PT2A 3UGWA 3PMWA 3FXRA 2F34A 1R9QA 1H45A 2F6PA 1FCKA 1NL5A 5AA2A 3FATA 1VSOA 3H6TA 3C4MA 4RXLA 1A54A 1Z7NE 4F2QA 2QJEA 2A5TA 2OK2A 3SERA 4F1UA 3K6XA 3MPKA 4IGTA 5ICTA 1MM6A 2QL3A 1T0KA 1DOTA 1MQIA 1XS5A 4OETA 5AA1A 2F78A 2Q9TA 3D4GA 4OZ9A 2XX9A 4JXIA 4F31B 3I6VA 4NF8A 3OXNA 1HSLA 1SW2A 3HCQA 1B3FA 1B2HA 5ELVA 2I48A 1Y4TA 1M5EA 3TEPA 2OBGA 2ALUA 1QKBA 1B46A 3EHUA 2XD2A 4G68A 4HS7A 4NMYA 4OHNA 1BLFA 4P0GA 4R73A 4IO5A 4XKNA 1I6QA 2R6GE 4ISUA 4U1OA 3KZGA 1R9LA 3ZKLA 2H4IA 3MZBA 2ZYNA 4X9TA 2DS9A 3C34A 3SETA 1M5DA 1B3EA 1RKMA 3LC8A 4BLAA 3G7WA 1CE2A 1B9JA 1KWHA 1XT8A 2I3WA 4FEBA 3PUXE 4R6KA 4YKIA 3T96B 1ZJLA 3S4UA 4GLIA 1OMPA 1CB6A 1POTA 3H6WA 4QFPA 4RY1A 3IAZA 1VFEA 4UACA 1MY2A 4Q0CA 4X1BA 3BBRA 3FV2A 3VV5A 1MQGA 1BIYA 2XXXA 4OENA 3C9HA 1OQGA 3MPLA 1MPCA 4JSOA 3RN8A 5DYHA 5L8DA 1Q1KA 5B70A 3U93A 4X1DA 2F36A 2M8CA 2WKYA 1LFHA 3PMXA 4KCCA 1AIVA 4FJPA 1NNTA 3TTRA 2H99A 2I4CA 3FJGA 4N6PA 4PQJA 4TOZA 4OQOA 3HPIA 1ZIUA 1B51A 4OESA 4R2FA 4NE4A 3SESA 4KR5A 4DCXA 1N7WA 1NKXA 2F97A 5CMKA 2V3TA 3H6VA 3ODBA 2ABHA 2YPNA 5I2KA 4BDQA 2E1SA 1QKAA 2F7CA 3QAXA 4G8HA 4GXAA 1SI1A 1FQDA 2E0SA 1M5BA 3ONMA 2G93A 4H8JA 4JWYA 4QHQA 1JETA 5ITOA 4F1VA 3RGYA 2HXWA 1URGA 3KN3A 2XXTA 2VGQA 4R2BA 3TTNA 4DZ1A 5H8SA 4F3BA 3FGSA 4F39A 1XC1A 1FQFA 4PFUA 1R6ZA 2F7AA 1IITA 4RPOA 5I84A 2RC7A 1D4NA 1Y3NA 1QVSA 1YPNA 5CM6A 3L6HA 4RK9A 4EF1A 5AA3A 5TU0A 2PVUA 2NWJA 1N7XA 3K1NA 3K6VA 1TFAA 2P0SA 4KYSA 1P1WA 1H43A 3OD7A 3TCFA 3G3FA 3K4UA 2QMXA 1GGGA 2DQVA 1MH3A 1D9VA 2P1SA 3H4ZA 3I5OA 4OFLA 4OWDA 5L9MA 1B58A 1Y1MA 3R7XA 3S9NC 2BJJX 3K02A 3BKIB 4FE8A 1SYHA 4QF9A 4EUOA 1YTVA 1GVCA 4IO4A 4P0IA 1FTJA 1B40A 4GIZA 3G3JA 4U4SA 1JNFA 3ILUB 5I59B 2GRVA 1RYOA 3WAFA 1MRPA 4XKQA 2V3QA 3SEUA 4RJZA 2FYIA 2PMSA 1MY1A 2XXIA 3VLWA 4LONB 1I69A 4NF6B 4F2OA 5IKBA 4OEVA 1SDXA 4TLMB 1OQHA 4KCDA 1UTHB 3K00A 2VHAA 3K6UA 5A5XB 3P7IA 1URDA 5FTIA 5ICQA 2KLFA 3H6UA 1IIWA 2VP1A 1PDAA 2P2AA 3IJXB 3KFMA 4QSDA 3IX1A 4QFNA 4QSEA 1ANFA 3K2DA 5LOMA 2DWAA 1IEJA 3DM0A 3PMVA 5B7DA 5FHOA 2GHBA 1SW5A 3TQLA 1LAXA 2ZNTA 1BTJA 2XXRA 4PETA 3UN6A 1EZOA 3T9VA 4DXCA 3KBRA 1B4HA 1MQDA 1O7TA 2O51A 3DP4A 2B65A 1B52A 4WEDA 2PX1A 4KYDA 4MLVA 3KGCA 4NTLA 3MVYA 3EQ1A 4Z0IA 2QS3A 1DPEA 5BWJA 4Q30B 3IB2A 1GV8A 1FW0A 3VFJA 1DMBA 1SVXB 2Y7IA 4LATA 4U23A 4YB5A 5EHSA 5AA4B 1S50A 4NWCA 5I2KB 1XOCA 3TCHA 1MQHA 4F18A 1JW5A 4POWA 3FD3A 2O1MA 1B1HA 1XVXA
chains in the Genus database with same CATH superfamily
3HSTA 2QSXA 4NF4B 5EYFA 3C31A 2Z22A 1FJ6A 4G8NA 4OFJA 4TQUQ 1D9QA 4GX3A 4MBPA 1LB9A 1NUZA 1UTHA 2VOZA 1HSEA 3U65A 5CMBA 4QRZA 3CR9A 1FPEA 3PTYA 4H5GA 4LZ5A 1B7HA 3C32A 3HN0A 1MXZA 3HV1A 4LN5A 5I7IA 4KHZE 3LV0A 5I56A 4KD5A 4O7MA 2DWIA 3MZ9A 5HBCA 1A7LA 3LUZA 3QSLA 3E13X 1FTOA 4ELRA 3KEIA 4QSCA 5DEXB 1DTZA 4XIGQ 1OVTA 3F11A 4IY5A 3PV0E 1VFDA 4WEPA 1PB8A 4H0WA 1WVJA 2RF1A 2XXHA 2YLNA 4PFRA 3EHTA 3JYRA 1B6HA 3OO9A 1VR5A 3R6UA 2AL5A 4JVCA 5I57A 2XWVA 4X48A 4DI3D 2RKMA 5DEXA 1N3XA 1FPDA 2D5WA 3U94A 3D4CA 3KG2A 3MUQA 5EYHA 2CEYA 4ESWA 3SEXA 4N07A 1IMEA 2GFEA 3OO7A 3K0VA 1LB8A 4N17A 3MJNA 1A8FA 5LTCA 3TTMA 2ESNA 4IB2A 1MQJA 4U21A 4P9KA 5A5XA 2V3UA 4JWOA 1SPIA 2GHAA 4R74A 2UVGA 5DT6A 2XX8A 5IZZA 2XXPA 1N84A 1K9ZA 5IAIA 1PB9A 1P1OA 3M3FA 3OENA 4DLDA 1EH3A 3VVDA 2QPQA 4I3EA 3RPWA 2CMOA 2OCUA 3FVNA 1UTBB 1JEVA 1PBQA 5H8HA 1K9YA 3B8BA 4XKPA 2ZNSA 5CI5A 2ONRA 1Z7ME 2I49A 3W9WA 2BJIA 3IO6A 1IXGA 1USYE 1FRPA 4F3SA 3EKIA 5DVIA 1FPIA 3DP6A 4AS4A 4I8CA 3FVKA 4ZEKA 1AH5A 2HAVA 5J1DA 2D21A 1QUIA 4H65A 2Q2CA 4GBVA 3LR1A 2UXAA 3ILTB 1IUDA 1OIBA 3VXCA 1IQ7A 4YU0A 4NF5B 1QW0A 4EXKA 3KSJA 1P1UA 3G3HA 3M3KA 3VVEA 1LAGE 1JQFA 1FQCA 4BDOA 2QVUA 1PB7A 1POY1 4DXUA 4MNPA 4P47A 3CG3A 2PT1A 3WAEA 1LFIA 4HW8A 2Y7PA 4DIGA 1UIUA 2V93A 5FBPA 3U8QA 3Q29A 3GBAA 3RTFB 3TCGA 2DYXA 1P1NA 4R6HA 3IR1A 4FEDA 2ONSA 3PUZE 3TYHA 2NOOA 4RYAA 2FIEA 2I0CA 1ZMGA 1B7ZA 2ZZXA 5AA2B 3HHFA 5K2YA 3G3GA 3FASA 3LBSA 4OXVA 4PDHA 2XXVA 1FBPA 4NF6A 3TAJA 5H8QA 3E4RA 3S9EA 1JVXA 2PBWA 4F22A 4QBAA 3BFTA 4U22A 2HZKA 3FUZA 1O63A 3EHSA 1UQWA 3MP1A 4GQOA 1Y1ZA 2VD3A 4NHBA 5CRYA 4C1UA 3PGFA 4QXDA 1SW1A 5JK4A 1H44A 3MVZA 2OWTA 2B3BA 4FAJA 4DE8A 4ZEBA 4E0WA 2HZLA 1I6BA 1URSA 1S7YA 4G61A 1LBBA 3PMWA 3FXRA 2CZKA 4DI4B 1VSOA 1IMDA 3SERA 4F1UA 5ICTA 2WBDA 1FPGA 1T0KA 2F78A 2Q9TA 4OZ9A 4NF8A 3OXNA 1B3FA 1B2HA 2I48A 1Y4TA 4OHNA 1YYZA 4G68A 4NMYA 4R73A 4U1OA 4P1EA 3SETA 3C34A 1G0IA 3LC8A 1B9JA 4H45A 4R6KA 1CB6A 2XA5A 3BBRA 4PGPA 4HE2A 1MQGA 1KZ8A 3MPLA 1OQGA 4JSOA 4GWYA 3B50A 4X1DA 2WKYA 2Q74A 4PQJA 1B51A 1N7WA 2F97A 2F7CA 3QAXA 4QHQA 1FPLA 3FXBA 2HXWA 4HE0A 3TTNA 4DZ1A 4PCDA 1R6ZA 5I84A 1D4NA 3L6HA 2KQZA 1N7XA 3K6VA 1P1WA 3G3FA 2QMXA 1MH3A 2P1SA 3I5OA 3S9NC 1B58A 4N8YA 1GVCA 4P0IA 1FTJA 4GIZA 2FYIA 3T1BA 5A5XB 1AWBA 4KCDA 5IM2A 5ICQA 2KLFA 3H6UA 2VP1A 1PDAA 2P2AA 4QFNA 5B7DA 3UN6A 4DXCA 1B4HA 1FPJA 2VPNA 2ZZWA 1B52A 4Z0IA 5BWJA 3IB2A 1DMBA 1SVXB 4YB5A 3TCHA 1MQHA 3IB1A 1B1HA 1XVXA 5H8HB 2JJKA 3PUYE 1NFTA 1PC3A 5KZTA 2F5XA 2OZZA 5BUUA 3TDJA 5I59A 2F3BA 4UABA 4N13A 1G0HA 3QUFA 2NUVA 4IY6A 2ZYMA 5AE4A 3OO8A 4MNCA 5CMCA 3MQ9A 3MWBA 4AB6A 1FQEA 3IK6B 2PFZA 3BIHA 2DVCA 2XX7A 4YICA 3TPAA 2WYPA 5I3SA 5H8NB 2X7QA 1AMFA 3SEVA 5I58A 1D9YA 1JP4A 4P56A 4FIMA 4H6DA 3MYUA 1KA1A 2FIXA 1FPKA 4POXA 1US5A 3KN7A 3MP6A 3W15C 2DE2A 1ELJA 1TWYA 1NNPA 3CRBA 3FVGA 4F3PA 5DW8A 4Z7EA 2DWHA 3MW0A 1B1XA 4NF4A 2VD2A 3EPEA 2OWSA 2R71A 2Y7RA 4EDPA 1LBZA 2DXYA 2AL4A 5F24A 4YKJA 2QRYA 1B05A 4GFRA 1FPFA 3V5AA 1I6AA 3FZVA 4GVOA 1LAHE 1MY0A 3GLBA 3OEMA 3T9HB 2DXRA 3HHGA 4H46A 5ET7A 2W7YA 2XWIA 1B5IA 3TKDA 3IL1B 1FTKA 4WKMA 3V83A 3VXBA 3A3CA 4JVIA 5HPQA 5H8QB 3RLFE 1D3KA 4GWUA 1B3LA 1JW1A 3L6GA 4KI0E 4N15A 5CBRA 1LBCA 3VE1B 4MFIA 3OSRA 3S9MC 2P3VA 3EN3A 3IFCA 4O8MA 3BFUA 1ZU0A 1CNQA 1DSNA 1PEBA 4ELQA 4MNIA 4L17A 2ZYOA 4FECA 4E0XA 2VT5A 2HEUA 4H8IA 3IOTA 3U72A 2I6EA 3LSLA 1EZ9A 4KYEA 1Y3QA 4GL8A 3H06B 2THIA 1IXCA 1MH4A 4YB7A 2F6GA 2XXWA 1YZ0A 2KR0A 2DWJA 1RYXA 1UIVA 2DVZA 2QMWA 4NF8B 3RQTA 3OOAA 4GOTA 1O64A 2OLBA 4PGNA 4G68B 3HO7A 1XI6A 4ZEDA 2O1LA 1F9BA 3RPLA 3PPOA 5KDTA 3T9UA 3KC0A 2RC9A 5TP9B 1A8EA 4IO6A 4Q5TA 4NN3A 1NUWA 3FV1A 1M5FA 4JDFA 5J16A 2H5YA 4NEDA 2XD3A 2DP8A 3KOTA 1II5A 5EQ7A 5LDZA 4ZDMA 3UIFA 1N04A 4FATA 5IGAA 5ISUA 4IO7A 1SYIA 3MZ1A 2Y7WA 1NNFA 2REJA 4XF5A 1US4A 5KDTB 3LSFB 3QYTA 5ET6A 3KBZA 4ZECA 3DLNA 1DPPA 4NGUA 1QGXA 3ROJA 1QUJA 2QS1A 1M5CA 4F29A 1A99A 1MS7A 4I9DA 5FHMA 2X7PA 3PUWE 2HHMA 1P99A 3V8XB 3TTLA 3K6WA 3OSQA 4YZZA 4GWWA 1NH8A 1PBPA 3KJ7A 2FVZA 3RY3A 3GBBA 1FBFA 4LQ5A 3H03A 3TMGA 3A3UA 4QFLA 1Q35A 4I1DA 4R6YA 5KCJA 1Y9UA 3PD8A 3AXFA 4BDMA 1L5TA 4OEUA 2UYFA 4OVPA 4PFBA 2NXOA 3OELA 3Q25A 3JZJA 3K01A 1NV6A 2AIXA 4MJOA 1MY3A 2AYSA 1LBWA 1MG1A 3ECRA 1Y3PA 3TUSA 1ZKBA 1GR2A 4JWXA 4PTKA 4R75A 2X26A 4PE3A 2WBBA 2F34A 1R9QA 1H45A 5ESYA 1NL5A 3GYYA 5AA2A 4PF8A 1NI9A 3H6TA 4GX6A 3C4MA 4PAIA 1NUXA 2OK2A 3K6XA 1MQIA 4F31B 4OVRA 1M5EA 4P0GA 4HE1A 1B46A 1EYKA 2XD2A 4XKNA 4HS7A 4IO5A 2R6GE 3KZGA 4NG7A 2H4IA 2ZYNA 2DS9A 1M5DA 1B3EA 3G7WA 1FJ9A 1CE2A 2VPOA 1ZJLA 3S4UA 3H6WA 3IAZA 4X1BA 3FV2A 4N8GA 4OENA 3RN8A 5DYHA 5L8DA 1Q1KA 5T3JA 2M8CA 4KCCA 1FBDA 4FJPA 2I4CA 4OQOA 3HPIA 4DCXA 1NKXA 2V3TA 2ABHA 3T93B 1SI1A 2E0SA 1DK4A 1M5BA 4F1VA 5ITOA 3KN3A 5H8SA 4PFUA 4RPOA 2RC7A 1Y3NA 1YPNA 2V4CA 5CM6A 4RK9A 4EF1A 2CEXA 3K1NA 3OD7A 3K4UA 1GGGA 3H4ZA 1D9VA 3R7XA 3RYDA 3BKIB 1NV0A 1YTVA 4U4SA 3G3JA 1JNFA 1RYOA 3SEUA 4RJZA 2XXIA 3VLWA 1I69A 4F2OA 2WYKA 4OEVA 1SDXA 4TLMB 1UTHB 2VHAA 4PF6A 3P7IA 1IIWA 4QSDA 2GHBA 1SW5A 2ZNTA 1BTJA 