1US8A

The rad50 signature motif: essential to atp binding and biological function
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
147
structure length
129
Chain Sequence
MKLERVTVKNFRSHSDTVVEFKEGINLIIGQNGSGKSSLLDAILVGLYWPLRIDTYIDLIFEKDGTKYRITRRFLSGEIHAMKRLVGNEWKHVTEPSSKAISAFMEKLIPYNIFLNAIYIRQGQIDAIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Rad50 Signature Motif: Essential to ATP Binding and Biological Function
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Dna repair
molecule keywords DNA DOUBLE-STRAND BREAK REPAIR RAD50 ATPASE
total genus 30
structure length 129
sequence length 147
ec nomenclature
pdb deposition date 2003-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1us8A00
2B8TA 2R62A 2CEAA 3NWJA 1ZUHA 4MKIA 2ATXA 2CDNA 1E79A 3SYLA 1YKSA 1KK2A 2Q9BA 2HYIC 4N3NA 4Z8XA 5GADl 4BPBA 1OF1A 2CVHA 1EFRA 1G8GA 2ZYTX 1E9DA 1EFCA 1SVWA 2GCOB 3GJXC 4GFDA 4P3YA 1CJTC 2X2EA 2OSBA 3TRFA 2UZIR 3L0SA 2V8OA 4PX9A 2A3RA 2WSSA 4K81B 4U7DA 1AIPA 3K9HA 3L82B 3SE0A 2A5YB 2YWHA 2W58A 4WZAE 4AC9A 2QG6A 2OEPA 2UZ3A 4PQYA 4DCVA 4ZDKA 4PAOA 1W2HA 1ZMXA 2OLKA 1NSTA 4OQFA 2XJ9A 5KPJA 4HZIA 4MRVA 2ZSAA 1OIVA 5DI3A 3U44A 3BH6A 4A6PA 3QG1A 3IILA 2XZOA 1AM4D 5BN4A 1SKQA 1Z0DA 1ZAKA 2FSIA 1X6VA 3ADDA 2YHSA 1OHHA 1KZGB 2ZE8A 4OI1A 4DSTA 2QM8A 2Z0MA 4D80A 3BB4A 4CRWB 1GG2A 2VPPA 3LA6A 2HCJB 2FSFA 3LBNA 5C4GB 2JLQA 5SZHB 6Q21A 1KMHA 4W5HA 2NO1A 4B73A 3RDPA 3QKTA 3LW8A 1JJ7A 3REGA 1VCOA 1YRBA 2ZJOA 1D2MA 3VR6A 4DSNA 4PQRA 2R6DA 3TE6A 3GD7A 3OIYA 4NCJA 2IYSA 2I4IA 4PTLA 3W3AA 1KO4A 1XCGB 2AX4A 4TT3A 3NG1A 4TLCA 3RAPR 5DNYB 5AUPB 1GL9B 1KI2A 1G7CA 1MO3A 2D06A 1GUAA 2J0SA 2XB4A 1X8KA 2GHIA 1Q44A 4PO1A 1E2GA 1XMIA 5FBLB 1Q1EA 2HT6A 5J5CA 2PMKA 1NVVR 3FDIA 5KYKA 1SKYB 4D4LA 1LVGA 1EK0A 1W4AA 2GILA 3EZ6A 1R8QA 4QBFA 5FOUA 3GP8A 3K70B 2R65A 1E0JA 4M9XA 3EPKA 2QSZA 5CLQA 1XNJA 2ZEJA 1IN4A 2YINC 4LHZA 2YWEA 3DDCA 2VSXA 1OXVA 2CBZA 3MWLA 3C5HA 2H17A 4ON9A 3WYGA 2ZRBA 5AJYA 3I3SR 5BXQC 5KDDA 5DN6A 1QRAA 2VHTA 4HB0A 2DHRA 2JASA 1NVXQ 4M53A 4WZ6A 4B2LA 1KDRA 1RZ3A 1NMYA 3UMRA 1WE2A 2GRJA 2NZJA 1XTJA 3WMEA 1QVAA 2QMUA 4LPSA 3KXIA 3MRSA 3H2YA 3QF4B 4EJSA 2RH5A 2IYYA 1EFRD 3K0FB 1NN3A 5IT5A 1RJ9B 1YZGA 4RCYA 3AUYA 5BQ5A 4HB3A 1PVOA 4PQFA 5FI0B 4RVCA 2E1RA 1XX6A 1BYIA 4DXAA 3GJ7A 1XJCA 1D2EA 5HCNA 4II7A 4HB4A 4IJMA 4EFLA 4OK3A 4TL6A 3PEWA 5IF9A 2EFHB 4CEHA 2A5GA 2PLRA 1YR9A 4MUAA 3AVTA 1S2MA 1PLKA 3AGQA 2XX3A 4LJYA 3F0TA 3KUDA 1II8A 4YLGA 1M74A 4B3XA 3T61A 4C7OA 3PUZA 2ERXA 2TMKA 2BCGY 4QHTA 4X8OA 1DADA 3T35A 4A6XA 4EUNA 2QAGA 3U7HB 3MJHA 1GRRA 3HDTA 2YOFA 1G8PA 3EARA 3I8XA 3MJRA 3TJZA 4CZ2A 4W5JA 4CT4B 2J41A 5EP2A 4OK5A 1EX7A 3FPAA 3UMFA 2RHMA 2GF9A 1G6OA 3QBTA 2HV8A 3R20A 4IDQA 2AFHE 1G7SA 2P5SA 4GL2A 4R71A 1U9IC 3CONA 3D8BA 4BZPA 3BORA 1JBKA 3AP2A 3KKPA 1NSFA 2BBSA 3UPUA 4JLOA 2BMEA 4C4PA 1ZNZA 3TKLA 1T5LA 2V4ZA 2OXCA 1TTTA 1IOZA 4Q4JB 2ZRGA 4KITB 2BEJA 4W5WA 3M1IA 2VHQA 1TQ2A 1Q0UA 5SZJA 5JWHA 1YZNA 1A7JA 1G9XA 2VRWA 4DUGA 2CJWA 2FEOA 2XAUA 2AHOA 5HKKA 1FP6A 2A30A 4A2PA 1CR1A 3BERA 2FFQA 1E2MA 2BIFA 3Q8XB 5E7IA 2RKOA 2YV5A 1NF3A 1P9WA 1ZCBA 1KI9A 4G0NA 4KODA 3FVQA 3UATA 3UWKA 4RD1A 4NP6A 5D3MB 3VFDA 3VKGA 3NVAA 3CF2A 4LUCA 4ILEA 1VTKA 2FZLA 2OCPA 2CHGA 4FW9A 4KXFB 4BUJA 1Q3HA 4LV6A 3CWZA 2WPDD 4EIWA 1EGAA 3LBHA 1E2JA 1YE8A 1WDTA 2FJUA 2BEKA 2ORVA 5FBRB 4RKFA 3H86A 1E1RD 2RAPA 1EX6A 3UANA 1TF5A 3DMDA 3I1FA 3V00A 4XOIA 3ZQJA 3TUJC 4CEJA 2OUKA 4DIEA 4LCBA 5KUTA 2G1JA 4D26A 1Y3AA 2HF9A 4DLTA 1XMJA 4PFSA 1Q3TA 1PLJA 2O8BB 4L8GA 4UKDA 3W3ZB 5LD2B 5EXXA 3L8ZA 4QJ5A 3RWOA 4NE2A 3FKQA 4KYIB 3Q85A 3LVRE 5EP4A 2BM0A 2EVWX 3U3MA 1DAKA 5SZKB 3B9QA 1JXOA 3RRMA 4HAVA 2AFIE 2ZREA 1F2TA 5HR5A 4LSGA 4B33A 2FWRA 5B57C 1EXMA 3LXXA 4JJKA 4UJ3A 3CNOA 4DKXA 1IN8A 3LFUA 1T5IA 1Z06A 2C9CA 2VP5A 4DT1A 3TSOA 2XSZD 4CW7A 2VH5R 3C16C 1P60A 4A36A 4XVRA 1ZM3A 5JJIA 3ZZUA 3I8SA 2C9YA 4KFTA 4CT5A 4LY6A 3ZLJA 3TK1A 4DDVA 1G16A 2ZJYA 1MO4A 4M1TA 2ZS7A 1RW4A 2FN4A 5DLQC 1FUKA 2A9KA 2RGEA 1IN6A 1CJUC 5GJWC 4HDCA 4I4LA 1IJEA 1D2NA 4C0AC 4URUR 4GP7A 2WWYA 3ASZA 3PVSA 3D6TB 4JKYA 1XJQA 1IN7A 1O87A 2R2AA 4JVMA 4KO8A 1N6RA 3PXGA 4B2IA 4GOXA 5A0FA 4UNRA 5JWOA 2ZR0A 2YNMA 5EE0A 4TL7A 3LLUA 2ZRFA 3R8CA 2JATA 3H84A 1YR8A 4GT1A 1XD2B 4DLZA 3SR0A 1P72A 2JLRA 3C7KA 3GFPA 3K09A 2GEUA 1Z83A 2J45A 3QXXA 4BRWA 2NO9A 3UK6A 4MYTA 4YONB 3SBEA 2HLDA 3U7FB 2HJGA 5DHAA 4BRUA 4RFVA 1R0YA 1ETUA 2KWIA 4LDJA 1F48A 1Q1QA 1XDBA 2CK3A 2HDNB 1T9HA 1GKYA 1AZTA 4AYWA 4GSYA 4XTRA 4JVLA 3THWB 1ESNA 4B43A 1G4AE 2GXUA 4DDTA 1RRPA 4RFSA 1HT2E 3TIFA 2AL7A 1PV4A 2ZVPX 2DFKB 1CRQA 4G5GA 3S1AB 1N25A 5H1YA 4EFMA 4OKSA 3OZXA 4QOSA 4V0NA 3TUIC 1T0HB 2O52A 4QBHA 2WWFA 2RGNA 1Z6AA 2CL6X 1N2CE 2AXNA 2VHCA 3CH4B 5CJPA 1M7HA 2D4HA 4BFTA 3ICQB 3O47A 1P61B 3ZVLA 2KJQA 3B60A 1RVDA 1E2NA 5BYKA 2QT0A 2IYXA 1GDDA 2CE7A 1Z63A 2JDID 2OESA 1DAEA 3OESA 2KSQA 4L5BA 2VA8A 3NH9A 1W4RA 1E9BA 5HTKA 2O0KA 3QF4A 4EJSB 2F9MA 4JZKA 3TW4A 2CNWD 4YQFA 2QTVB 1QHHA 4BECA 2ZR9A 3F5FA 4QNRA 3THWA 1FTNA 5CYPA 1W5SA 2IXFA 4OHXA 3X1WA 5GJBA 2DYKA 3PG5A 4B6FA 1GNRA 2IXEA 2IYTA 3QPWA 3I62A 