1USGA

L-leucine-binding protein, apo form
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
345
structure length
345
Chain Sequence
DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCINE-SPECIFIC BINDING PROTEIN
publication title X-Ray Structures of the Leucine-Binding Protein Illustrate Conformational Changes and the Basis of Ligand Specificity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 138
structure length 345
sequence length 345
ec nomenclature
pdb deposition date 2003-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usgA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usgA01
3FMVA 1NY5A 3O1IC 4EVSA 4S05A 3F73A 1ZAYA 1W25A 5JNTA 1RZRD 5BRAA 2FN9A 3IP5A 4GPAA 4O1IA 4WUTA 1C0EA 1LBIA 4LDAA 2GBPA 5TQ2B 1LJUA 3N0WA 1Z25A 4PYRA 2F8SA 1B00A 2PMCA 2CWDA 4ZMSA 1QP7A 1YIOA 2I6FA 1EWVA 2IOYA 3D8UA 3HDGA 3LTEA 3O1HB 3BILA 3O2JA 3QELA 4LRQA 1ABFA 4MAAA 1QPZA 4G0OA 4ML3A 4Z4CA 1Z15A 1KGSA 2J48A 1NXVA 2MYUA 2HQRA 2YHBA 2VUHB 3CS3A 4ZYLA 1ZN2A 1ZH2A 1U04A 3NHZA 1NXSA 5IBQA 3H5LA 4Z4IA 5BQ3A 2MSWA 3NHMA 4MR7B 1JX6A 3NBMA 1RNLA 3LFTA 4LE2A 3IP7A 1MB0A 2JVJA 2FKAA 2NT4A 2QR3A 3QEKA 1M2FA 4RDCA 5IEBA 3S99A 1QO0D 3H75A 1USKA 4MQEB 3HO1A 2FQYA 2IPAB 5TPZD 3OLWA 2PUCA 5TQ0A 3LOPA 2PKXA 5IEJA 1M5UA 1PHRA 2A9QA 2FVYA 5DKFA 5TE9A 1S8NA 5EWJB 5C5CA 3HJFA 5FWYB 3HEBA 1JWLA 1KRXA 2R4QA 3KLOA 4P98A 4W5TA 3EQ2A 3QK7A 1HEYA 4MS1A 4F12A 3OLYA 4EYGA 1NXPA 4JAVC 1RXEA 1FQWA 1E6MA 3H5WA 5D2CA 1NXOA 2JVKA 3HZHA 2WJAA 4TLMB 4RU1A 2NUBA 1SXIA 3EQZA 4KQ9A 3T95A 3HV2A 3KLNA 3QLTA 1DZ3A 1JYEA 4MS4A 3LUCA 2RDMA 4Z0NA 3VNAA 3LUFA 4TMYA 4DQDA 4F8JA 2F8TA 4Q6BA 2JVIA 3HVRA 4FB4A 4Z99A 3KYJB 4KK3A 3Q7SA 