3SZPA 1EZOA 3T9VA 5I5PA 1O7TA 3DP4A 2PX1A 3KGCA 1LBYA 1DPEA 1GV8A 5I56B 4U23A 1S50A 3CHGA 3FD3A 4UACA 2O1MA 2QVVA 3G3IA 1Y20A 1NV7A 4JVDA 2ZYKA 1B5HA 3IOWA 2DSFA 2OJTA 3V89B 2H25A 3QXMA 4EXLA 3ISPA 2I4BA 4QFKA 2RCBA 3A09A 3MBPA 2UVIA 2LAOA 1LAFE 1VDWA 4PP0A 3FIRA 1FTMA 5DTBA 4H67A 4ZZEA 1SW4A 1DTGA 4BDNA 3PU5A 4PFYA 3USDA 4F19A 3E78A 3Q26A 3CIJA 3O9PA 2I58A 4U2RA 2CZLA 4KPTA 3PUVE 3RTWB 3LSWA 3VLUA 3SDFA 2DOJA 1MDQA 2DDKA 2MKZA 1LCTA 1A55A 4ZE8A 1J1NA 1QULA 1OLCA 4ELPA 4YKPA 3TQWA 5H8FA 4PDDA 3U1OA 3Q28A 5L9SA 5ET5A 3FVOA 4ZZAA 3QUJA 1TFDA 2HAUA 4JB7A 4O3BA 2RINA 2Y5LA 1AOVA 1NV2A 5FTHA 3GZGA 1EYIA 3B6TA 4TLLB 3CSBA 3QK6A 3O6IA 3Q27A 1EU8A 3PPPA 1MXYA 1B0LA 4OERA 3TODA 1FTAA 1OVBA 1TT1A 4RPNA 3C36A 4EF2A 5CMMA 1NV3A 4LQ2A 4RA1A 2WEFA 4F1YA 3S9LC 4FORA 1R1NA 2O68A 2I0BA 4OYVA 3PPNA 3JV9A 4ZEFA 2O7IA 1A40A 2R9JA 1MPDA 3DP8A 3ZS6A 4MIJA 4MLQA 5JTYB 3IJOB 3KSXA 5I57B 3VDFA 1JEUA 4YMBA 4JSDA 4GXSB 4LVQA 2HCAA 1FTLA 3N94A 4NWDA 1P1QA 4GL0A 3K1PA 3LUYA 1NV5A 4OMBA 1LEVA 5I2NB 4OTEA 2B4LA 2UYEA 2YJPA 3PPQA 1N76A 4FBPA 3IO4A 1ZTYA 3O28A 2HQ0A 4OA4A 1MXVA 1ATGA 3OMBA 1FQAA 2PYYA 3S2VA 4HTGA 1B4ZA 3RNNA 1LGBC 1ZBMA 1FQBA 3OEKA 3B7DA 4MMPA 3PPRA 3MVWA 5IZ1A 1WODA 2Z8DA 3G3KA 3M3LA 5JEIA 4G77A 1LSTA 3MC2A 1RDXA 2Q8JA 4G68C 4GBWA 1LCFA 1SD3A 4YKKA 4XTCQ 1LFGA 1BKAA 1ZLQA 1VE4A 4H5FA 2IA4A 1YCJA 4ESXA 3IORA 4YB6A 4NF5A 3CI8A 4XKRA 4I62A 1NH7A 3CFXA 3FJMA 1YXIA 3O66A 3UP9A 2XXYA 2FA7A 3T22A 1NNKA 5TPAA 1N3WA 3NOHA 4PBHA 3MVXA 2GQ1A 1B7UA 3IOUA 4M4GA 2ZMBA 3SKPA 5ITPA 1EZPA 2RC8A 1XVYA 3CFLA 2ANJA 5EHMA 1OLAA 2HXRA 4ND9A 3RT8A 3T66A 4YAHX 2XXUA 1IMBA 2XWKA 1LLSA 4IO3A 4O94A 5TPAB 1IMAA 4R9FA 4KFQA 4RK2A 3B6QA 4X04A 4P11A 2ZZVA 2ONKE 4GRKA 2Z8FA 1HSJA 3KN8A 1B32A 4ONYA 4PAFA 4DDDA 4IO2A 5EQ9A 3LSXA 2F8DA 4IR8A 4Q8RA 1FSAA 3ZSFA 2PT2A 4N6DA 4RXLA 4F2QA 4IGTA 1DOTA 5AA1A 3D4GA 3I6VA 3E79A 1SW2A 3HCQA 1QKBA 1BLFA 1I6QA 4ISUA 3ZKLA 3MZBA 4X9TA 1RKMA 3BIGA 4AS5A 2I3WA 4FEBA 1FPBA 4I3YA 1OMPA 5EQAA 5IZ3B 3IFAA 4GWXA 1MPCA 5B70A 3U93A 1INPA 4N6PA 1ZIUA 4OESA 4NE4A 5CMKA 3H6VA 3ODBA 2FBPA 5I2KA 4BDQA 2E1SA 4G8HA 4GXAA 4H8JA 3ONMA 5AA4A 1JETA 1URGA 2XXTA 2VGQA 4F3BA 1XC1A 1FQFA 2PFYA 2F7AA 4P8BA 5IZ3A 5TU0A 1TFAA 1H43A 3TCFA 4OFLA 5L9MA 1SYHA 2PCRA 4QF9A 5ET8A 5I59B 2GRVA 4I40A 1MRPA 2HPGA 2PMSA 3MSTA 1OQHA 3K00A 3K6UA 5FTIA 1URDA 3HFUA 3IJXB 3IX1A 4QSEA 1ANFA 3K2DA 2DWAA 4PFIA 1NV1A 4N4UA 3DM0A 3PMVA 4PAKA 5FHOA 2O51A 2B65A 4WEDA 4KYDA 4NTLA 3EQ1A 3QMFA 4Q30B 2Y7IA 4F18A 4POWA 1EYJA 2Q2AA 4P3LA 4N6KA 2V84A 4GWZA 4QFOA 3QIMA 2Z23A 1Q9DA 1S9TA 2RCAA 1B0HA 2UVHA 4ZS9A 3B6WA 3O6GA 4O3AA 4NQ8A 2OWZA 5DVJA 2Q88A 1MXUA 5EYGA 3C35A 3I3VA 3VVFA 2IEEA 2I3VA 2REGA 3N6UA 3EF7A 1H76A 3KJTA 4N91A 1IXIA 4C1TA 3VLVA 4OVQA 4G2ZA 4P1LA 5M2VA 4DCYA 3T0JA 4DXBA 1RDYA 4OVTA 4R72A 1DBZA 4UA8A 4OANA 3MAMA 3U92A 3FXQA 5DVFA 4MX6A 1YAEA 2NVUB 2CZIA 3GXAA 1JW4A 4AB5A 4X8RA 1N0TA 4NX1A 1JVYA 4BDRA 3H7MA 5F7VA 3TZAA 4XFEA 1UTBA 4PFTA 4LUBA 2V25A 1MM7A 5H8NA 2Q89A 1MDP1 1AL3A 5I58B 4LZ8A 4NF0A 1SBPA 1NMUA 4NAPA 4THIA 5K2XA 3O6HA 1MY4A 5AA2D 2QFLA 2Z8EA 4HCWA 4KXPA 4MF3A 2ZNUA 5CBSA 1GTKA 4KQPA 1IXHA 1FBCA 4PE5B 3CFZA 1BP5A 1QUKA 4GF8A 3H3GA 4PBQA 5H8FB 4YMAA 4C0RA 4ZE9A 4IGRA 4OVJA 4EQBA 4HCYA 3KOSA 3CVGA 2G29A 3O2AA 2O84X 3SEWA 1FBEA 3CG1A 3ZKKA 4H1XA 4ELOA 4LP2B 3CSGA 3RT6B 2FNCA 4AQ4A 4EQ9A 4LZ7A 4G8MA 1Y4CA 4ZEIA 1XHYA 1QJMA 1MXWA 3D1RA 4XXUA 4PFWA 4OFOA 3DELB 4M1VA 3UA8A 4JBZA 3N5LA 3E3KA 2H9BA 2O69A 2B3FA 5F1QA 4WXJA 4F3GA 4GWOA 2QS2A 2A5SA 2HFBA 1SI0A 3M8UA 4MHFA 1H3DA 2R8TA 2DE4A 4O3CA 2OX3A 4MH5A 5JTYA 2O6AA 4K3FA 1FBHA 1NUYA 4GD5A 3TFLA 4RNSA 2F3DA 1WDNA 2D3IA 4ECFA 1NV4A 3UK4A 2FHYA 2Y7KA 5I2NA 3O97A 5EQ8A 3FJ7A 3T9XB 3K1MA 5KCJB 3IB0A 1IMFA 5HM4B 2F35A 3RPLB 4LA9A 3UORA 4GX4A 2DE3A 2XWOA 1RDZA 5TP9A 3N26A 3W9VA 2QS4A 3TELA 4U1ZA 4N81A 2WX9A 4MAGA 3R26A 3MP8A 2ZXTA 3E9XA 4EQ7A 3FXUA 1B5JA 3RUMA 2UVJA 2XXQA 2GH9A 4XEQA 4G4PA 1B3GA 5CC2A 5FHNA 1MPBA 4MCOA 1TXFA 2B4MA 3TTKA 1MXXA 2A5TB 2XHDA 4R9GA 3PD9A 1IMCA 1KA0A 5L9OA 1SQYA 4MEVA 4U4XA 2CZHA 3N6TA 2Y84A 4GWSA 3O29A 3C33A 4BDLA 2O7UA 2Q8MA 1USYH 1DCUA 3THIA 2F7BA 4OVSA 2QVRA 2Y5KA 3IOVA 3SEYA 2H98A 1IZ1A 1B3HA 3OO6A 3UGWA 2F6PA 1FCKA 3FATA 1A54A 1Z7NE 2QJEA 2A5TA 3MPKA 1MM6A 2QL3A 1XS5A 4OETA 2XX9A 4JXIA 1HSLA 4O7IA 5ELVA 3TEPA 2OBGA 2ALUA 3A29A 3EHUA 3WAFA 1LBXA 1R9LA 4BLAA 1KWHA 1XT8A 3PUXE 4YKIA 3T96B 4GLIA 1POTA 4QFPA 4RY1A 1VFEA 1MY2A 4Q0CA 3VV5A 2XXXA 1BIYA 2P3NA 3C9HA 2L5VA 3KC1A 2F36A 1LFHA 3PMXA 1FBGA 1BK4A 1AIVA 1NNTA 3TTRA 2H99A 3FJGA 4TOZA 4R2FA 1LBVA 3SESA 4KR5A 2YPNA 1QKAA 4F39A 4JWYA 1FQDA 2G93A 3RGYA 4R2BA 3FGSA 1IITA 1QVSA 5AA3A 2PVUA 2NWJA 2P0SA 4KYSA 2DQVA 4OWDA 1Y1MA 2BJJX 4PC9A 3K02A 4FE8A 4EUOA 3FBPA 4IO4A 1B40A 3ILUB 4XKQA 2V3QA 2XXKA 1MY1A 4LONB 4NF6B 5IKBA 5A5LA 3KFMA 5LOMA 1IEJA 3TQLA 4HXVA 1LAXA 4PETA 2XXRA 3KBRA 1MQDA 4MLVA 3MVYA 2QS3A 3VFJA 1FW0A 4LATA 5EHSA 5I2KB 4NWCA 1XOCA 1JW5A 5AA4B
chains in the Genus database with same CATH topology
2Q2AA 3HSTA 2QSXA 3G3IA 5H8HB 1Y20A 3PUYE 1NFTA 2ZYKA 1B5HA 2V84A 3IB1A 1PC3A 3IOWA 4NF4B 2DSFA 5EYFA 5KZTA 2OJTA 3C31A 3QIMA 2F5XA 2OZZA 4QFOA 3TDJA 3V89B 5BUUA 2Z22A 5I59A 2H25A 4G8NA 4N13A 2Z23A 1S9TA 2RCAA 4OFJA 3QXMA 4TQUQ 4EXLA 1B0HA 2I4BA 4QFKA 3QUFA 2RCBA 3A09A 2NUVA 1LB9A 2UVHA 4IY6A 2ZYMA 3MBPA 2UVIA 4MBPA 4ZS9A 5AE4A 3OO8A 1UTHA 2LAOA 3B6WA 3O6GA 2VOZA 1LAFE 4O3AA 5CMCA 1HSEA 3MQ9A 5DVJA 2Q88A 3MWBA 1MXUA 5CMBA 4PP0A 3FIRA 1FTMA 4AB6A 5DTBA 4QRZA 4H67A 3C35A 3CR9A 3I3VA 4H5GA 1FQEA 3VVFA 3IK6B 2IEEA 4LZ5A 1B7HA 2I3VA 4ZZEA 3C32A 1SW4A 2REGA 3N6UA 1DTGA 3HN0A 4BDNA 3EF7A 1MXZA 2DVCA 3HV1A 2XX7A 1H76A 3KJTA 3PU5A 4YICA 4PFYA 1IXIA 4C1TA 4KHZE 3TPAA 3USDA 4F19A 3VLVA 5H8NB 5I56A 4KD5A 2X7QA 1AMFA 3SEVA 5I58A 2DWIA 3Q26A 1D9YA 3CIJA 3O9PA 4G2ZA 3MZ9A 5M2VA 2I58A 4FIMA 2CZLA 4H6DA 3PUVE 1A7LA 4KPTA 4U2RA 5HBCA 3RTWB 4DCYA 3LSWA 4DXBA 3VLUA 4R72A 3SDFA 3QSLA 2DOJA 1MDQA 3E13X 1FTOA 4POXA 4UA8A 1US5A 3KN7A 3MAMA 3MP6A 4ELRA 3U92A 1LCTA 3KEIA 3FXQA 4QSCA 5DVFA 1A55A 4ZE8A 3W15C 2DE2A 5DEXB 1ELJA 1TWYA 1J1NA 1NNPA 1YAEA 3CRBA 3FVGA 1QULA 2NVUB 1DTZA 4F3PA 4XIGQ 4Z7EA 1OLCA 2DWHA 4ELPA 3GXAA 1JW4A 4YKPA 4AB5A 1OVTA 3F11A 4IY5A 3TQWA 3PV0E 1VFDA 3MW0A 1PB8A 1N0TA 1B1XA 4WEPA 5H8FA 4NF4A 2VD2A 4H0WA 3EPEA 1JVYA 1WVJA 2OWSA 2RF1A 4BDRA 3U1OA 2XXHA 2YLNA 4WXJA 3Q28A 5L9SA 2R71A 3H7MA 2Y7RA 3FVOA 5F7VA 4ZZAA 4EDPA 3EHTA 3TZAA 2DXYA 3QUJA 3JYRA 1TFDA 2HAUA 1B6HA 4JB7A 1UTBA 4O3BA 4PFTA 3OO9A 4LUBA 2RINA 2V25A 1VR5A 1MM7A 2AL4A 5H8NA 2Q89A 1AOVA 3R6UA 2AL5A 1MDP1 4YKJA 5FTHA 3GZGA 2QRYA 1AL3A 5I57A 1B05A 4GFRA 5I58B 4LZ8A 4X48A 3B6TA 4TLLB 3V5AA 3CSBA 1SBPA 1I6AA 3FZVA 4GVOA 1LAHE 2RKMA 3QK6A 1NMUA 1MY0A 5DEXA 1N3XA 3O6IA 3GLBA 3OEMA 3Q27A 2D5WA 3U94A 4THIA 3T9HB 1EU8A 2DXRA 3PPPA 3D4CA 3HHGA 3KG2A 3MUQA 5K2XA 3O6HA 1MY4A 1MXYA 4ESWA 1B0LA 4OERA 3SEXA 2W7YA 3TODA 4N07A 1OVBA 5AA2D 1TT1A 1B5IA 4RPNA 3C36A 3TKDA 4EF2A 3IL1B 1FTKA 5CMMA 2Z8EA 2GFEA 4WKMA 3OO7A 3K0VA 1LB8A 4LQ2A 3MJNA 1A8FA 3V83A 4RA1A 3TTMA 4HCWA 4MF3A 3VXBA 2ESNA 4F1YA 2ZNUA 1MQJA 4IB2A 3A3CA 4U21A 3S9LC 5A5XA 4FORA 5HPQA 2V3UA 4JWOA 5CBSA 1GTKA 2GHAA 4KQPA 4R74A 1R1NA 2O68A 5H8QB 2I0BA 4OYVA 2UVGA 1IXHA 3PPNA 5DT6A 3RLFE 3JV9A 2XX8A 4ZEFA 4PE5B 2XXPA 2O7IA 3CFZA 1D3KA 1BP5A 1A40A 1N84A 1QUKA 1B3LA 2R9JA 1MPDA 3DP8A 3ZS6A 5IAIA 1PB9A 1JW1A 3L6GA 4GF8A 3H3GA 1P1OA 4MLQA 3M3FA 3OENA 5H8FB 4YMAA 4C0RA 4KI0E 3IJOB 3KSXA 1EH3A 5JTYB 3VVDA 4DLDA 1LBCA 5CBRA 5I57B 3VDFA 4ZE9A 3VE1B 4MFIA 