2IS2A 1G291 4ZKDA 2C98A 4B44A 1ZYUA 2GETA 2G1KA 1NKSA 4JLMA 4Y0AA 2O0HA 3VHLB 1VCIA 3WP0A 3EA5A 3PFIA 3SYNA 3VKWA 2B92A 1CR0A 2RGXA 5HE8A 4Z1MD 1EESA 2ZR7A 4PZYA 1G4UR 2EWVA 1X8LA 2QP9X 2RB4A 5JSZB 5DI9A 1XD2A 3U4QA 4YC7A 1XTIA 1NBME 4TMZA 2FGKA 1AQYA 1P75A 2XSZA 3A4NA 3CPHA 5JECA 2QPOA 4TZ0A 3GLHA 4DUGD 5JMTA 2ZRLA 3TAUA 2ZI5A 3WRYC 3AF3A 4IDNA 2A5DA 3QKRB 3ZIAA 1AS3A 2CCJA 1OSNA 2YC4C 1G64A 4PC2A 1GM5A 4G01B 1OLOA 4JYBA 4Q48A 4DCNA 2PEZA 4TTQA 2RCNA 3RABA 1N5JA 4QRHA 2PJRA 5DSZA 3VTKA 2N42A 3FKSD 2H18A 5TXGA 5HCIA 3K0SA 1GWNA 2H16A 1P9RA 2JLSA 4U02A 1N6HA 521PA 1KI8A 1W36D 4Q18A 4MH0R 5KDLA 1E0SA 2BJVA 4RZ3A 2NZ8A 5CK5A 2D62A 2BWJA 3LX5A 2ZUDA 2PMDA 1R0XA 1DAFA 4ZDWA 2WPDA 4G5RA 3SJAA 1QHIA 2HEIA 1M8PA 3C8UA 3NH6A 1F3OA 1JPNA 2XITA 4A8JC 3KQKA 1BOFA 2HLDD 2DB3A 3IHLA 2ZJBA 2VP9A 2OCYC 2WWGA 4MYUA 4DSOA 5KSOA 1QVRA 3A8TA 4Q9KA 1XD8A 2PL3A 4IVPA 4YMWA 4IRUB 4ERNA 3GEEA 4Q7KA 4LBWA 2JLVA 4LHYA 3WMFA 4YMVA 3L8YA 3A36A 1FL9A 4AK9A 4DLWA 3FHTA 2AK3A 1KYIA 1SKYE 3B8HA 4XD7A 5FPHA 1P4SA 2IX3A 3ZVNA 4Q9LA 4NBSA 2O8CA 1OXTA 2PCJA 5KHOC 1H8HA 4NYMQ 4LX0A 3WXMA 2O0JA 4EPRA 2Q9CA 5F2EA 2PH1A 3ZD6A 1XEFA 2Z43A 1DS6A 3NBYC 4Q1AA 2F1RA 4LBVA 1J99A 4B3GA 1DBSA 1VHLA 3VKHA 2WV9A 2VSOA 3AUXA 3N5CA 2EU8A 5TMPA 1BMFD 2QAGC 2ZRCA 3FMFA 3Q72A 4ZIRB 4Q7LA 1WMSA 3EZFA 1TAGA 1SVSA 5J4VA 4QXAA 3WHLA 3PENA 4DLYA 4IVQA 5A5GA 1RKBA 4XWOA 3EIEA 1S96A 1L8QA 1X1SA 3LNCA 2FMXA 4V0MA 2FPLA 2C9OA 1OB2A 1KKMA 4EPVA 2NIPA 1XB2A 2NO6A 4RZUA 5KSZA 2WAXA 4KCGA 1Z0IA 2ECKA 3THYA 2O8DA 2ZPTX 4LHXA 2HCBA 2R44A 1HA3A 3PEUA 1IY0A 4KSCA 2QI9C 3TQFA 3IO3A 4C3ZA 1U94A 3R9IA 1L4UA 1T3SA 1U2RA 1FZQA 5DIFA 3GLFB 5GVSA 1J90A 2JLZA 1KI1A 1XEXB 2A5FA 2CHQA 1Z6YA 3IPXA 2IUUA 4OI0A 3J81k 4LBZA 3AF0A 4TMVA 2YYZA 1PUJA 4NKRA 1HTWA 4Q4LA 1ZJ6A 4NYIQ 4TT3D 1KAGA 5EP1A 2CL0X 1JECA 1XWIA 2C77A 4HATA 3IQWA 1KI6A 1ZNYA 2CHVA 1KO1A 2ZI7A 4HAXA 4MRSA 2IWRA 1ZM4A 4LYAA 2CLDX 5E7MA 2D7DA 4CEIB 2OV2A 1LTQA 5CDFE 1G3QA 2DFNA 2OCBA 2PCLA 3V4FA 3THYB 4Q4HA 2F6RA 5FOTA 1NLZA 3HPQA 3LH5A 4RFSB 1OPXA 1XTRA 4WIAA 4ZO4A 1XTKA 4JBYA 2H1LA 1XU4A 4FWIB 4C0BA 1NL3A 4TN1A 2IC5A 2BBTA 4FIDA 4D4KA 1VPLA 4LRWA 2VHUA 5M04A 2ZS9A 1UKVY 2K5UA 3A1TA 4Z54A 4D0NA 4L16A 1KJWA 1W1WA 3AV0B 4JS0A 5KPDA 1F2UB 2C8VA 3NHAA 2O8BA 1U9IA 4GRAA 3KKMA 1IBRA 2I1QA 3RS0A 2LKDA 4Q4AA 2I1VB 3AGPA 3K9NA 4GZMA 3U6KA 1EFUA 2B21A 4Q01A 3U2QA 1AN0A 1Z2CA 2P0EA 2PT5A 4US2R 5FI1B 5CM8B 4OI2A 2ZAOA 1P6XA 2SHKA 3GJ6A 2AWNA 3RLFA 1LF0A 3CRMA 3GEHA 1XF9A 1XZPA 2R8RA 3EPHA 1WP9A 4TSFD 3EIQA 3RRZA 1IXZA 2UKDA 2KI5A 5F3WB 3AF4A 4OHZA 4LHVA 1E99A 2DFTA 2YOHA 5DHFA 2REBA 3CWQA 2JGNA 1FPMA 2ZRIA 3MFYA 3CPEA 2FG5A 3JZMA 5CIQA 5K8TA 1SXJD 1CU1A 2NGRA 3EX7C 3HR7A 3L43A 4EDHA 5FL7A 4QJ4A 5FOVA 3GPLA 4UJ5A 2FZ4A 5FBWB 4I1UA 2JJ1A 4E5UA 4F7WA 2HXSA 3BGWA 3QJYA 5KTYA 2JJ2A 5G40A 2J0UB 4I81A 1ZU4A 4A2QA 1HUQA 1Q20A 1VYTA 5FH9A 1JQLB 4BQSA 4L15A 4DLSA 5KSPA 1ZNWA 3CR7A 3X1XA 3ZIAD 5F9HA 1R5OA 3MSXA 1T3HA 1IAQA 1I2DA 3VHXA 3UWOA 4AIIA 2XTMA 3TH5A 1NLYA 3SQWA 1KAOA 4AURA 3CF0A 3EPJA 5FOXA 1WRBA 3SJZA 3K70C 2PT7A 3QXHA 4JLKA 2VSFA 2ZRDA 2OHFA 5TARA 4P31A 3SOPA 1JR3D 1RYFA 2ZJ8A 1XPUA 4M1MA 5FPTA 2ZRNA 1TUIA 1W36C 1HY3A 3AP3A 3LRPA 1UM8A 5CM9C 3TBKA 2DBYA 3BH7A 1SVMA 5JBQA 4HAYA 5JHHB 1Z07A 1MKYA 2BMDA 2QEQA 1ZM9A 2WMNB 3MGCA 3CO5A 1LFDB 4HAZA 3DO6A 4V0LA 3RSLA 1ESMA 4M1OA 2OILA 4HAWA 4Q9JA 2UVQA 1S9DA 2PZGA 1F6BA 4AY2A 1QHYA 2ASEA 5LDDC 2XNSA 1KI3A 3EG5A 4B76A 3GLFA 4TQAA 4BEBA 1V43A 1T8UA 5JJLA 4XWAA 3PUVA 5EUQB 5EXPA 5KNDA 2FDCA 4V0OA 1US8B 1ODFA 3IIJA 1XD9A 2BV3A 2ZRKA 5KO2A 3R8FA 1XXHB 3KQLA 2XXAA 4B3BA 4PSVA 2QSYA 3DVLA 3NHBA 3I61A 1COWA 1G41A 4BLSA 2QRZA 2RGNC 4PSKA 1E1QA 4DEYA 2EFDB 2QY9A 1IONA 5LPNA 3CB4A 1JQJC 2X8AA 3LXRA 2BKEA 3AF1A 3QKSB 4Z51A 2JA1A 2XB2A 5BN3A 3IBYA 5FUYA 3T1TA 4JLVA 2IL1A 3VNUA 4CEHB 2MSDB 3FYHA 4JBWA 1Z29A 2R9VA 221PA 5AJWA 3ZYCA 4B74A 4B48A 4I1SA 4FMBB 3AVUA 3EWSA 1C1YA 3I92A 721PA 1X3SA 3UXMA 1II8B 3IIKA 1KHTA 3B82A 2HT1A 1G5PA 3BOSA 3B1XA 3BD9A 1NLFA 3CBQA 3FB4A 5JFGA 4IXMA 3SC3A 3KKNA 1CBUA 3DM5A 4AKGA 3RS2A 3SFVA 1B0UA 2G77B 2ZITA 4NCIA 1XXHA 2VTKA 1DPFA 5DO9A 2O8CB 1C9KA 1KKLA 2ZYVX 4RD0A 1UKZA 5JZVA 1N6OA 2BM1A 2ODWA 3HYTA 1W0KA 2W6IA 1OH5A 3LVQE 2BOVA 2QMHA 1CULC 2VYFA 4FMDF 4RD4A 2D74A 3C15C 1RRCA 4HAUA 3EC2A 1SQ5A 4V0KA 1UEIA 4M9SA 3A4LA 5AUOB 2EWWA 3P4YA 2WSSD 3TVTA 4YXWD 1M1YE 2CL7X 5FTJA 1G18A 3JZAA 3K0CA 3U3OA 2E9SA 1IY1A 1J8MF 3N2EA 2ATVA 2ZXUA 4IDPA 2WMOB 4V03A 4MKFA 4KV9A 3X1YA 4LPKA 3TVDA 1U99A 4U00A 4M9ZA 2QQ0A 1R10A 2WICA 3DHWC 3KJIA 5H68A 3SN6A 2GCOA 1XPRA 2QZ4A 2VHJA 4FD2A 5J40A 1ZD1A 4B75A 1RRFA 1JNYA 3EAQA 4HLUA 4K46A 3MG9A 3RNLA 1TEXA 4GNKA 4BFZA 1VECA 3C41J 4QNMA 5KOYA 1TU4A 4TQ9A 5DYIA 5L3SB 2XZLA 4XVQA 2H5EA 1OH8A 1W5TA 1GL6A 5BW8A 1P2UA 1QHXA 1WF3A 3QF7A 1FNNA 3VR5A 4XSHA 1OKKA 1AGRA 3KTAA 2R6GA 5BN5A 2YC2C 3K0AA 1PLLA 3KXKA 4A4DA 4MDFA 1MT0A 1WBDA 4QG7A 3BWDD 4BFSA 2OFOA 3OFNA 3WHKA 4Q19A 1VIYA 3AEZA 4HI0E 4QKQA 3VNVA 2I3BA 4ZI2A 5HPYB 4I1VA 2EFGA 2AK2A 1Q22A 1IQPA 3OE7D 3MCAA 1P2SA 2RHDA 2GVZC 3GLGB 4B34A 3F8TA 3ZH9B 1W49A 