1DCFA 3H1FA 1I3CA 3HUTA 1SXHA 1L5YA 1AB5A 5HM6A 9ABPA 5BRJA 1YS6A 4G97A 5FWXB 3DZDA 3CRNA 3CKMA 1OXKB 1XHEA 3LUHA 4YLEA 3NNSA 4ZPJA 5EWMB 5IUKC 4MS3A 3E3MA 3C97A 3F7NA 1EAYA 3JTEA 4RKQA 1A04A 1Z16A 2WY2D 2VUIB 4DN6A 4DADA 1NTRA 4RK5A 2MYNA 3GWGA 1UDRA 5TQ2A 1GLGA 1ZY2A 1DCKA 5DTEA 1D1QA 2IDMA 3LUDA 4F11A 1ZESA 2GX6A 4RY9A 1FFSA 1Z26A 3O74A 5KQLA 3H1GA 1JFTA 2FMIA 4JB0A 2IYNA 3Q9SA 5EWLB 4F06A 3UKJA 5T7BA 5TPWB 1AB6A 2P4UA 1ABEA 3KHTA 1TMYA 4KRFA 4KK4A 2AYZA 4YWHA 4N47A 3CG0A 1Z13A 2HJ9A 3GRCA 2VK2A 1D2AA 2GI4A 5GQSA 1DC8A 2FXIA 3RVSA 4OATA 4KNYA 3DLBA 3C3KA 2FLWA 4MR7A 5JNUA 3CTPA 3H5IA 4IRXA 1JHZA 2JBAB 3C3WA 4N0PA 4OBBA 3SM9A 1D4ZA 4JOQA 1YMVA 2A9PA 3IPCA 3T8YA 3LUGA 4L4UA 3CFYA 5ED4A 2FEPA 3GYBA 2FW0A 4RZSA 5HKOA 1T34A 1QQAA 2R47A 4YCSA 1JFVA 2WJWA 3CZ5A 3H6HA 5EWJA 4ETNA 5FWYA 2FQXA 3EGCA 4P1ZA 2PL1A 2LPMA 5BR1A 4PE5B 3RVQA 5JNRA 4MGEA 2AYXA 2MYPA 3DGEC 4D74A 4EYQA 3HXMA 4MYRA 3H1EA 3QLUA 3RVMA 4RY8A 1JDPA 4RV5A 1MIHA 3EULA 3F6PA 5B3JA 4G86A 1Z2EA 1FFWA 1CEYA 1LBHA 1PNTA 1SXGA 4KV7A 3OQOA 1BAPA 3I5AA 5T3YA 1J56A 3RVNA 1ZGGA 2YHAA 1M5TA 1QQBA 4KFCA 3CLKA 4YRZA 5IULC 1M2EA 2E4UA 2HQBA 1YS7A 2OENG 3N0XA 2VYCA 4RXUA 2PUGA 3Q41A 3QX9A 4LE0A 1ISRA 4NV3A 4N76A 1TM2A 2WRZA 2L17A 2QVCA 2LP4Y 1GCAA 4KQCA 2PE5A 3H5VA 4XXHA 1DCMA 5FWXA 1BVHA 4WT7A 1JF8A 3FFXA 4MR8B 3T38A 5GOTA 4QYWA 3LUJA 4JB2A 1DBQA 2E4VA 4LX8A 5CNIA 5EWMA 4B09A 2JB9A 4PEVA 3C6QA 2LBPA 1YMUA 3Q7RA 4Z4EA 2FMFA 3CHYA 3NNNA 2FEWB 4TLLB 3L6UA 3BBLA 4KPYA 1QP4A 3CNBA 1WETA 1XHFA 3TX6A 3OMXA 3LUAA 3RVJA 1BDHA 4QPJC 5JNVA 2IPNA 4G0PA 3MMNA 1U0SY 3M9WA 4KZKA 4ETMA 3MQ4A 2QW1A 1LJLA 1DG9A 4NQRA 5EWLA 4KMRA 4Z4FA 2Q5CA 4WXMA 1MAVA 4F3TA 