3OSRA 1JEUA 4IGRA 4OVJA 4EQBA 4YMBA 4JSDA 3S9MC 4HCYA 3KOSA 3EN3A 3CVGA 2QPQA 4GXSB 3RPWA 3BFUA 2CMOA 2OCUA 4LVQA 2G29A 1ZU0A 3O2AA 3FVNA 2HCAA 1UTBB 1JEVA 1PBQA 1DSNA 1FTLA 2O84X 5H8HA 3SEWA 3CG1A 2ZNSA 4XKPA 3N94A 5CI5A 1PEBA 3ZKKA 4ELQA 4H1XA 4NWDA 2ONRA 1Z7ME 2I49A 2ZYOA 1P1QA 4FECA 4GL0A 4L17A 4LP2B 3K1PA 3W9WA 3LUYA 3CSGA 4OMBA 4E0XA 5AA4A 3RT6B 2HEUA 3IO6A 1IXGA 1USYE 4H8IA 2FNCA 4F3SA 4AQ4A 5DVIA 3IOTA 3U72A 4EQ9A 2I6EA 4G8MA 4LZ7A 5I2NB 3LSLA 1EZ9A 4OTEA 1Y4CA 4ZEIA 3DP6A 4KYEA 1Y3QA 1XHYA 4GL8A 2UYEA 3FVKA 4I8CA 1QJMA 3H06B 4ZEKA 2THIA 2YJPA 1AH5A 1MXWA 2HAVA 3PPQA 1N76A 4XXUA 1IXCA 2D21A 4OFOA 4PFWA 1MH4A 5J1DA 4YB7A 2F6GA 1QUIA 4H65A 2Q2CA 3DELB 2XXWA 3LR1A 3IO4A 4M1VA 3UA8A 2UXAA 3N5LA 3E3KA 3ILTB 2H9BA 1ZTYA 2O69A 4JBZA 3O28A 2HQ0A 2B3FA 1MXVA 1ATGA 2DWJA 1IUDA 1OIBA 1RYXA 3OMBA 1UIVA 2DVZA 4GWOA 1IQ7A 1FQAA 2QMWA 2QS2A 2PYYA 3VXCA 4F3GA 4NF8B 3RQTA 4YU0A 3OOAA 4GOTA 4NF5B 3S2VA 1O64A 1QW0A 2A5SA 2OLBA 4HTGA 4EXKA 2HFBA 4G68B 1SI0A 1B4ZA 3HO7A 3M8UA 3KSJA 1H3DA 2DE4A 1P1UA 4ZEDA 2O1LA 1F9BA 3G3HA 4O3CA 3RNNA 1LGBC 3M3KA 3VVEA 1LAGE 1ZBMA 3PPOA 5KDTA 5JTYA 4MH5A 2O6AA 3T9UA 2RC9A 1FQBA 1FQCA 1JQFA 4K3FA 3OEKA 4BDOA 3B7DA 4GD5A 3PPRA 3MVWA 3TFLA 1PB7A 1WODA 4RNSA 5TP9B 1POY1 2Z8DA 4DXUA 1A8EA 4IO6A 3G3KA 1WDNA 3M3LA 3CG3A 2PT1A 4Q5TA 3WAEA 1LFIA 5JEIA 4HW8A 3FV1A 1M5FA 4JDFA 4G77A 2D3IA 2H5YA 1LSTA 2Y7PA 1UIUA 2V93A 3MC2A 4NEDA 2XD3A 4G68C 2Q8JA 4DIGA 2DP8A 3KOTA 4ECFA 5I56B 1II5A 1LCFA 1SD3A 4YKKA 4XTCQ 4ZDMA 3UIFA 3U8QA 1N04A 3UK4A 4FATA 2Y7KA 1LFGA 1BKAA 1ZLQA 1VE4A 5ISUA 4IO7A 1SYIA 4H5FA 2IA4A 3MZ1A 5I2NA 3Q29A 3O97A 2Y7WA 3GBAA 1YCJA 3RTFB 1NNFA 3TCGA 4ESXA 3IORA 4YB6A 2REJA 3FJ7A 2DYXA 1US4A 1P1NA 3CI8A 4NF5A 5KDTB 3LSFB 3K1MA 4R6HA 4XKRA 4I62A 3T9XB 1NH7A 3CFXA 3FJMA 3QYTA 5KCJB 3IB0A 3IR1A 4FEDA 5F1QA 3O66A 3UP9A 2ONSA 2XXYA 2FA7A 4ZECA 5HM4B 2F35A 4LA9A 3UORA 3DLNA 3PUZE 1DPPA 3T22A 3TYHA 1NNKA 2NOOA 2DE3A 4RYAA 5TPAA 1QUJA 2QS1A 1M5CA 1N3WA 4F29A 2I0CA 1A99A 3MVXA 1ZMGA 5TP9A 1B7UA 1MS7A 3N26A 4I9DA 1B7ZA 3IOUA 3W9VA 5FHMA 2QS4A 2X7PA 3PUWE 4M4GA 5AA2B 2ZMBA 3SKPA 3TELA 5ITPA 4U1ZA 3HHFA 1EZPA 5K2YA 3G3GA 2RC8A 1XVYA 1P99A 3FASA 3LBSA 4OXVA 3V8XB 3R26A 2XXVA 3MP8A 3TTLA 3K6WA 3CFLA 2ZXTA 3OSQA 4NF6A 4YZZA 2ANJA 3E9XA 3TAJA 4EQ7A 1NH8A 3FXUA 5EHMA 5H8QA 1B5JA 1OLAA 3E4RA 3RUMA 1JVXA 1PBPA 3KJ7A 2UVJA 2XXQA 3S9EA 4ND9A 2PBWA 4F22A 2GH9A 3BFTA 4G4PA 1B3GA 3RY3A 3RT8A 3T66A 5CC2A 4U22A 4YAHX 2HZKA 3GBBA 5FHNA 1MPBA 3FUZA 2XXUA 4LQ5A 1TXFA 1LLSA 3H03A 3A3UA 4QFLA 3TMGA 1O63A 4IO3A 1Q35A 5TPAB 3EHSA 4I1DA 1UQWA 3MP1A 4R6YA 1Y9UA 4GQOA 4R9FA 5KCJA 3PD8A 1Y1ZA 3AXFA 3TTKA 4BDMA 1MXXA 2A5TB 2XHDA 4KFQA 3PD9A 4R9GA 1L5TA 4OEUA 2VD3A 2UYFA 5L9OA 1SQYA 4U4XA 4RK2A 3N6TA 3B6QA 2NXOA 3OELA 5CRYA 4C1UA 2Y84A 3PGFA 3Q25A 3JZJA 3K01A 2AIXA 3O29A 3C33A 4P11A 4BDLA 1MY3A 1SW1A 2O7UA 2AYSA 2ONKE 1HSJA 1USYH 2Z8FA 1H44A 4GRKA 3T93B 3MVZA 3THIA 5JK4A 1MG1A 2F7BA 2OWTA 3KN8A 1B32A 2B3BA 4ONYA 3ECRA 4DDDA 4ELOA 4IO2A 1Y3PA 4FAJA 4DE8A 3LSXA 4ZEBA 2F8DA 4E0WA 2HZLA 3TUSA 1ZKBA 1I6BA 3IOVA 3SEYA 1URSA 1IZ1A 2H98A 1B3HA 4Q8RA 3OO6A 1GR2A 1S7YA 1LBBA 4JWXA 3ZSFA 4R75A 2X26A 2PT2A 3UGWA 3PMWA 3FXRA 2F34A 1R9QA 1H45A 2F6PA 1FCKA 1NL5A 5AA2A 3FATA 1VSOA 3H6TA 3C4MA 4RXLA 1A54A 1Z7NE 4F2QA 2QJEA 2A5TA 2OK2A 3SERA 4F1UA 3K6XA 3MPKA 4IGTA 5ICTA 1MM6A 2QL3A 1T0KA 1DOTA 1MQIA 1XS5A 4OETA 5AA1A 2F78A 2Q9TA 3D4GA 4OZ9A 2XX9A 4JXIA 4F31B 3I6VA 4NF8A 3OXNA 1HSLA 1SW2A 3HCQA 1B3FA 1B2HA 5ELVA 2I48A 1Y4TA 1M5EA 3TEPA 2OBGA 2ALUA 1QKBA 1B46A 3EHUA 2XD2A 4G68A 4HS7A 4NMYA 4OHNA 1BLFA 4P0GA 4R73A 4IO5A 4XKNA 1I6QA 2R6GE 4ISUA 4U1OA 3KZGA 1R9LA 3ZKLA 2H4IA 3MZBA 2ZYNA 4X9TA 2DS9A 3C34A 3SETA 1M5DA 1B3EA 1RKMA 3LC8A 4BLAA 3G7WA 1CE2A 1B9JA 1KWHA 1XT8A 2I3WA 4FEBA 3PUXE 4R6KA 4YKIA 3T96B 1ZJLA 3S4UA 4GLIA 1OMPA 1CB6A 1POTA 3H6WA 4QFPA 4RY1A 3IAZA 1VFEA 4UACA 1MY2A 4Q0CA 4X1BA 3BBRA 3FV2A 3VV5A 1MQGA 1BIYA 2XXXA 4OENA 3C9HA 1OQGA 3MPLA 1MPCA 4JSOA 3RN8A 5DYHA 5L8DA 1Q1KA 5B70A 3U93A 4X1DA 2F36A 2M8CA 2WKYA 1LFHA 3PMXA 4KCCA 1AIVA 4FJPA 1NNTA 3TTRA 2H99A 2I4CA 3FJGA 4N6PA 4PQJA 4TOZA 4OQOA 3HPIA 1ZIUA 1B51A 4OESA 4R2FA 4NE4A 3SESA 4KR5A 4DCXA 1N7WA 1NKXA 2F97A 5CMKA 2V3TA 3H6VA 3ODBA 2ABHA 2YPNA 5I2KA 4BDQA 2E1SA 1QKAA 2F7CA 3QAXA 4G8HA 4GXAA 1SI1A 1FQDA 2E0SA 1M5BA 3ONMA 2G93A 4H8JA 4JWYA 4QHQA 1JETA 5ITOA 4F1VA 3RGYA 2HXWA 1URGA 3KN3A 2XXTA 2VGQA 4R2BA 3TTNA 4DZ1A 5H8SA 4F3BA 3FGSA 4F39A 1XC1A 1FQFA 4PFUA 1R6ZA 2F7AA 1IITA 4RPOA 5I84A 2RC7A 1D4NA 1Y3NA 1QVSA 1YPNA 5CM6A 3L6HA 4RK9A 4EF1A 5AA3A 5TU0A 2PVUA 2NWJA 1N7XA 3K1NA 3K6VA 1TFAA 2P0SA 4KYSA 1P1WA 1H43A 3OD7A 3TCFA 3G3FA 3K4UA 2QMXA 1GGGA 2DQVA 1MH3A 1D9VA 2P1SA 3H4ZA 3I5OA 4OFLA 4OWDA 5L9MA 1B58A 1Y1MA 3R7XA 3S9NC 2BJJX 3K02A 3BKIB 4FE8A 1SYHA 4QF9A 4EUOA 1YTVA 1GVCA 4IO4A 4P0IA 1FTJA 1B40A 4GIZA 3G3JA 4U4SA 1JNFA 3ILUB 5I59B 2GRVA 1RYOA 3WAFA 1MRPA 4XKQA 2V3QA 3SEUA 4RJZA 2FYIA 2PMSA 1MY1A 2XXIA 3VLWA 4LONB 1I69A 4NF6B 4F2OA 5IKBA 4OEVA 1SDXA 4TLMB 1OQHA 4KCDA 1UTHB 3K00A 2VHAA 3K6UA 5A5XB 3P7IA 1URDA 5FTIA 5ICQA 2KLFA 3H6UA 1IIWA 2VP1A 1PDAA 2P2AA 3IJXB 3KFMA 4QSDA 3IX1A 4QFNA 4QSEA 1ANFA 3K2DA 5LOMA 2DWAA 1IEJA 3DM0A 3PMVA 5B7DA 5FHOA 2GHBA 1SW5A 3TQLA 1LAXA 2ZNTA 1BTJA 2XXRA 4PETA 3UN6A 1EZOA 3T9VA 4DXCA 3KBRA 1B4HA 1MQDA 1O7TA 2O51A 3DP4A 2B65A 1B52A 4WEDA 2PX1A 4KYDA 4MLVA 3KGCA 4NTLA 3MVYA 3EQ1A 4Z0IA 2QS3A 1DPEA 5BWJA 4Q30B 3IB2A 1GV8A 1FW0A 3VFJA 1DMBA 1SVXB 2Y7IA 4LATA 4U23A 4YB5A 5EHSA 5AA4B 1S50A 4NWCA 5I2KB 1XOCA 3TCHA 1MQHA 4F18A 1JW5A 4POWA 3FD3A 2O1MA 1B1HA 1XVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2A A;  3HST A;  2QSX A;  3G3I A;  5H8H B;  1Y20 A;  3PUY E;  1NFT A;  2ZYK A;  1B5H A;  2V84 A;  3IB1 A;  1PC3 A;  3IOW A;  4NF4 B;  2DSF A;  5EYF A;  5KZT A;  2OJT A;  3C31 A;  3QIM A;  2F5X A;  2OZZ A;  4QFO A;  3TDJ A;  3V89 B;  5BUU A;  2Z22 A;  5I59 A;  2H25 A;  4G8N A;  4N13 A;  2Z23 A;  1S9T A;  2RCA A;  4OFJ A;  3QXM A;  4TQU Q;  4EXL A;  1B0H A;  2I4B A;  4QFK A;  3QUF A;  2RCB A;  3A09 A;  2NUV A;  1LB9 A;  2UVH A;  4IY6 A;  2ZYM A;  3MBP A;  2UVI A;  4MBP A;  4ZS9 A;  5AE4 A;  3OO8 A;  1UTH A;  2LAO A;  3B6W A;  3O6G A;  2VOZ A;  1LAF E;  4O3A A;  5CMC A;  1HSE A;  3MQ9 A;  5DVJ A;  2Q88 A;  3MWB A;  1MXU A;  5CMB A;  4PP0 A;  3FIR A;  1FTM A;  4AB6 A;  5DTB A;  4QRZ A;  4H67 A;  3C35 A;  3CR9 A;  3I3V A;  4H5G A;  1FQE A;  3VVF A;  3IK6 B;  2IEE A;  4LZ5 A;  1B7H A;  2I3V A;  4ZZE A;  3C32 A;  1SW4 A;  2REG A;  3N6U A;  1DTG A;  3HN0 A;  4BDN A;  3EF7 A;  1MXZ A;  2DVC A;  3HV1 A;  2XX7 A;  1H76 A;  3KJT A;  3PU5 A;  4YIC A;  4PFY A;  1IXI A;  4C1T A;  4KHZ E;  3TPA A;  3USD A;  4F19 A;  3VLV A;  5H8N B;  5I56 A;  4KD5 A;  2X7Q A;  1AMF A;  3SEV A;  5I58 A;  2DWI A;  3Q26 A;  1D9Y A;  3CIJ A;  3O9P A;  4G2Z A;  3MZ9 A;  5M2V A;  2I58 A;  4FIM A;  2CZL A;  4H6D A;  3PUV E;  1A7L A;  4KPT A;  4U2R A;  5HBC A;  3RTW B;  4DCY A;  3LSW A;  4DXB A;  3VLU A;  4R72 A;  3SDF A;  3QSL A;  2DOJ A;  1MDQ A;  3E13 X;  1FTO A;  4POX A;  4UA8 A;  1US5 A;  3KN7 A;  3MAM A;  3MP6 A;  4ELR A;  3U92 A;  1LCT A;  3KEI A;  3FXQ A;  4QSC A;  5DVF A;  1A55 A;  4ZE8 A;  3W15 C;  2DE2 A;  5DEX B;  1ELJ A;  1TWY A;  1J1N A;  1NNP A;  1YAE A;  3CRB A;  3FVG A;  1QUL A;  2NVU B;  1DTZ A;  4F3P A;  4XIG Q;  4Z7E A;  1OLC A;  2DWH A;  4ELP A;  3GXA A;  1JW4 A;  4YKP A;  4AB5 A;  1OVT A;  3F11 A;  4IY5 A;  3TQW A;  3PV0 E;  1VFD A;  3MW0 A;  1PB8 A;  1N0T A;  1B1X A;  4WEP