3K53A 2IEYA 1R2QA 4TQUS 3ADCA 3FMPB 1J8YF 1NVUQ 4Z8YA 1WA5A 3SEAA 3OFND 1E2HA 1PJRA 2WWIA 4TLBA 1ZU5A 2GZDA 3E70C 5JEDA 3UKDA 1BYUA 4ACBA 2MMCA 1GFIA 4ZV4A 4POAA 2KBEA 3FHOA 1XTQA 1A5TA 4JLDA 4LI0A 5FL3A 1U0JA 4AG6A 5F9FA 2QMOA 5FBVB 2GNOA 2F43A 2VQSA 4HDQB 3TR5A 1LS1A 1RIFA 3OAAA 3T5DA 4HLUC 1ELOA 3DKVA 1H8ED 1P62B 2XZPA 1JEDA 2VEDA 2XNDA 3A4MA 3MMPA 1QZXA 5TB5A 1JPJA 4UNSA 5JRZA 5FPKA 4H1VA 4PAMA 5LBIA 2O8DB 1UJ2A 1CP2A 2FE4A 2G0NA 4F38A 1MOZA 2ZS8A 3K8YA 1IHUA 2X1VA 2FPMA 3B1YA 2W6JD 4MGZR 2PLFA 1GSIA 2VO1A 3B1ZA 2V7QA 3NIBA 1M2OB 4LJ6A 2OT3B 4PC3A 5FOSA 2ZUBA 2QBYB 2LKCA 1CJKC 1O3YA 4DB2A 1E9FA 3U5ZB 4BFVA 3WBJA 2P65A 2BC9A 1M34E 4GOKA 2QENA 2RGCA 4ARZB 3QKSA 4R7ZA 4AI6A 1XXHE 3SNHA 2WWHA 3LBIA 1XFAA 3RWMB 1KY3A 4G5QA 3SZRA 5EQTA 1ZUIA 1Z0JA 2V54A 3EZ2A 1VCNA 4JIMA 4BGDA 4XJXA 2ZIAA 1E9SA 2IHYA 3A6PC 3DZ8A 1KY2A 2IYRA 5FBQB 1Z08A 2CVFA 2PX0A 1LY1A 2WKPA 4N1AA 2NOAA 3FTQA 1I4TD 5E4FA 4M2LA 4Q7JB 4EQ6B 1MO5A 3CRVA 1MO6A 1S8FA 1PZNA 2J3EA 3WP1B 3W6OA 5E7JA 4LJ5A 2GA8A 1JALA 1E0KA 1G5TA 2GEVA 3O8RA 121PA 1GKUB 1W4CA 4OJKA 1HE1C 3AP1A 4UXIA 2WOOA 4J0QA 4JLPA 2ZRMA 3QG5A 2OAQ1 3QENA 4M4SA 3L0PA 2IYUA 2WWWA 2NMVA 3NC1C 4ACAA 2ZRAA 2R6AA 2C95A 3A37A 3GFOA 2JJ1D 4HUQA 1G3UA 1COWD 2A7QA 2QA5A 1EWQA 3OIWA 2WWXA 3LDAA 3VR1A 4ZCIA 4BE7B 2WBLC 3EC1A 1VG9B 1OKKD 4CVNA 1AGPA 1N6KA 4PPGA 3TUZC 1VG1A 3O8BA 1VDZA 4TL9A 2ODNA 2GZHA 4MKHA 1D9XA 5CIWA 2AD1A 4OHWA 1A2BA 1JAIA 1VHTA 1GZSA 5JCPA 2WVJA 5KNBA 1DE0A 1S1CA 4L9WA 4RCZA 1N5LA 2EFEB 4LV5B 2XOKD 3Q7QA 1II0A 2GJKA 1OYWA 3LQRA 5L3SA 3BAFA 4DVGA 2RGGA 4OBEA 5FUVA 1G20E 4GZLA 3IKJA 4JSYA 2ZJ5A 1SXJE 3SQXA 5JS8A 1G8FA 3GEIA 4AG5A 2FV8A 5DN6D 4JSTA 2ZE7A 3D31A 3OF5A 1F60A 1Z6GA 2GKSA 4OK6A 4JMPA 2F55A 1CF4A 1U8YA 4A0GA 2MSEB 5EJEA 5G41A 3IUYA 4CGZA 1HH4A 1FFHA 1XEWY 2V55B 3AVQA 4X8HA 4BFWA 3NBXX 2QU8A 1TF7A 3T1VA 3GLGA 5EZ5A 1G17A 3IHWA 2ZSEA 5KDOA 2DFLA 3BC1A 5B64A 2AD5A 2QQEA 4PPFA 4M21A 3VR4A 2W83A 3QQ5A 1WXQA 3RVBA 3U3RA 1HQCA 2CMKA 4BFYA 4TYWA 2Q3FA 2OO7A 2QPTA 1S3GA 4BLRA 4MGKR 2WZQA 3AM1A 1HEIA 5EP3A 3K1JA 4A0FA 4Q21A 4DLVA 4TYNA 3NDBB 4DB4A 2OZEA 4CYMA 3KB2A 3U3JA 2P3SA 3AVVA 1E1RA 1KGDA 4BLQA 4W9MC 1ZRHA 3AF2A 1KSHA 3KTAB 4JT2A 2OBLA 2WAYA 1GOTA 1N6PA 4RD3A 2YZ2A 1YVDA 3RS4A 3DZDA 4LJ4A 3GJ8A 1FW6A 1OT3A 4F4JA 1E9EA 4DJTA 4WA7A 2ERYA 1K5GA 4GBMA 2VIIA 4OI4A 5CB6A 5FL7D 1IXRC 2IUTA 4PHTA 3NEYA 1EWRA 2MSCB 2ODEA 3FHCB 3LW7A 2CJWB 3HPRA 1RPZA 1KDOA 2G0TA 1R7RA 4TYYA 2OFWA 3P4XA 4URYR 2NPFA 2BKUA 2PX3A 2P6NA 5AK0A 4A82A 2J9RA 2QRNA 5E3HA 3PEYA 4KFSA 1R4AA 4Q1CA 5DH9A 4M1WA 3HR8A 1Z5ZA 1US8A 2BBOA 2HUPA 2YWGA 4BASA 5JCZA 2GWHA 2FOLA 1DAHA 4WAUA 4WW0A 3B13B 1KSGA 3AKCA 2JEOA 1LF5A 1XP8A 2QGZA 1E94E 3B2EA 3PUYA 2G83A 5HKKD 3CRRA 5JI2E 4AKHA 4HEJA 4F92B 1AS2A 2IBMA 2XEXA 1R8SA 3BBPA 1VYUA 4PZLA 4M0LA 4O25A 4Q66C 3MWKA 3W6PA 1N5IA 5LB2A 4WVFA 1W47A 4IVRA 1HE8B 4IKEA 4YXWA 2DCUA 1N6IA 1MR3F 2ZRJA 8OHMA 2IYVA 3P20A 3Q5EA 2O8EB 1I2MA 4CDGA 1E2KA 4MKGA 1FUUA 1UBFA 2NTYC 1HQYE 1E98A 2WJIA 4M1KA 4C0JA 1RC8A 2QMEA 1KZ7B 1KO8A 3MLEA 1H8EA 2ZTSA 3CRW1 1Y63A 4TYPA 4DBLC 2P6UA 2FF7A 2DWPA 3DEFA 3M0EA 4Q4HB 5J4KA 4IHQA 2C5LA 4Q1DA 5L3QA 1KJZA 4QM6A 821PA 3QXSA 5TVKA 4YDHB 1JR3E 2BBWA 3DKPA 2OM2A 2GJ9A 3AVOA 4NYMR 2RGDA 4Q1FA 2D7CA 4JLAA 4PHHA 1N0UA 5FTMA 3EZ9A 4P32A 4OJQA 4D6PA 4QHSA 5G53C 4JLJA 1YZLA 3GLIE 4FMCF 3WRXC 1CEEA 1ZM7A 4KFRA 3FWYA 4DLUA 4AYXA 4IDHA 1SHKA 3HU1A 4DCTA 5P21A 2WJHA 1YR6A 1D8TA 5AR1A 3T34A 4ZI3A 1E0AA 3AVPA 3OE7A 4UNNA 1KDTA 1GNQA 1N6LA 1T6NA 1A2KC 1H65A 1OFUX 2GJ8A 2ZVQX 3OEHD 1DO0A 2WOJA 3TAHA 1TQ6A 4ASUA 3ZZ0A 3CLVA 3HU3A 1SVIA 3VU9B 4DZZA 4P4SB 5LD2C 2V3CC 4B6EA 1N5KA 4P0TA 1UBCA 3IPYA 4KJZA 4MGYR 3GCGA 5G3YA 3U60B 3KFXA 4LYJA 3SFZA 2G3YA 3RS7A 4BWYA 5HE9A 2D2EA 1KI4A 1Q1ZA 4NONA 4NDZA 1WQ1R 5UKDA 3I4LA 2A2ZA 3BH0A 2ZU0C 2QP4A 1G7TA 3TQCA 4EPTA 4DLRA 4LV8B 1XMVA 2ONJA 4WXPA 3ZVRA 3A1VA 3I5XA 1TU3A 2QP3A 5A4JA 3WNCA 5AUQA 1EG7A 1DELA 2GXAA 2HJVA 1W2GA 2ZE6A 4HUQB 3V9PA 1DO2A 1P7CA 2FFAA 1W0JD 1KK1A 4KI0A 3NEJA 1N0VC 5EZ6B 2MMGA 3B1VA 5KSYA 3BIFA 1MABA 1UDWA 3B6EA 4TL8A 5E95A 4HLQB 2JDIA 1WBBA 3KQUA 2OAP1 5ANRB 1CRPA 3OAAD 1EFHA 4QGFA 1UKYA 1TADA 4H9GA 5KU1A 4ZKEA 3N70A 2F3RA 2GBLC 2JJ8A 4IOMA 1AJEA 3KJHA 3R7WA 2CCKA 3SJCA 3QPVA 3T06B 3OIUA 1U90A 4F91B 1HT1E 1UKEA 5J47A 4F93B 4HDOB 2ZI4A 4LOAA 3QSYA 2OE2A 2R6FA 4Q1BA 2NQ2C 3GLGE 3ADKA 4HYYA 4NYJR 5L3RA 1UBEA 2ZI6A 2PBRA 4URWR 2GF0A 3ND9A 3L0IB 3OEHA 4YDSA 2P67A 2O5VA 3T5GA 3WBKA 1XCMA 3NXSA 1RFLA 1FMJA 1S4QA 3E1SA 4IXNA 4XVUA 3TR0A 3FFBA 3VU9A 1SXJC 1FTSA 3SI7A 2FFHA 1KO5A 1QG4A 1UF9A 4HLCA 1X86B 4ZDJA 1GTVA 2H8KA 2Z5FA 1QHHB 2DY1A 2WM9B 1I4LD 1U98A 3KXLA 3R9XA 4N0EA 5GVRA 3W5IA 3EW9A 2VF8A 4M9QA 5SZIA 1Z6XA 2VP6A 3ZJYA 4Q9IA 1CJVC 2LWIA 2JIZA 3LWNA 2F1JA 3EPLA 4OQNA 4O3MA 1NN5A 1S0UA 1OH7A 2ZM5A 2AKYA 1NP6A 1D9ZA 1K6MA 2J7PA 2ZI3A 3H4MA 5L3VA 2GDJA 2FA9A 5TDHA 4R9UC 1YU9A 2P2LA 1DARA 1J70A 3BFXA 4PANA 4RD6A 4B35A 4UNQA 3AB3A 1ZC4A 1FX0A 4FMDB 4KYUA 4F4CA 3W8NA 1NVWQ 3PQCA 1NY5A 4UXJA 4WOPA 1SZPA 2IS1A 3GLIA 3CF6R 4XD7D 1DTSA 1E2IA 1W44A 4Q4JA 5EXSA 3LLMA 3IQXA 