1USGA

L-leucine-binding protein, apo form
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
345
structure length
345
Chain Sequence
DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structures of the Leucine-Binding Protein Illustrate Conformational Changes and the Basis of Ligand Specificity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords LEUCINE-SPECIFIC BINDING PROTEIN
total genus 138
structure length 345
sequence length 345
ec nomenclature
pdb deposition date 2003-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usgA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usgA01
2FKAA 3Q7RA 4MS1A 1GCGA 2FSPA 2MYNA 4WXMA 3RVQA 4WZZA 4WWHA 3CS3A 5DTEA 5TQJA 2MYTA 3BILA 1TJYA 2P9HA 4TLMB 1L5ZA 4XXHA 3ILHA 3HM9A 3KYIB 3HUTA 2GX6A 1L5YA 4DQDA 1YMVA 4RK6A 2R4QA 4EYQA 3B2NA 5KQMA 1F51E 3LMKA 4G0XA 3RVOA 2PL9A 2AYZA 2ID9A 3KSMA 5IULC 1J56A 2WRZA 1Z15A 1PEAA 3KYJB 4DADA 1U2PA 1JL3A 2FEPA 4W5OA 4G0OA 1VLZA 2L2QA 2LP4Y 4UHJA 5CNIA 1EWKA 1YIOA 3MQ4A 4JAVC 5CNMA 4HYEA 3CNBA 3MF4A 4G97A 3OMWA 1QP0A 1WETA 2FMHA 2WMYA 2I6FA 2GKGA 1EWTA 1LK0A 2FQYA 3FMVA 4FE7A 4HNQA 3H5IA 4F06A 3I42A 2LPMA 2QVCA 5I4CA 2GI4A 3IP9A 1EHCA 2PKXA 4MR9B 3EAFA 2PUAA 3H75A 3CRNA 1TVMA 3O75A 3O1JC 1AB5A 1Z25A 4LE2A 4RK5A 2LIVA 5HM6A 1VPWA 4Q6BA 3HDVA 4MPTA 2FN9A 2HSGA 4MS3A 2CHEA 5BQ3A 3KKEA 3I09A 4WUTA 2PUFA 1FSPA 5HQJA 3GA5A 1A04A 2FW0A 3P9YA 2FLWA 3ILYA 3Q9SA 4KQ9A 5TQ2B 3MIZA 3VNBA 1YS6A 2QXYA 3T8YA 2F8TA 5DCLA 4LRQA 6CHYA 1K68A 3CG4A 1USGA 4RXMA 3H6HA 1APBA 1XHFA 4EVRA 3RVLA 1ISSA 3RVSA 3H5WA 3E61A 3T38A 2PMCA 2NZVG 2NT4A 5DKFA 5JNTA 1YVUA 2VUIB 4MS3B 1QO0A 5TE9A 1JWLA 5CNKA 2E4YA 3H1EA 3TX6A 1RXEA 3RH0A 4ZMRA 1XHEA 2OENG 3G85A 2B1JA 4EYGA 4M88A 4YR7A 1Z13A 1JH9A 1BAPA 2QU7A 2FLKA 3H5OA 1ZESA 2PE5A 4MR8A 5IBQA 3GBVA 3QX9A 2VYCA 4NQRA 4Z9BA 3T95A 3LTEA 2M98A 3IDOA 1PEYA 3BBLA 1DBPA 5FWYA 3HXMA 4Z4FA 4MQEB 3QEMB 4KK4A 2PLNA 3CZ5A 3SG0A 2RGYA 2MYPA 2FXIA 4EYKA 3DZDA 5KWSA 2JVIA 1FFSA 4D6XA 3HSYA 3JTEA 3S99A 5KQPA 1CHNA 2WY2D 1ABFA 1DP4A 3JVDA 1DC8A 3HZHA 1F4VA 2F8SA 4JB0A 1BDJA 3M9XA 4MS4B 1JFTA 4Z4GA 4MYRA 3OQOA 1EFAA 1JLKA 2H0AA 5HSGA 4RKRA 1Z18A 4KMRA 1DJMA 3O2QB 2A9QA 1NXXA 4FE4A 4GNRA 2QV0A 5FWYB 1QQBA 1D4ZA 1Z17A 2MYUA 3ROFA 4IRXA 2JBAB 3KG2A 3OLXA 3SQNA 2LBPA 3KHTA 3F6PA 3W9SA 1YTUA 2WWVD 4MRMB 4ML3A 3M6MD 4MLDA 1KRXA 1ZH2A 2XDYA 1ZITA 1P6UA 3HEBA 1P2FA 6ABPA 1LJUA 4MS4A 3OLZA 4N47A 2HQRA 4XASA 5JS2A 1D1QA 3BRSA 3OQNA 3L6UA 3TO5A 3CKMA 2E4ZA 2OQRA 3LFTA 2Q5CA 4O1HA 2MSWA 3H1GA 4ETIA 4KPYA 3IP7A 5IUNC 1JFSA 4MRMA 2MSLA 3I45A 2GWRA 4N41A 3LUJA 9ABPA 1Z12A 5IX8A 3NHZA 5TQ0B 1QP7A 1NXSA 3DBIA 1RZRA 3GRCA 3EQZA 3A10A 1C4WA 1ZGZA 4ZPJA 4NCAA 2A9RA 3EGCA 4F8JA 1LBIA 1MB3A 3FFXA 1ABEA 4W5RA 3KCNA 2AYXA 3CU5A 3CTPA 2IOYA 2BGGA 1PUXA 1CYEA 5EWJB 2YHAA 1YMUA 4YS6A 4HNSA 5F64A 3HCWA 1MIHA 4S04A 5FBHA 4XLTA 4IF4A 1M5UA 2CHFA 2CD7A 2CWDA 3TMYA 4RSMA 1JDPA 1U8TA 3O21A 4QYWA 3N8IA 1TM2A 4TMYA 1GUDA 5FBKA 1M5TA 3HO1A 4JB2A 4RK4A 2FMFA 2FMKA 2X7XA 2ZAYA 4MR9A 3GWGA 3HDGA 4CBVA 5C5CA 3JVIA 3LUGA 2IKSA 1GUBA 5HKOA 3E3MA 1E6KA 2FTKE 5EWMA 5TPWB 4RS3A 5E3JA 4ZYLA 4LDAA 4XAQA 4YP9A 3C97A 4G0MA 3QELA 4IMIB 2FN8A 4Y9TA 5C5EA 5JNVA 4D74A 4EYOA 1USIA 2JVJA 1EWVA 4L85A 5T3YA 4Z4CA 1EAYA 2QW1A 3QX8A 2JB9A 4KREA 3CG0A 2A9PA 4RXTA 3Q7TA 1R8JA 3JPYA 1RNLA 3JY6A 8ABPA 4Z0NA 3SNKA 1QQAA 4YGXB 3F6CA 1QP4A 2NZUG 3CLKA 3C3WA 4N0QA 4ZMSA 1DZ3A 1OXKB 3OM1A 5TPWA 4MLCA 4N03A 1MB0A 4O1IA 2FVYA 4B09A 4LDZA 4Z4IA 1NY5A 3N0WA 3GT7A 4RXUA 1SD5A 2N9UA 2QVGA 3BREA 1XWWA 5JNWA 4F11A 3EDCA 4LZLA 4YWHA 2MSKA 3KTOA 3DLHA 3VNAA 3D8UA 5KC9A 3A0UA 3IP6A 4KRFA 3F73A 3OLYA 1I3CA 3G1WA 1LBHA 4P1ZA 2JK1A 1QPZA 2E4UA 3N0XA 1JHZA 1QMPA 3OM0A 2JCGA 4RK0A 4RK1A 2PUEA 1AB6A 1D2AA 1DCMA 1U04A 3H5LA 3LKVA 4UHKA 5EWJA 2PUGA 5DLEA 4IMJB 3QEKA 1DG9A 1ZHHA 1SXHA 4H3KB 4H60A 1NATA 5KI6A 3H5VA 3QLUA 4EGSA 5ABPA 3UKJA 1RPJA 2IPNA 3KLNA 5FWXB 1USKA 4TLLB 4Z9AA 1GLGA 4RY0A 2QSJA 4XARA 2PUBA 3NHMA 3EODA 3DLBA 3HUUA 1P8AA 2JBAA 3K4HA 3OO0A 4F3TA 4OG2A 1BDIA 4RK7A 1DC7A 5TPZD 1E6LA 1DRKA 4KZKA 5CHYA 2ZWMA 2E4VA 4RDCA 3FGZA 3MMNA 5KQLA 2HJ9A 1M2EA 4IILA 1IIBA 3O2JA 4MQFA 4OLAA 4PICA 3OO1A 2FEKA 1UDRA 2YHBA 4NICA 4TN5A 4N0PA 1ZDMA 3SM9A 1BVHA 1MVOA 1K66A 4YO7A 3SAJA 3LUAA 2IDMA 1OXBB 4JP1A 4KV7A 2E4WA 1KGSA 4FB4A 1A0OA 4G0YA 3QLVA 2PUCA 3R0JA 3MM4A 4G0ZA 5D2CA 5JS1A 3EULA 5EWLA 3LUKA 4RY8A 2RJOA 3HV2A 5IC5A 4MQEA 3QEMA 4YLEA 3N53A 4MS1B 1P6QA 1ZH4A 3DGEC 1B00A 2R48A 1JYEA 3DGFC 1NXVA 3RVMA 5IEBA 2PL1A 5IUJC 1T34A 3NNDA 2RJNA 3A3KA 1Z2DA 2KYRA 3HS3A 3RVPA 5B3JC 3HJFA 2JRLA 1LJLA 1SXGA 2J48A 5CNJA 2HQOA 4OTZA 2VUHB 4QICA 3GBPA 3NNNA 1BA2A 1KMIY 4G0PA 4E7OA 3OMXA 1JFVA 1NXOA 2FMIA 2HQBA 1ZY2A 4JOQA 4S05A 5IUKC 2E4XA 1YK1A 1DCFA 3K9CA 1HEYA 1Z26A 3LUCA 4XFKA 5BRAA 4G0QA 1M2FA 2L18A 3O1HB 3N0RA 5TPZA 1U2QA 1ISRA 4MR8B 3RVRA 7ABPA 1JDNA 2WJWA 1MAVA 1U0SY 5FWXA 4ETNA 3BRQA 1FFWA 2GBPA 1ZN2A 5DGCA 3FDFA 3D02A 3LUHA 3RVNA 2R47A 2R25B 4MR7A 3EQ2A 4NCBA 3NBMA 4OBBA 1D1PA 1NXTA 3OLVA 3LOPA 3QLTA 4D6YA 5JNRA 1YK0A 1PHRA 4IGAA 2DRIA 3URMA 