A;  5H8F A;  4NF4 A;  2VD2 A;  4H0W A;  3EPE A;  1JVY A;  1WVJ A;  2OWS A;  2RF1 A;  4BDR A;  3U1O A;  2XXH A;  2YLN A;  4WXJ A;  3Q28 A;  5L9S A;  2R71 A;  3H7M A;  2Y7R A;  3FVO A;  5F7V A;  4ZZA A;  4EDP A;  3EHT A;  3TZA A;  2DXY A;  3QUJ A;  3JYR A;  1TFD A;  2HAU A;  1B6H A;  4JB7 A;  1UTB A;  4O3B A;  4PFT A;  3OO9 A;  4LUB A;  2RIN A;  2V25 A;  1VR5 A;  1MM7 A;  2AL4 A;  5H8N A;  2Q89 A;  1AOV A;  3R6U A;  2AL5 A;  1MDP 1;  4YKJ A;  5FTH A;  3GZG A;  2QRY A;  1AL3 A;  5I57 A;  1B05 A;  4GFR A;  5I58 B;  4LZ8 A;  4X48 A;  3B6T A;  4TLL B;  3V5A A;  3CSB A;  1SBP A;  1I6A A;  3FZV A;  4GVO A;  1LAH E;  2RKM A;  3QK6 A;  1NMU A;  1MY0 A;  5DEX A;  1N3X A;  3O6I A;  3GLB A;  3OEM A;  3Q27 A;  2D5W A;  3U94 A;  4THI A;  3T9H B;  1EU8 A;  2DXR A;  3PPP A;  3D4C A;  3HHG A;  3KG2 A;  3MUQ A;  5K2X A;  3O6H A;  1MY4 A;  1MXY A;  4ESW A;  1B0L A;  4OER A;  3SEX A;  2W7Y A;  3TOD A;  4N07 A;  1OVB A;  5AA2 D;  1TT1 A;  1B5I A;  4RPN A;  3C36 A;  3TKD A;  4EF2 A;  3IL1 B;  1FTK A;  5CMM A;  2Z8E A;  2GFE A;  4WKM A;  3OO7 A;  3K0V A;  1LB8 A;  4LQ2 A;  3MJN A;  1A8F A;  3V83 A;  4RA1 A;  3TTM A;  4HCW A;  4MF3 A;  3VXB A;  2ESN A;  4F1Y A;  2ZNU A;  1MQJ A;  4IB2 A;  3A3C A;  4U21 A;  3S9L C;  5A5X A;  4FOR A;  5HPQ A;  2V3U A;  4JWO A;  5CBS A;  1GTK A;  2GHA A;  4KQP A;  4R74 A;  1R1N A;  2O68 A;  5H8Q B;  2I0B A;  4OYV A;  2UVG A;  1IXH A;  3PPN A;  5DT6 A;  3RLF E;  3JV9 A;  2XX8 A;  4ZEF A;  4PE5 B;  2XXP A;  2O7I A;  3CFZ A;  1D3K A;  1BP5 A;  1A40 A;  1N84 A;  1QUK A;  1B3L A;  2R9J A;  1MPD A;  3DP8 A;  3ZS6 A;  5IAI A;  1PB9 A;  1JW1 A;  3L6G A;  4GF8 A;  3H3G A;  1P1O A;  4MLQ A;  3M3F A;  3OEN A;  5H8F B;  4YMA A;  4C0R A;  4KI0 E;  3IJO B;  3KSX A;  1EH3 A;  5JTY B;  3VVD A;  4DLD A;  1LBC A;  5CBR A;  5I57 B;  3VDF A;  4ZE9 A;  3VE1 B;  4MFI A;  3OSR A;  1JEU A;  4IGR A;  4OVJ A;  4EQB A;  4YMB A;  4JSD A;  3S9M C;  4HCY A;  3KOS A;  3EN3 A;  3CVG A;  2QPQ A;  4GXS B;  3RPW A;  3BFU A;  2CMO A;  2OCU A;  4LVQ A;  2G29 A;  1ZU0 A;  3O2A A;  3FVN A;  2HCA A;  1UTB B;  1JEV A;  1PBQ A;  1DSN A;  1FTL A;  2O84 X;  5H8H A;  3SEW A;  3CG1 A;  2ZNS A;  4XKP A;  3N94 A;  5CI5 A;  1PEB A;  3ZKK A;  4ELQ A;  4H1X A;  4NWD A;  2ONR A;  1Z7M E;  2I49 A;  2ZYO A;  1P1Q A;  4FEC A;  4GL0 A;  4L17 A;  4LP2 B;  3K1P A;  3W9W A;  3LUY A;  3CSG A;  4OMB A;  4E0X A;  5AA4 A;  3RT6 B;  2HEU A;  3IO6 A;  1IXG A;  1USY E;  4H8I A;  2FNC A;  4F3S A;  4AQ4 A;  5DVI A;  3IOT A;  3U72 A;  4EQ9 A;  2I6E A;  4G8M A;  4LZ7 A;  5I2N B;  3LSL A;  1EZ9 A;  4OTE A;  1Y4C A;  4ZEI A;  3DP6 A;  4KYE A;  1Y3Q A;  1XHY A;  4GL8 A;  2UYE A;  3FVK A;  4I8C A;  1QJM A;  3H06 B;  4ZEK A;  2THI A;  2YJP A;  1AH5 A;  1MXW A;  2HAV A;  3PPQ A;  1N76 A;  4XXU A;  1IXC A;  2D21 A;  4OFO A;  4PFW A;  1MH4 A;  5J1D A;  4YB7 A;  2F6G A;  1QUI A;  4H65 A;  2Q2C A;  3DEL B;  2XXW A;  3LR1 A;  3IO4 A;  4M1V A;  3UA8 A;  2UXA A;  3N5L A;  3E3K A;  3ILT B;  2H9B A;  1ZTY A;  2O69 A;  4JBZ A;  3O28 A;  2HQ0 A;  2B3F A;  1MXV A;  1ATG A;  2DWJ A;  1IUD A;  1OIB A;  1RYX A;  3OMB A;  1UIV A;  2DVZ A;  4GWO A;  1IQ7 A;  1FQA A;  2QMW A;  2QS2 A;  2PYY A;  3VXC A;  4F3G A;  4NF8 B;  3RQT A;  4YU0 A;  3OOA A;  4GOT A;  4NF5 B;  3S2V A;  1O64 A;  1QW0 A;  2A5S A;  2OLB A;  4HTG A;  4EXK A;  2HFB A;  4G68 B;  1SI0 A;  1B4Z A;  3HO7 A;  3M8U A;  3KSJ A;  1H3D A;  2DE4 A;  1P1U A;  4ZED A;  2O1L A;  1F9B A;  3G3H A;  4O3C A;  3RNN A;  1LGB C;  3M3K A;  3VVE A;  1LAG E;  1ZBM A;  3PPO A;  5KDT A;  5JTY A;  4MH5 A;  2O6A A;  3T9U A;  2RC9 A;  1FQB A;  1FQC A;  1JQF A;  4K3F A;  3OEK A;  4BDO A;  3B7D A;  4GD5 A;  3PPR A;  3MVW A;  3TFL A;  1PB7 A;  1WOD A;  4RNS A;  5TP9 B;  1POY 1;  2Z8D A;  4DXU A;  1A8E A;  4IO6 A;  3G3K A;  1WDN A;  3M3L A;  3CG3 A;  2PT1 A;  4Q5T A;  3WAE A;  1LFI A;  5JEI A;  4HW8 A;  3FV1 A;  1M5F A;  4JDF A;  4G77 A;  2D3I A;  2H5Y A;  1LST A;  2Y7P A;  1UIU A;  2V93 A;  3MC2 A;  4NED A;  2XD3 A;  4G68 C;  2Q8J A;  4DIG A;  2DP8 A;  3KOT A;  4ECF A;  5I56 B;  1II5 A;  1LCF A;  1SD3 A;  4YKK A;  4XTC Q;  4ZDM A;  3UIF A;  3U8Q A;  1N04 A;  3UK4 A;  4FAT A;  2Y7K A;  1LFG A;  1BKA A;  1ZLQ A;  1VE4 A;  5ISU A;  4IO7 A;  1SYI A;  4H5F A;  2IA4 A;  3MZ1 A;  5I2N A;  3Q29 A;  3O97 A;  2Y7W A;  3GBA A;  1YCJ A;  3RTF B;  1NNF A;  3TCG A;  4ESX A;  3IOR A;  4YB6 A;  2REJ A;  3FJ7 A;  2DYX A;  1US4 A;  1P1N A;  3CI8 A;  4NF5 A;  5KDT B;  3LSF B;  3K1M A;  4R6H A;  4XKR A;  4I62 A;  3T9X B;  1NH7 A;  3CFX A;  3FJM A;  3QYT A;  5KCJ B;  3IB0 A;  3IR1 A;  4FED A;  5F1Q A;  3O66 A;  3UP9 A;  2ONS A;  2XXY A;  2FA7 A;  4ZEC A;  5HM4 B;  2F35 A;  4LA9 A;  3UOR A;  3DLN A;  3PUZ E;  1DPP A;  3T22 A;  3TYH A;  1NNK A;  2NOO A;  2DE3 A;  4RYA A;  5TPA A;  1QUJ A;  2QS1 A;  1M5C A;  1N3W A;  4F29 A;  2I0C A;  1A99 A;  3MVX A;  1ZMG A;  5TP9 A;  1B7U A;  1MS7 A;  3N26 A;  4I9D A;  1B7Z A;  3IOU A;  3W9V A;  5FHM A;  2QS4 A;  2X7P A;  3PUW E;  4M4G A;  5AA2 B;  2ZMB A;  3SKP A;  3TEL A;  5ITP A;  4U1Z A;  3HHF A;  1EZP A;  5K2Y A;  3G3G A;  2RC8 A;  1XVY A;  1P99 A;  3FAS A;  3LBS A;  4OXV A;  3V8X B;  3R26 A;  2XXV A;  3MP8 A;  3TTL A;  3K6W A;  3CFL A;  2ZXT A;  3OSQ A;  4NF6 A;  4YZZ A;  2ANJ A;  3E9X A;  3TAJ A;  4EQ7 A;  1NH8 A;  3FXU A;  5EHM A;  5H8Q A;  1B5J A;  1OLA A;  3E4R A;  3RUM A;  1JVX A;  1PBP A;  3KJ7 A;  2UVJ A;  2XXQ A;  3S9E A;  4ND9 A;  2PBW A;  4F22 A;  2GH9 A;  3BFT A;  4G4P A;  1B3G A;  3RY3 A;  3RT8 A;  3T66 A;  5CC2 A;  4U22 A;  4YAH X;  2HZK A;  3GBB A;  5FHN A;  1MPB A;  3FUZ A;  2XXU A;  4LQ5 A;  1TXF A;  1LLS A;  3H03 A;  3A3U A;  4QFL A;  3TMG A;  1O63 A;  4IO3 A;  1Q35 A;  5TPA B;  3EHS A;  4I1D A;  1UQW A;  3MP1 A;  4R6Y A;  1Y9U A;  4GQO A;  4R9F A;  5KCJ A;  3PD8 A;  1Y1Z A;  3AXF A;  3TTK A;  4BDM A;  1MXX A;  2A5T B;  2XHD A;  4KFQ A;  3PD9 A;  4R9G A;  1L5T A;  4OEU A;  2VD3 A;  2UYF A;  5L9O A;  1SQY A;  4U4X A;  4RK2 A;  3N6T A;  3B6Q A;  2NXO A;  3OEL A;  5CRY A;  4C1U A;  2Y84 A;  3PGF A;  3Q25 A;  3JZJ A;  3K01 A;  2AIX A;  3O29 A;  3C33 A;  4P11 A;  4BDL A;  1MY3 A;  1SW1 A;  2O7U A;  2AYS A;  2ONK E;  1HSJ A;  1USY H;  2Z8F A;  1H44 A;  4GRK A;  3T93 B;  3MVZ A;  3THI A;  5JK4 A;  1MG1 A;  2F7B A;  2OWT A;  3KN8 A;  1B32 A;  2B3B A;  4ONY A;  3ECR A;  4DDD A;  4ELO A;  4IO2 A;  1Y3P A;  4FAJ A;  4DE8 A;  3LSX A;  4ZEB A;  2F8D A;  4E0W A;  2HZL A;  3TUS A;  1ZKB A;  1I6B A;  3IOV A;  3SEY A;  1URS A;  1IZ1 A;  2H98 A;  1B3H A;  4Q8R A;  3OO6 A;  1GR2 A;  1S7Y A;  1LBB A;  4JWX A;  3ZSF A;  4R75 A;  2X26 A;  2PT2 A;  3UGW A;  3PMW A;  3FXR A;  2F34 A;  1R9Q A;  1H45 A;  2F6P A;  1FCK A;  1NL5 A;  5AA2 A;  3FAT A;  1VSO A;  3H6T A;  3C4M A;  4RXL A;  1A54 A;  1Z7N E;  4F2Q A;  2QJE A;  2A5T A;  2OK2 A;  3SER A;  4F1U A;  3K6X A;  3MPK A;  4IGT A;  5ICT A;  1MM6 A;  2QL3 A;  1T0K A;  1DOT A;  1MQI A;  1XS5 A;  4OET A;  5AA1 A;  2F78 A;  2Q9T A;  3D4G A;  4OZ9 A;  2XX9 A;  4JXI A;  4F31 B;  3I6V A;  4NF8 A;  3OXN A;  1HSL A;  1SW2 A;  3HCQ A;  1B3F A;  1B2H A;  5ELV A;  2I48 A;  1Y4T A;  1M5E A;  3TEP A;  2OBG A;  2ALU A;  1QKB A;  1B46 A;  3EHU A;  2XD2 A;  4G68 A;  4HS7 A;  4NMY A;  4OHN A;  1BLF A;  4P0G A;  4R73 A;  4IO5 A;  4XKN A;  1I6Q A;  2R6G E;  4ISU A;  4U1O A;  3KZG A;  1R9L A;  3ZKL A;  2H4I A;  3MZB A;  2ZYN A;  4X9T A;  2DS9 A;  3C34 A;  3SET A;  1M5D A;  1B3E A;  1RKM A;  3LC8 A;  4BLA A;  3G7W A;  