1GL7A 3ND8A 4FMCB 2R6CA 2ZROA 4E03A 1X1RA 2V6IA 3O8CA 4MRNA 1GAJA 2ANCA 1H8HD 1JXMA 1FOEB 2Q3HA 1L7VC 2AR7A 2JIZD 2CLCX 5B30A 1GITA 1E69A 4OQLA 1JR3A 1JJVA 3NBZC 2CNWA 1Z3IX 1LB1B 4B3CA 4LJ8A 2X19A 3U44B 3TNFA 2YJTD 2FSGA 1JAHA 3TSWA 1E32A 3IDQA 5J4HA 2REXB 1W46A 2QAGB 2ZSBA 3A1SA 4LBYA 4PPNA 3I5YA 1GIAA 3Q9LA 4US0R 1I4DD 2Z4RA 2ZI9A 2FSHA 2J0VA 2ZU6A 3B78A 3W5JA 1IY2A 4LYFA 1Z28A 1G21E 1NMZA 1OXXK 4FCWA 1T3LA 1BIFA 4MRPA 4PPQA 3BXZA 3RANA 4CF7A 1J7KA 3AKYA 3I72A 5FFMA 4TSFA 3WYFA 4X8LA 3GLIB 4P33A 3LY5A 2ZJZA 2IYWA 2FFBA 3FGNA 5JRJA 3P1JA 1XMSA 2KE5A 2ZSDA 3FE2A 4FXPA 1ANKA 5HZHA 4A8JB 1E9AA 2GXQA 4JL5A 2GCNA 3CKLA 2CE2X 4Q1EA 4TMTA 4PC7A 3KUCA 4D4JA 4RJLA 4I99A 2KBFA 3SU8A 1CS4C 2EFCB 3AVYA 1OIXA 4S2EA 4YMTA 1ZNXA 4KAXA 3VAAA 1E1QD 4OHVA 5EE3A 1E2DA 1M7GA 2GBLA 3K0FA 4IFEA 4GPTA 1NY6A 1GRQA 1BMFA 4QL3A 5CDFA 4F4IA 4TTPA 5AUNB 1V5WA 4Q7MB 4XH9B 3RHFA 5IHPA 4AYTA 1NKTA 2VP4A 3B1WA 3X2SA 3MUFA 4EKDA 1MRNA 4P4SA 3I73A 1G7RA 4A15A 2W6JA 3BJIC 2BHRA 3SBDA 4IOKA 1MH1A 3QUSA 2J0UA 2WJGA 3OEED 4OYHA 3CZPA 2AWOA 5FR2A 5JJKA 1JI0A 4U5XA 4Q47A 5C18A 1SHZA 1LV7A 4BLPA 5DYGA 1DAGA 2ONKA 3QE0A 5C46F 3KZ1E 4C0KA 4D25A 2ZRPA 1P9NA 1OW3B 2GEDA 4E09A 1TPZA 1OJLA 4HB2A 1BO6A 1F5NA 1IM2A 4NMMA 3EWAA 4ESHA 4R98A 4Q03A 3Q3JB 4GMXA 3T1OA 4N0DA 1FQKA 5EE1A 4JVSB 5D3QA 3OIVA 2GAAA 4K8OA 4LWZA 4S35A 1QHGA 3C5CA 1NG1A 5J4YA 1S9HA 4EFNA 4QBIA 2C03A 4MGIR 4RY2A 3EXAA 1ZIPA 3ZS9A 1IJFA 4KU4A 4LGMA 3PEVA 2J7PD 1W48A 4RZXA 2J87A 4IOLA 4PO8A 4B2PA 1MABB 4BFXA 4O2RA 4Q9HA 3N2IA 5JHGB 1KMQA 2QORA 3A1WA 4DSUA 3DMNA 1R5NA 2C96A 4ZCLA 4ABYA 3ECCA 4GMDA 3FKSA 3BK7A 3QXCA 3WMGA 2WIAA 1ZM2A 3KL4A 2QE7A 1G3MA 2QTFA 2YKGA 3GLHE 2OCAA 3ZZTA 1CR2A 4A1FA 4NU0A 4BEJA 2Q6TA 4GP6A 1G6HA 2LCFA 2DWQA 3HP1A 1F2TB 2CK3D 3DOFA 5CJ2A 3T1QA 2Z4SA 1Z22A 2WJJA 1SXJA 4TLAA 1G8YA 3ASYA 1UBGA 3C4JA 4FN5A 4B71A 4QFMA 1UDXA 2GESA 4PXAA 3CX8A 4EJSC 2QE7D 3PJRA 4GOJA 3B9PA 4JL6A 1ZD8A 3CNLA 5H8WA 4URXR 2XGJA 4D2IA 1G8HA 2W00A 1KDPA 1TQDA 5CLLA 1AZSC 2GJSA 5DISB 1IN5A 1YZUA 3BFKA 2Q9AA 2O8EA 4X8MA 1L4YA 3GJ0A 4Z1MA 1ONBA 1VG0B 2GAOA 3QXJA 4M1SA 3U7GA 4UXHA 1A4RA 2X77A 3EASA 2IS4A 1Z6TA 4BLOA 1J2JA 4B32A 2G9NA 4HZUA 4MA4A 2GCPA 1YZKA 1VIAA 4O2LA 2GZAA 1Q57A 3T12A 4A2WA 2ZE5A 1GRNA 5F98A 1E2EA 1UEJA 1NG9A 1ZCAA 3QNUA 2X2FA 3SHFA 1QBKC 5AJZA 2RGBA 3O8DA 4NCKA 2IEZA 4BFUA 4A0RA 2WKRA 4L4UA 2H57A 1DAMA 1GP2A 2B8WA 2IF2A 3Q7PA 4I1OA 2NPIA 4JBXA 2IF0A 2EQBA 3KQNA 3DOEA 5FTKA 2AKAB 3THOA 1CLUA 3BS4A 3K0AB 2FEMA 1AKEA 1SVLA 1QDEA 2BCJQ 3M4YA 3FOZA 2B7CA 1N6NA 1E4VA 2IXGA 1SGWA 3R7WB 1N0WA 1ZW6A 2QGNA 4NZYA 2ODBA 1UADA 2QT1A 1QG2A 3IIMA 4JVNA 1U0LA 4G5OA 3BRWD 4NCHA 1NI3A 2XNDD 1XPOA 2NG1A 5FPSA 3UG7A 1XBTA 4BZXA 3V4RA 4MQBA 4XIGS 1Z47A 5B2ZA 3LV8A 4US1R 4LC1A 4A8JA 2Q21A 4HZUB 4DLXA 2QNRA 4IOJA 2J5XA 1UAAA 4LJ9A 3LAWA 2Y8EA 2PZFA 4DCUA 1NJFA 3B7GA 4OL0A 2BMJA 4E07A 1YR7A 5JSZA 3ETLA 4KFUA 3QBVA 4DDUA 4FCTA 3IEUA 3G82C 3GLFE 5C4MA 2DWOA 3HU2A 5IDVA 1Z0AA 2ZANA 1KSJA 2QN6A 2P5TB 1TQ4A 5JWRA 1P73A 2W0MA 3ADBA 4URVR 4IEIA 1K5DA 1KOFA 3H1TA 3JVUA 2IK8A 4LK2A 3SJBA 2WKQA 4M22A 1CIPA 3QVVA 4Q00A 2ZJ2A 4EQ6A 3QI2A 4KHZA 2E87A 2O8FB 1NIPA 3KB1A 2OLJA 4MUBA 3RRNA 4B3DA 1OB5A 3WYAA 1T0JB 2HF8A 3AVWA 2IWHA 1JR6A 5FUWA 3EA0A 4WXRA 1MRSA 2W2XA 2B6HA 4BLTA 2EW1A 1TX4B 3KX2A 3PUWA 1GKIA 5BWMA 2WTUA 1S1MA 1XEWX 2HXYA 3FMIA 4LJAA 5FTNA 1KTVA 2G88A 1MV5A 3KJEA 2ORWA 4KLNA 2YWFA 4KVAA 2NO0A 5CK4A 3RSOA 4E22A 4GDFA 4IEEA 1G1MA 1OFHA 3BB1A 4B47A 2IYQA 1G3RA 2QBYA 1Z0FA 3ZQ6A 1CR4A 1FP7A 3LO5A 3ZS8A 1R5BA 3BE4A 2J7KA 3IGFA 4JLBA 5CB8A 4ARZA 1X8JA 3CX7A 3W6NA 4DHEA 2XXAB 2VF7A 1TMKA 1NRJB 5C1BA 1B23P 3MWYW 3NKVA 4DT1B 4DC9A 1KO7A 1TL7C 3A1UA 4CIDA 1BKDR 4FCVA 1YQTA 3OHMA 3PV0A 4G5SA 2F43B 1CTQA 1G3IA 4CEJB 1CXZA 4HLDA 1AA9A 1DOAA 3DM9B 1DAIA 1T8TA 4PHFA 4LZZA 4PO9A 4QBGB 4IDOA 4XSGA 4NH0A 3UIEA 1E3MA 3K9GA 2QAJA 2IYZA 1XTSA 4URZR 4ASUD 1Q12A 5KNCA 4FWTA 2V1UA 4TTRA 5EXTA 2FPKA 1IXSB 3KDSE 3TSZA 1TEVA 1U8ZA 4BZQA 1Q21A 4FI3C 3P32A 3DL0A 4NYJQ 1D5CA 1RE0A 2C78A 2ZRHA 1NMXA 1OE0A 1OFTA 3QPUA 2DPXA 2OFXA 2QPAA 1KNQA 3QVUA 3RC8A 4LYHA 4AWXA 5FPYA 4NL4H 4P4TA 4DEXA 1SVKA 3K9LA 2CXXA 3NBFA 1NIJA 3AKEA 3GMTA 1GNPA 1M6NA 2IHBA 1ZC3A 2RGAA 2YVUA 1KNXA 1HV8A 5L8VA 3U3KA 3U6BA 4A92A 1LW7A 3VR3A 4JYCA 4ZPXA 1II9A 3W90A 1KIMA 3S1AA 5FTLA 4C0LA 4TMWA 4C0SA 3REFA 3I32A 1DG1G 1G5RA 1KMHB 4NTZA 1NN1A 3KJGA 3G0HA 1ZVQA 3E5HA 3K09C 1E4YA 3PUXA 2ANBA 3BB3A 5EE5B 3SDZA 3B85A 4KBFA 2FNAA 4Q5IA 1E2FA 2DR3A 4AKIA 1E2PA 3K0EA 3KQHA 3THXA 4M8NE 4LJ7A 2ZYWX 4D4MA 1OFIA 4ITRC 3AVXA 3T15A 4LC0A 3X1DA 3GLHB 1SULA 3U4QB 4EPWA 1FMLA 2VP0A 2G6BA 2L0XA 2IYLD 1YRAA 1A1VA 1OIWA 4QHYA 2JAQA 4QJ3A 3WY9A 3NTUA 4FINA 4MDEA 1E9CA 2OG2A 5TY0A 1Z2AA 4R2IA 2VP2A 1NNEA 2GK6A 2V7QD 1E96A 2F7SA 2V6JA 2Q0HA 1W0KD 2W6ID 4V02A 2QUZA 1A82A 1XCPA 3RRYA 4XWKA 3DPUA 3PCRB 4TLEA 3JVVA 1VYVA 3KFVA 4NCNA 2N1BA 1SVOA 3VX4A 3GJ4A 1YJ5A 2J46A 4RKEA 3TLXA 4QGAA 2J59A 3CH5A 3THXB 3CR8A 2KB0A 4MITA 1GVNB 3CUEF 1BS1A 1XRJA 4OHYA 1DVRA 2IW3A 2FU5C 3QKRA 4KSBA 4C0QC 4HSEA 2VL7A 5AJXA 1CKEA 1F2UA 1G19A 3X1ZA 4B3FX 