2IPLA 1W9HA 5IEJA 2FEWB 3CHYA 5KQGA 3OQMA 4HNRA 5TQ0A 4G86A 2PUDA 4YRZA 4KFCA 3CZCA 3RVJA 4EUKA 4H3HB 4DN6A 3O2SB 1QO0D 2PAFA 3H1FA 4MQFB 2TMYA 4RU1A 3IPCA 3KS9A 5TQ2A 4MGEA 5GOTA 1JX6A 3IPAA 3MA0A 2FQWA 3C3KA 1JBEA 1H9CA 4LX8A 3LKBA 4MAAA 3C3MA 3C6QA 4LE0A 2IPMA 2FQXA 3UUGA 2A9OA 3Q7SA 4ETMA 3M9WA 3QLVC 2M1ZA 1NTRA 4RV5A 1TLFA 2IYNA 2QZJA 3TD9A 3IP5A 4KNYA 1JYFA 2JVKA 4PEVA 2QR3A 1QNLA 3NNSA 1ZVVA 5JNUA 5GQSA 5PNTA 2LUOA 1C0EA 4N76A 1DCKA 4W5QA 2L19A 1SRRA 4W5NA 2P4UA 1NXPA 4WT7A 4QYMA 1GCAA 1A2OA 4EY3A 3L49A 2V0NA 3F7NA 4RKQA 4W5TA 3HVRA 4PZ0A 3TB6A 3T6KA 2PJUA 4RZSA 4EVQA 1TMYA 4YV7A 3A0RB 2WB4A 4Q6WA 3N75A 1S8NA 4YCSA 5JNSA 4RWEA 3JPWA 1ZAYA 2RDMA 2IPAB 4L4UA 3QELB 1CEYA 2B4AA 3N6VA 3O74A 1DBQA 2W42A 5KC8A 4Z99A 1RXIA 4OATA 4WXEA 1QKKA 1W25A 2O20A 1Z16A 3UK0A 4QPJC 3KLOA 1JF8A 3LUFA 3QLUC 2WJAA 4JA2A 1VKRA 4P98A 4GPAA 2HPHA 3Q15C 4PYRA 3GV0A 4Z4HA 4NV3A 1NXWA 1E6MA 5BRJA 2NUBA 1Y1LA 1E2BA 4Q7EA 4KK3A 5BR1A 1ZGGA 1DBWA 3H5TA 3O1IC 3I5AA 2L17A 4MR7B 4JASB 4EVSA 1FFGA 3GYBA 3LUDA 4KVFA 1VRVA 5ED4A 1PNTA 3CFYA 1SXIA 3GL9A 4KQCA 3H6GA 1BDHA 4LE1A 4E7PA 4OLBA 1FQWA 3HK2A 3OLWA 5B3JA 3KJXA 4Z4EA 2NT3A 3RQIA 2VK2A 3SY8A 1KRWA 2H3HA 4F12A 3QK7A 2ID7A 1DRJA 3Q41A 4O5AA 3MYYA 4PE5B 4RY9A 5EWLB 3ROTA 1YS7A 5T7BA 3FFWA 3EJWA 5EWMB 3RVKA 1D5WA 1RZRD 1PNRA 1Z2EA 3JS5A 3FFTA 1URPA 4ZJPA
chains in the Genus database with same CATH superfamily
4P0TA 1R5NA 2C59A 4LOJA 2QVBA 4PSCA 1GRVA 1QVAA 3NDPA 3SU8A 4A10A 3G8AA 4R3NA 2FRXA 3C3JA 4TLMB 5ARCA 3ZE9A 4N5NA 2DT5A 1ZNXA 1NW5A 1YXMA 2R8EA 3TZEA 5A6VA 5F52A 2GO7A 3PXCX 4IZHA 4BNKA 3PTZA 1XA4A 1VJ0A 2GXQA 4KSYA 2CCJA 4KYVA 4P58A 4QFCA 5AMXA 1GA1A 4IDPA 4AY6A 1RMTA 5HTOA 1T4CA 1KI6B 1SIBE 4CIDA 3KQLA 1D2CA 4X1KA 4Q0MA 3EK2A 4UCXA 4BVFA 3B8HA 3K0FA 5T3UA 3RFUA 5EEGA 3MTBA 3L43A 4RMGA 4RJIA 3GLIA 2QKYA 1P5RA 1OXVA 3O73A 4DADA 4EQZA 4LCJA 1Y4UA 2FG7C 4WLOA 1SKAA 4GW3A 4CHTA 2ZWPA 1Q0ZA 5IANA 3E9ZA 4MW1A 1T0UA 3BSYA 4J94A 2YVKA 5AKGA 4JAVC 4AIIA 4GQAA 7ADHA 3VYWA 3LBHA 5DE3A 3L6BA 3OJ0A 3D5EA 4QOGA 4WUVA 1RE1A 1E63A 3GU3A 4W9MC 3FI9A 4PQFA 3TW8A 1EWTA 3M49A 5JADA 1TFRA 1XL1A 4EFKA 4XWGA 4EMSA 4MR9B 2IEIA 4PGAA 1V47A 4M3NA 2YMQA 5CB6A 1HV8A 1FFCA 1XGKA 4J2TA 3RDPA 2WF7A 3TINA 3MAAC 1LLCA 5IAAA 3GAAA 3D8TA 2NV0A 4WUTA 1JA9A 4QGFA 4F6RA 3LVBA 1XF9A 1E7YA 4JDPA 3GA5A 4XUDA 1NBAA 4WDRA 3REQB 3UAOA 2G5TA 4FOTA 5FHQA 4HRVA 4JK3A 4KWIA 2CUNA 2PV0A 3OJCA 3QUQA 3KEGA 1W44A 1SVLA 4QUEA 3BFPA 5EXTA 2OCYC 1HG0A 2XODA 4NV0A 2ZIGA 4HTFA 3N70A 1G8YA 1SUDA 4H59A 3RVLA 2XUAA 4TSKA 1RZUA 4XX0B 3GA7A 4BAGA 5B3KA 5A5VA 1E9FA 2ZYDA 4YT2A 3EMDA 4N1AA 3ZDCA 3WYGA 1J8QA 1LH0A 1P17A 1OXUA 4D3ZA 2D3WA 3RTGA 5L4LA 2OESA 3AUFA 1W5FA 1UQUA 3VZRA 3GDOA 1QAOA 1BFKA 3FZGA 3P5SA 4UM5A 5CNKA 3I62A 3ZDDA 3PQFA 3QEOA 4EUSA 4EKGA 1HDGO 1OUMA 1L3CA 3M6XA 2V6IA 1YNOA 2QXUA 2QTAA 1GNLA 2QU7A 3ZTWA 3R8XA 1CDZA 1NW3A 1I0LA 2X8WA 3H5OA 4GOKA 3A4VA 4HAVA 4ZCPA 4DLVA 4F6CA 3AYXB 2AXNA 4GVXA 2C31A 1UOEA 1BVYF 4JFRA 1GPKA 2NACA 1D0IA 4TZKA 1FDSA 2CF6A 2JJ2D 2QTRA 4F92B 5KNDH 2P6RA 2VXBA 3ON5A 1EG7A 3HEAA 2HEGA 3IUNA 3EVNA 2J3DA 4GI3A 4KXNA 4L15A 1VE9A 4LCBA 4WERA 2W6ZA 4BQQA 1AIPA 5F2KA 4AI6A 3GLIB 4ZU6X 4EJSA 3JYPA 4A4DA 3EN0A 1F0YA 3H05A 3C4JA 1FFXB 1ONBA 1ZOPA 5A4IS 3ICQB 1DP4A 4YUYA 3X0DA 2K87A 3C7CB 2HM7A 2OBYA 3AG5A 5JWRA 1YA6A 1DHTA 4BV8A 1ECJA 4B6JA 3HLYA 2AXEA 3MJRA 1QGUA 3D6UA 2GPWA 4HAXA 4ND4A 3B7PA 4B6GA 2Q28A 1I30A 2A0UA 2O3SA 4AO7A 4EHBA 5IPFA 1GTRA 2PDAA 3UQYS 4HB4A 1PV4A 1ZMXA 3VHXB 2ONYA 3N2EA 4RHUA 1L7QA 2G6TA 4LV6A 5ENZA 1U9JA 3G2MA 4HH3C 3H11B 4I7EA 4EHLA 3UAGA 2YQZA 5AM4A 4XLLA 1OGYA 1IIRA 3GPLA 5KYGA 3P0RA 1ZM3A 3RUDA 3DC7A 5C18A 1TGVA 2CUKA 2QE6A 1V9SA 2FEXA 3ZHTA 4CL8A 1YONA 4MS4A 5LZ4A 3ZQUA 1WHTA 1B26A 1Q1AA 3A26A 1EVIA 4N47A 1E69A 4URYR 3LP5A 1OX4A 5BV8A 1PQWA 4F4FA 1Y8QA 2IU6A 3IH5A 4BV3A 4P35A 1SJ9A 3DAPA 2AFHB 3AQIA 1SKUA 3D31A 2AFIA 2GJ9A 1UBOS 5D7NA 1GTMA 4FKMA 1DG1G 1NJ8A 4IX1A 4YRRA 4INAA 3HE3A 4ZZ0A 5BV1A 4N41A 1IRXA 3D3KA 1NVGA 4XD7A 3IAM1 3GHYA 4RIHA 5DM0A 5JEDA 4AG3A 2H6EA 2GFHA 3HZZA 5GJCA 3VYRB 3WJ2A 1P60A 4YDRA 4M8IA 4EHIA 1PJ2A 4QSHA 3DP9A 5IJ9B 4R9VA 3Q0TA 3SJAA 3I6BA 1QRAA 1VTKA 2GEVA 3TQTA 5HKAA 5ALLA 2UYOA 1G38A 1DKPA 1WF6A 4ZTBA 3EF1A 4RULA 1JR2A 1MNQA 3NAGA 4WASA 5BPHA 1OMOA 5JYEA 1OPRA 2D06A 4X1IA 3AY7A 1GSIA 3NBFA 4Q18A 1KQ3A 4M0LA 1C3XA 2PZFA 5K4GA 5THQA 4DUZB 2J7KA 1ENPA 2CNDA 3FJOA 4P54A 1BTOA 2C88A 2ZAIA 4AKGA 3TQIA 5TX7A 2AZTA 2HMSA 3HP4A 4JKOA 2BEJA 4Z9YA 3V8EA 4C4RA 1XEXA 2K2QB 3WK6A 5J63A 16PKA 1XWIA 2KMLA 4J49A 2FPIB 4IDFA 5F3DA 5FBKA 3U4QB 2M32A 3L7NA 1L5GB 1IPEA 4JDUA 4X8HA 4OGWA 2DKNA 4D0LB 4L7QA 1SCBA 2SCUB 2D6FA 1M6HA 4JXKA 4QDXA 3ZX4A 4LMPA 5TPWB 4L5AA 4GX0A 4OVKA 2PD4A 1ND5A 2GBLC 1XRQA 4DA0A 2R6FA 2FN8A 2R9VA 5C37A 5EVJA 3KP1A 1USIA 2NXWA 2YNMD 1CV2A 4B9AA 1EWVA 1GLNA 1JQDA 4I2NA 5T6BA 2WUEA 3E9QA 4LXIA 1S01A 3C8MA 4C6TB 1O6CA 4JBIA 2GN2A 3ECAA 1Z3CA 2PKCA 2FN7A 1BRMA 1DBIA 1QTRA 2E21A 4RACA 1JKJB 5JRJA 4EG3A 1RYNA 1WXGA 1H2HA 1GSHA 4FOLA 5E9WA 1FMCA 1U0RA 4IIHA 3SC4A 3VZBA 4I14A 3ZEAA 5J1SB 