1CE2 A;  1B9J A;  1KWH A;  1XT8 A;  2I3W A;  4FEB A;  3PUX E;  4R6K A;  4YKI A;  3T96 B;  1ZJL A;  3S4U A;  4GLI A;  1OMP A;  1CB6 A;  1POT A;  3H6W A;  4QFP A;  4RY1 A;  3IAZ A;  1VFE A;  4UAC A;  1MY2 A;  4Q0C A;  4X1B A;  3BBR A;  3FV2 A;  3VV5 A;  1MQG A;  1BIY A;  2XXX A;  4OEN A;  3C9H A;  1OQG A;  3MPL A;  1MPC A;  4JSO A;  3RN8 A;  5DYH A;  5L8D A;  1Q1K A;  5B70 A;  3U93 A;  4X1D A;  2F36 A;  2M8C A;  2WKY A;  1LFH A;  3PMX A;  4KCC A;  1AIV A;  4FJP A;  1NNT A;  3TTR A;  2H99 A;  2I4C A;  3FJG A;  4N6P A;  4PQJ A;  4TOZ A;  4OQO A;  3HPI A;  1ZIU A;  1B51 A;  4OES A;  4R2F A;  4NE4 A;  3SES A;  4KR5 A;  4DCX A;  1N7W A;  1NKX A;  2F97 A;  5CMK A;  2V3T A;  3H6V A;  3ODB A;  2ABH A;  2YPN A;  5I2K A;  4BDQ A;  2E1S A;  1QKA A;  2F7C A;  3QAX A;  4G8H A;  4GXA A;  1SI1 A;  1FQD A;  2E0S A;  1M5B A;  3ONM A;  2G93 A;  4H8J A;  4JWY A;  4QHQ A;  1JET A;  5ITO A;  4F1V A;  3RGY A;  2HXW A;  1URG A;  3KN3 A;  2XXT A;  2VGQ A;  4R2B A;  3TTN A;  4DZ1 A;  5H8S A;  4F3B A;  3FGS A;  4F39 A;  1XC1 A;  1FQF A;  4PFU A;  1R6Z A;  2F7A A;  1IIT A;  4RPO A;  5I84 A;  2RC7 A;  1D4N A;  1Y3N A;  1QVS A;  1YPN A;  5CM6 A;  3L6H A;  4RK9 A;  4EF1 A;  5AA3 A;  5TU0 A;  2PVU A;  2NWJ A;  1N7X A;  3K1N A;  3K6V A;  1TFA A;  2P0S A;  4KYS A;  1P1W A;  1H43 A;  3OD7 A;  3TCF A;  3G3F A;  3K4U A;  2QMX A;  1GGG A;  2DQV A;  1MH3 A;  1D9V A;  2P1S A;  3H4Z A;  3I5O A;  4OFL A;  4OWD A;  5L9M A;  1B58 A;  1Y1M A;  3R7X A;  3S9N C;  2BJJ X;  3K02 A;  3BKI B;  4FE8 A;  1SYH A;  4QF9 A;  4EUO A;  1YTV A;  1GVC A;  4IO4 A;  4P0I A;  1FTJ A;  1B40 A;  4GIZ A;  3G3J A;  4U4S A;  1JNF A;  3ILU B;  5I59 B;  2GRV A;  1RYO A;  3WAF A;  1MRP A;  4XKQ A;  2V3Q A;  3SEU A;  4RJZ A;  2FYI A;  2PMS A;  1MY1 A;  2XXI A;  3VLW A;  4LON B;  1I69 A;  4NF6 B;  4F2O A;  5IKB A;  4OEV A;  1SDX A;  4TLM B;  1OQH A;  4KCD A;  1UTH B;  3K00 A;  2VHA A;  3K6U A;  5A5X B;  3P7I A;  1URD A;  5FTI A;  5ICQ A;  2KLF A;  3H6U A;  1IIW A;  2VP1 A;  1PDA A;  2P2A A;  3IJX B;  3KFM A;  4QSD A;  3IX1 A;  4QFN A;  4QSE A;  1ANF A;  3K2D A;  5LOM A;  2DWA A;  1IEJ A;  3DM0 A;  3PMV A;  5B7D A;  5FHO A;  2GHB A;  1SW5 A;  3TQL A;  1LAX A;  2ZNT A;  1BTJ A;  2XXR A;  4PET A;  3UN6 A;  1EZO A;  3T9V A;  4DXC A;  3KBR A;  1B4H A;  1MQD A;  1O7T A;  2O51 A;  3DP4 A;  2B65 A;  1B52 A;  4WED A;  2PX1 A;  4KYD A;  4MLV A;  3KGC A;  4NTL A;  3MVY A;  3EQ1 A;  4Z0I A;  2QS3 A;  1DPE A;  5BWJ A;  4Q30 B;  3IB2 A;  1GV8 A;  1FW0 A;  3VFJ A;  1DMB A;  1SVX B;  2Y7I A;  4LAT A;  4U23 A;  4YB5 A;  5EHS A;  5AA4 B;  1S50 A;  4NWC A;  5I2K B;  1XOC A;  3TCH A;  1MQH A;  4F18 A;  1JW5 A;  4POW A;  3FD3 A;  2O1M A;  1B1H A;  1XVX A; 
#chains in the Genus database with same CATH topology
 3HST A;  2QSX A;  4NF4 B;  5EYF A;  3C31 A;  2Z22 A;  1FJ6 A;  4G8N A;  4OFJ A;  4TQU Q;  1D9Q A;  4GX3 A;  4MBP A;  1LB9 A;  1NUZ A;  1UTH A;  2VOZ A;  1HSE A;  3U65 A;  5CMB A;  4QRZ A;  3CR9 A;  1FPE A;  3PTY A;  4H5G A;  4LZ5 A;  1B7H A;  3C32 A;  3HN0 A;  1MXZ A;  3HV1 A;  4LN5 A;  5I7I A;  4KHZ E;  3LV0 A;  5I56 A;  4KD5 A;  4O7M A;  2DWI A;  3MZ9 A;  5HBC A;  1A7L A;  3LUZ A;  3QSL A;  3E13 X;  1FTO A;  4ELR A;  3KEI A;  4QSC A;  5DEX B;  1DTZ A;  4XIG Q;  1OVT A;  3F11 A;  4IY5 A;  3PV0 E;  1VFD A;  4WEP A;  1PB8 A;  4H0W A;  1WVJ A;  2RF1 A;  2XXH A;  2YLN A;  4PFR A;  3EHT A;  3JYR A;  1B6H A;  3OO9 A;  1VR5 A;  3R6U A;  2AL5 A;  4JVC A;  5I57 A;  2XWV A;  4X48 A;  4DI3 D;  2RKM A;  5DEX A;  1N3X A;  1FPD A;  2D5W A;  3U94 A;  3D4C A;  3KG2 A;  3MUQ A;  5EYH A;  2CEY A;  4ESW A;  3SEX A;  4N07 A;  1IME A;  2GFE A;  3OO7 A;  3K0V A;  1LB8 A;  4N17 A;  3MJN A;  1A8F A;  5LTC A;  3TTM A;  2ESN A;  4IB2 A;  1MQJ A;  4U21 A;  4P9K A;  5A5X A;  2V3U A;  4JWO A;  1SPI A;  2GHA A;  4R74 A;  2UVG A;  5DT6 A;  2XX8 A;  5IZZ A;  2XXP A;  1N84 A;  1K9Z A;  5IAI A;  1PB9 A;  1P1O A;  3M3F A;  3OEN A;  4DLD A;  1EH3 A;  3VVD A;  2QPQ A;  4I3E A;  3RPW A;  2CMO A;  2OCU A;  3FVN A;  1UTB B;  1JEV A;  1PBQ A;  5H8H A;  1K9Y A;  3B8B A;  4XKP A;  2ZNS A;  5CI5 A;  2ONR A;  1Z7M E;  2I49 A;  3W9W A;  2BJI A;  3IO6 A;  1IXG A;  1USY E;  1FRP A;  4F3S A;  3EKI A;  5DVI A;  1FPI A;  3DP6 A;  4AS4 A;  4I8C A;  3FVK A;  4ZEK A;  1AH5 A;  2HAV A;  5J1D A;  2D21 A;  1QUI A;  4H65 A;  2Q2C A;  4GBV A;  3LR1 A;  2UXA A;  3ILT B;  1IUD A;  1OIB A;  3VXC A;  1IQ7 A;  4YU0 A;  4NF5 B;  1QW0 A;  4EXK A;  3KSJ A;  1P1U A;  3G3H A;  3M3K A;  3VVE A;  1LAG E;  1JQF A;  1FQC A;  4BDO A;  2QVU A;  1PB7 A;  1POY 1;  4DXU A;  4MNP A;  4P47 A;  3CG3 A;  2PT1 A;  3WAE A;  1LFI A;  4HW8 A;  2Y7P A;  4DIG A;  1UIU A;  2V93 A;  5FBP A;  3U8Q A;  3Q29 A;  3GBA A;  3RTF B;  3TCG A;  2DYX A;  1P1N A;  4R6H A;  3IR1 A;  4FED A;  2ONS A;  3PUZ E;  3TYH A;  2NOO A;  4RYA A;  2FIE A;  2I0C A;  1ZMG A;  1B7Z A;  2ZZX A;  5AA2 B;  3HHF A;  5K2Y A;  3G3G A;  3FAS A;  3LBS A;  4OXV A;  4PDH A;  2XXV A;  1FBP A;  4NF6 A;  3TAJ A;  5H8Q A;  3E4R A;  3S9E A;  1JVX A;  2PBW A;  4F22 A;  4QBA A;  3BFT A;  4U22 A;  2HZK A;  3FUZ A;  1O63 A;  3EHS A;  1UQW A;  3MP1 A;  4GQO A;  1Y1Z A;  2VD3 A;  4NHB A;  5CRY A;  4C1U A;  3PGF A;  4QXD A;  1SW1 A;  5JK4 A;  1H44 A;  3MVZ A;  2OWT A;  2B3B A;  4FAJ A;  4DE8 A;  4ZEB A;  4E0W A;  2HZL A;  1I6B A;  1URS A;  1S7Y A;  4G61 A;  1LBB A;  3PMW A;  3FXR A;  2CZK A;  4DI4 B;  1VSO A;  1IMD A;  3SER A;  4F1U A;  5ICT A;  2WBD A;  1FPG A;  1T0K A;  2F78 A;  2Q9T A;  4OZ9 A;  4NF8 A;  3OXN A;  1B3F A;  1B2H A;  2I48 A;  1Y4T A;  4OHN A;  1YYZ A;  4G68 A;  4NMY A;  4R73 A;  4U1O A;  4P1E A;  3SET A;  3C34 A;  1G0I A;  3LC8 A;  1B9J A;  4H45 A;  4R6K A;  1CB6 A;  2XA5 A;  3BBR A;  4PGP A;  4HE2 A;  1MQG A;  1KZ8 A;  3MPL A;  1OQG A;  4JSO A;  4GWY A;  3B50 A;  4X1D A;  2WKY A;  2Q74 A;  4PQJ A;  1B51 A;  1N7W A;  2F97 A;  2F7C A;  3QAX A;  4QHQ A;  1FPL A;  3FXB A;  2HXW A;  4HE0 A;  3TTN A;  4DZ1 A;  4PCD A;  1R6Z A;  5I84 A;  1D4N A;  3L6H A;  2KQZ A;  1N7X A;  3K6V A;  1P1W A;  3G3F A;  2QMX A;  1MH3 A;  2P1S A;  3I5O A;  3S9N C;  1B58 A;  4N8Y A;  1GVC A;  4P0I A;  1FTJ A;  4GIZ A;  2FYI A;  3T1B A;  5A5X B;  1AWB A;  4KCD A;  5IM2 A;  5ICQ A;  2KLF A;  3H6U A;  2VP1 A;  1PDA A;  2P2A A;  4QFN A;  5B7D A;  3UN6 A;  4DXC A;  1B4H A;  1FPJ A;  2VPN A;  2ZZW A;  1B52 A;  4Z0I A;  5BWJ A;  3IB2 A;  1DMB A;  1SVX B;  4YB5 A;  3TCH A;  1MQH A;  3IB1 A;  1B1H A;  1XVX A;  5H8H B;  2JJK A;  3PUY E;  1NFT A;  1PC3 A;  5KZT A;  2F5X A;  2OZZ A;  5BUU A;  3TDJ A;  5I59 A;  2F3B A;  4UAB A;  4N13 A;  1G0H A;  3QUF A;  2NUV A;  4IY6 A;  2ZYM A;  5AE4 A;  3OO8 A;  4MNC A;  5CMC A;  3MQ9 A;  3MWB A;  4AB6 A;  1FQE A;  3IK6 B;  2PFZ A;  3BIH A;  2DVC A;  2XX7 A;  4YIC A;  3TPA A;  2WYP A;  5I3S A;  5H8N B;  2X7Q A;  1AMF A;  3SEV A;  5I58 A;  1D9Y A;  1JP4 A;  4P56 A;  4FIM A;  4H6D A;  3MYU A;  1KA1 A;  2FIX A;  1FPK A;  4POX A;  1US5 A;  3KN7 A;  3MP6 A;  3W15 C;  2DE2 A;  1ELJ A;  1TWY A;  1NNP A;  3CRB A;  3FVG A;  4F3P A;  5DW8 A;  4Z7E A;  2DWH A;  3MW0 A;  1B1X A;  4NF4 A;  2VD2 A;  3EPE A;  2OWS A;  2R71 A;  2Y7R A;  4EDP A;  1LBZ A;  2DXY A;  2AL4 A;  5F24 A;  4YKJ A;  2QRY A;  1B05 A;  4GFR A;  1FPF A;  3V5A A;  1I6A A;  3FZV A;  4GVO A;  1LAH E;  1MY0 A;  3GLB A;  3OEM A;  3T9H B;  2DXR A;  3HHG A;  4H46 A;  5ET7 A;  2W7Y A;  2XWI A;  1B5I A;  3TKD A;  3IL1 B;  1FTK A;  4WKM A;  3V83 A;  3VXB A;  3A3C A;  4JVI