3GL9A 5TPWA 4EY3A 3OLZA 3VNBA 3G1WA 1C4WA 1NXWA 1F4VA 1EHCA 1P2FA 1QKKA 3UUGA 5C5EA 4N41A 3HUUA 2HQOA 3HCWA 4OLBA 1ZGZA 4RY0A 4RWEA 3BRQA 3O2QB 1MB3A 4YR7A 3HS3A 7ABPA 2PUEA 1XWWA 4Z9BA 1R8JA 1GUBA 1Y1LA 4EYOA 1SRRA 2JBAA 1L5ZA 1DRKA 1FSPA 1W9HA 2NZVG 3JY6A 1A0OA 2L18A 4JP1A 3OQNA 3A0RB 3A0UA 4PICA 4ETIA 2M1ZA 3EJWA 4RK1A 1USGA 2QVGA 3GBPA 4XASA 2DRIA 3M9XA 1EWKA 3KG2A 1ZH4A 1JL3A 1Z17A 3EDCA 3K9CA 3Q7TA 3R0JA 4IMJB 5DCLA 3OLVA 3UK0A 4MR9B 3T6KA 2CHEA 3HSYA 3BREA 3ROTA 2A9RA 3B2NA 2E4WA 3RVLA 1E6LA 4LE1A 3JPWA 3HDVA 3EODA 3QLVC 4E7PA 1H9CA 3CG4A 4EYKA 2FSPA 2H3HA 1DC7A 3KYIB 2M98A 1A2OA 3H6GA 2H0AA 5CNKA 3N8IA 2MSLA 1U8TA 1JBEA 4YGXB 4ZJPA 1EWTA 5ABPA 5TPZA 1APBA 3GT7A 2QZJA 3RVKA 3CZCA 4W5OA 5PNTA 1NXTA 3N53A 2O20A 3SQNA 4WZZA 4EVRA 1JYFA 2RJNA 3O1JC 2QSJA 1Z12A 4MLDA 3I42A 4L85A 4G0YA 2E4ZA 1PEAA 5JS2A 4Q6WA 4Y9TA 2FTKE 4NCBA 4MQEA 3QEMB 5KC9A 4N0QA 3URMA 4O1HA 3DLHA 4MR8A 4RXMA 2L19A 4H3KB 3IPAA 1Z18A 4GNRA 1GUDA 2JK1A 1DP4A 1P6UA 2HSGA 3RQIA 2IPLA 2QU7A 5JS1A 3KTOA 2PUFA 2E4XA 2JCGA 5IUJC 1VKRA 4LZLA 4G0QA 2ID7A 1P8AA 1CHNA 2W42A 3O21A 3E61A 3FFWA 2FMHA 3W9SA 4CBVA 4E7OA 2IKSA 3JVIA 4RKRA 4RK4A 2FLKA 1U2PA 1QMPA 3I45A 4FE7A 1K66A 3A10A 5KI6A 2N9UA 4RS3A 3H5TA 3QX8A 3LMKA 3IDOA 1LK0A 3OO1A 3TMYA 4W5QA 4D6XA 3SNKA 2HPHA 1PEYA 4IF4A 4S04A 5CNJA 3FFTA 3KJXA 2CD7A 4WWHA 2BGGA 4YV7A 3BRSA 1VRVA 1IIBA 5HSGA 4NICA 3ILYA 3Q15C 2PUAA 1QNLA 2PUBA 1P6QA 5FBHA 1TVMA 5KWSA 3RVPA 4Q7EA 5KQGA 2PAFA 5DGCA 2LIVA 3IP9A 4MQFB 1NXXA 4UHJA 3I09A 1BDIA 2JRLA 3ILHA 1OXBB 3A3KA 3L49A 1ZDMA 3F6CA 1EFAA 3O75A 3OMWA 2LUOA 4MRMB 4HNQA 5I4CA 1KMIY 4MR9A 4G0MA 1PNRA 3KSMA 4RSMA 4XAQA 5F64A 6ABPA 4RK0A 1TLFA 2FEKA 