1WKBA 4OJMX 3ENKA 5DVZA 1XQVA 3PL5A 4CF5A 4YREA 2O5CA 2PT6A 1XJQA 2QX7A 4MIOA 5EUMA 4FGSA 1Z5NA 3V4SA 4BP1A 3PGMA 4YWJA 1FRZA 2QENA 2OV6A 1WG8A 1E1RA 1P18A 2W8ZA 3E1GA 3V3KA 1EUCB 4GR4A 1FYXA 4ZVNA 4NEGA 3NIFB 2NVOA 4V2UA 2QX4A 5COQA 2FUKA 1E79A 1E59A 1ONPA 3C3DA 4E46A 1TYZA 4PSDA 5H3LA 1G8KA 4QULA 2WT4A 3JTMA 4F84A 3L1VA 2OL4A 1V41E 4JJ4A 2C9MA 1U0HC 2ATCA 4PCLA 1IEQA 4X90A 3H97A 3FDXA 4ABTA 4WKNA 5TY0A 1Y37A 3HB1A 3SZMA 1Q1ZA 2I2DA 3TL2A 1JHZA 4B3CA 4CM6A 3PPWA 1DPGA 2OG2A 4RK1A 3HWRA 5KJFA 2H7XA 1M6NA 1X70A 1Z7EA 3ICOA 1DQSA 1EQUA 2P1ZA 1P74A 2QGFA 2A30A 4ZU3A 2BR4A 1OE0A 3FN4A 3Q5EA 4H60A 3EA0A 3T4XA 4KO3S 3ZJYA 1VXRA 2OCXA 4Y7DA 5EKSA 1BXGB 1ESNA 2I87A 2W11A 1XZEA 3GMIA 5TRTA 3V46A 5JCXA 3NOQA 3ZW8A 4DQ0A 5FWXB 1JVSA 4C3VA 3PFGA 2OE2A 5ALDA 3SLRA 1GGJA 1N3BA 2G6BA 3T3GA 4DDTA 1OT3A 1O97C 4ND3A 5AI9A 4PQRA 2W6JD 2V6MA 1QG6A 3FLMA 4FILA 1ZXXA 2AN9A 2GAOA 4EPXA 2I4OA 2WOJA 2AQKA 2FR0A 1PD0A 3BAFA 4YP5A 3UMGA 3V55A 2P30A 3IEPA 4CMIB 2B99A 3L8MA 3M83A 1WXXA 2BMJA 2E4VA 4J0FA 1SUWA 4DV5B 3ZDFA 1KK2A 4OU5A 5IKMA 2BKUA 1VGQA 1PGQA 3N87A 4QQ8A 1KS9A 3IEUA 2OMEA 3SXUA 3UXMA 1MB4A 3UGJA 1SZCA 1CJTC 2OCAA 2VWHA 5KKAA 5EZ5A 5TT1A 1MAUA 5HE9A 3T9AA 3LP8A 4KX3A 5DRTA 3VSAA 2XH8A 1OXBB 2H92A 2PNFA 4ZEXA 2WJPA 2VPQA 4MIYA 4P9NA 1UBFA 4KXMA 3GLUA 4EKNB 1KL7A 1K2VN 3S2ZA 2Y05A 3HCPA 2FZ5A 3KWMA 3ASVA 2FHPA 3B6JA 4M8LA 2P0AA 3DGEC 5E4FA 2GARA 3O93A 2IDKA 4PF1A 3FOEC 1QIHA 2Y6UA 4KAXA 4QD3A 3WLPA 3RCBA 4Z6KA 5ALHA 1J49A 1S8OA 2F64A 2C84A 1SUEA 1TPYA 2FG5A 2Q3LA 4EPYA 1KO4A 3MQ2A 4G41A 3LYLA 2A84A 4E6PA 1PUJA 3RLFA 2G1JA 2F3UA 2YN4A 2X5JO 4DWOA 2ZM6B 3KJEA 1YJ5A 1JU9A 1M6WA 4BC0A 2DBYA 3ZX5A 3UA3A 3LA8A 4DMGA 3HBAA 4I8XA 1PWZA 3VZCA 1F6BA 1G7SA 2FZGA 3PRJA 2E4XA 3WBBA 3ERCA 3PE4A 4L4YA 2W0SA 4ZZIA 1PT7A 2B1RA 2QRVA 5IKXA 5EE5B 3ROXA 3EVCA 1SB8A 2IY7A 3LCUA 1Q0QA 2WJVA 4C29A 1W36B 3NIWA 1ZN2A 4Q4HB 1TK9A 5MHTA 3HNPA 2P6NA 3R0XA 4UCQA 8MHTA 1L7MA 3W2TA 3MRVA 2DBRA 4EQ6A 3NI2A 4KYIB 4YMSA 3KC2A 2VDJA 3O7WA 3R3HA 1NIJA 3OLVA 4L22A 3N6RA 3PC4A 1K8XB 3ILSA 4EY4A 5CA0B 1B93A 4TRRA 4F1WA 2VO1A 3LDHA 4KR0A 1BHJA 1VPTA 1RYYA 3NYQA 4OBEA 3L4JA 3PXBA 1U7WA 2FW1A 4PRKA 4MO9A 1NZFA 2I2FA 4QXAA 4RU1A 2OV8A 5TQ2A 2X6QA 1EJ0A 1H0RA 5EE3A 2FQWA 2ZBPA 1NM5A 3PUIA 3GNTA 1VSQA 3LQYA 4RAOA 4HNGA 1KDPA 1KETA 1WZNA 4M37A 2AOWA 1C14A 4M9SA 4ZOBA 4XVUA 3AKYA 5DBGA 2XDAA 1JQAA 1GAWA 1RRVA 2E5FA 2HN9A 3QLVC 1E2JA 2B34A 1UBMS 2FB9A 2F3TA 2JVKA 2BFEB 3H84A 3HA2A 3NNSA 2VF7A 2W2XA 2VBCA 3L6CA 4M46A 3DZJA 4NNJA 1PU2A 1TYAE 4PLCA 2BRUC 4RVNA 3HXQA 4QQKA 2X15A 4H4DA 4JVOA 4YGYA 2D2VA 1M72A 2F90A 2NO1A 4ZT5A 3R9XB 1XT6A 4MCJA 4E6EA 4PQEA 4MJXA 1GCAA 3BA6A 1T6BY 3F7NA 1E3IA 4FYIA 4Y2PA 1E2GA 2QTLA 3ROEA 2H2WA 2WIJA 1A3CA 4FNAA 1RLMA 4D4LA 5LNK6 4KLCA 1X7WB 2IBTA 4YV7A 3F96A 4CODB 2GM5A 2QTHA 5COBA 4HH4A 1N6OA 3THXB 3EVBA 2P41A 3O74A 2V7QD 3UJ9A 2KE5A 3LP6A 1L5LA 2ZSJA 3G0DA 1GZ4A 1FBNA 1ZD8A 2O20A 1ZONA 3KLOA 4RL6A 5EIBC 3LQ2A 4TXHA 3H4TA 4G81A 4GPAA 4JOBA 4MQ5A 3TUIC 4BO5A 1JJAA 2WG0A 3Q15C 1H3EA 3HU5A 3DBVO 2CHGA 2UXBB 4E5MA 1VG9B 2ZIXA 3COZA 4H31A 4QBIA 5DTRA 3RVBA 3TVYA 4MO2A 5JPDA 3QYJA 1XYVA 5TJHA 4MWSA 3V9AA 4KK3A 4AW9A 4NU8X 4YVFA 1DMSA 1YC5A 2WU3A 3U7GA 2EW1A 2OO3A 1EE1A 1NR1A 1GSOA 2QN8A 2W58A 3QQPA 3DE3X 3REGA 1ZEJA 4X62B 2FU5C 3K09C 1BDHA 4W9RA 5I5GA 5BURA 2Q1XA 4BCDA 3I1YA 4Q9DA 2VTEA 2I99A 1GTVA 1CIPA 4WXRA 1X1TA 3WLMA 1H4QA 2OXCA 2OHOA 4WDQA 4Z4EA 3SY8A 4O4HA 2DQYA 3ROTA 4O4JF 3T3NA 5AW3A 3IOBA 4AO6A 4LJ4A 3QEAZ 5ADHA 1J33A 3S5JA 4BZZA 1YB2A 4RGYA 1Z2EA 5LQJA 2ZUSA 3MD9A 1ZR2A 4TYYA 1PQYA 4ZJPA 2NU9A 3CF4A 3FYSA 2BSQA 2IPXA 5ADWA 1OQAA 1TJPB 1XAHA 1X7DA 2MYNA 4ABYA 1KZ6A 3WHKA 4AY3A 4D9CA 5AUPB 1VG1A 1X86B 3C6XA 3GT3A 3EF0A 4R9SA 3THYA 1M2OA 1OFHA 1TJYA 1TK2A 1P2GA 3AOGA 1PFUA 1QR6A 1NULA 2BKXA 1T2VA 2JJYA 4LBYA 3KWLA 4QJ4A 2HDWA 2I3GA 1GL9B 3AUYA 1C8VB 4H7IA 3U3OA 2PZKA 3KPWA 4Q3AA 4KMSA 2GX6A 1QJCA 2MOKA 1SK9A 1LEHA 1NLUA 4J6FA 5F9MA 1TEHA 3BE5A 1XTUA 3HXTA 3A28A 3BGIA 5IP5A 1F51E 1O89A 1JJ7A 1VHJA 3L8GA 2WWHA 1RC0A 4OHVA 2C77A 1PR9A 1Z4MA 2QWXA 5A9TA 1FSGA 1QORA 4QM6A 3Q5GA 2PL9A 4E2XA 1CKEA 1Z33A 2XCOA 4MGZR 1D0VA 2JGKA 4DJEC 1B73A 4FYXA 5CB4F 4LZOA 4BLOA 3M6LA 1VIYA 3GB9A 1WRBA 3OX3A 4OHBA 1RR6A 1EBFA 3GT4A 2WTEA 2QG9A 4HXYA 4NDZA 3MWJA 2JBHA 4BX9A 2AK2A 3U16A 3H04A 5DYYA 1H1LB 5U1PA 2P4SA 2D13A 1H1TA 4RZXA 3F47A 3WMGA 3GRKA 4G5YA 4C7OA 2JL1A 1MV8A 5CMLA 4LG1A 1TKBA 4ZT4A 2QVCA 5AOVA 1LSSA 3T7CA 2X9GA 1YHZA 1JE0A 1N2CA 2Z98A 1J5EB 1AKUA 1VSTA 4P4UA 3HCNA 3NOVA 1NZDA 5C0OE 4KXQA 2SCUA 5K8LA 4RX1A 5FPYA 4L0DA 2X76A 5J1TB 3JD3A 3TNJA 3ESRA 1ARZA 1SC1A 2X1LA 1E3EA 4LF4B 3NHKA 4NZ9A 2NU6A 4M1WA 2EQBA 1P9RA 1XRPA 2FZVA 1XMPA 5LBUA 5BYKA 3DUWA 2NVBA 4RIGA 4DLSA 1BWQA 3H1TA 4X92A 3TQOA 1QM5A 2F8TA 4GRAA 4B5KA 4EGFA 5HP4A 3OM9A 4MGIR 1N0WA 1SBNE 2FPXA 4PONA 1IMJA 3RB8A 3RD5A 2XMPA 3VC7A 3GELA 2ORED 3FUCA 4OYLA 3ZDBA 1POWA 2VHVA 1YFKA 3K6KA 3PKIA 2ZAMA 3GJ7A 3O3NB 2RK4A 4RKWA 2AUMA 5DW3A 5F4ZA 2NUTA 3KZMA 2E49A 4XB2A 4P4SB 1IOLA 5K0BA 2OO7A 1QWOA 3PGLA 3PGXA 4JQSA 1Q20A 5DWDA 