A;  5HPQ A;  5H8Q B;  3RLF E;  1D3K A;  4GWU A;  1B3L A;  1JW1 A;  3L6G A;  4KI0 E;  4N15 A;  5CBR A;  1LBC A;  3VE1 B;  4MFI A;  3OSR A;  3S9M C;  2P3V A;  3EN3 A;  3IFC A;  4O8M A;  3BFU A;  1ZU0 A;  1CNQ A;  1DSN A;  1PEB A;  4ELQ A;  4MNI A;  4L17 A;  2ZYO A;  4FEC A;  4E0X A;  2VT5 A;  2HEU A;  4H8I A;  3IOT A;  3U72 A;  2I6E A;  3LSL A;  1EZ9 A;  4KYE A;  1Y3Q A;  4GL8 A;  3H06 B;  2THI A;  1IXC A;  1MH4 A;  4YB7 A;  2F6G A;  2XXW A;  1YZ0 A;  2KR0 A;  2DWJ A;  1RYX A;  1UIV A;  2DVZ A;  2QMW A;  4NF8 B;  3RQT A;  3OOA A;  4GOT A;  1O64 A;  2OLB A;  4PGN A;  4G68 B;  3HO7 A;  1XI6 A;  4ZED A;  2O1L A;  1F9B A;  3RPL A;  3PPO A;  5KDT A;  3T9U A;  3KC0 A;  2RC9 A;  5TP9 B;  1A8E A;  4IO6 A;  4Q5T A;  4NN3 A;  1NUW A;  3FV1 A;  1M5F A;  4JDF A;  5J16 A;  2H5Y A;  4NED A;  2XD3 A;  2DP8 A;  3KOT A;  1II5 A;  5EQ7 A;  5LDZ A;  4ZDM A;  3UIF A;  1N04 A;  4FAT A;  5IGA A;  5ISU A;  4IO7 A;  1SYI A;  3MZ1 A;  2Y7W A;  1NNF A;  2REJ A;  4XF5 A;  1US4 A;  5KDT B;  3LSF B;  3QYT A;  5ET6 A;  3KBZ A;  4ZEC A;  3DLN A;  1DPP A;  4NGU A;  1QGX A;  3ROJ A;  1QUJ A;  2QS1 A;  1M5C A;  4F29 A;  1A99 A;  1MS7 A;  4I9D A;  5FHM A;  2X7P A;  3PUW E;  2HHM A;  1P99 A;  3V8X B;  3TTL A;  3K6W A;  3OSQ A;  4YZZ A;  4GWW A;  1NH8 A;  1PBP A;  3KJ7 A;  2FVZ A;  3RY3 A;  3GBB A;  1FBF A;  4LQ5 A;  3H03 A;  3TMG A;  3A3U A;  4QFL A;  1Q35 A;  4I1D A;  4R6Y A;  5KCJ A;  1Y9U A;  3PD8 A;  3AXF A;  4BDM A;  1L5T A;  4OEU A;  2UYF A;  4OVP A;  4PFB A;  2NXO A;  3OEL A;  3Q25 A;  3JZJ A;  3K01 A;  1NV6 A;  2AIX A;  4MJO A;  1MY3 A;  2AYS A;  1LBW A;  1MG1 A;  3ECR A;  1Y3P A;  3TUS A;  1ZKB A;  1GR2 A;  4JWX A;  4PTK A;  4R75 A;  2X26 A;  4PE3 A;  2WBB A;  2F34 A;  1R9Q A;  1H45 A;  5ESY A;  1NL5 A;  3GYY A;  5AA2 A;  4PF8 A;  1NI9 A;  3H6T A;  4GX6 A;  3C4M A;  4PAI A;  1NUX A;  2OK2 A;  3K6X A;  1MQI A;  4F31 B;  4OVR A;  1M5E A;  4P0G A;  4HE1 A;  1B46 A;  1EYK A;  2XD2 A;  4XKN A;  4HS7 A;  4IO5 A;  2R6G E;  3KZG A;  4NG7 A;  2H4I A;  2ZYN A;  2DS9 A;  1M5D A;  1B3E A;  3G7W A;  1FJ9 A;  1CE2 A;  2VPO A;  1ZJL A;  3S4U A;  3H6W A;  3IAZ A;  4X1B A;  3FV2 A;  4N8G A;  4OEN A;  3RN8 A;  5DYH A;  5L8D A;  1Q1K A;  5T3J A;  2M8C A;  4KCC A;  1FBD A;  4FJP A;  2I4C A;  4OQO A;  3HPI A;  4DCX A;  1NKX A;  2V3T A;  2ABH A;  3T93 B;  1SI1 A;  2E0S A;  1DK4 A;  1M5B A;  4F1V A;  5ITO A;  3KN3 A;  5H8S A;  4PFU A;  4RPO A;  2RC7 A;  1Y3N A;  1YPN A;  2V4C A;  5CM6 A;  4RK9 A;  4EF1 A;  2CEX A;  3K1N A;  3OD7 A;  3K4U A;  1GGG A;  3H4Z A;  1D9V A;  3R7X A;  3RYD A;  3BKI B;  1NV0 A;  1YTV A;  4U4S A;  3G3J A;  1JNF A;  1RYO A;  3SEU A;  4RJZ A;  2XXI A;  3VLW A;  1I69 A;  4F2O A;  2WYK A;  4OEV A;  1SDX A;  4TLM B;  1UTH B;  2VHA A;  4PF6 A;  3P7I A;  1IIW A;  4QSD A;  2GHB A;  1SW5 A;  2ZNT A;  1BTJ A;  3SZP A;  1EZO A;  3T9V A;  5I5P A;  1O7T A;  3DP4 A;  2PX1 A;  3KGC A;  1LBY A;  1DPE A;  1GV8 A;  5I56 B;  4U23 A;  1S50 A;  3CHG A;  3FD3 A;  4UAC A;  2O1M A;  2QVV A;  3G3I A;  1Y20 A;  1NV7 A;  4JVD A;  2ZYK A;  1B5H A;  3IOW A;  2DSF A;  2OJT A;  3V89 B;  2H25 A;  3QXM A;  4EXL A;  3ISP A;  2I4B A;  4QFK A;  2RCB A;  3A09 A;  3MBP A;  2UVI A;  2LAO A;  1LAF E;  1VDW A;  4PP0 A;  3FIR A;  1FTM A;  5DTB A;  4H67 A;  4ZZE A;  1SW4 A;  1DTG A;  4BDN A;  3PU5 A;  4PFY A;  3USD A;  4F19 A;  3E78 A;  3Q26 A;  3CIJ A;  3O9P A;  2I58 A;  4U2R A;  2CZL A;  4KPT A;  3PUV E;  3RTW B;  3LSW A;  3VLU A;  3SDF A;  2DOJ A;  1MDQ A;  2DDK A;  2MKZ A;  1LCT A;  1A55 A;  4ZE8 A;  1J1N A;  1QUL A;  1OLC A;  4ELP A;  4YKP A;  3TQW A;  5H8F A;  4PDD A;  3U1O A;  3Q28 A;  5L9S A;  5ET5 A;  3FVO A;  4ZZA A;  3QUJ A;  1TFD A;  2HAU A;  4JB7 A;  4O3B A;  2RIN A;  2Y5L A;  1AOV A;  1NV2 A;  5FTH A;  3GZG A;  1EYI A;  3B6T A;  4TLL B;  3CSB A;  3QK6 A;  3O6I A;  3Q27 A;  1EU8 A;  3PPP A;  1MXY A;  1B0L A;  4OER A;  3TOD A;  1FTA A;  1OVB A;  1TT1 A;  4RPN A;  3C36 A;  4EF2 A;  5CMM A;  1NV3 A;  4LQ2 A;  4RA1 A;  2WEF A;  4F1Y A;  3S9L C;  4FOR A;  1R1N A;  2O68 A;  2I0B A;  4OYV A;  3PPN A;  3JV9 A;  4ZEF A;  2O7I A;  1A40 A;  2R9J A;  1MPD A;  3DP8 A;  3ZS6 A;  4MIJ A;  4MLQ A;  5JTY B;  3IJO B;  3KSX A;  5I57 B;  3VDF A;  1JEU A;  4YMB A;  4JSD A;  4GXS B;  4LVQ A;  2HCA A;  1FTL A;  3N94 A;  4NWD A;  1P1Q A;  4GL0 A;  3K1P A;  3LUY A;  1NV5 A;  4OMB A;  1LEV A;  5I2N B;  4OTE A;  2B4L A;  2UYE A;  2YJP A;  3PPQ A;  1N76 A;  4FBP A;  3IO4 A;  1ZTY A;  3O28 A;  2HQ0 A;  4OA4 A;  1MXV A;  1ATG A;  3OMB A;  1FQA A;  2PYY A;  3S2V A;  4HTG A;  1B4Z A;  3RNN A;  1LGB C;  1ZBM A;  1FQB A;  3OEK A;  3B7D A;  4MMP A;  3PPR A;  3MVW A;  5IZ1 A;  1WOD A;  2Z8D A;  3G3K A;  3M3L A;  5JEI A;  4G77 A;  1LST A;  3MC2 A;  1RDX A;  2Q8J A;  4G68 C;  4GBW A;  1LCF A;  1SD3 A;  4YKK A;  4XTC Q;  1LFG A;  1BKA A;  1ZLQ A;  1VE4 A;  4H5F A;  2IA4 A;  1YCJ A;  4ESX A;  3IOR A;  4YB6 A;  4NF5 A;  3CI8 A;  4XKR A;  4I62 A;  1NH7 A;  3CFX A;  3FJM A;  1YXI A;  3O66 A;  3UP9 A;  2XXY A;  2FA7 A;  3T22 A;  1NNK A;  5TPA A;  1N3W A;  3NOH A;  4PBH A;  3MVX A;  2GQ1 A;  1B7U A;  3IOU A;  4M4G A;  2ZMB A;  3SKP A;  5ITP A;  1EZP A;  2RC8 A;  1XVY A;  3CFL A;  2ANJ A;  5EHM A;  1OLA A;  2HXR A;  4ND9 A;  3RT8 A;  3T66 A;  4YAH X;  2XXU A;  1IMB A;  2XWK A;  1LLS A;  4IO3 A;  4O94 A;  5TPA B;  1IMA A;  4R9F A;  4KFQ A;  4RK2 A;  3B6Q A;  4X04 A;  4P11 A;  2ZZV A;  2ONK E;  4GRK A;  2Z8F A;  1HSJ A;  3KN8 A;  1B32 A;  4ONY A;  4PAF A;  4DDD A;  4IO2 A;  5EQ9 A;  3LSX A;  2F8D A;  4IR8 A;  4Q8R A;  1FSA A;  3ZSF A;  2PT2 A;  4N6D A;  4RXL A;  4F2Q A;  4IGT A;  1DOT A;  5AA1 A;  3D4G A;  3I6V A;  3E79 A;  1SW2 A;  3HCQ A;  1QKB A;  1BLF A;  1I6Q A;  4ISU A;  3ZKL A;  3MZB A;  4X9T A;  1RKM A;  3BIG A;  4AS5 A;  2I3W A;  4FEB A;  1FPB A;  4I3Y A;  1OMP A;  5EQA A;  5IZ3 B;  3IFA A;  4GWX A;  1MPC A;  5B70 A;  3U93 A;  1INP A;  4N6P A;  1ZIU A;  4OES A;  4NE4 A;  5CMK A;  3H6V A;  3ODB A;  2FBP A;  5I2K A;  4BDQ A;  2E1S A;  4G8H A;  4GXA A;  4H8J A;  3ONM A;  5AA4 A;  1JET A;  1URG A;  2XXT A;  2VGQ A;  4F3B A;  1XC1 A;  1FQF A;  2PFY A;  2F7A A;  4P8B A;  5IZ3 A;  5TU0 A;  1TFA A;  1H43 A;  3TCF A;  4OFL A;  5L9M A;  1SYH A;  2PCR A;  4QF9 A;  5ET8 A;  5I59 B;  2GRV A;  4I40 A;  1MRP A;  2HPG A;  2PMS A;  3MST A;  1OQH A;  3K00 A;  3K6U A;  5FTI A;  1URD A;  3HFU A;  3IJX B;  3IX1 A;  4QSE A;  1ANF A;  3K2D A;  2DWA A;  4PFI A;  1NV1 A;  4N4U A;  3DM0 A;  3PMV A;  4PAK A;  5FHO A;  2O51 A;  2B65 A;  4WED A;  4KYD A;  4NTL A;  3EQ1 A;  3QMF A;  4Q30 B;  2Y7I A;  4F18 A;  4POW A;  1EYJ A;  2Q2A A;  4P3L A;  4N6K A;  2V84 A;  4GWZ A;  4QFO A;  3QIM A;  2Z23 A;  1Q9D A;  1S9T A;  2RCA A;  1B0H A;  2UVH A;  4ZS9 A;  3B6W A;  3O6G A;  4O3A A;  4NQ8 A;  2OWZ A;  5DVJ A;  2Q88 A;  1MXU A;  5EYG A;  3C35 A;  3I3V A;  3VVF A;  2IEE A;  2I3V A;  2REG A;  3N6U A;  3EF7 A;  1H76 A;  3KJT A;  4N91 A;  1IXI A;  4C1T A;  3VLV A;  4OVQ A;  4G2Z A;  4P1L A;  5M2V A;  4DCY A;  3T0J A;  4DXB A;  1RDY A;  4OVT A;  4R72 A;  1DBZ A;  4UA8 A;  4OAN A;  3MAM A;  3U92 A;  3FXQ A;  5DVF A;  4MX6 A;  1YAE A;  2NVU B;  2CZI A;  3GXA A;  1JW4 A;  4AB5 A;  4X8R A;  1N0T A;  4NX1 A;  1JVY A;  4BDR A;  3H7M A;  5F7V A;  3TZA A;  4XFE A;  1UTB A;  4PFT A;  4LUB A;  2V25 A;  1MM7 A;  5H8N A;  2Q89 A;  1MDP 1;  1AL3 A;  5I58 B;  4LZ8 A;  4NF0 A;  1SBP A;  1NMU A;  4NAP A;  4THI A;  5K2X A;  3O6H A;  1MY4 A;  5AA2 D;  2QFL A;  2Z8E