2NZUG 4NCAA 3MIZA 3LKBA 5CHYA 1K68A 1YK1A 3CU5A 3MM4A 4YS6A 5IUNC 5IX8A 4H60A 1DBPA 4RK7A 3MYYA 1QP0A 3SG0A 5KQMA 4EUKA 4OTZA 5TQJA 1RPJA 1ZVVA 3N75A 4MLCA 1BA2A 8ABPA 3DGFC 2RGYA 1GCGA 2XDYA 3TO5A 2GWRA 4FE4A 2MYTA 4IGAA 3HM9A 4Z9AA 3NNDA 1MVOA 1JFSA 3KCNA 4KREA 3FDFA 4HNSA 1DBWA 4D6YA 1RZRA 4JA2A 2GKGA 1FFGA 3TB6A 4ZMRA 4YO7A 2A9OA 3QELB 2QXYA 1CYEA 1SD5A 2IPMA 4Z4GA 4TN5A 3QEMA 5JNSA 3ROFA 3P9YA 2PJUA 5CNMA 1VPWA 2X7XA 2QV0A 1E2BA 3LUKA 3O2SB 2P9HA 4JASB 4QICA 3EAFA 1ZITA 4H3HB 5IC5A 1VLZA 4M88A 4OG2A 4HNRA 2TMYA 5JNWA 3GA5A 4LDZA 3JVDA 3K4HA 2L2QA 3KKEA 1YK0A 3OO0A 1TJYA 3TD9A 2R25B 2ID9A 3OLXA 5KQPA 1NATA 1JDNA 2FN8A 2WB4A 2KYRA 3GV0A 4PZ0A 4UHKA 3SAJA 3M6MD 2V0NA 5TQ0B 2WMYA 4IMIB 1YTUA 3N6VA 3HK2A 1DJMA 6CHYA 1QO0A 2B1JA 2OQRA 3OM1A 4YP9A 1U2QA 3RH0A 3OM0A 4WXEA 1F51E 3RVOA 2PLNA 3FGZA 4IILA 2B4AA 3G85A 4MS1B 4RK6A 3N0RA 5KC8A 5HQJA 4XARA 2RJOA 4W5NA 3JPYA 5FBKA 1E6KA 2R48A 4G0ZA 3QLVA 2PUDA 2MSKA 3IP6A 3D02A 1DRJA 1PUXA 2FMKA 1JLKA 3GBVA 1JH9A 4QYMA 2E4YA 4MQFA 2FQWA 2ZAYA 5E3JA 4MS4B 2PL9A 4N03A 1D5WA 2WWVD 3DBIA 3MA0A 1ZHHA 3KS9A 4OLAA 4G0XA 4Z4HA 4MRMA 4O5AA 2ZWMA 3OQMA 1ISSA 1BDJA 4W5RA 4KVFA 1D1PA 3JS5A 3C3MA 3QLUC 3H5OA 3LKVA 3MF4A 4EGSA 4MPTA 4RXTA 4XFKA 3RVRA 1USIA 2NT3A 1Z2DA 1URPA 4XLTA 4EVQA 4MS3B 5B3JC 1KRWA 5DLEA 2CHFA 1YVUA 1RXIA 3SY8A 4HYEA
chains in the Genus database with same CATH superfamily
1NY5A 1FXUA 3LC1O 1H8ED 4P7FA 2V55B 3RRMA 5BRAA 4GPAA 3NAZA 1FTGA 1MNQA 2D5LA 3KC2A 1JDVA 3QYPA 2JD1A 1CS0B 2PQ0A 1R37A 3R20A 2QM3A 4ZEVA 1DEKA 4JV5B 3BXEA 3NYWA 3WYBA 4GPD1 4B3BA 2C4KA 5DX1A 1PQPA 2DAPA 3TZEA 1CT9A 3HXOA 4D4LA 4WLNA 3TFWA 2H4JA 3DMRA 521PA 1U80A 1LLFA 2ZRQA 