1IG0A 1GPMA 3TX6A 3AP3A 1RYFA 4LUCA 1CY1A 1ODIA 1ZIPA 3HMQA 5EQJB 3TW0A 2VDNB 3ZBQA 4ALNA 5I5EA 4N5LA 1E3WB 1MH9A 3G6KA 4M88A 2CLOB 3A7DA 4R98A 4E5UA 3D9QX 4CUJA 1DOZA 1PD1A 4L2IB 3AW8A 3V4ZA 1ZESA 4P4NA 4EBBA 2HUNA 4A36A 4B4VA 4FR5A 5CDFA 2Y0PA 4K0KB 1KOJA 1NVTA 3IT2A 4K88A 4N3CA 4Z3DA 1WMFA 1S0UA 1OLUB 3EXEB 1OVMA 4WFQA 3T95A 5JUWA 2OV3A 5CTJA 4A2QA 2RKOA 3BBLA 5AVSA 1KVRA 4Y6LA 4OXQA 4DZTA 2PLNA 1V9CA 3FB1A 4HB2A 1V11A 1NVVR 4FR0A 3F71A 3SDSA 2I8CA 3ABRB 3HSYA 3L0ZA 4CEJB 2MINA 2HRQA 4DMRA 3JVDA 2I1LA 4ZGWA 5C8XA 4NJMA 2C7RA 1C3VA 1XZBA 2GN9A 3JCZA 2DEUA 1JE1A 3CB2A 1XNQB 3GLSA 3H4IA 3F6RA 2HYDA 3AB8A 3OQOA 2OFPA 5IMSA 5JJLA 4H7FA 1E1QA 1M3SA 4D92A 3OCVA 3ANLA 4I4LA 3BMNA 4ECAA 2QLMA 4DCVA 3W5BA 1FVFA 2VJKA 1HE3A 1DAFA 1C9EA 1OTYA 3DYIA 3MOSA 5CPFA 3X1DA 5FBRB 3LQRA 1QOQB 1OIVA 3V2IA 2YYYA 1UIRA 3PC2A 5HDQA 5IRCD 1OIXA 2AMJA 3DT6A 3EY9A 2NPOA 1C7ZA 1J8FA 2VSYA 3GARA 3KUDA 3MVEA 4I9HA 4ZEMA 3SBOA 3RYFA 4ZOLB 2FDCA 1X38A 1ZGCA 3HCOA 3I2FA 5IVIA 5BQPA 5EE0A 2LDXA 2XXAA 3NVDA 4U7PB 5EYPB 4FLEA 1G8FA 2DH6A 5DRYA 4UNSA 4BNUA 3VMMA 3SXUB 1QKJA 1ZU4A 1XHLA 2OBFA 5D3MB 1ATZA 4RD1A 2TMKA 1HZJA 3MTQA 4EFNA 4FFSA 1VJ1A 4MWBA 4BLWA 3B53X 1LDBA 2H31A 3ZU6A 3G7UA 4Y2GA 3UXEA 2VSNA 2B2CA 3FOWA 1Y5NA 1ZMRA 5DLPA 4YDHB 5KSWB 2LGJA 4JEUA 5LQKA 2EJBA 2EEZA 5FAXA 2ODEA 3CVWA 1E0JA 2GA9A 3FWZA 5AQEA 4UTZA 4BX0A 4NATA 3LQFA 5JNLA 2CLEB 1T4CB 4E07A 2CL0X 3K1TA 2WQ6A 4CCAA 3E1SA 3NC4A 2IOYA 4E5PA 4NBNA 3CX7A 1JSZA 3VJMA 1KEEB 1CEYA 1FNMA 1PZEA 3KSZO 4LHSA 1O6ZA 1OXSC 2YBEA 4ZALA 5HZGA 3FHTA 2C9BA 5EMKA 2NGRA 4BP8A 5EZYF 3U3DA 4DM4A 2CNLA 4MAMA 3F3MA 3BGSA 1G3QA 3T5GA 5LOVB 3FOAA 5AK5A 1E2IA 1L7VC 2FUEA 1PKXA 4X45A 3KD3A 3KB8A 3DDCA 1V5FA 1NQXA 1J5PA 4UM8B 2Y0CA 3QVUA 1M5TA 3IQFA 3AVTA 1IBRA 2MHCA 1JSXA 3GQBA 2X7XA 4MR9A 5FWDA 3VC2A 1GA4A 5KJCA 3Q4GA 4DREA 1JR3D 3I9MA 2C92A 3NHRA 4KAAA 1USWA 2P3QA 4IXNA 4PO1A 4E14A 4UOZA 4MDEA 5KREA 4P0QB 4YJGA 2CK3D 4AUEA 4ZV9A 3IDSA 1KXJA 3A6HA 1E0AA 3SFTA 3C41J 3KQWA 1T29A 1UK7A 1U5AA 1YR2A 3I72A 3T34A 4ALJA 2JCYA 1JFLA 5ALJA 4BS9A 3F6BX 1AS2A 4Q39A 1XCMA 4JNKA 3TEMA 4CV2A 4RL4A 5IZ4A 3AFHA 1SA0A 1ZZGA 4LK2A 2IH5A 3WRXC 1P4AA 4I2VA 2PY6A 4JEHA 1LI7A 1AQLA 4YAKA 4F7WA 2ILVA 1FLVA 1HL7A 2Q5IA 1JMKC 3BZBA 2A3RA 3JR3A 3L6EA 4MICA 3SS7X 4F91B 3GLGB 3IE2A 3OPNA 1XALA 1M0WA 2QW0X 5D00A 5KTMA 1Z74A 2ZUEA 4ZXFA 2F2TA 2J1LA 2PGNA 2H1OA 1RJEA 1NUSA 2EHJA 1E5XA 2FETA 2JGIA 2ZWIA 3AIKA 2ZTHA 2ERXA 3TRDA 5FV4A 4X6YA 3JVVA 2OAEA 5LA6B 4GMHA 2V4ZA 4CQMD 2ZS9A 2N9UA 3G0IA 4HYTA 2XYGA 1F1JA 3D59A 3FYHA 4UXHA 1E62A 1C4XA 4GI2A 4F2WA 3IEMA 1A5TA 2MSKA 3BULA 5ADUS 4G1BA 5KDOA 1V26A 1A7AA 1FSSA 1N5OX 2Q9BA 5DBIA 4MP6A 3U7FB 1I3KA 3KHSA 1W76A 2V3CC 3JW8A 2Y0DA 2OTCA 2P9YA 3L8FA 1YBVA 1JHOA 2JCGA 4X7RA 3HXLA 2YDYA 3S2YA 1AHNA 4ITRC 4NBKA 5K3CA 1X7WA 5LQUA 3KOXA 1CF2O 1N3YA 4G8BA 4C2TA 2ZXFA 4ZKEA 5ICMA 4PNHA 5JCPA 2HMTA 4J43A 5EXPA 4N49A 1UMBA 4DSZA 3CCCA 1RPJA 5JAHA 1Y5RA 1R6BX 1S2IA 2ZE5A 5T67A 1DJPA 1TADA 3RTCA 3TSCA 4KR6A 4WCVA 3KSUA 3T9CA 3B52X 4KXVA 5K4HA 3C6ZA 2Y1EA 1OWMA 2A5DA 1F14A 3HZOA 3DLBA 3CH7A 3HVJA 1KAQA 5DN6D 5F9FA 4TLCA 3TLCA 4A03A 2CMDA 1VL6A 2ZUUA 1CUJA 3PICA 3MTGA 4JYZA 2AHRA 2NXJA 1V7CA 1Z88A 1U4NA 1EGMB 4XPZA 3RYHB 2A1TS 5LIPA 2A88A 4L9AA 1YZTA 4RDCA 3BKXA 1G1MA 5EJ2A 3MSXA 2YINC 1WM1A 4AUKA 4LOHA 1UDRA 2YHBA 3RM3A 3PUKA 4TN5A 3QJYA 1TMGE 4D5EA 3BMQB 3EFOB 4C4PA 5HJ5A 4QL3A 4Y3UA 3C4VA 2A2ZA 1V95A 2ZSDA 4J9VA 5JRDS 3P2YA 3N8HA 4JENA 2AFHA 2OM6A 1E1DA 4ZYYA 2BGNA 3T15A 1WZUA 5D2CA 4B47A 5AW2A 3SGLA 4Q3BA 5EWLA 5CBPB 2GWHA 4N7JA 3IVCA 4S1TA 4QDZA 4W8HA 3HV2A 1O9HA 2WZQA 1UDWA 2JLQA 2O1SA 5CW1A 1DU4A 2J30A 4I5IA 1NRIA 1P6QA 1Y1PA 1ZVMA 2ERCA 2ZS8A 3CKYA 4KLAA 4UNNA 5BSFA 2PT5A 3OKPA 4ITVA 3ZI0A 4DCJA 2XI4A 1FJGB 2G7MC 4REMA 2RHGB 2EKBA 2OBXA 1IOVA 1UXKA 5CFQA 2Q3HA 4BNFA 1HT2E 1Z2DA 1ZCJA 4DCGA 3AOEA 2BHSA 1F17A 3NTUA 3Q98A 5KVCA 1JZQA 1TU3A 1XZGA 3KVNA 2EIXA 1V2GA 1O3YA 1QZUA 4N7MA 3LC7O 5HILA 5IU6A 1R5BA 2QAGB 1H8HA 3W2IA 2ZYWX 1UXGA 1FTGA 2DQKA 3QE9Y 4H0NA 4PAQA 1J8YF 2HF7A 4ZAXA 1GAXA 1MO4A 4TL8A 2OV1A 3DH0A 4H1HA 2QRGA 3IYLW 2RGRA 2PTGA 3IALA 4KXXA 3VKFA 1CE8B 1IN6A 3G2NA 2IYPA 1UFQA 2KI5A 2QTMA 4GGPA 3AW9A 2A1TR 1G0NA 5ISMA 2VSQA 5AO9A 3W1EA 4ZP1A 3SJUA 5TPZA 3QP9A 1DDGA 2WWIA 3ZWXA 3MUOA 1JEAA 3G02A 4IDDA 3SHTA 4DR7B 4IVQA 4ZOLF 4Q82A 1PVOA 4U6SA 2Z5LA 4QGSA 4OYRA 1FFBA 1MAWA 1BJKA 5TB5A 3LL7A 3AZQA 3P2KA 1RJ9A 3JYNA 2JGRA 4QUBA 1RXVA 3AR4A 1Y8QB 1U1GA 4MR7A 2P5YA 4PLGA 1N2CB 2C5GA 4NH0A 4KIUA 1MX3A 3CEPB 4D6YA 4CTKA 2C7OA 2O8FA 1U2GC 5GV7A 4EHNA 2P4EA 4TLEA 1O58A 2ZREA 5IEJA 3DCJA 1RLUA 2PXXA 2PUDA 2OR3A 4PLZA 4UUNA 3DHWC 4Q3OA 3LECA 4RCZA 5GZ1A 2ZTUA 1CZNA 4DN6A 1NW7A 1FFHA 3GRPA 4IG9A 5KQSA 5KNLA 4DG9A 3OI7A 3THRA 3D6HA 3WLOA 1V6SA 1DQNA 3SE0A 2RGAA 1X8XA 4C0XA 5IT0A 3D7NA 3R7BA 1N32B 3D6MA 1BC5A 3K2BA 3LKBA 3HEMA 5FPSA 1MEJA 3GJSA 4X84A 2SKEA 3NHAA 3EDMA 3SYNA 4I8DA 2EBUA 3PD1A 1QFJA 2W9XA 5BSWA 3TGPA 3PCTA 1XJ0A 1BX3A 5BVHA 1TU0A 4G5GA 4RV5A 1HDXA 3HY3A 2NW6A 4R1LA 2P4HX 3GCXA 5BNFA 3K5WA 3RTEA 5ELXA 3MJVA 5JNUA 