4RZ2A 4JLNA 4ESVA 1OXUA 2GK7A 2VBCA 3RS5A 4D0LB 3ZGXA 3ZD7A 4KLZA 1E2QA 2QL6A 2ZETA 2CLSA 1W36B 2WJYA 2A78A 4G1UC 1KI6B 5AWFC 5K8LA 4AKEA 2D3WA 5J4LA 4CEIA 3FFAA 5H70A 3CRQA 1U0HC 3GQBA 1KK3A 4DCSA 2JLYA 4NYIR 4Y0VA 3H0KA 2F1HA 2Q3MA 3U7EB 3P27A 1ZINA 1HURA 1D6JA 1W4BA 2WJVA 2JLUA 1T4GA 1KJYA 1NBMD 1QF9A 4EPYA 1P3JA 1YZTA 2OBMA 3QOFA 4C0HA 2O8FA 3HJNA 1LNZA 2YOGA 1DEKA 4R2HA 2A5JA 3D3QA 3NDPA 3CW2A 1FQJA 1R0WA 2BVNA 2ZYUX 2Z6VA 3R9WA 1AS0A 2WIBA 2BMFA 3E2IA 3D7MA 4GI7A 5IK2D 2JLWA 1N3BA 3QIAA 2C04A 1CJMA 2F1IA 2IUSA 5ELXA 4LHWA 5DE3A 2C2HA 2FX3A 2V1XA 2GTPA 2GXSA 1UFQA 2XOKA 3OEEA 1UPTA 4JJZA 4UQOA 2ZUCA 2GJAA 2J1LA 3AQ4A 4RSGA 1S3SA 4NHOA 2ZSFA 5FR1A 1L2TA 2N46A 3IEVA 1OH6A 3KKQA 4JKIA 1SXJB 3WNDA 2B7BA 2FGJA 4MYCA 1C4OA 3CM0A 3CZQA 3SS8A 1W7AA 4Q02A 1QHNA 3AH8A 1E79D 1VMAA 4PAQA 5L3QB 4KVGA 1VG8A 4TLDA 4JT4A 1P2VA 5IK2A 1U81A 3M6AA 1RYHA 1Z0KA 2W2TA 1NJGA 1EFTA 5G3ZA 1T91A 2PZEA 5CYOA 4DIDA 1WB9A 2JLXA 3NC0C 3GFTA 4QC2A 3K70D 4WBSA 3PIRA 1GILA 2BJWA 1TNDA 3MAAC 4DRZA 4PZZA 4KBGA 4ZIRA 1NBMA 2ZAMA 4JL8A 2F9LA 1OXSC 1ZD9A 3KKOA 5DI3B 2EYUA 4NPHA 2JJ2D 2ZJAA 3AKDA 2OBNA 1ZUNB 4W7SA 5IRCD 3HYRA 5EUMA 2V9PA 1E6CA 3RS3A 1JEEA 5C2JB 1OV4A 3QEJA 2NO7A 4C30A 3ZVMA 4M1YA 2ZQ5A 2XTZA 1KK0A 5TV2A 3K0CC 2C99A 5GJCA 4OQXA 4IW3B 2AXPA 3C14C 4TMXA 3W34A 3W8RA 5AJVB 4DWJA 3TW8B 2PJZA 3QEOA 4ZDIA 5FOWA 5JLJA 3HWSA 3A58B 3CIOA 4QGHA 1QHSA 3GJ5A 3P26A 4L9SA 4Q4AB 1P2TA 4PC6A 4D82A 1OHHD 1ZP6A 2RMKA 3CX6A 3WNBA 1PUIA 1AK2A 1VKJA 2F3TA 2JCSA 3BFVA 421PA 1YZQA 4IFBA 3QKUA 3QY0A 4TZ6A 1TUEA 1JB1A 621PA 5K8IA 2CCGA 3GJ3A 4C9BA 4O0MA 1AKYA 1K8RA 1KSFX 4QGGA 1W0JA 1OYYA 3VMFA 2Z83A 5FUXA 2GVDC 3CPJB 3LQQA 3U61B 3EIHA 5CITA 4YMSA 2REOA 3FMOB 4C7OB 3IBGA 4H1UA 2J0QA 1BH2A 2PEYA 1FNMA 4OQMA 4TYQA 4A0HA 1DG3A 2IA5A 1Q1BA 2QM7A 2ORIA 5EE9A 3SHWA 3W9YA 5JEEA 5BYJA 1R0ZA 4G3XA 3PITA 3MWJA 3TGPA 1ZBDA 3ICEA 1YHNA 4D0GA 4MYHA 2H92A 3MD0A 2FH5B 1R6BX 3PR1A 4V0ME 4TMKA 2AN9A 1TF2A 4XTCS 1AQUA 4DDWA 1HYQA 2QTHA 3CNNA 3Q5DA 4YMUA 1U8AA 4QM7A 1XEXA 4RD2A 5LB4A 3VQTA 2IS6A 2EYQA 3SYKA 1WCV1 4C2TA 1M7BA 2HYDA 5K8UA 4TWZA 2W2VA 1LS6A 3LX8A 2BDTA 2WSMA 2P6RA 2IT1A 2D2FA 1KI7A 1RJ9A 1VCMA 5HZKA 1NN0A 1ZIOA 4PC1A 4EPXA 3LD9A 1Z8FA 3RC3A 1XJ0A 3EZ7A 3ONWA 2QROA 2W0SA 3B5JA 3G5UA 5GJVC 2XJ4A 5DGXA 1XZQA 3UG6A 4HUTA 4PHGA 4P4UA 4A9AA 5JI3E 4C2UA 4PR0A 1E2LA 1NVVQ 2XTNA 4AD8A 3TMKA 3L2OB 5B58C 3VR2A 3UMSA 2VLIA 4EAQA 1FX0B 1P5ZB 2WHXA 4MRRA 4D81A 1E9RA 4ZCMA 3F3YA 3VX3A 4WZBE 3RYTC 3L0OA 3ZDQA 5D3MA 4PSAA 5JS7A 3IO5A 1RRGA 2OXRA 4UNPA 2H7VA
chains in the Genus database with same CATH superfamily
2B8TA 1VMEA 3OPYI 2R62A 3G85A 3NWJA 1ZUHA 2HBRA 5LFAA 1PJLA 2OAGA 5AQ1A 1Y89A 3HEMA 4TRMA 2Q9BA 3C3MA 1C1XA 1M83A 1SCKA 1UPXA 2C4MA 2H31A 4N3NA 4Z8XA 5KNCD 1H9CA 3LUFA 1OF1A 2YIJA 2C2XA 1EFRA 2FW1A 1ICIA 1U3UA 3EIWA 2ZYTX 3FCOA 1E9DA 1SVWA 1O58A 3AIKA 1CJTC 1PFWA 1T1IA 5A5FA 3L0SA 5SV2A 1Z5PA 1QGUA 3JZFA 2YW2A 3AFHA 4W5QA 1AIPA 3L8DA 5A3VA 5HG0A 4XWTA 4DV4B 2I62A 5JZSA 1AGXA 4PQYA 4M7WA 3ZUGA 2D6FA 4BAZA 4YXFA 1NSTA 5KPJA 1GZHB 4INZA 1M8JA 2VK4A 4HZIA 3GAMA 2ZSAA 5LQKA 4DR5B 1I2BA 1PSZA 2V3VA 4LRQA 5DI3A 3QSGA 3IILA 3RYHB 2XZOA 2Y4NA 4BYGA 3PPXA 4H3HB 1JJIA 1TQHA 1Q7RA 1SCUB 2GTIA 2V9CA 4KK4A 5DT2A 2YHSA 2CDAA 3ZY5A 3C6QA 5KBYA 3LX6A 4Y2VA 1CDEA 2ZE8A 4P3KA 3VC7A 1HDRA 4RV5A 3OT5A 5DU2A 4L51A 4OM7A 3BB4A 3LG2A 5C4GB 4R1UA 2QUBA 2CV2A 2RHHA 3LCVB 2Z3WA 1I3NA 3NVDA 3UMBA 1Z5WA 3RDPA 2C54A 3IAM6 3ZU3A 2X9LA 3C45A 5F73A 3H1FA 1VCOA 3X1MA 1ESZA 2O2ZA 5HHTA 3NT5A 3PVCA 4DSNA 3ME5A 1J8QA 1V6SA 3OIYA 4NCJA 4OUKX 3ZD9A 3RADC 4HGYA 4BX9A 4PTLA 3SJUA 4MTCA 4JEMA 2FG7C 1KVSA 1PT7A 2AX4A 1KVRA 1GFWA 1QH9A 2OOKA 3IDFA 1VE5A 1GL9B 3NG1A 5DCLA 3SSMA 4CHTA 3HBLA 4XDGA 4UU8A 3VDXA 4Z4FA 1WU8A 3D5TA 4U7JA 1FS5A 1DIHA 3R7SA 5NLLA 2D06A 2GX6A 2J0SA 2IDZA 1X8KA 3I37X 4LI3X 2GHIA 2GDZA 4HDSA 4ZOBA 1MEEA 1XMIA 5J5CA 1NVVR 2D2IA 3FDIA 1X14A 3LCUA 5FX2A 1IY8A 2C2ZA 4A23A 4Z0NA 3E8XA 3AY6A 4OLHA 2JH8A 5DNWA 2ZCJA 5FCDA 1EZ1A 1L5WA 2FN3A 3VRHA 3RVSA 2DKFA 1CUYA 5IHXA 1EK0A 1X7XB 1VSTA 3R3SA 2EJCA 1R8QA 4LVOA 4QEKA 3GP8A 2BEUA 1E0JA 5EIWA 3A6HA 4G4GA 4EW6A 2Q45A 1XNJA 1UFRA 1WM1A 2B8JA 2ZEJA 4TTVA 2Q4EA 4S24A 4KOEC 4C0WA 1EDOA 1DJNA 1L5VA 3FPCA 3L92A 5DK4A 4G0YA 4LHZA 5PNTA 1A71A 3EFHA 2VSXA 1OXVA 2CBZA 3UOGA 3O0DA 2H17A 3RS9A 1EX9A 4HOYA 4O4LF 3AHHA 4EHLA 5KDDA 4GMHA 1QRAA 2VHTA 3ECAA 2WT4A 3R24A 2HWXA 3L8CA 2JASA 2BHSA 1RZ3A 3EXIB 3WE7A 4F2WA 1XTJA 3I1IA 4LPSA 2QMUA 2AMYA 1ZJ5A 3VDRA 4LF7B 4R54A 3MRSA 3H2YA 2C5FA 2IITA 4ZAVA 1PQWA 1H69A 4M87A 5CT5A 3S7TA 1KXZA 5IT5A 4LFCB 1F17A 4HDSB 1QUEA 1YZGA 3GB9A 2BN4A 3SS7X 4LY3A 4PQFA 2D8MA 2HY7A 1XX6A 1IBKB 4R05A 3FOAA 1BYIA 3E3OA 4I3GA 4RTLA 1D2EA 3FFWA 4HB4A 3O1LA 3F49S 5CH3A 3PEWA 1O1YA 2EFHB 4PLCA 3QPBA 2F64A 1YR9A 1GLNA 1YQDA 1M73E 4HN4B 2B5OA 1NUQA 1V8DA 5FAXA 4EEZA 4ZEVA 1QYDA 4LJYA 4TKUB 4CLOA 4BKQA 7AT1A 4M1EA 4C7OA 3PUZA 4RGYA 5T64A 4ZMBA 4IF4A 4IEFB 1A2QA 5JAZA 3QNMA 2C2BA 2JCBA 3OOHA 2B4AA 3DYIA 3UUGA 2Y6UA 3ZK9A 2QAGA 4NG5A 3U7HB 1GRRA 4GX2A 1TVEA 2E4UA 3JQBA 3SEQA 5IZ4A 1VKNA 3TRJA 