4ARBA 1G63A 5ALSA 1HDRA 3SX4A 1VLHA 5ECDA 4GKJB 3EOBI 4E33A 4KHPB 1QO7A 4BJ5A 1J9EA 2EU8A 1ZM3A 1KYIA 3M5DA 5EJGA 4YRPA 3M3DA 2IY9A 1EUYA 5F5LA 1N34B 5IBQA 4Q3KA 4L22A 1DRUA 3NATA 2UYOA 5AHKA 3NBMA 3ZS8A 3O90A 1OLUA 4DUGD 2PIAA 3T9AA 1M1YB 4Q03A 4QVIA 2I33A 4JD5A 4OB7A 3SQDA 1F3OA 3UFXA 3GJ7A 4K9DA 3S99A 3QG1A 1W4LA 3DZHA 1XZDA 5BXQC 1EQ2A 3I52A 2JZNA 4ZTUB 1T2VA 2PFSA 3SZLA 5G41A 5KWJA 2O7VA 2PKXA 4TVOA 5DCUA 5JAZA 1DEOA 5DV9A 5TGZA 4CEIA 4B3GA 3WLMA 1K75A 1PHRA 3B89A 4YWJA 2J3EA 3B8HA 3FNBA 1PVOA 1P7ZA 1LVGA 4FPXA 3FM9A 3RSSA 2NPFA 2XSZD 4QDTA 1Y89A 3GJTA 3HLTA 3PGKA 2BEKA 5JAIA 1XMJA 2HNBA 3EZ9A 1T3TA 3F96A 3QFRA 2XE7A 4Q1AA 3RV3A 1T0PA 5GTDA 1E8NA 1PHPA 4HDMB 1L5HA 2O1WA 1LFDB 3ABQB 2FX3A 2RC5A 3STVA 5J23A 3GEBA 2OMEA 1N5JA 4KGXA 1ZJWA 2QJRA 4M1EA 4NRDA 3WGLA 4IDBA 1TQ8A 4WH0A 2WBLC 4DJ5X 3PUKA 3RIXA 2EZTA 3A6FA 1A7AA 4IXDA 3QE9Y 4TLMB 3NG1A 4RU1A 3BD6A 4XYMA 1D1SA 1Z6GA 3VU9A 3T95A 1WW2A 3MWJA 3IXQA 2FP3A 3K2BA 4D99A 4G1CA 2NN3C 4Q3EA 4Z0NA 3U0VA 4BCBA 3KVVA 4PZDA 4S1OA 2JVIA 3W6PA 3LM8A 4Q02A 1H4SA 3HUTA 2X9LA 4HATA 3A1TA 4I9UA 4O4LF 5JV5A 4AX4A 3SX2A 2WZDA 4CKEA 5J47A 4GKKB 3K1JA 3W5CA 1X77A 3VMFA 4HBZA 1R6VA 1I24A 1AK1A 1S2NA 4ZOAA 3LUHA 1MIOA 1HGXA 1ZD2P 4R3NA 4RLSA 4WEQA 1UM9B 4F84A 2XCTB 3A1FA 1RAFA 2ZT8A 1ULHA 3QVXA 4J3NA 4JX8A 1XMIA 2YCBA 2O2JA 4PQRA 4EMUA 1T5SA 5I8WA 5LUAA 3GWGA 4GYYA 4HQKA 1LGYA 3X2FA 4NJEB 1A5TA 3VOBA 2FFJA 2VHJA 3AFIA 1UM8A 1ULUA 3X1KA 3KZMA 4M0FA 2PM8A 3VH1A 1A9TA 3Q9SA 3SU8A 5U4QA 3V7WA 3IURA 2IIPA 4ZOLB 5D84A 1T9DA 3UKJA 5EJ5A 5JJ5A 3IELA 3U1BA 2QRMA 3G2IA 3ZZTA 4DGSA 5IJ9B 1TVKA 1BA3A 3L07A 2GETA 2WTAA 3H3XA 3JQ7A 1ULSA 5HCIA 1Q19A 3PNVA 1Z13A 4WLFA 