3FZNA 2Q3JA 1JVNA 1T9KA 1ZGJA 1NFFA 2FX2A 1CYDA 3QWIA 3UC5A 2P3SA 4CVNA 5K6AA 3U61B 2BM0A 4V02A 3FOFC 2C2GA 2W2KB 4BFWA 1BMFA 3V1MA 4BB0A 5H3CA 1GPJA 4JOSA 1VB5A 2LCFA 3IV7A 3FYUC 4QYMA 4RJTA 1Y81A 4N5IX 1WUHS 3DV2A 1CJBA 4RKQA 4W5TA 2HRCA 5F1OA 2XDWA 4GNKA 4XUGB 4KQIA 3AK4A 2RC5A 4G9EA 4S1PA 4RZ2A 2PYDA 5EIWA 3OF5A 3ZWKA 1NYTA 4KE9A 1Q95A 2X19A 4ON9A 4D4HA 4CG3A 1E1QD 2HHAA 3BF7A 1HR0B 1TI7A 2G3YA 3PXAA 1CRPA 1QHNA 5BT9A 2XF2A 2ATEA 3LKDA 4OATA 2Q3MA 1Y1QA 1UC4B 3G23A 3ISJA 1JYSA 3P8ZA 3MOIA 1OY1A 4N5MA 1PJSA 2WJAA 2P7IA 5SZJA 1J8VA 2C42A 3HKDB 1M7HA 4EG8A 1SG6A 2ZCJA 5TLSA 1OBCA 3WGKA 2B4TO 1MTZA 1ZRMA 2SICE 1EGAA 3M4XA 1Z7WA 5E2IA 5ANRB 3W78A 3R6TA 2I8AA 4DLLA 2L17A 4IIJA 5JJBA 3DOOA 3N2KB 1RBMA 4M1KA 2ADOA 3ZQ4A 1IHUA 3H6GA 1CQPA 4LE1A 2H1IA 1MIOA 1YS2X 1WPQA 2OUIA 1IJEA 2JFZA 4ZTZB 2FSSA 3OLWA 1VXOA 1CVRA 3DDHA 3SYRA 3UUFA 3Q41A 5AW0A 4ZYWA 3D3WB 2PRYA 4C6HA 4UE3S 1SOVA 2PRKA 2IHYA 2K5UA 2QTFA 3FPHA 2QRKA 4IICA 4ASUD 3KUKA 1NG9A 5ECWA 2QD1A 4C2UA 3OTHA 1FJHA 4D25A 1N57A 2OD7A 5JYCA 2YTZA 1UJ4A 1WEKA 4WZZA 3RJZA 4AIRA 4ZVOA 3WGIA 4B3HA 2Q9AA 3IODA 2XEXA 4ZO9A 5HTKA 1DKLA 2JI8A 4BBJA 1W2GA 2C97A 4V0OA 4Z7OB 3ILHA 5CDUA 2QOEA 4CLOA 1HQKA 3OZBA 2NIPA 3P27A 4K9PA 1KQNA 3A70A 1WSWA 3MINA 1UC8A 2R4QA 5HF5A 5ALQA 1ENOA 3V8RA 2F00A 3KB1A 4KH1A 5H59A 3NJRA 2C7BA 5IAGA 3HKBB 1P0QA 4EHDA 2VJCA 4YNBA 4YY3B 3BXGA 4UXIA 1CY0A 5CM9C 1UINA 2R8BA 3UBTA 2ID9A 1GTG1 3PUXA 4YT4A 5IULC 2CDBA 1PR5A 2WRZA 3DXZA 1YO6A 3NRCA 3OEWA 2BOVA 1U8FO 4LXQA 5T5QA 3W8RA 2GEDA 1TQDA 4HYYA 2NOAA 3L7LA 4RMNA 4Q1DA 4IEEA 1E98A 1VLZA 4FLMA 1W4RA 2X77A 3GPCA 3HGQA 1A72A 4WZBA 2MCFA 4ZVRA 3NAMA 1U8CB 5LLTA 2CK3A 4N6GA 1OWNA 4J1TA 2QUAA 2CFIA 1JLLA 2EXXA 4EHKA 4ZCRA 1M8GA 4U02A 1QXSA 3TSYA 3GCWA 1UMDB 3GDFA 4D8TA 1DXYA 1XN1A 3FJ1A 2XUHA 1YJQA 2ZIFA 3HRIA 1Q83A 3BGOS 3I42A 3M9LA 1X1CA 1DLJA 2NWQA 3GQBB 2VL7A 1EHCA 3MLEA 1IULA 1HYQA 1TA4A 1TE2A 3N1UA 4GH5A 1QIJA 4MAFA 4AG5A 4E4RA 5HQ3B 1MO2A 2OILA 1FP4A 4AZ0B 1V6AA 1TO1E 1SUIA 1LFAA 1FSFA 2HTFA 4JMPA 2YX1A 4YUXA 3VUEA 5AW1A 5K3FB 1R18A 3NV9A 5AW8A 1Y8ZA 2Y9MB 2EBWA 2BSXA 3UQZA 2GXSA 2G8NA 3U19A 2IYTA 1JG6A 4H6PA 3EHDA 1NLYA 3WMWA 4BE9A 5SZIA 2I55A 4EHJA 4UM9D 1TD9A 4DYVA 5EJAA 4C05A 5BWLA 1R6XA 1KGDA 2XGMA 4NF2A 2FSHA 3QRWA 3T41A 2PKQO 5GM1A 1H0SA 4TTIA 1RJFA 4RS4A 2PN1A 4FMDB 1NZJA 3RK4A 3UANA 4JX9A 4RHCA 4ACBA 2JFQA 3CSDA 3ZE1B 4HNAA 2FLVA 4B40A 4EVRA 5AQ1A 2R85A 1A95A 3GLTA 1N5IA 3SQDA 3EWIA 4DT1A 4MV3A 4ESHA 2ZSFA 2XWBF 2Q7XA 5LXTF 4LX0A 1TX4B 1TJ4A 5ARDA 4MWGA 1D2MA 3V4LA 2DC1A 4JV5B 1B8NA 5FTMA 3UMVA 5IAJA 5AESA 1O57A 3QUCA 5KWVA 3HUFA 1U7HA 4EYGA 1VCNA 4D9NA 5JROA 1K6JA 2J3KA 4ZVTA 4DTIA 2YMPA 4E4TA 1T8SA 3EFOA 1OR8A 2JKZA 4XSVA 2KJQA 4OHYA 2AMVA 3I9LA 4RFLA 2H4WA 2XBLA 3EIWA 4ZAGA 4GWGA 4IZIA 3GBVA 1NT2A 2DH5A 3MAGA 4MR8A 3DVAB 1Y89A 4NQRA 4UBLA 1E89A 4BB5A 3CEAA 4EABA 2ZI7A 1RP1A 3LTEA 1FFEA 4OU4A 4YACA 5AXAA 3E8XA 3MGBA 4MQEB 4F3KA 2M6KA 3HB7A 3OTQA 4JC4A 4EYKA 1GN8A 2V98A 3H5NA 3SJBA 2Y1LA 3GJ6A 4CM8B 1I6WA 3V48A 2YKGA 1NURA 4WNAA 1GQQA 2JAUA 2D7JA 4M7RA 4IVNA 3KZCA 1BDJA 1E9CA 4HDNB 2FW9A 5ALKA 2GUGA 1QYRA 4KIFA 1KA9H 2H0AA 3E5NA 5EIFA 3Q7PA 4ZVKA 1V1RA 3VU8A 4EX7A 1G2QA 2V74B 5K0CA 2CKMA 2PVPA 4D9KA 3FVTA 2AN3A 2IEZA 1KH1A 1QB8A 5BVGA 3ZJUA 4UE6A 3ILVA 1U28A 2VQDA 1JG2A 4FKBA 2GD0A 3KG2A 3UNXA 4ARVA 4B9EA 1R37A 1I4DD 1Z45A 2VHUA 4KDCA 2OYRA 1DC5A 3AETA 3M6MD 3PX2A 1A2KC 4HAOA 1U1CA 4GKVA 3TJZA 2QLBA 3DTVB 3OZUA 1JVBA 1WPXA 3THOA 9LDTA 1WXQA 1G5QA 3GP5A 3OLZA 2OB1A 1VCHA 4OF4A 4M99A 5DGDA 3MWFA 4GQBA 3B60A 1GL6A 3IPXA 3WLRA 1KO5A 1E5DA 1HDYA 1M8KA 4DLXA 5HUHA 2H4XA 2OKGA 3K1YA 5J5AA 3NFRA 4YRMA 4ENTA 4YQEA 5CFLA 2R1TB 1F48A 2C5SA 3IAXA 2QVLA 4V3CA 1K9VF 3R7FA 1AVTA 1Z2PX 2ZJFA 3AI1A 2PZMA 5FOVA 4FWTA 1XG5A 1JFFB 1PZGA 1YFJA 3NHZA 2R5FA 4X85A 3T52A 3NC1C 4AJLA 2F17A 5ITVA 5BUCA 1TTHA 4BFLA 4FFPA 3FR7A 2R97A 2A9RA 2AR0A 1F2TB 4RW0A 2QZ9A 3I9V6 4ZGBA 3DBOB 3UMYA 1MJGA 3VVCA 1JSCA 2WTUA 2WV7A 3CKLA 1MORA 3FLBA 3ISVA 1DRVA 4L6CA 4EI9A 1JB1A 5JG7A 2Y0BA 5C53B 3EDYA 1EDDA 5EERA 2GN6A 4Q37A 1Z36A 3LYAA 1CYEA 3DEJA 2J7PD 4FYPA 4LSMA 2H4FA 3ESCA 4NBSA 5F4BA 4MGHA 2C0QA 2DUUA 5KX5A 1M6VA 1WXWA 2J9RA 4RTKA 2VAVA 4JI7B 4FGKA 4IHAA 2CN1A 3MOGA 1JI0A 4MVJH 5CRIA 2H4HA 2JIMA 1BS2A 2CD7A 1ZA2A 2OAGA 3NB0A 5E9JA 1FDWA 3GF4A 3Q85A 4TMYA 5LWHA 3FCEA 5KNCA 2HC9A 4YAEA 4AX4A 4DCNA 1TNDA 4MWCA 3EDRA 5CCXA 2ST1A 4S0ZA 2F48A 2GN0A 3PR2B 4NK5A 4EP1A 1T5TA 4OFXA 2NSHA 2VPXA 3DAFA 4GX2A 3FUVA 4O2AF 4YJFB 3H2KA 3A3YA 4YASA 4L78A 4TX1A 2GAJA 3PX7A 4L02A 4GGOA 3TTXA 1Z37A 1RHQA 3CLSD 3DEIA 4RQBA 3LYUA 3O03A 1NC1A 1UAAA 2QW1A 5ILGA 3E9EA 1QGAA 2GSWA 2QYOA 3WO0A 2Z8YA 1PYDA 4IJVA 1P2TA 2HNKA 4EPWA 4A91A 1JDUA 2GK3A 3UOAB 5H5JA 3C85A 4X65B 1R9MA 4ROTA 4YCBA 5CXSA 4CTJA 3KKNA 9ATCA 1I2AA 3CSUA 4ACAA 4ZVUA 1F4PA 4L57A 1L6RA 4AB1A 5KVAA 4TTJA 2OT3B 5ENVA 3KWFA 4NULA 3ECCA 2IF0A 4D42A 4Y18A 1SBHA 1STOA 3GLKA 3N0WA 1NRXA 2BM9A 2IEAA 1EUDB 4JEIA 2WYUA 1GKKA 1XWWA 4RA6B 3ZIAA 1XRMA 3GG9A 3I34X 3QV1A 4L2IA 5E0OA 1HOTA 3EGEA 2P9CA 1XD2B 2P2DA 5DIFA 3ZS9A 