1VLMA 2OORC 1HZJA 2QUKA 4E88A 1PJZA 3HCOA 1JU3A 1ZGGA 3NALA 1VCHA 1H4TA 5KOHA 3FNIA 3VH4A 5EP2A 4BP3A 5B6PA 2DULA 1EX7A 4KSYA 4OAQA 1AKNA 1MJNA 4DMRA 1J39A 2C8JA 4P34A 2AFHE 1G7SA 1YKGA 4DC1A 4GL2A 5CVJA 3D8BA 4BZPA 1CZLA 5AJTA 2WSBA 1NBWB 4FUQA 3VNQA 5FA6A 4D99A 1GGVA 2VZ0A 4L7VA 5JR3A 3UPUA 3DFIA 3BJZA 5IW8A 1S7CA 4L3WA 4NQRA 3QOYA 4L07A 1T5LA 2V4ZA 5F4BA 1P0FA 2ZYAA 2HPVA 3T1YB 3U7IA 4Q4JB 3W5VA 4YMHA 4MR8A 4W5WA 2VHQA 1EZZA 2JIQA 2YZNA 4PYLA 3DCIA 4OUDA 3SKVA 2ZTMA 3MLBA 1A7JA 3KZXA 2C9DA 2WAOA 4LDPA 5ES3A 3V8NA 3VZSA 4X7RA 3USES 2B4KA 3E9NA 2C88A 4Z3KA 3OJLA 3UJBA 2AHOA 1BXGA 1QB7A 3NP9A 5HKKA 1FP6A 2DKNA 1B93A 4A2PA 4CT0A 1L8LA 1OVMA 3BERA 4QXQA 2JA2A 4ENTA 2VDVE 2OPBA 4BTEA 2IXBA 3Q8XB 4D79A 5E7IA 3ZK8A 4E4TA 1H9BA 4ND8B 1P9WA 2FQXA 3K1ZA 3KPVA 1NTOA 3O90A 4RD1A 1KEEA 3LCJA 5D3MB 4ILKA 4AZ3A 3UJ8A 1RHMA 3NAQA 3RSQA 4FZRA 3ZHBA 2DBRA 3ITDA 2P9YA 4M6WA 1JDTA 2YXBA 2H9AA 2PNJA 5ALNA 3T5AA 3VPSA 2X40A 4YNBA 5IT4A 2QM0A 4NABA 4OL9A 4HYEA 3L7OA 4OYYA 4IJVA 4DDKA 1X42A 1X80B 5GMOA 1P1IA 2GPAA 1QQ7A 4J1QA 1CUVA 4O4JB 1W19A 3K72B 3AEYA 2PZ8A 5B3JA 2Z98A 5LWQA 1XMOB 1QCCA 1YE8A 1A5BB 2J85A 4KQJA 2PD3A 4F4UA 2AUMA 1KEUA 4MW0A 1RQNA 2ORVA 3ZCRA 1SBHA 1ZMBA 3MRXA 4BMCA 1UAGA 5H3HA 1CUWA 4BP1A 4I50B 3V00A 4YR9A 1PFUA 3A4TA 1WOYA 3UFXB 4DIEA 1TJ4A 4KWTA 1KEVA 1F7VA 1CUDA 2HF9A 1TYCA 1H0HA 4PFSA 4RZHA 1Q3TA 3MERA 1PLJA 2HBZA 3R3ZA 1M6HA 4L8GA 3W3ZB 5LD2B 1MC4A 1Y8QB 5BV8A 4NE2A 1SCUA 3FKQA 3EVBA 2GF2A 4KYIB 4D45A 5BRJA 5DWVA 1U6KA 2BM0A 4NVRA 1XK6A 4KUEA 3STWA 1JXOA 4QFDA 2E0IA 3H8JA 4HAVA 3RRMA 1N77A 1ULUA 3W3AD 5AT1A 3HB9A 4L5JA 2B9EA 1U7UA 4OXKA 3WXBA 1Q84A 3DEZA 3KSMA 3LXXA 5SY4A 5B57C 3H9QA 4NFLA 2IKQA 3MT9A 5FBKA 4QOEA 4D9CA 2VXCA 5A9SB 4MAFA 4UEWA 3IOBA 1QOPB 5LZ9A 4E6PA 3JARA 1GA1A 2D1RA 4QUDA 1P60A 3F6EX 1O96A 2UYCA 1UEXC 4ARCA 4F9FA 3ER6A 1JQDA 2FEKA 5G0UA 3HY3A 1Y5LA 2FW0A 2GPSA 3A6KA 3EGOA 4CT5A 2PH3A 1R18A 3G79A 4LY6A 3SR4A 3KYIB 3GAAA 4TVSA 4O4LB 3ZDZB 4DY6A 5DPMA 1E3EA 9LDTA 5JSFA 4OFBA 1N7GA 3ILXA 3Q88A 4XFKA 4B4VA 1CJUC 1GUZA 4MUGA 4D3DA 4UMDA 1ZRMA 1H2HA 1WS6A 5DGIA 5AI0A 4I4LA 1Q19A 1E6MA 1IJEA 3PKJA 3OVMA 5FADA 4AJ4A 5E2AA 3OCZA 3QTLA 4GP7A 1CEYA 2QM3A 3ASZA 4BIIA 1TYDE 1LSJA 3GFVA 1XJQA 1Z13A 4RVHA 1O87A 1UDRA 2WFLB 2XV1A 1N6RA 3U7QA 3UH1A 4B8ZA 5A0FA 1C8VB 5C5EA 3S2FA 4YUWA 1BWPA 1J5PA 1B16A 1DHRA 1E6WA 1R0CA 4JVOA 7MHTA 2IZ6A 2OV8A 2R8XA 3H2ZA 3MA0A 3L18A 2OCXA 3U16A 3DONA 1M6VB 2C29D 4U7HA 5BVGB 1H1TA 1P1BA 3HLYA 1XD2B 5ERYA 4LYYA 1P72A 1QFXA 2I6UA 2JLRA 3C7KA 2WMDA 1SZCA 3F96A 4U6NA 3TMYA 4J07A 3OX4A 4CHGA 2J45A 2WVGA 3A05A 3ZHXA 3R5SA 3UK6A 4MYTA 3BMOB 1SBQA 2HDWA 4JNCA 1V6CA 2YQ5A 3H6GA 3L1JA 4RSHA 3U7FB 3W5AA 2E3JA 1RM3A 3AJEA 2XRYA 2Z2XA 5DHAA 3V7UA 4I9HA 1XCOA 2XXBA 3VH1A 4BRUA 1ETUA 1KEKA 1FRNA 4MP3A 2I80A 5BSWA 4J0DA 5C5DA 3PGKA 1MU0A 5FBWB 3M6XA 2R68A 3QU4A 4E5UA 2ZRQA 3JQEA 3T7KA 5JLJA 3VI4B 1RYZA 4FYXA 2QW1A 5F1OA 3K2BA 4RVNA 4YJHA 1RRPA 4DDTA 3P52A 1GQSA 2DH5A 4RTRA 1VLQA 2QPLA 1CRQA 1X74A 1C7IA 1MBZA 1WXXA 1N25A 3BHMA 2PLNA 3IAM1 5JS2A 5F3DA 5EPOA 3V33A 3A9TA 4QBHA 3VOBA 3AF5A 2RGNA 4GZ5A 2CL6X 2AXNA 4BFTA 1M7HA 2D4HA 4D4IA 4XWWA 3FD8A 4UMVA 4C5BA 4P9NA 1E2NA 2QT0A 4RS4A 3B12A 4WJKB 1CR6A 2Q5JA 4B82A 2QJRA 3CW8X 3MWEA 4FFSA 3SF8A 1Z63A 2G5CA 1F0NA 2W2LA 1HEUA 3JQAA 4NV3A 2P2CA 5KNDD 2CD7A 1UK7A 4L5BA 3BD7A 1XWFA 3DR5A 3NH9A 3EFOB 1OZFA 2OV3A 1C41A 1B2LA 3WIUA 3QF4A 4J4HA 4EJSB 1KRXA 5A6SB 2FZCA 1LU9A 4R81A 3RQSA 4DAOA 2CNWD 4RA9A 3IDSA 1EH5A 4INJA 2OORA 3T5PA 4PICA 2HNAA 5IAAA 4GNRA 3KQMA 4BECA 5ITZB 1IOLA 2QRJA 4EO4A 1Z2DA 1GNRA 3QPWA 5KX5F 4RKQA 3A11A 1EUDB 4OM8A 3FHJA 4ZKDA 4HH0A 5JS1A 3URKA 2D7JA 4RUKA 2JAPA 4Y0AA 3S2ZA 3WGUA 3GO4A 3ET4A 3SYNA 3ZHTA 1K9VF 1EBBA 2HA0A 3PCXA 1XZDA 3JX9A 4G6ZA 4YK7A 5AI8A 3AU8A 1PP4A 3L04A 4I6JA 3O3MB 1OX4B 3CXRA 2GB4A 3D3KA 4UCFA 5IXYA 1KOLA 3DQPA 3KNZA 4CKZA 4Y2GA 1Q7GA 4PZYA 2Q46A 2EWVA 3PYXA 4KPUA 2IKSA 4O4IB 1VBNA 4PLVA 5BRAA 5J2TB 5CNKA 1E7RA 1E63A 2VJKA 4WNIA 3DEHA 5I4KA 4IBOA 3SZLA 3CPHA 1NBEA 2H63A 1DLIA 3HRIA 4HR7A 1M2GA 1S4MA 3BMCA 3ZI7A 4WFIA 1VLLA 3NATA 4UTVA 4RHYA 3T7DA 2FJ0A 1K2WA 1NXXA 2ZRLA 2IY8A 2ZI5A 3JATA 3AF3A 3LL4A 3NWBA 4FHFA 4IDNA 4Q3DA 5ALTA 1TRHA 1T35A 1XL1A 3QKRB 5EUCA 5F51A 2EKZA 2J4DA 4NARA 3ZIAA 3IRUA 3FDFA 4HDRB 5CNJA 3DL2A 1G64A 4EA8A 3CLUC 4ZZ2A 3WLQA 4F5WA 4GOMD 2QUAA 1RPJA 2H5JA 2RCNA 3R5FA 5TIIA 4Z2AA 1YL7A 2P9QA 3CSSA 2Q50A 1ZH2A 4FTWA 5EIFA 5EMKA 2PJRA 3L46A 1EWKA 3FKSD 1MW8X 4G1FA 4OOFA 5HCIA 3UHOA 7GPBA 3N9IA 4OEHA 1AMNA 1NQAO 5IKMA 4HVCA 1XZBA 1ZRNA 2Y67A 3KJQA 1N6HA 3KQVA 1Y7IA 3N87A 4U02A 2HA6A 1XDWA 1OX4A 2Y99A 4MH0R 1GCUA 1E0SA 4PLZA 2BJVA 3DEJA 4JSRA 1W34A 4YAFA 1AHIA 2BL4A 2BWJA 2D62A 3LX5A 4WVLA 1TCVA 2PN1A 4MA5A 5IUJC 1R0XA 2WE7A 1IG0A 3G13A 4EX7A 2WPDA 1TMOA 1ACLA 1QHIA 1VI6A 2HEIA 1GZDA 2OENG 1FYFA 2PJUA 2FQYA 5HZGA 1F3OA 1JPNA 2H29A 2H4HA 2PS0A 1TZBA 4ENUA 2R7AA 2DB3A 1VQ1A 2VP9A 4QDKA 1Z4OA 1HNWB 2MTBA 2GKGA 1QVRA 4O2AA 1GPWB 4Q9KA 5COQA 2PL3A 7YASA 3UB2A 5FNVF 2QK4A 3NHJA 1SUFA 4ERNA 5JZBA 4BBPA 1PAUA 3G02A 4BV2A 1QQ5A 4LHYA 3DZIA 1ZK0A 1WKCA 