4JLMA 3UUEA 3IAAA 4RHXA 4DNQA 1XA4A 4KOAA 1FFYA 1ZS9A 1TM3E 3M34A 4GE3A 4RJJA 2NVWA 4QGHA 5ANRB 5LXTB 2VBIA 2JBAB 1FTNA 5AOBA 3SM9A 1D4ZA 1VQ1A 1KE2A 5AM3A 3H5AA 5B2ZA 2W9XA 3N2EA 4WOKA 4EHJA 3D3KA 3LQ2A 4E30A 5IDWA 3FOZA 7MDHA 5JO9A 2QBYB 1JGTA 1AGNA 1PGJA 2Z3ZA 5A4KA 5WRFA 4WI1A 1SNYA 1G66A 3HYCA 5CR9A 4TVBA 4PLWA 1XF9A 2IDJA 2QQ0A 4LBZA 5JIBA 1KJZA 4WKGA 2HF2A 3RVQA 2X1MA 2D1FA 3SZUA 1JEDA 3CXRA 3C5HA 4MYRA 3H1EA 4LYFA 3DLPX 1KC1A 1AXEA 1QV6A 1ULZA 3E81A 3OZTA 4GZ3A 3FOEC 4ZREA 2QMZA 3J80A 2H2AA 4JQSA 2A1TS 1UBSB 1CEYA 3QY9A 2BVNA 1JVBA 4XUGB 2EBWA 4TUYB 4OI1A 2GCEA 4H7PA 2JCSA 1M5TA 1YJXA 2A1UB 3CQ9A 2XKBA 3B51X 3KXDA 5LP6C 1CIPA 1WTAA 3CLSC 3LY8A 2E4UA 2WAAA 2C54A 1N9GA 4IVPA 2JIPA 3ZY3A 3ETCA 1LI5A 1R0CA 2D6FA 3VYRB 4I50F 2PD4A 4CMAA 4RZHA 1EJ6A 1L5MA 2YXNA 1E61A 5L4SA 2V8OA 1NDUA 5CDFA 2ZRLA 1R8QA 1QPGA 2AHRA 2D59A 1OLSA 3E9RA 4V1CB 3I8XA 2J41A 4KQCA 3QW2A 3TLAA 2PYZA 5CBKA 3EVAA 2H48A 2D2XA 3KKKA 3TEMA 2ZTSA 4WT7A 4IJ6A 3QUBA 5K2MA 2PS3A 4CMJA 3H9UA 3AWDA 1Z08A 3N7UA 2JAQA 3DZBA 4LX8A 1BMQA 1DIRA 2C7GA 2YDXA 3DJFA 4CQMA 4DLTA 1I1QB 2YXPX 4J0KA 1OBHA 4H0CA 3FNQA 2VP9A 1QGYA 4C21A 4GICA 4RDXA 1QHHB 3B9PA 4B4OA 4FFVA 4BKPA 2PSHA 3LT2A 4BLPA 4CWAA 2KS6A 1T8RA 3TOCA 1VCMA 4LJ4A 4G0PA 5BR8B 1M76A 3ZN2A 2MSDB 5HFAA 2SBTA 4JN6B 1I4DD 2QRVB 1ZM2A 2VF2A 2Z8YM 4JBWA 4G3XA 4NZYA 4UHFA 1RKBA 1CS4C 4HV4A 4DS3A 5IK2D 3CO5A 3NHBA 1PFQA 5KJ6A 4NBSA 1YD7A 4ETWA 1YF3A 4NG5A 5D3KA 1YS4A 1XKLA 2PXCA 2YBEA 3AEKB 3G89A 3QUSA 1MMFB 5AK3A 2O5RA 1JEQB 1E5XA 4OMDA 4AYXA 4B43A 4ECEA 5TMPA 5L40A 4XOUA 4RWEA 1OZAA 1OHHD 2XNJA 3PEFA 2OLKA 1GU7A 1NUAA 1I9GA 1U3CA 1GG5A 3HA3A 3AFGA 3W78A 4X8LA 5JJBA 1X3LA 3ZYZA 