2GVDC 4OREX 1LS1A 3BB3A 4QOHA 3PNYA 5DX1A 2WWXA 5JXGA 3HR7A 2J0SA 1HG1A 2ZE6A 4DIUA 1XXLA 3OZDA 2EGHA 1JALA 3GFTA 3CN9A 1GGNA 1P7PA 3S1AB 3UPDA 2ZYTX 5C7LO 4YCNA 4Q00A 3NRJA 1CUYA 1XUOA 4H7EA 2R6R1 1U28C 3KPJA 2E9SA 2N0SA 3N2ZB 1HE1C 2CJXA 5K2MA 4LHYA 5LJLA 3NONA 3WOHA 1E7MA 1DWOA 1NQVA 1WSAA 1H6CA 1UKAA 4OBWA 2CMFA 1Z6XA 3OP1A 2PZLA 2VBIA 3UJ8A 5JI2E 2DCMA 1EFRA 3L8HA 4A92A 3RIMA 1BJRE 5MGNA 1ZHOA 2PU7A 3CBQA 2YCLA 3KQHA 3SVZA 3OO0A 3ETGA 4ZT6A 1XVIA 4NAUA 3UHAA 1P81A 2ZRNA 3FNEA 4MVCA 4I5DA 1DKQA 2IQ5A 2UVDA 4LEIA 5F1KA 5CBPA 5L3SA 1RZRD 1I2MA 3NQ41 1L3IA 3WIOA 2P91A 1LF5A 1FX1A 2W37A 4GVPA 4MUBA 1U02A 4LHZA 5C80A 2QVYX 1V1MB 1WPRA 4LSWA 5IABA 5L9AA 4K6MA 2FEKA 5GVRA 3CRVA 4EGQA 1R6DA 2VPZA 1TO2E 2ZANA 2VK4A 4X5OA 4HJRA 5K99A 2GZ1A 3ANTA 4HGQA 4TMKA 2NU8B 5DW0A 4A2WA 1FXWF 4JP1A 2P9BA 5JHGB 2IHBA 4TT3A 2JLZA 2IUFA 3DCYA 1LVHA 4RY8A 1MW8X 3TZCA 3RYHA 1L5WA 5JU6A 2C94A 3GUHA 3QEMA 1YDFA 1KEUA 5AHRA 1Y0BA 2CVZA 3PJRA 2EWWA 2X2PA 4G0WA 4KGDA 1JYEA 1TU4A 4RY2A 4IIYA 5JMPA 1W46A 1SVSA 3OZVA 1ODCA 3QXHA 3PQCA 4RKYA 5KTKA 1MABB 2OGTA 5IUJC 2DFKB 2CLHB 4N54A 1DT5A 5TXGA 5DHTA 3A3KA 1M66A 3GGGA 1X1DA 5K8JB 1G3MA 1EGHA 5KOIA 3BXEA 1TW3A 4DG8A 4H1UA 1KMHA 2GZ2A 2P75A 2GMWA 3CM0A 1YBFA 4H1TA 2C83A 1G66A 2EJCA 1TMKA 2II6A 3PS9A 4P53A 5ESXA 3RIYA 3AEUB 3NG1A 2AE1A 1OASA 4ND2A 3GBPA 4MHTA 1RWVA 6NULA 2DY1A 3GFFA 1XTBA 3I61A 4DV7B 4W5HA 5AOCA 1M76A 2H07A 2OXRA 3IIKA 2VPYA 1RAFA 4G4SP 2Q7DA 1PK7A 4FJ0A 1WDTA 1JXMA 2QD2A 3ZGOA 4B7CA 4PQYA 4U7TB 1GNQA 1M2FA 1LBSA 1RWWA 3PEEA 4WZBB 3SC2A 1AG9A 1RRFA 3ULKA 4BC1A 4MV7A 5CFRA 2IYUA 3H3XA 1MAVA 1S4MA 1JHMA 1ZU5A 3OKFA 3LGSA 4HSGA 3RWBA 1SVNA 3BRQA 2GYUA 3GGJA 3RADC 3SJ7A 2AKYA 1XTZA 2XRFA 1ZGAA 4NZOA 2GZRA 4BO2A 1MG0A 1ECPA 3K0HA 1S2NA 3EBOA 2QMYA 3FH0A 1LPSA 4UC0A 3VOBA 1KE1A 1QYXA 2OG1A 3I5MA 4MUGA 1KQOA 4KNVA 2W6ID 3ZGVA 3HXPA 2V1UA 3UEOA 1J0CA 4H0FA 3U4HA 5I9SA 1PLLA 1AF4A 3Q8KA 3FZQA 3EMVA 3FR8A 1MJFA 2E4AA 4LRXA 4JLNA 5KNBH 3NWEA 4OHPA 3D1VA 1G6OA 1RS0A 1YJ8A 1MC5A 1Z68A 3Q88A 3IV6A 4MGEA 1MC8A 2ZQZA 3HNRA 5E0KB 3NUGA 5EG5A 2IQIA 4NS4A 3WK5A 1JDBB 1TF2A 3DZBA 3H7AA 3OPMA 1Y7TA 3QPAA 4HNUA 1EP2B 1XZDA 1EX1A 1N6IA 2QTGA 5JR3A 4R40A 3Q7SA 4XQ0A 2GILA 4UPDA 5H9WA 3JWGA 3V7NA 4O4JB 4C88A 2BKVA 5J4HA 3N2NA 4DT1B 5EJFA 1O5OA 2WMNB 4H7HA 1II8B 1EA7A 1Z6TA 5B53A 2CXSA 4PANA 2B83A 2LUOA 3RBAA 3FCYA 4Y9RA 3EPPA 1C3EA 3RU7A 4W5QA 4O2LA 1XMOB 2V45A 3UYKA 1NM5C 1XP8A 2EZTA 3PPYA 3IV9A 4TWJA 5AYVA 3R75A 4R4JA 4KMOA 1GNTA 4WT7A 1W59A 2GVNA 2EERA 2ONZA 3C14C 1I9GA 3L0SA 4JWTA 3GCDA 4KN6A 2QTZA 5A7GA 4WBXC 4GKKB 2GUWA 4RZSA 5CBKA 1ZSYA 2CDCA 2ZSEA 1DC3A 3IC5A 5E6UA 2FUG6 3T06B 3G9TA 1J90A 3BORA 4WAUA 2C3YA 3CGGA 4A0HA 2BLLA 1W4LA 4KGVA 4P5PA 4AUNA 1Q7GA 3N0TA 1FDTA 2F4NA 2CNKA 4D56A 2AEJA 3GN2A 4LS3A 3FE2A 2KPOA 4WXEA 1XQXA 4EJSB 4BKRA 1NI4A 3TKLA 1KNXA 3WP0A 2F6RA 3O83A 3K6SA 3QIAA 3WB9A 3QLUC 5T4EA 3B6IA 4IIUA 4TOIA 2QAIA 1W5TA 4DIDA 4L73A 1IQPA 2CB0A 2DUMA 4PHTA 3WLEA 4Z4HA 2O2EA 2R751 2VT7A 5JD6A 2VK1A 4ENQA 2NUBA 4FHFA 5BRJA 2OFWA 1DQZA 1M34A 3GNQA 4D81A 4Q7EA 2N1MA 3RARA 3FUXA 5F21A 4Z2AA 3KFVA 2XDQB 3FKQA 2XVYA 2UZAA 3GRZA 3QBDA 4OMCA 1A9PA 4QARA 4P7GA 3SIPA 4IH9A 2BFCA 3UM9A 3WNCA 3W8NA 1PNTA 4JP3A 3P2MA 4R9NA 4AJ1A 3EUEA 3O8OA 4XVHA 2J0QA 2WHEA 1P4JA 5AK0A 2VYVD 3QKSA 1CD5A 3HKDA 4PG4A 4BFTA 3LPDA 2V0CA 1ZL0A 3KJXA 4EI2A 1H8ED 2VK2A 2WKPA 1WHTB 2R11A 2Y77A 3MZ0A 5FTKA 1MMFB 1XEWX 3M1LA 1N25A 4LECA 3W34A 5JH7F 2R6AA 4WMLA 4YMHA 1OZGA 4ZVMA 2VDPB 3ADOA 2PKQP 3AM1A 1ZYUA 4B74A 5B4UA 1GQYA 4K05A 3OPQA 1JIXA 2QP9X 3RU3A 1CB0A 4WXMA 1REQB 2RBEA 4EM6A 1PX0A 3UMBA 3VR6H 3B9PA 1OFIA 1YMQA 2JPDA 5BR7A 1THTA 2CV1A 4G0VA 1QYDA 2JGAA 3OT4A 1CZKA 1UT8A 4AS1A 2RHRA 1BIFA 3BM5A 1GLVA 5KYVA 1ETUA 2ZCVA 3JSAA 4DMCA 2Y3IA 4C87A 1F3OA 1TL7C 3R7SA 2Q6VA 2JZNA 1RC1A 2QK4A 3E27A 2IYXA 1WR8A 3BPSA 3DZ8A 4HH1A 3U7JA 4TUYB 1H2RS 2H0QA 2VH1A 1R16A 1W0JD 2EATA 1TTPB 3OE7A 4GAEA 2WHPA 3H83A 1S2LA 2ORYA 5EZQA 4EB8A 1CZLA 1PSZA 4B4DA 1XVTA 5EXSA 3PNBA 1ZR4A 1NNLA 4ZVSA 4W5OA 1BN7A 1X1QA 1G1AA 3OJEA 4YRCA 4EG1A 4Q24A 2P2CA 1QAQA 4RTNA 3IAHA 5FR2A 3LNTA 1ESMA 2FWBA 3IBCA 4NYJQ 4HYEA 3SHVA 1PJBA 3VVMA 4FS3A 3EW9A 3KKZA 3CVOA 1Z47A 3OMWA 2ZSIA 1WETA 4P8RA 3L06A 1QCDA 4XM2A 5G3ZA 3K6SB 1LK0A 2FQYA 3EVDA 1AV7A 3DFIA 3ONWA 4LBZA 3AESA 4P34A 4DWVA 2XPCA 4IJMA 4HBZA 2H54A 3IP9A 4OEHA 1O6BA 2C2KA 2OO5A 2E87A 1XWFA 1CFJA 4K03A 5HM6A 1VPWA 2X5KO 4NL4H 1USVA 4EUEA 2ZIEA 2V65A 4BB9A 4D3XA 2P6PA 2AQ8A 3REFA 2C4KA 4FZ5A 4BKPA 2CLMB 3GEHA 5GTDA 3FMIA 1NG1A 3P9YA 2NLOA 3GJQA 4KQGA 2WDPA 1NU8A 1P1IA 1KSGA 4KXWA 2Q5OA 3V4PB 4BZXA 3QHPA 4HWGA 4MI3A 2KB0A 5MN5A 4EB3A 3V97A 3I8XA 2HR1A 1EXWA 4RABA 2Q27A 5DXFA 4MTLA 1SZDA 4RF3A 3PL1A 1UFRA 3VPAA 3ETEA 4INZA 2P8SA 5HCIA 3WAGA 1RSZA 2Z57A 1CZOA 2VJLA 3X2FA 2BTQB 1YVUA 3T1QA 1QO0A 1YBHA 1FW8A 1NPYA 4KN8A 4CKEA 1HX7A 4DJ5X 1KI8A 1W5AA 4CM4A 2W43A 4P83A 2AL7A 1FA9A 3H8SA 4Q4LA 2OHIA 1EEXB 4C6RA 4DYHA 3H2YA 4P4GA 3HA5A 4CN8A 2A1UB 1O4WA 2WAOA 4MITA 3IR5A 1ZA1A 4I55F 4RTOA 4Z4QA 4RDIA 2CNNA 1SEVA 1WUTA 4QGGA 4NNOA 1CDEA 