4J29A 4Y2UA 3L8YA 4YREA 5BY2A 1L7NA 1VIDA 2BR5A 4XD7A 3HVIA 5FPHA 2Q07A 3ZVNA 1OZ0A 1Q0RA 1RMQA 2PCJA 4X60A 2WUGA 2P2DA 4NYMQ 4AJ1A 4D1YA 4EPRA 1Y6ZA 2Q9CA 1MX3A 5F2EA 5KJCA 1MVNA 3RF7A 3TSCA 2FMIA 2ZVJA 1XRPA 3IL2A 1XEFA 1DS6A 1C4XA 4Q1AA 4XGIA 2F1RA 2QDXA 2Q8QA 1CRZA 2VBIA 1E60A 2VSOA 3AUXA 5TMPA 1WTAA 5HOQA 5BMVA 4R7TA 3RHSA 1RS0A 1QGYA 3CVJA 4ZVTA 4UBIA 3UCXA 3ROTA 1PEYA 4DBZA 4EHJA 3U9SA 1FTGA 1HE2A 3PENA 2PGIA 1YV9A 1A72A 2PO7A 1TW2A 1VMIA 1RKBA 4IVQA 3CQ9A 3ZHZA 4ZA2A 1DTEA 4E3ZA 4UTOA 1HMYA 3HUEA 1X1SA 3UWSA 5IVKA 2C9OA 4CNBA 3T8YA 2ZYRA 3T7AA 5K0CA 4BCBA 2NIPA 3FNEA 3WK5A 5ALXA 2HBQA 3IVGA 2WAXA 4CMIB 1H6AA 3C3EA 4WKBA 4DKJA 2ZQZA 2NM0A 1R74A 1PZMA 3COSA 1N8KA 2EATA 1IK6A 4QEZA 1ECJA 1L7QA 1P9OA 4C5AA 4LQLA 4NJMB 4PO3X 1CQZA 2OBFA 4OQEA 5FBZA 4EHBA 1L4UA 2UYGA 4YFVA 1FZQA 5DIFA 4AXBA 4DTCA 1USUA 4GLLA 4L7QA 5DX0A 4U7GA 2IH2A 3P2OA 1J90A 1YOVA 2JLZA 5LYJB 1M1XB 3AEXA 1H5QA 3QMMA 1VKRA 3C4VA 4YB8A 4NK4A 5KWVA 4GGPA 1PFKA 1KI1A 4KGVA 1XEXB 3QFSA 3A0RB 3W5UA 1AA6A 4KHPB 2CXUA 1FF9A 2OHGA 4K6GA 4LRSB 2DPGA 1LX7A 2CHQA 2FDCA 3PSHA 2IUUA 1GYQA 2GHTA 3F98A 1TOAA 3FPFA 3QVWA 2Q2OA 1PJ3A 3I2KA 2JIBA 4LBZA 5BQ3A 4CIYA 5U9CA 1DQYA 1JLKA 2BGKA 2L17A 3KWLA 4DR4B 5TPZD 1GY8A 3I1YA 4ZVQA 4IH4A 3WYEA 5ALFA 1EFPA 1MN6A 2C3YA 3V97A 2GS9A 5EP1A 3WL3A 1E5LA 1XWIA 1IY9A 1PVDA 2O57A 1ZWKA 3PB3A 5CJJA 4NOLA 2PWBA 1ZNYA 2ZI7A 2IWRA 4QQFA 1ZM4A 5E7MA 3HBAA 3ZNNA 3JQ9A 3IDZA 4QUAA 2HRDA 4MI1A 3D9QX 5K0JA 3YASA 1T4BA 1UMCB 2DC1A 2G17A 2JFQA 3ITKA 4J7UA 4RL4A 3KC2A 4KDRA 1NBOA 1OPXA 3SQDA 3RE1A 4ZO4A 2I2XB 3IERA 3GA5A 2H1LA 3EH2A 1LW6E 2X8JB 3ICVA 1UXIA 5EVCA 5BSRA 1NL3A 3RSCA 2ZB2A 1DWQA 4W7HA 1N75A 1W85B 4H0NA 1VFNA 1BWSA 2AMFA 1A97A 4D4KA 1UZNA 1VPLA 1L5OA 3UM9A 1SUWA 3VYWA 4DA4A 3G2PA 4I19A 3U4IA 2K5UA 2NADA 4L16A 3W78A 3G8YA 3QVOA 4JFAA 1J24A 4E2ZA 1HBJA 1WPXA 4ZAZA 5JLAA 1U9IA 1OOEA 2HU7A 5CLJA 4O02B 5IVIA 1BTOA 5JH7B 1Y5IA 4YAJA 1O5IA 3AR5A 2B1JA 5AVQA 1ZY2A 4Q01A 1Z2CA 3EVTA 3ZK7A 4DC0A 3MXOA 1NFRA 2XZTA 2A4MA 1PGNA 3KTDA 4G0OA 3Q8WA 4YCLA 1OYVA 1XUOA 1Q92A 3RLFA 2AWNA 4J1NA 5HUJA 3GEHA 1XZPA 3EPHA 1YNSA 3NBAA 1QWOA 1WP9A 3AESA 1YIDA 1DG9A 4M98A 5KS2A 3LOPA 3AEQB 2WFMA 2C7QA 4DG8A 5AVJA 4LX8A 2V45A 3DAOA 2DTEA 5DHFA 1TKCA 2YOHA 3CWQA 1OILA 1ZXXA 1PZXA 2JGNA 3K20A 1PWYE 2WJ3A 3MFYA 2FG5A 2Q3LA 1NT2A 2Z5LA 5E6UA 3L8FA 3L43A 5FL7A 4ZARA 1GFSA 1D1SA 5I9TA 2FZ4A 3ID6C 4I1UA 4JQZA 4K9OA 4MWTA 2HXSA 3BGWA 3LSTA 4R1NA 2IEAA 4JN6B 4WOJA 5HKBA 2JJ2A 5D5QA 4BMNA 2FMUA 1KMCA 1JDZA 1ZU4A 1B14A 3H9GA 2HFKA 4A2QA 1HUQA 3FPLA 4TXMA 4R1LA 2IPLA 5LYYA 5FH9A 1J33A 1BFUA 5KSPA 2YASA 1NBHA 5EFOA 2ACVA 3TLGA 5IH7A 1F6DA 4MWCA 3ESDA 1R5OA 3OX2A 1NNSA 1T3HA 1IAQA 3TCXB 3UCFA 4PZEA 3UWOA 1E77A 4TPKA 1NE7A 5ADWA 1UR5A 2Y0BA 4WGGA 3RSHA 3Q15C 4IG9A 4OU5A 2P2ZA 3E58A 3ZQKA 3UJNA 3SQWA 1Y98A 2GEFA 3CF0A 3IOCA 1PU2A 4QXOA 4AURA 1OY1A 1ZI6A 1TIPA 3IS3A 1T0BA 2PT7A 5AXCA 1P0IA 3SJZA 3K70C 4A36A 3DKIA 4ADSG 2OHFA 1BG6A 4EG3A 4ES6A 1RYFA 4YIKA 3VTAA 1QDUA 1KBOA 2ZRNA 1W36C 4ML3A 3LRPA 4D44A 4FFMA 3TBKA 2DBYA 1DXYA 3H5LA 3OTQA 4EMUA 5A4AA 3RH0A 1L5HA 3IALA 2WB4A 3A1NA 2IXDA 3MGCA 2XTAA 3CO5A 4O4HA 3UKJA 4A16A 3VH3A 3RSLA 4B1FA 3ZGYA 4M1OA 2SECE 4HAWA 3ZLVA 1RWBA 2H0AA 2Z5GA 3P5SA 5LA6A 5A6VA 1QHYA 2VSYA 5LDDC 3NB0A 1ATIA 1O6BA 2UYQA 4RACA 3GLFA 1V43A 4ZYTA 4BOYA 4XWAA 4JLUA 3AMVA 3ANLA 3FDJA 5JASA 3IIJA 1XD9A 2WINI 5IYZF 2PUHA 3T3MB 5C1IA 3P9KA 5DASA 3ULKA 1E59A 4FD3A 1JFSA 3OQHA 3I61A 2NSLA 2ESRA 5E38A 2AQIA 3TECE 1QGZA 1SHUX 5LPNA 3U4DA 4M0PA 5AM2A 2EBHX 3UT0A 3AF1A 3V34A 4OQZA 3AB7A 5BN3A 1C1HA 1YCGA 1JJFA 4KIFA 3TZQA 1VMDA 1TM2A 3VNUA 4CEHB 3FYHA 5KX5A 1E8MA 3RAEC 2WDPA 221PA 1XQWA 3LBFA 3OCCA 1KVTA 2EFYA 3IP1A 3PQFA 1JMKC 4FMBB 3EWSA 2ZXFA 3OFSA 3I92A 5TVGA 2UZAA 4COOA 1X3SA 1A2OA 2C5BA 1JDJA 1CQPA 1WNTA 2ZT6A 3NOXA 4CLOB 4DGQA 2JAUA 3B82A 2QRGA 3D64A 3O84A 4XA8A 2I71A 4GKAA 3B1XA 3R76A 2OSVA 4NS1A 5GQSA 2X8JA 3SC3A 4GE3A 2QW8A 3A1EA 1FDTA 2P4UA 1VYHA 2R00A 3DM5A 3TPCA 5KHLB 3RS2A 5A1TA 3NIFB 5BUSA 1X1TA 3TNLA 3E81A 4FYVA 2DOKA 2HZBA 3DBHA 3LCCA 3R23A 3R77A 1NDUA 1JVNA 1ZGJA 4GLOA 3NHYA 1FX1A 3INTA 3AIMA 3IOEA 1KKLA 1ZOLA 2ZYVX 4EVSA 3NJ4A 2HKIA 3SKYA 3HYTA 1OH5A 1W0KA 3R5TA 2YY5A 4P92A 1P5JA 1WU7A 2IOQA 2QMHA 2CUNA 1CULC 3I2GA 4N65A 1MTZA 3GT3A 3IAUA 5L7TA 1V96A 2CFRA 2QJOA 3UTDA 4I08A 3EFOA 2AFRA 4M9SA 3A4LA 4IPTA 4V0KA 3G5MA 5DM60 5AUOB 4FGLA 2HGSA 2WSSD 4U0JA 3TVTA 4BMSA 4YXWD 2YXDA 1OPRA 3ZNPA 5FTJA 3D7NA 3FKJA 4KBYA 2TRSB 3U1BA 2ZXUA 4IDPA 2WMOB 1NJ6A 3THRA 3P0JA 4V03A 4F8JA 4TXLA 2JCYA 4M9ZA 4YRQA 4GXTA 3JYNA 3M4JA 2WICA 2ZYHA 5H68A 2FTKE 4YPOA 4U8HA 1QFSA 4CDRA 3FAZA 2PNFA 2H4JA 3EFEA 2LP4Y 4Q9AA 5C8YA 1ZD1A 2Q7DA 3PX2A 3QV1A 4K46A 4YRDA 5BSGA 2ZTLA 4QUKA 5AW3A 1UWVA 3OF2A 1E4EB 1TEXA 1U3VA 3LPNA 2DMRA 4GNKA 4BFZA 5JXGA 2HSZA 4Z7OB 5ADHA 5C51B 2NO5A 1ZGAA 1P4AA 2GASA 2GKOA 4FP9A 4IHAA 5KOYA 2AVDA 3KVYA 1AXRA 2J3DA 2O14A 4R1QA 3GA0A 3KOMA 4XVQA 5KYWA 1OH8A 4DQVA 2IUYA 5FNVA 3K30A 1QHXA 3QF7A 3LL7A 2BI4A 3RKRA 4XSHA 3VR5A 1RXEA 2FP3A 3KTAA 2IZ5A 2R87A 3G2NA 3VPXA 4I6EA 2YC2C 4I2VA 3AZOA 