A;  4HCW A;  4KXP A;  4MF3 A;  2ZNU A;  5CBS A;  1GTK A;  4KQP A;  1IXH A;  1FBC A;  4PE5 B;  3CFZ A;  1BP5 A;  1QUK A;  4GF8 A;  3H3G A;  4PBQ A;  5H8F B;  4YMA A;  4C0R A;  4ZE9 A;  4IGR A;  4OVJ A;  4EQB A;  4HCY A;  3KOS A;  3CVG A;  2G29 A;  3O2A A;  2O84 X;  3SEW A;  1FBE A;  3CG1 A;  3ZKK A;  4H1X A;  4ELO A;  4LP2 B;  3CSG A;  3RT6 B;  2FNC A;  4AQ4 A;  4EQ9 A;  4LZ7 A;  4G8M A;  1Y4C A;  4ZEI A;  1XHY A;  1QJM A;  1MXW A;  3D1R A;  4XXU A;  4PFW A;  4OFO A;  3DEL B;  4M1V A;  3UA8 A;  4JBZ A;  3N5L A;  3E3K A;  2H9B A;  2O69 A;  2B3F A;  5F1Q A;  4WXJ A;  4F3G A;  4GWO A;  2QS2 A;  2A5S A;  2HFB A;  1SI0 A;  3M8U A;  4MHF A;  1H3D A;  2R8T A;  2DE4 A;  4O3C A;  2OX3 A;  4MH5 A;  5JTY A;  2O6A A;  4K3F A;  1FBH A;  1NUY A;  4GD5 A;  3TFL A;  4RNS A;  2F3D A;  1WDN A;  2D3I A;  4ECF A;  1NV4 A;  3UK4 A;  2FHY A;  2Y7K A;  5I2N A;  3O97 A;  5EQ8 A;  3FJ7 A;  3T9X B;  3K1M A;  5KCJ B;  3IB0 A;  1IMF A;  5HM4 B;  2F35 A;  3RPL B;  4LA9 A;  3UOR A;  4GX4 A;  2DE3 A;  2XWO A;  1RDZ A;  5TP9 A;  3N26 A;  3W9V A;  2QS4 A;  3TEL A;  4U1Z A;  4N81 A;  2WX9 A;  4MAG A;  3R26 A;  3MP8 A;  2ZXT A;  3E9X A;  4EQ7 A;  3FXU A;  1B5J A;  3RUM A;  2UVJ A;  2XXQ A;  2GH9 A;  4XEQ A;  4G4P A;  1B3G A;  5CC2 A;  5FHN A;  1MPB A;  4MCO A;  1TXF A;  2B4M A;  3TTK A;  1MXX A;  2A5T B;  2XHD A;  4R9G A;  3PD9 A;  1IMC A;  1KA0 A;  5L9O A;  1SQY A;  4MEV A;  4U4X A;  2CZH A;  3N6T A;  2Y84 A;  4GWS A;  3O29 A;  3C33 A;  4BDL A;  2O7U A;  2Q8M A;  1USY H;  1DCU A;  3THI A;  2F7B A;  4OVS A;  2QVR A;  2Y5K A;  3IOV A;  3SEY A;  2H98 A;  1IZ1 A;  1B3H A;  3OO6 A;  3UGW A;  2F6P A;  1FCK A;  3FAT A;  1A54 A;  1Z7N E;  2QJE A;  2A5T A;  3MPK A;  1MM6 A;  2QL3 A;  1XS5 A;  4OET A;  2XX9 A;  4JXI A;  1HSL A;  4O7I A;  5ELV A;  3TEP A;  2OBG A;  2ALU A;  3A29 A;  3EHU A;  3WAF A;  1LBX A;  1R9L A;  4BLA A;  1KWH A;  1XT8 A;  3PUX E;  4YKI A;  3T96 B;  4GLI A;  1POT A;  4QFP A;  4RY1 A;  1VFE A;  1MY2 A;  4Q0C A;  3VV5 A;  2XXX A;  1BIY A;  2P3N A;  3C9H A;  2L5V A;  3KC1 A;  2F36 A;  1LFH A;  3PMX A;  1FBG A;  1BK4 A;  1AIV A;  1NNT A;  3TTR A;  2H99 A;  3FJG A;  4TOZ A;  4R2F A;  1LBV A;  3SES A;  4KR5 A;  2YPN A;  1QKA A;  4F39 A;  4JWY A;  1FQD A;  2G93 A;  3RGY A;  4R2B A;  3FGS A;  1IIT A;  1QVS A;  5AA3 A;  2PVU A;  2NWJ A;  2P0S A;  4KYS A;  2DQV A;  4OWD A;  1Y1M A;  2BJJ X;  4PC9 A;  3K02 A;  4FE8 A;  4EUO A;  3FBP A;  4IO4 A;  1B40 A;  3ILU B;  4XKQ A;  2V3Q A;  2XXK A;  1MY1 A;  4LON B;  4NF6 B;  5IKB A;  5A5L A;  3KFM A;  5LOM A;  1IEJ A;  3TQL A;  4HXV A;  1LAX A;  4PET A;  2XXR A;  3KBR A;  1MQD A;  4MLV A;  3MVY A;  2QS3 A;  3VFJ A;  1FW0 A;  4LAT A;  5EHS A;  5I2K B;  4NWC A;  1XOC A;  1JW5 A;  5AA4 B; 
#chains in the Genus database with same CATH homology
 2Q2A A;  3HST A;  2QSX A;  3G3I A;  5H8H B;  1Y20 A;  3PUY E;  1NFT A;  2ZYK A;  1B5H A;  2V84 A;  3IB1 A;  1PC3 A;  3IOW A;  4NF4 B;  2DSF A;  5EYF A;  5KZT A;  2OJT A;  3C31 A;  3QIM A;  2F5X A;  2OZZ A;  4QFO A;  3TDJ A;  3V89 B;  5BUU A;  2Z22 A;  5I59 A;  2H25 A;  4G8N A;  4N13 A;  2Z23 A;  1S9T A;  2RCA A;  4OFJ A;  3QXM A;  4TQU Q;  4EXL A;  1B0H A;  2I4B A;  4QFK A;  3QUF A;  2RCB A;  3A09 A;  2NUV A;  1LB9 A;  2UVH A;  4IY6 A;  2ZYM A;  3MBP A;  2UVI A;  4MBP A;  4ZS9 A;  5AE4 A;  3OO8 A;  1UTH A;  2LAO A;  3B6W A;  3O6G A;  2VOZ A;  1LAF E;  4O3A A;  5CMC A;  1HSE A;  3MQ9 A;  5DVJ A;  2Q88 A;  3MWB A;  1MXU A;  5CMB A;  4PP0 A;  3FIR A;  1FTM A;  4AB6 A;  5DTB A;  4QRZ A;  4H67 A;  3C35 A;  3CR9 A;  3I3V A;  4H5G A;  1FQE A;  3VVF A;  3IK6 B;  2IEE A;  4LZ5 A;  1B7H A;  2I3V A;  4ZZE A;  3C32 A;  1SW4 A;  2REG A;  3N6U A;  1DTG A;  3HN0 A;  4BDN A;  3EF7 A;  1MXZ A;  2DVC A;  3HV1 A;  2XX7 A;  1H76 A;  3KJT A;  3PU5 A;  4YIC A;  4PFY A;  1IXI A;  4C1T A;  4KHZ E;  3TPA A;  3USD A;  4F19 A;  3VLV A;  5H8N B;  5I56 A;  4KD5 A;  2X7Q A;  1AMF A;  3SEV A;  5I58 A;  2DWI A;  3Q26 A;  1D9Y A;  3CIJ A;  3O9P A;  4G2Z A;  3MZ9 A;  5M2V A;  2I58 A;  4FIM A;  2CZL A;  4H6D A;  3PUV E;  1A7L A;  4KPT A;  4U2R A;  5HBC A;  3RTW B;  4DCY A;  3LSW A;  4DXB A;  3VLU A;  4R72 A;  3SDF A;  3QSL A;  2DOJ A;  1MDQ A;  3E13 X;  1FTO A;  4POX A;  4UA8 A;  1US5 A;  3KN7 A;  3MAM A;  3MP6 A;  4ELR A;  3U92 A;  1LCT A;  3KEI A;  3FXQ A;  4QSC A;  5DVF A;  1A55 A;  4ZE8 A;  3W15 C;  2DE2 A;  5DEX B;  1ELJ A;  1TWY A;  1J1N A;  1NNP A;  1YAE A;  3CRB A;  3FVG A;  1QUL A;  2NVU B;  1DTZ A;  4F3P A;  4XIG Q;  4Z7E A;  1OLC A;  2DWH A;  4ELP A;  3GXA A;  1JW4 A;  4YKP A;  4AB5 A;  1OVT A;  3F11 A;  4IY5 A;  3TQW A;  3PV0 E;  1VFD A;  3MW0 A;  1PB8 A;  1N0T A;  1B1X A;  4WEP A;  5H8F A;  4NF4 A;  2VD2 A;  4H0W A;  3EPE A;  1JVY A;  1WVJ A;  2OWS A;  2RF1 A;  4BDR A;  3U1O A;  2XXH A;  2YLN A;  4WXJ A;  3Q28 A;  5L9S A;  2R71 A;  3H7M A;  2Y7R A;  3FVO A;  5F7V A;  4ZZA A;  4EDP A;  3EHT A;  3TZA A;  2DXY A;  3QUJ A;  3JYR A;  1TFD A;  2HAU A;  1B6H A;  4JB7 A;  1UTB A;  4O3B A;  4PFT A;  3OO9 A;  4LUB A;  2RIN A;  2V25 A;  1VR5 A;  1MM7 A;  2AL4 A;  5H8N A;  2Q89 A;  1AOV A;  3R6U A;  2AL5 A;  1MDP 1;  4YKJ A;  5FTH A;  3GZG A;  2QRY A;  1AL3 A;  5I57 A;  1B05 A;  4GFR A;  5I58 B;  4LZ8 A;  4X48 A;  3B6T A;  4TLL B;  3V5A A;  3CSB A;  1SBP A;  1I6A A;  3FZV A;  4GVO A;  1LAH E;  2RKM A;  3QK6 A;  1NMU A;  1MY0 A;  5DEX A;  1N3X A;  3O6I A;  3GLB A;  3OEM A;  3Q27 A;  2D5W A;  3U94 A;  4THI A;  3T9H B;  1EU8 A;  2DXR A;  3PPP A;  3D4C A;  3HHG A;  3KG2 A;  3MUQ A;  5K2X A;  3O6H A;  1MY4 A;  1MXY A;  4ESW A;  1B0L A;  4OER A;  3SEX A;  2W7Y A;  3TOD A;  4N07 A;  1OVB A;  5AA2 D;  1TT1 A;  1B5I A;  4RPN A;  3C36 A;  3TKD A;  4EF2 A;  3IL1 B;  1FTK A;  5CMM A;  2Z8E A;  2GFE A;  4WKM A;  3OO7 A;  3K0V A;  1LB8 A;  4LQ2 A;  3MJN A;  1A8F A;  3V83 A;  4RA1 A;  3TTM A;  4HCW A;  4MF3 A;  3VXB A;  2ESN A;  4F1Y A;  2ZNU A;  1MQJ A;  4IB2 A;  3A3C A;  4U21 A;  3S9L C;  5A5X A;  4FOR A;  5HPQ A;  2V3U A;  4JWO A;  5CBS A;  1GTK A;  2GHA A;  4KQP A;  4R74 A;  1R1N A;  2O68 A;  5H8Q B;  2I0B A;  4OYV A;  2UVG A;  1IXH A;  3PPN A;  5DT6 A;  3RLF E;  3JV9 A;  2XX8 A;  4ZEF A;  4PE5 B;  2XXP A;  2O7I A;  3CFZ A;  1D3K A;  1BP5 A;  1A40 A;  1N84 A;  1QUK A;  1B3L A;  2R9J A;  1MPD A;  3DP8 A;  3ZS6 A;  5IAI A;  1PB9 A;  1JW1 A;  3L6G A;  4GF8 A;  3H3G A;  1P1O A;  4MLQ A;  3M3F A;  3OEN A;  5H8F B;  4YMA A;  4C0R A;  4KI0 E;  3IJO B;  3KSX A;  1EH3 A;  5JTY B;  3VVD A;  4DLD A;  1LBC A;  5CBR A;  5I57 B;  3VDF A;  4ZE9 A;  3VE1 B;  4MFI A;  3OSR A;  1JEU A;  4IGR A;  4OVJ A;  4EQB A;  4YMB A;  4JSD A;  3S9M C;  4HCY A;  3KOS A;  3EN3 A;  3CVG A;  2QPQ A;  4GXS B;  3RPW A;  3BFU A;  2CMO A;  2OCU A;  4LVQ A;  2G29 A;  1ZU0 A;  3O2A A;  3FVN A;  2HCA A;  1UTB B;  1JEV A;  1PBQ A;  1DSN A;  1FTL A;  2O84 X;  5H8H A;  3SEW A;  3CG1 A;  2ZNS A;  4XKP A;  3N94 A;  5CI5 A;  1PEB A;  3ZKK A;  4ELQ A;  4H1X A;  4NWD A;  2ONR A;  1Z7M E;  2I49 A;  2ZYO A;  1P1Q A;  4FEC A;  4GL0 A;  4L17 A;  4LP2 B;  3K1P A;  3W9W A;  3LUY A;  3CSG A;  4OMB A;  4E0X A;  5AA4 A;  3RT6 B;  2HEU A;  3IO6 A;  1IXG A;  1USY E;  4H8I A;  2FNC A;  4F3S A;  4AQ4 A;  5DVI A;  3IOT A;  3U72 A;  4EQ9 A;  2I6E A;  4G8M A;  4LZ7 A;  5I2N B;  3LSL A;  1EZ9 A;  4OTE A;  1Y4C A;  4ZEI A;  3DP6 A;  4KYE A;  1Y3Q A;  1XHY A;  4GL8 A;  2UYE A;  3FVK A;  4I8C A;  1QJM A;  3H06 B;  4ZEK A;  2THI A;  2YJP A;  1AH5 A;  1MXW A;  2HAV A;  3PPQ A;  