1H2AS 4TKUA 3UG7A 1WMSA 1OWPA 2YL2A 2XWQA 1U80A 3M89A 2AEFA 1Z2CA 1GPDG 4HB3A 1E7SA 1V8OA 3V00A 4BEVA 4EJ6A 4BHTA 4LGYA 2ZPUA 5E2BA 4J07A 4DUYB 5E7QA 2QP3A 4H4EA 4TWAA 2DXIA 5EA2A 1CP2A 2FUCA 2J0VA 1UFOA 3E58A 2FXIA 1KC1A 1KO8A 3CPSA 1W0KD 3CH4B 1VJTA 3ZK7A 4JLDA 5FUQA 2AQIA 3R41A 5AW6A 5I9TA 3L0CA 4LNUB 3SVLA 2WY2D 3H6KA 4CFSA 1L4NA 2VUUA 3DZIA 5LDHA 4P3PA 4DIMA 2H5IA 2Q6KA 5TIIA 1C9KA 3ZZTA 4Z4GA 4ND7A 2X2FA 4LYAA 1JLKA 3V2GA 4TN1A 3ZHOA 1P29A 4PTYA 2C9OA 3DOEA 3T4PA 1U94A 2E82A 3ZOZA 3FTEA 4EELA 3O2QB 1YRHA 2XAAA 1FDIA 1NV8A 1QRDA 2ID4A 5FEUA 4MOWA 4NE2A 4EW2A 1Z17A 2R7LA 2PKRA 1LDMA 3OUZA 3PWKA 1UC9A 5CEJA 5I7VA 3B5IA 2JBAB 1EESA 4PPFA 2YW2A 1YTUA 4MRMB 1FFYA 3DFFA 2XX3A 1Y7IA 3RU2A 3TUJC 4AWAA 1RI5A 1DQPA 1HKHA 5IT4A 4HDOB 1PL8A 3HEBA 4JS0A 4CYMA 1ZRNA 2NYVA 2OQ2A 3DVQX 2ZTVA 3E4DA 1T2NA 3MT7A 4I08A 5JJ5A 2B4YA 5FTJA 3F90A 1JR4A 3VH1A 4BP3A 4HJXA 3IXQA 4QM7A 2EFHB 3LDGA 1C30A 2E4ZA 3EVZA 4J0GA 2CSXA 4IKOA 1I3LA 4LMRA 5C7YA 4U7FA 1P0CA 1A9TA 3UB2A 1TUIA 2XYQA 1NWHA 1I5EA 4IQ0A 5CA0A 4R2LA 3LIPA 2FYTA 2GWRA 4WZ6A 1FNCA 2X0KA 3PDCA 9ABPA 4NG4A 5IX8A 3H86A 2VDKB 4JT2A 2J32A 1UKBA 3WP1B 1AN0A 4RDXA 2W6QA 5KUTA 3EQZA 3EQ9A 4B8YA 4I99A 2QJWA 1G16A 1IHXA 1L7AA 5IC4A 1BN6A 2HV8A 4DE5A 1OSNA 4NCAA 2Q5HA 1K3TA 1VJRA 2Z95A 2BFOA 3FFXA 1ABEA 5FBLB 1UDCA 2BHRA 1D2GA 4IHJF 4LY6A 1AKMA 2YZ2A 2B7LA 1XCOA 2W00A 3IEKA 3QOYA 2BGGA 4TKUB 1PUXA 2VRCA 2F9FA 2H57A 3UJNA 2P40A 2O2SA 2IH2A 3U40A 4MQMA 1KDVA 4G8JA 1CRWG 4YCJA 2RGEA 4Y2JA 4IFEA 1J8DA 1KMQA 2E1PA 2EL7A 2V7WA 1NKSA 1O95A 3V8PA 3I12A 3P20A 2FGKA 4O2BB 2OFFA 4PVCA 5AJUA 1HMPA 3FLAA 1JHQA 4C3ZA 2H4YA 2CHFA 4XWOA 2P2NA 2FW7A 4OFZA 4ZREA 1CUXA 3A4TA 1OFVA 3W6ZA 3ROZA 1BXZA 3HGTA 2WSYB 2OLJA 4D0NA 2RGWA 4ATNA 4E3WA 4QVKA 1UDAA 1DIBA 4DLYA 4H6WA 1KBQA 4PAMA 5CU7A 3GLHB 2OWDA 5TEVA 4ZAZA 3PGVA 2GHRA 3RS5A 2LV8A 2ES4A 2NXEA 3P71T 4C3UA 5JS8A 1YZVA 4AKTA 1NJFA 1UUFA 2Z09A 4AWBA 2YFQA 1TF7A 3PHLA 4ZYLA 3LCCA 1OI3A 3T3EA 1RRGA 1HWYA 3RRZA 1EFVB 3T0FA 3QKIA 4ARZA 4I4TB 5GONB 1K86A 5JNVA 1SQSA 2Z0MA 2FOIA 2VQEB 4EYOA 4A2PA 1E3QA 4Z4CA 4AY2A 4J75A 2H18A 3RRXA 4DIEA 4RGVA 3IAM6 2FPIA 4GD3Q 1Q12A 4KLZA 3W4KA 5E9QA 4LC1A 1KPGA 1S2OA 1A2QA 2AJBA 2Z2JA 3NHYA 1VLQA 1DXQA 4Z8XA 3GVHA 2CXNA 1DBSA 3ZPXA 2CJWA 1RKUA 1PR4A 4O02B 1OXKB 1NNUA 2E48A 1R4MB 2QZ4A 3WV4A 4AJ9A 1XROA 1TA0A 1WUJS 1J07A 4B45A 1F12A 2PRZA 3BL5A 3STTA 3GT7A 2Z2KA 4DIKA 5LQCA 1JLMA 3ZLTA 1AUVA 1VPLA 2QVGA 3I1JA 4IUDS 3ND6A 4MDYA 3ORFA 1C8BA 3SF0A 4EITA 5B7GA 5KSOA 2R44A 3P5BA 1U1EA 4AP9A 4LZLA 4YWHA 4KQJA 1PCXA 2D5IA 2Q2NA 4Y6OA 3C87A 3JQGA 1TGYA 4B84A 5DT2A 4LI0A 3DVAA 3E5MA 1T9CA 2NUAA 3E9NA 3NBYC 2H7CA 4QG3A 3IT1A 2RHHA 3A3NA 2AVNA 4NMXB 4BFSA 5LZ7A 1JPUA 3PFHA 3WYAA 1QMPA 3KZOA 1TYEB 5KDLA 4AY4A 1ZAKA 2HXGA 1VLLA 2HSWA 5L7YA 3B1JA 4CCYA 1V16B 3HBNA 4XDZA 1RXYA 1VQ1A 4XIYA 2RH4A 3IAFA 5K3FA 1HPLA 2D4AA 4PWYA 5KI6A 3NUQA 3WK9A 3OHPA 4LJ8A 2E1RA 2IEBA 2OCPA 1HI9A 2LXNA 4XQGA 1QGUB 2PIAA 1KI7A 5LMUB 2FR1A 3MB8A 4MZXA 1D9XA 3KB2A 1NSTA 5JO0A 4IJWA 1XTVA 3OT5A 2O3RA 3UJ3X 4ER0A 3SIRA 1BQ4A 3AKCA 5F1YA 3EODA 3V4OA 3KYDB 1OBVA 2ARKA 2Y1XA 3IUPA 2G5GX 4HAIA 5T57A 5DLDA 4ER5A 1NSYA 4NENB 3WWOA 4L08A 3DMPA 3GZJA 5GMOA 4W1QA 4ALLA 1HLDA 4EX6A 4J16C 3UTDA 1MHPA 5HKLA 2Q8QA 3ZXIA 3FETA 1T5IA 1J1IA 5CW2A 3ZU3A 1XI2A 1W85A 5K3EA 1C9NA 3Q9NA 5A03A 2RGNC 3BC1A 4XX1A 3TLBA 1RJDA 4TYPA 3TCNA 2V7BA 2IDMA 5LQNA 1OXTA 1S2GA 3DDWA 1HY3A 2O8BA 4MUHA 4MVJG 3CX3A 3DE1X 3WK4A 3ROQA 2VRNA 2XE7A 2PRSA 3LE8A 4G0ZA 2O8NA 1ECFA 1FLDA 1QZTA 4QAQA 4S3MA 4WNYA 3FRIA 2IX3A 5JS1A 4LF7B 1SBCA 3QZUA 2HV9A 4BWVA 1Q0TA 4YO8A 2ZBQA 3NAZA 4UHEA 5BNIA 1OLOA 4IHJB 4BEJA 4R9RA 1W0JA 5LA6A 1N5DA 4JJZA 2XMDA 3FCAA 4PYLA 5JY1A 3UT6A 1CFZA 3OTWA 1WB4A 1GVHA 4XVRA 4ZI5A 4B3DA 4YK7A 1Z0IA 2GZMA 1N2EA 1FE8A 2D0IA 2B35A 3QUSA 1TUGA 1CUAA 2M1XA 3C7TA 1LPBB 1N4DA 2AOUA 1T8TA 1P3DA 3WJ1A 1IATA 4GMGA 3PYLA 4G07A 1SXGA 1XNGA 3IUQA 4HR7A 1NBOA 4RVDA 4Q5IA 1ZK4A 4ZD6A 3VJKA 4HGZA 3G2HA 3BN3A 3RS8A 4ZO6A 1CRQA 4UHFA 3SM3A 4HEA6 1KYVA 4CZ2A 1V5GA 5BN4B 3K94A 10MHA 1QRRA 1SHTX 4EWLA 1GGEA 3E05A 4KQXA 4F4DA 3VBEA 4G5RA 2OBMA 2QN7A 3QG5A 4KEAA 4L9SA 4RSRA 3GPDG 3GZ4A 4H7PA 2L18A 3NM6B 4PBTA 1Z28A 1GPYA 2W8BB 2WQZA 2J5QA 1Z8NA 1TT7A 3K4PA 3NLLA 3PCXA 4MPPA 3TIIA 1U0SY 4UTNA 3H65A 2I4MA 1W6UA 4KN5A 3ICEA 4JL6A 3ICPA 2QJTA 3GR6A 2H11A 4MULA 2C7QA 4JC0A 1A88A 2AZ4A 3VU0A 2GERA 5KTOA 1CT9A 4WJLA 3FCXA 1J0XO 4F3YA 1JT2A 1I5OA 2FH5B 3JWJA 5CVVA 4ZGGA 3PEVA 3C6KA 4EB6A 3BCHA 1ZGBA 2Y66A 4CCWA 2H1VA 4TYMA 1PHRA 2D5AA 4XJXA 3MJDA 1E8NA 1HTBA 4M1YA 1A8IA 3QF4A 3A9SA 3AY6A 5AVWA 1R4AA 3ETHA 3KQMA 1LI4A 4FC7A 1E7QA 2BFMA 1UP6A 3IBSA 3JZMA 5EIAA 5KHOC 2DHEA 4XGKA 5JJKA 1OB2A 1TM3E 5H1YA 3LOUA 2QDXA 3U1VA 1CEXA 1V45E 3C43A 4UMEA 5J2TF 3SC6A 1R27A 3GP3A 2A14A 4AL4A 4WFKA 3KSAC 4HNHA 5IDWA 2H29A 3HKEA 4TWIA 1Z5PA 3B8EA 1R6UA 3QVJA 4YJ3B 3HVIA 5AK4A 3AERA 4IUYA 5DP2A 3WYNA 4MW6A 1CF4A 1CNFA 1T5DX 1II9A 1DTEA 3I2GA 4WJKB 5GQSA 5HS4A 1PAUA 3MINB 1CUZA 1PT6A 3ENWA 3IMFA 5BO5A 4B44A 1L5HA 1TMOA 4L5IA 1NUQA 1C3JA 1D2HA 3JWEA 1EA5A 2C5AA 