3E9QA 1IYZA 4A4DA 2JH3A 4JP8A 4EB6A 1MT0A 2Y1DA 5ADVA 1V4BA 2GAFA 3AU9A 3MTAA 3ODGA 3WHKA 4Q19A 4N5DA 4ZWNA 4UUMA 1K7YA 3BSYA 4I1VA 3QK7A 4CM8A 4XLZA 5TEVA 2BFBB 1L5RA 5EHZA 3OE7D 2B99A 3MCAA 5F1KA 3MRTA 1SOMA 3WFJA 1EFVA 3Q8LA 2Q6KA 2ZBUA 4U2EA 4HAOA 1FTYA 5EGSA 1J8YF 1XALA 1BHQ1 1WA5A 3T94A 3OFND 2QB5A 3D3WB 3OQVA 1YONA 1GSHA 2NUTB 1ZGCA 2ZVDA 2B1QA 5HM8A 2MMCA 1QFZA 1GFIA 2O0LA 3HUDA 4Q3LA 4RTQA 5AKYA 3NWOA 2Y9PB 2A94A 3L0BA 5CX1A 4LI0A 5COAA 4YQZA 5TS2A 1RRVA 4BKUA 2WJ6A 4TTAA 4MCAA 2GLTA 4QJIA 2QMOA 4TUYB 1ZN7A 4AQYB 4DIBA 5CD9A 1IPHA 4HDQB 1LS1A 4KX5A 3WJ1A 1I01A 3OAAA 5HTOA 3B6JA 4HLUC 3P0EA 1P62B 5K0LA 3KAPA 3QEBZ 1I3KA 5AHOA 2XNDA 3G0OA 1TA0A 1IEXA 3MMPA 1JSCA 4HGZA 2XCOA 5TB5A 4OI0A 3FCEA 4V3BA 2VF2A 4JH0A 1TDJA 3WOHA 2W2MA 3GGDA 3PC8A 3A9VA 5EQJB 1L4HA 4CLDA 2WD7A 3FNQA 2X1VA 4OJYA 4UUBA 2I99A 3OCYA 2XDQA 5LDGA 3WC4A 1OXBB 1GSIA 1XTZA 3LRTA 2QS9A 3QKWA 4FHEA 4MCJA 1M2OB 1CP3A 2OT3B 4AY5A 5GTDA 2DU8A 1QONA 1K6EA 5BSFA 1KORA 1NQ5A 3I3OA 4BFVA 1ADCA 2Z1NA 1Q0TA 3WRXA 3MJTA 4GOKA 4J90A 5CCDA 4YT4A 3TGPA 2YMPA 2BJHA 1DBVO 4R7ZA 5U1PA 2VYVA 4FNAA 3OCWA 4GO1A 4MLDA 3WHPA 2WWHA 3NGLA 1XFAA 3DPIA 1Q16A 1KY3A 2VJAA 3EY9A 4R8LA 1H4SA 5K1ZA 4G84A 1L5MA 1Z0JA 2VPXA 4H60A 5HWSA 4LE1A 3DEYX 2BW0A 4NE7A 2HREA 4J16C 4WNCA 1T9GR 5DGHA 1AV7A 3A6PC 4QECA 1LLQA 4C22A 5ICSA 4G8BA 5KINB 1JE1A 3O3OB 3UW1A 2NOAA 3GWZA 1P5HA 5LLTA 1NMEA 3U13A 3JAWA 1BNCA 3PHIA 5K3EA 2CWDA 5DRYA 3R0XA 4BWFB 4EQ6B 3BE8A 3FYUA 4Q9DA 3T7TA 3G23A 1JR2A 1N78A 1BMQA 2J3EA 3CUSA 3W6OA 2RIPA 4EA7A 1VPDA 2JGEA 4R16A 4BO9A 4DLKA 1JALA 1E0KA 3RGGA 1S89A 1G5TA 3LZCA 4HMQA 5AVSA 2FWNA 5EQFA 1VXRA 4MUYA 3BGOS 2ZJ6A 3CS3A 3BUSA 2ZIWB 3C3WA 3KR9A 1CZNA 4OJKA 1JSZA 2PS3A 4E2FA 1RWPA 2BCEA 4JLPA 4CQLB 3QENA 2FW9A 3PC3A 4M4SA 1UPUA 4G0XA 4HH4A 2JVKA 3ZE0B 4ND7A 1V48A 1MOSA 4NZNA 2AR9A 1V7PC 2PGXA 1QPBA 4YJGB 1GEEA 1COWD 3F1LA 4YACA 1EWQA 1WW3A 3LDAA 3ICOA 4ZREA 4BE7B 4JT8A 3NO4A 4JEUA 1YDWA 1K5PA 3IQHX 1VG1A 3O8BA 4WLVA 3WLOA 4PQEA 2HCRA 4E1BA 1NU8A 3NKLA 4DIMA 2GZHA 2QLLA 1D9XA 5C7LO 1I3CA 3QFHA 1GZSA 3D8HA 4ZQGA 1J42A 1DE0A 4NENA 4XR4A 1Z9BA 4RCZA 5CA1F 1N5LA 3N2LA 3N7AA 2EFEB 4K6HA 1N2IA 3BWEA 2HQ1A 4EYQA 4G97A 3LQRA 3UHAA 1R6UA 4MYRA 5BNFA 4DVGA 1VLHA 3RUIA 5BVHB 2IEIA 3NFYA 4OBEA 3GRKA 5FUVA 1U7TA 3EXEA 5CDSA 2CUTA 2IZZA 2W22A 3AZPA 2JI6A 3PT5A 4WMLA 4DRXB 4F3KA 4JSYA 1N92A 1S6YA 4LWPA 5JS8A 4QU0A 5ELMA 1G8FA 2YNMC 1U02A 1TJNA 1Y5NA 3M8KA 4O63O 1I7NA 1JHPA 5A9TA 3TJMA 3TRIA 1CCWA 2C1EA 2ZE7A 3PUJA 5H4HA 2IU0A 3KSRA 3AEKA 2GKSA 2I67A 4JMPA 4WQMA 2F55A 1MA0A 1VRCA 2PANA 3SF0A 5FV4A 2KPOA 5C52B 1KJJA 1WUJS 4AX4A 5A4MS 5EJEA 5G41A 4AZWA 2AW5A 4CGZA 2F8SA 2H54A 1BX1A 2V55B 3ZJ5A 2XNHA 2QU8A 3I01A 3A26A 4IJUA 2Q1UA 1FDVA 5F21A 3DW3X 2BRUC 5LIPA 2ZSEA 2ZYGA 5KDOA 4R0NA 1Y7LA 3LXMA 2AD5A 1TRKA 1C3OB 2QQEA 4PPFA 2GH1A 1UDCA 2W83A 3KELA 4M6WB 3H11A 1ADJA 3UT6A 5DBEX 4GKJB 4XARA 2VC2B 4G26A 4GPAA 1R4MA 2AMVA 1ACJA 1J0XO 2OO7A 4IWXA 3E3LA 1S3GA 2C7OA 3DDSA 3AM1A 4YP6A 4ZOLA 1JFFA 4A0FA 4DLVA 1BWRA 1G8AA 3DNFA 1PN3A 2O07A 2OB1A 5KNLA 4DB4A 5E9QA 4P0PB 3NDBB 1YCDA 3C4QA 1FRVA 4W9MC 1KGDA 4PFQA 1Z5OA 3H75A 1KSHA 1ODSA 3ABRB 1WPQA 1RM0A 3HLTA 4IV8A 1BEZA 4E0BA 2NV0A 2MJLA 5LC1A 3RS4A 4DPMA 5HUQA 3DZDA 5B5SA 3KAJA 5JCJD 1NVDA 3F3MA 1OBOA 4C29A 1P74A 1K5GA 1ISSA 4OI4A 1UC5B 5FL7D 3JYHA 1IXRC 4J6EA 2NU9A 3T9FA 3TZ6A 4CI9A 4EKGA 2X7XA 1XQYA 1EWRA 1KQ3A 2MSCB 3O7WA 3K4HA 3ZDCA 1RPZA 4B80A 3ENNA 2Z58A 5SY6A 1NSYA 1OAAA 3RU2A 1W5BA 1DBWA 2PX3A 1P91A 3ND5A 4AMZA 4FHGA 4J0GA 3PEYA 1O95C 4Q3OA 4YTEA 4FJ0A 3T0GA 1J2UA 1VDMA 2BEVB 2FSUA 3G5LA 3MTGA 4YT5A 1RC1A 1C0PA 3A6FA 3OZCA 3KT3A 3AUSA 5LUBA 4I9FA 4A1OA 1XZFA 3KEMA 3LIPA 4WAUA 3TDKA 1BOOA 4DG9A 4F46A 3ZDBA 3MGKA 2JEOA 2P69A 1LF5A 3BD8A 5HKKD 3BL6A 3B2EA 1ZJZA 1XZGA 1P5RA 3L6OO 3E2PA 4PTYA 1JEYB 4F92B 1IDOA 5FJIA 4GI5A 2WHQA 2Z3VA 2Q5EA 4FX5A 4DJDC 2FWJA 4PZLA 5D84A 1X3LA 3SYRA 4BC0A 2XUPA 3RT7A 4MW6A 1ZK3A 2NSHA 3V8RA 1W47A 1DPGA 2ATIA 3OFJA 4I4CA 4DXDA 4J1TA 3S6JA 4YXWA 4A0SA 3KE9A 5JO9A 5CDYA 3CU5A 4KR9A 1MR3F 4LYDA 2ZRJA 4F4FA 2UUBB 2IYVA 5IULC 1I2MA 3DD1A 1E2KA 1XWWA 1FUUA 2P0YA 1DRUA 4XKJA 3RUDA 1KZ7B 2WV7A 3ADPA 4ZI2A 1CQXA 1XKLA 2IZ1A 1ZWLA 2O5CA 4UFPA 4WLUA 1EB9A 3DNMA 4DBLC 5L6LB 3IX7A 3KOUA 3HCAA 5HKOA 2BI7A 2YYAA 2IE0A 1ENZA 2WTNA 1WXHA 3HNPA 4Q1DA 1FFBA 3C8DA 1S7GA 3X43A 821PA 1KH3A 1R4ZA 5TLSA 4MV4A 3DKPA 3WLKX 3DVQX 1H2WA 1TLLA 2D7CA 2E4WA 2QJTA 2VA9A 3I53A 4PHHA 4Q1FA 3F3KA 3GJQA 5FTMA 4BFCA 5FUMA 5K4HA 3CZAA 2R6HA 5HQTA 2AYZA 4M7PA 5BN3B 2PRKA 3HXQA 1NMSA 1VL8A 3W9UA 2VK8A 3WRXC 1CEEA 4RJKA 4K9DA 1S3FA 4OHKA 1JT2A 4AYXA 4DM3A 3WGOA 1H42A 4MR9A 3BCSA 1X1EA 1EM6A 1KJQA 5LZ5A 5AR1A 3N6VA 5BUQA 2RI1A 4IJWA 1GG9A 1KDTA 1N6LA 2ZVQX 4UNNA 2GJ8A 1A2KC 1D1QA 1OFUX 1L5NA 1N1DA 2E1PA 1MB2A 1DO0A 2C2KA 2OG1A 2P4EA 2VT2A 2B1RA 2WOJA 2X42A 1TQ6A 5K09A 3RG2A 3VNRA 2D1QA 1K88A 3VR4D 4HNVA 4DZZA 1NI4B 4P4SB 1G21B 1ZD5A 3ST7A 3T3IA 2V3CC 1UBCA 1A9TA 3KP1A 4J7AA 3GCGA 4Q3CA 2J3IA 3KFXA 1QSGA 2YJ3A 3ETNA 4IDDA 4U2FA 4ZO6A 3GU3A 3SFZA 3KLMX 1CZHA 5A3SA 3I04A 1T9BA 4EABA 3T7SA 3HFGA