1N76 A;  4XXU A;  1IXC A;  2D21 A;  4OFO A;  4PFW A;  1MH4 A;  5J1D A;  4YB7 A;  2F6G A;  1QUI A;  4H65 A;  2Q2C A;  3DEL B;  2XXW A;  3LR1 A;  3IO4 A;  4M1V A;  3UA8 A;  2UXA A;  3N5L A;  3E3K A;  3ILT B;  2H9B A;  1ZTY A;  2O69 A;  4JBZ A;  3O28 A;  2HQ0 A;  2B3F A;  1MXV A;  1ATG A;  2DWJ A;  1IUD A;  1OIB A;  1RYX A;  3OMB A;  1UIV A;  2DVZ A;  4GWO A;  1IQ7 A;  1FQA A;  2QMW A;  2QS2 A;  2PYY A;  3VXC A;  4F3G A;  4NF8 B;  3RQT A;  4YU0 A;  3OOA A;  4GOT A;  4NF5 B;  3S2V A;  1O64 A;  1QW0 A;  2A5S A;  2OLB A;  4HTG A;  4EXK A;  2HFB A;  4G68 B;  1SI0 A;  1B4Z A;  3HO7 A;  3M8U A;  3KSJ A;  1H3D A;  2DE4 A;  1P1U A;  4ZED A;  2O1L A;  1F9B A;  3G3H A;  4O3C A;  3RNN A;  1LGB C;  3M3K A;  3VVE A;  1LAG E;  1ZBM A;  3PPO A;  5KDT A;  5JTY A;  4MH5 A;  2O6A A;  3T9U A;  2RC9 A;  1FQB A;  1FQC A;  1JQF A;  4K3F A;  3OEK A;  4BDO A;  3B7D A;  4GD5 A;  3PPR A;  3MVW A;  3TFL A;  1PB7 A;  1WOD A;  4RNS A;  5TP9 B;  1POY 1;  2Z8D A;  4DXU A;  1A8E A;  4IO6 A;  3G3K A;  1WDN A;  3M3L A;  3CG3 A;  2PT1 A;  4Q5T A;  3WAE A;  1LFI A;  5JEI A;  4HW8 A;  3FV1 A;  1M5F A;  4JDF A;  4G77 A;  2D3I A;  2H5Y A;  1LST A;  2Y7P A;  1UIU A;  2V93 A;  3MC2 A;  4NED A;  2XD3 A;  4G68 C;  2Q8J A;  4DIG A;  2DP8 A;  3KOT A;  4ECF A;  5I56 B;  1II5 A;  1LCF A;  1SD3 A;  4YKK A;  4XTC Q;  4ZDM A;  3UIF A;  3U8Q A;  1N04 A;  3UK4 A;  4FAT A;  2Y7K A;  1LFG A;  1BKA A;  1ZLQ A;  1VE4 A;  5ISU A;  4IO7 A;  1SYI A;  4H5F A;  2IA4 A;  3MZ1 A;  5I2N A;  3Q29 A;  3O97 A;  2Y7W A;  3GBA A;  1YCJ A;  3RTF B;  1NNF A;  3TCG A;  4ESX A;  3IOR A;  4YB6 A;  2REJ A;  3FJ7 A;  2DYX A;  1US4 A;  1P1N A;  3CI8 A;  4NF5 A;  5KDT B;  3LSF B;  3K1M A;  4R6H A;  4XKR A;  4I62 A;  3T9X B;  1NH7 A;  3CFX A;  3FJM A;  3QYT A;  5KCJ B;  3IB0 A;  3IR1 A;  4FED A;  5F1Q A;  3O66 A;  3UP9 A;  2ONS A;  2XXY A;  2FA7 A;  4ZEC A;  5HM4 B;  2F35 A;  4LA9 A;  3UOR A;  3DLN A;  3PUZ E;  1DPP A;  3T22 A;  3TYH A;  1NNK A;  2NOO A;  2DE3 A;  4RYA A;  5TPA A;  1QUJ A;  2QS1 A;  1M5C A;  1N3W A;  4F29 A;  2I0C A;  1A99 A;  3MVX A;  1ZMG A;  5TP9 A;  1B7U A;  1MS7 A;  3N26 A;  4I9D A;  1B7Z A;  3IOU A;  3W9V A;  5FHM A;  2QS4 A;  2X7P A;  3PUW E;  4M4G A;  5AA2 B;  2ZMB A;  3SKP A;  3TEL A;  5ITP A;  4U1Z A;  3HHF A;  1EZP A;  5K2Y A;  3G3G A;  2RC8 A;  1XVY A;  1P99 A;  3FAS A;  3LBS A;  4OXV A;  3V8X B;  3R26 A;  2XXV A;  3MP8 A;  3TTL A;  3K6W A;  3CFL A;  2ZXT A;  3OSQ A;  4NF6 A;  4YZZ A;  2ANJ A;  3E9X A;  3TAJ A;  4EQ7 A;  1NH8 A;  3FXU A;  5EHM A;  5H8Q A;  1B5J A;  1OLA A;  3E4R A;  3RUM A;  1JVX A;  1PBP A;  3KJ7 A;  2UVJ A;  2XXQ A;  3S9E A;  4ND9 A;  2PBW A;  4F22 A;  2GH9 A;  3BFT A;  4G4P A;  1B3G A;  3RY3 A;  3RT8 A;  3T66 A;  5CC2 A;  4U22 A;  4YAH X;  2HZK A;  3GBB A;  5FHN A;  1MPB A;  3FUZ A;  2XXU A;  4LQ5 A;  1TXF A;  1LLS A;  3H03 A;  3A3U A;  4QFL A;  3TMG A;  1O63 A;  4IO3 A;  1Q35 A;  5TPA B;  3EHS A;  4I1D A;  1UQW A;  3MP1 A;  4R6Y A;  1Y9U A;  4GQO A;  4R9F A;  5KCJ A;  3PD8 A;  1Y1Z A;  3AXF A;  3TTK A;  4BDM A;  1MXX A;  2A5T B;  2XHD A;  4KFQ A;  3PD9 A;  4R9G A;  1L5T A;  4OEU A;  2VD3 A;  2UYF A;  5L9O A;  1SQY A;  4U4X A;  4RK2 A;  3N6T A;  3B6Q A;  2NXO A;  3OEL A;  5CRY A;  4C1U A;  2Y84 A;  3PGF A;  3Q25 A;  3JZJ A;  3K01 A;  2AIX A;  3O29 A;  3C33 A;  4P11 A;  4BDL A;  1MY3 A;  1SW1 A;  2O7U A;  2AYS A;  2ONK E;  1HSJ A;  1USY H;  2Z8F A;  1H44 A;  4GRK A;  3T93 B;  3MVZ A;  3THI A;  5JK4 A;  1MG1 A;  2F7B A;  2OWT A;  3KN8 A;  1B32 A;  2B3B A;  4ONY A;  3ECR A;  4DDD A;  4ELO A;  4IO2 A;  1Y3P A;  4FAJ A;  4DE8 A;  3LSX A;  4ZEB A;  2F8D A;  4E0W A;  2HZL A;  3TUS A;  1ZKB A;  1I6B A;  3IOV A;  3SEY A;  1URS A;  1IZ1 A;  2H98 A;  1B3H A;  4Q8R A;  3OO6 A;  1GR2 A;  1S7Y A;  1LBB A;  4JWX A;  3ZSF A;  4R75 A;  2X26 A;  2PT2 A;  3UGW A;  3PMW A;  3FXR A;  2F34 A;  1R9Q A;  1H45 A;  2F6P A;  1FCK A;  1NL5 A;  5AA2 A;  3FAT A;  1VSO A;  3H6T A;  3C4M A;  4RXL A;  1A54 A;  1Z7N E;  4F2Q A;  2QJE A;  2A5T A;  2OK2 A;  3SER A;  4F1U A;  3K6X A;  3MPK A;  4IGT A;  5ICT A;  1MM6 A;  2QL3 A;  1T0K A;  1DOT A;  1MQI A;  1XS5 A;  4OET A;  5AA1 A;  2F78 A;  2Q9T A;  3D4G A;  4OZ9 A;  2XX9 A;  4JXI A;  4F31 B;  3I6V A;  4NF8 A;  3OXN A;  1HSL A;  1SW2 A;  3HCQ A;  1B3F A;  1B2H A;  5ELV A;  2I48 A;  1Y4T A;  1M5E A;  3TEP A;  2OBG A;  2ALU A;  1QKB A;  1B46 A;  3EHU A;  2XD2 A;  4G68 A;  4HS7 A;  4NMY A;  4OHN A;  1BLF A;  4P0G A;  4R73 A;  4IO5 A;  4XKN A;  1I6Q A;  2R6G E;  4ISU A;  4U1O A;  3KZG A;  1R9L A;  3ZKL A;  2H4I A;  3MZB A;  2ZYN A;  4X9T A;  2DS9 A;  3C34 A;  3SET A;  1M5D A;  1B3E A;  1RKM A;  3LC8 A;  4BLA A;  3G7W A;  1CE2 A;  1B9J A;  1KWH A;  1XT8 A;  2I3W A;  4FEB A;  3PUX E;  4R6K A;  4YKI A;  3T96 B;  1ZJL A;  3S4U A;  4GLI A;  1OMP A;  1CB6 A;  1POT A;  3H6W A;  4QFP A;  4RY1 A;  3IAZ A;  1VFE A;  4UAC A;  1MY2 A;  4Q0C A;  4X1B A;  3BBR A;  3FV2 A;  3VV5 A;  1MQG A;  1BIY A;  2XXX A;  4OEN A;  3C9H A;  1OQG A;  3MPL A;  1MPC A;  4JSO A;  3RN8 A;  5DYH A;  5L8D A;  1Q1K A;  5B70 A;  3U93 A;  4X1D A;  2F36 A;  2M8C A;  2WKY A;  1LFH A;  3PMX A;  4KCC A;  1AIV A;  4FJP A;  1NNT A;  3TTR A;  2H99 A;  2I4C A;  3FJG A;  4N6P A;  4PQJ A;  4TOZ A;  4OQO A;  3HPI A;  1ZIU A;  1B51 A;  4OES A;  4R2F A;  4NE4 A;  3SES A;  4KR5 A;  4DCX A;  1N7W A;  1NKX A;  2F97 A;  5CMK A;  2V3T A;  3H6V A;  3ODB A;  2ABH A;  2YPN A;  5I2K A;  4BDQ A;  2E1S A;  1QKA A;  2F7C A;  3QAX A;  4G8H A;  4GXA A;  1SI1 A;  1FQD A;  2E0S A;  1M5B A;  3ONM A;  2G93 A;  4H8J A;  4JWY A;  4QHQ A;  1JET A;  5ITO A;  4F1V A;  3RGY A;  2HXW A;  1URG A;  3KN3 A;  2XXT A;  2VGQ A;  4R2B A;  3TTN A;  4DZ1 A;  5H8S A;  4F3B A;  3FGS A;  4F39 A;  1XC1 A;  1FQF A;  4PFU A;  1R6Z A;  2F7A A;  1IIT A;  4RPO A;  5I84 A;  2RC7 A;  1D4N A;  1Y3N A;  1QVS A;  1YPN A;  5CM6 A;  3L6H A;  4RK9 A;  4EF1 A;  5AA3 A;  5TU0 A;  2PVU A;  2NWJ A;  1N7X A;  3K1N A;  3K6V A;  1TFA A;  2P0S A;  4KYS A;  1P1W A;  1H43 A;  3OD7 A;  3TCF A;  3G3F A;  3K4U A;  2QMX A;  1GGG A;  2DQV A;  1MH3 A;  1D9V A;  2P1S A;  3H4Z A;  3I5O A;  4OFL A;  4OWD A;  5L9M A;  1B58 A;  1Y1M A;  3R7X A;  3S9N C;  2BJJ X;  3K02 A;  3BKI B;  4FE8 A;  1SYH A;  4QF9 A;  4EUO A;  1YTV A;  1GVC A;  4IO4 A;  4P0I A;  1FTJ A;  1B40 A;  4GIZ A;  3G3J A;  4U4S A;  1JNF A;  3ILU B;  5I59 B;  2GRV A;  1RYO A;  3WAF A;  1MRP A;  4XKQ A;  2V3Q A;  3SEU A;  4RJZ A;  2FYI A;  2PMS A;  1MY1 A;  2XXI A;  3VLW A;  4LON B;  1I69 A;  4NF6 B;  4F2O A;  5IKB A;  4OEV A;  1SDX A;  4TLM B;  1OQH A;  4KCD A;  1UTH B;  3K00 A;  2VHA A;  3K6U A;  5A5X B;  3P7I A;  1URD A;  5FTI A;  5ICQ A;  2KLF A;  3H6U A;  1IIW A;  2VP1 A;  1PDA A;  2P2A A;  3IJX B;  3KFM A;  4QSD A;  3IX1 A;  4QFN A;  4QSE A;  1ANF A;  3K2D A;  5LOM A;  2DWA A;  1IEJ A;  3DM0 A;  3PMV A;  5B7D A;  5FHO A;  2GHB A;  1SW5 A;  3TQL A;  1LAX A;  2ZNT A;  1BTJ A;  2XXR A;  4PET A;  3UN6 A;  1EZO A;  3T9V A;  4DXC A;  3KBR A;  1B4H A;  1MQD A;  1O7T A;  2O51 A;  3DP4 A;  2B65 A;  1B52 A;  4WED A;  2PX1 A;  4KYD A;  4MLV A;  3KGC A;  4NTL A;  3MVY A;  3EQ1 A;  4Z0I A;  2QS3 A;  1DPE A;  5BWJ A;  4Q30 B;  3IB2 A;  1GV8 A;  1FW0 A;  3VFJ A;  1DMB A;  1SVX B;  2Y7I A;  4LAT A;  4U23 A;  4YB5 A;  5EHS A;  5AA4 B;  1S50 A;  4NWC A;  5I2K B;  1XOC A;  3TCH A;  1MQH A;  4F18 A;  1JW5 A;  4POW A;  3FD3 A;  2O1M A;  1B1H A;  1XVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...