5L6MB 1Y9EA 5H70A 4EECA 2XE4A 3R77A 2E5LB 1IC6A 2V0NA 2B4QA 2NO5A 3U44A 2IX9A 1OA0A 1SQ0A 4X24A 3RC9A 1PJTA 2A9KA 2OXIA 3RSGA 2YV1A 4JYAB 2Z1MA 2DUWA 5EIHA 2RG1A 2O6LA 1ZINA 3EY4A 2ZRIA 2UYCA 2NZ8A 1EDEA 1SIUA 2G0TA 3D8HA 5FYDA 1DWPA 2DULA 4P92A 1GILA 4PG5A 4QJBA 4ZQFA 4AKEA 3AJ8A 3B7GA 1E2NA 4A23A 4L27A 1GEGA 2ZWAA 3LIIA 4MSUA 3TN7A 5B7QA 2VCYA 1CK4A 4LYYA 2CLDX 4O4LA 4AWXA 1MENA 3IMEA 5KC8A 2V58A 1W25A 2W42A 4HAYA 3VNVA 5E4YA 1A69A 4YP0A 2VNKA 3WRYC 1QRTA 2LD4A 1EFKA 3F97A 4MPRA 1ZNWA 1S8FA 1CQIB 4MVJD 1WDLA 1UJ6A 3HB4X 2Q62A 2J87A 2QN3A 3GD5A 2IIQA 3MPUA 4FIZA 1A4XA 4CM3A 1DELA 1NRWA 2ZLBA 3R5HA 1H4VB 1SCKA 1Y1LA 2C03A 4KYUA 4BRSA 5E1MA 4CTOA 1HE5A 1N6RA 5BR4A 5DSZA 1YE3A 4IFTA 1GY8A 4K8OA 3BHJA 5AKXA 4EGJA 5E95A 1IU9A 2PXHA 2P1DA 1LLQA 3AEYA 4OPMA 3UUEA 1WP9A 2Q8NA 3P0IA 1RI2A 4ARAA 4F96A 3TZLA 2ZJ3A 1JEDA 4KIGA 3HI6A 2QUIA 3Q3HA 4G89A 3MHPA 4CM5A 1CB7A 1K5GA 3LHSA 3PWTA 4J3JA 4KGXA 3C1UA 5K1ZA 3ADCA 2XXAB 3LY7A 1EI9A 4K7JA 4PR0A 4RF4A 1V96A 5AM0A 5T7BA 4KQ2A 1PIWA 1Z8HA 4I8IA 3CJRA 4KN9S 1CUWA 4DNPA 2QNIA 2VQFB 4JBXA 2HRBA 1BMFD 2GBFA 5I7WA 1PJAA 5T41A 2Q07A 2AI1A 2GTIA 1QVVA 4J7AA 3RBXA 2MYTA 1MHTA 2QBYB 2PXCA 2HBZA 3I76A 4JEMA 2JLXA 3DO6A 3RBVA 3WZMA 4J7UA 1XPJA 2HSDA 1O2DA 3CNHA 4OMUA 2ZR9A 2FW8A 1HQDA 3JZIA 1F8FA 4BO9A 1JU3A 2XNDD 5A3SA 1CUBA 1KMHB 3B2NA 3D4LA 4BOYA 1CS0A 4YMVA 1IVNA 5FB3A 3UCFA 4CIVA 5KTPA 3DAGA 3KTDA 1DSSG 4P93A 4DNOA 3OY2A 4XWYA 4PZCA 5DH9A 5FPTA 2ZT5A 4GSLA 2BFDB 2NU9B 2RGBA 4CKBA 1O96B 1G21E 4OGLA 3KSMA 5BXYA 5ALRA 1GNVA 1UKVY 4MNTA 2FZCA 3NIGB 2XZOA 3QPWA 5JAUA 1VBKA 1ORIA 3DM9B 1IL0A 1P0PA 4F4JA 3E3LA 4G0OA 4LOKA 5CJPA 1KAHA 5E6RA 3HDHA 3QXXA 2YMMA 1SN7A 3WWPA 3ZBPA 4XWAA 2MSDB 2TMGA 3AI2A 1AK2A 1E9BA 1XVVA 2YJTD 2D5CA 3SQMA 1PL0A 2V97A 2PZBA 2J3LA 2VAXA 2J46A 3IERA 1EQ2A 1GGVA 3JQAB 3N3AC 4M54A 4PS1A 2EC5A 4TTVA 5CYPA 5BRNA 3S7ZA 1WDWB 3SEZA 4X91A 4BMCA 5JSUA 1XMVA 1H69A 5I4CA 3NXSA 1WXHA 2AFVA 4LRSB 2X4LA 3MWDB 3LXUX 4D80A 8AT1A 5IFLA 2YWXA 1IY0A 2EOAA 1DEHA 1G8SA 1NASA 4MI9A 5TMBA 3O8QA 3NHWA 3U4CA 3WY9A 3G5TA 2HRDA 2VAPA 5B3LA 3R9KA 4GYKA 4C06A 4Y2VA 1U81A 3DTYA 5JSFA 3DOIA 3GT0A 3UAVA 2WLSA 2JAOA 1E3WA 1L8AA 1NBEA 1H42A 3ETNA 1YS6A 4OQZA 3N39C 3LT1A 4PIPA 4A5OA 2XNHA 4E5DA 6CHYA 4KQWA 4B79A 2HU7A 1DAGA 3H6HA 3I0NA 5LZ8A 5THXA 5A4DA 2FWPA 4FM9A 2ZJ0A 1YVPA 1YOVA 4Z49A 1KY3A 4BNDA 4MCIA 1OU0A 3B82A 5F51A 3G1UA 1C50A 4NENA 2VHTA 5EJEA 2C8KA 5CLFA 3HACA 4KWTA 4CR6A 1ZMBA 2XD9A 2P11A 3MT0A 3VYUB 5JBNA 3C70A 1WMEA 4Y2RA 1JWLA 4J0EA 3PITA 4A6EA 4DG5A 1WZ2A 4X6XA 5JQGB 1V4VA 4UD2A 3FD8A 1MX5A 2FPOA 4U63A 3ROGA 3GUCA 4MDFA 2SKDA 1MJNA 3HB9A 3GROA 4U2DA 1D4OA 1W9MA 2OOKA 3VR5D 1NU6A 4ZQHA 1T5SA 4J16A 1QBKC 3FNIA 4X1YB 3HKCB 5I01A 1UADA 3N5KA 1U6JA 3GUYA 1DBPA 3MWEB 4QGBA 3ND5A 3IQIX 3NWPA 1DFHA 3EGVA 2FZ4A 5HEKA 4G9GA 4B31A 1P2UA 3SG0A 3PIDA 2WB2A 3U2QA 3OECA 4AJKA 1F7VA 3CQ9A 3DZDA 4N6OA 2AZDA 4A9AA 1UC5B 3T3IA 4AZVA 1HFKA 1IHYA 1ADGA 3D3NA 2Q4BA 2HNBA 1JQEA 3ED1A 3VDQA 2CVPA 1IM2A 2VKTA 3F67A 3OLCX 1OAKA 3QE3A 1Q15A 2VJNA 4KIJA 4JU9A 2IP2A 3MHTA 2BP7A 2G1UA 2XBUA 5LQRA 1X8KA 5HSGA 4QBKA 4J3NA 2D0OB 2TS1A 4RVCA 1MC1A 1XFAA 4S24A 3SEFA 2A9QA 4MQLA 1C30B 3DOUA 5B1HA 1ORDA 3TZKA 3TX2A 4TV9A 2ZBRA 5KKCA 3IBFA 2JFBA 2ZYSA 4M55A 5CFZA 4EEXA 2VF8A 1TLLA 2VTVA 3T4UA 5KNCD 2EV9A 3OE1A 3HFGA 3S1LA 3VX4A 1VLJA 4W99A 5C1OA 2XDYA 1ZITA 1OX6A 3KFLA 4RKFA 2JD1A 3UB4A 5HR5A 3PLAE 1BE6A 3BK7A 4QUDA 4S35A 1HSOA 5JAPA 3HCDA 3MLBA 4ZOQI 3R0IA 5H3HA 2Q9CA 2ZI4A 4D2IA 3OQNA 4F8EA 4OKIA 4GOND 1G55A 3OM8A 4JC8A 2ZRFA 2DE0X 2JGDA 2HJVA 5CIYA 1XDBA 3HCRA 3JD2A 3QJGA 5IWCA 1T9HA 2XA9A 3ODGA 3G5LA 4LXYA 3TBHA 3EXG1 3WYDA 4E94A 4EDFA 1DV1A 2VHXA 2G40A 4MRMA 1HDCA 4OI0A 2WF9A 2Q5FA 3WXBA 4L3VA 2D0PB 2FZEA 2KBEA 4HDSB 4ER7A 4F4IA 5A1JA 2C5LA 3WISA 1DFIA 3CN7A 2WSLA 2Y71A 1JB9A 3FMGA 2AX4A 4LAFA 5IARA 1WXFA 3S2SA 1G7TA 1NI4B 1G17A 1LBIA 1RXSA 3EGCA 3H19A 4GYWA 1SEPA 2R66A 4MVJM 2AUTA 4XDHA 2VH2A 4PLVA 1N5MA 1FYWA 1I24A 3SYLA 4BVAA 4GM0A 2CYCA 4AXBA 1HC7A 4B2IA 1R4ZA 4X7MA 1Q92A 4X3OA 4RENA 4IRUB 4ZJUA 1V4NA 5DLQC 1E3SA 2YHAA 3K9QO 3RASA 1HTWA 1W8IA 1XMJA 2XLCA 2YWCA 1YMUA 4JCOA 3LWZA 3OQBA 4YS6A 4ZC8A 4HLDA 1I9CA 1O7JA 2XDQA 3PDJA 2CXUA 1AQ6A 1C7QA 1RVV1 4NCKA 3I1IA 4A8JA 1CLUA 4DHEA 2M9MA 3EG5A 4FXPA 4YLYA 4CKZA 3K70B 3TKAA 4HGPA 4BLRA 1XVLA 1SA0B 3HO1A 1NBWB 1H2EA 2VATA 1BWRA 2WM8A 1ZP6A 3LX4A 4JB2A 2I6UA 4WOBA 2UUBB 3O82A 1HORA 4OA8A 2VP5A 2O3QA 3L0BA 5H7XA 3SCZA 2D74A 2PUWA 1G3RA 4LTMA 5EKDA 5B1SA 4E1VA 3F9IA 4UBJA 2IXFA 3WHLA 1NN0A 2D54A 2FTKE 5DEIA 4Z7QB 4FMBB 3ZY4A 4RS3A 3W6PA 4LF8B 2J6IA 2IV7A 1A8UA 3ZG6A 4XAQA 1AKVA 4G0MA 1EFRD 2Q21A 4WBNA 1LKZA 2R3SA 3PDIA 4X61A 3T54A 1SQGA 2O2GA 4EEZA 2JVJA 5IXSA 4PN3A 3EF3A 2RAFA 3HJTA 3QVOA 1VKHA 1R5JA 4RXTA 1G63A 4ZCIA 1FMFA 1AZWA 2AG5A 5EMHA 1QQAA 4JLAA 3H17A 2ZUTA 4AN4A 1V35A 1SVKA 2JRCA 4X3CA 1OYOA 1FNNA 1YZFA 1OWOA 3NP9A 3K9NA 5TSDA 1NF8A 2XVMA 4W6ZA 3WV5A 2Q0XA 3Q7QA 1TCAA 2QMEA 4EJ2A 2HA7A 3L7CA 2G1AA 4QT4A 2B1GA 2Q99A 3QPDA 4C7MA 4NKRA 3MFQA 4QXPA 3X1XA 5EP2A 1E1KA 3T1VA 3V7YA 4Z7JA