4NBVA 1KR2A 2PUJA 1JIUA 1Z7EA 1P0IA 1ZINA 1SCAA 2CBZA 4GR9A 4P80A 1V6AA 1NQXA 1ZIPA 3M5CA 3DOIA 4PICA 4OHMA 1BXZA 5H16A 1N0WA 3L8GA 3ZLVA 1Y3CE 1R8SA 1LD3A 1EIZA 3K6KA 3PGA1 3HBMA 3QOFA 4Q3OA 3K32A 4M53A 5FRDA 2OUKA 2WJZB 1Q7CA 1E4OA 4M0UA 3IBGA 4MARA 1VIVA 2MT9A 2O3JA 4GOLD 1GN9A 3FF1A 3C7KA 3KWFA 4EGCB 3TVTA 3NHAA 1R10A 4O4LB 5BUCA 3HADA 1VYVA 3FCAA 3B48A 4HDSA 3RI3A 3ROTA 2ZFUA 1VP3A 3BJMA 3Q3CA 1IK4A 1JDBC 3H8JA 1OWMA 5FEUA 4JLOA 1B0AA 5EXDA 3TR6A 2J46A 1I32A 5EUBA 4OUDA 3UKOA 3JQ9A 2ZB7A 4IJVA 3IV6A 4DIBA 2W6IA 2PMWB 2CFIA 1NKVA 2JGKA 3DT8A 1SQ6A 3DDOA 5ABPA 1AV6A 3WLQA 3RVKA 4H27A 4I1PA 2C8VA 3JATB 4W5OA 2XBUA 4J03A 2WILA 1UC4B 3FPSA 1EFHA 3WB0A 5HDBB 3LX6A 3URKA 1UWCA 3KR9A 3I42A 5JCOC 1P5ZB 4CMIB 1GL9B 5AXAA 3A9SA 3PTZA 1I0ZA 4WCFA 3ISVA 1KZHA 2ZRCA 1H2FA 3KCQA 3S8EA 3GJXC 4BHTA 1WXXA 4Z49A 1DU4A 2XNDA 4B3TB 1VJGA 2XYHA 1Z4KA 3P4UA 1WOMA 4LPSA 3IPAA 3PDHA 2R9VA 4JVSB 1VXOA 1JIVA 2Y6VA 3BCSA 3JARA 3K9GA 2EC5A 3QE3A 1DP4A 3LLUA 4J6FA 4LDNA 3H11B 4M0CA 1UPAA 4LRYA 3Q9LA 1J8MF 2VXYA 1HFEL 2XWSA 3AKCA 3SN6A 1TB4A 4YGYA 4UVHA 3HG7A 4KAXA 5BOSB 1E2DA 1J8FA 1E3TA 2VJMB 5B2EA 2EFDB 2XE4A 2FE1A 1G7TA 1SJ9A 2G9RA 4LCJA 1AZWA 3TDKA 1NKSA 3JYPA 4FE7A 4LHSA 4EI8A 5JFGA 1RZVA 3OZSA 4Z0HO 4HSGA 4HYYA 5ALLA 1WSBA 2O0HA 2YJZA 2I7TA 1EFVA 2GUGA 4JOCA 4U7PB 4BQIA 2HNKA 3AYZB 3C5WP 4QVGA 2CXHA 1C81A 2VTBB 2XKJE 1XP5A 3WGKA 4G5OA 2BGGA 4D81A 3V8MA 3BRSA 3DFIA 1ESZA 1DJLA 4R1SA 3TTVA 1HDYA 4ZRNA 2PGLA 2XYRA 1YRWA 3NBUA 3WNDA 4CPDA 1Z0SA 4CIBA 4IFIA 2Y27A 3UHJA 5CLHA 1DOZA 7ADHA 4PXAA 1XX6A 4GRIA 5F9MA 4CM4A 1KO5A 4MUGA 2ZBQA 1XK7A 4GLOA 1WP4A 1KOGA 2JLRA 3FJ1A 4ZTZB 2VBCA 4GYWA 3G9UA 3O9MA 4PSCA 3FRHA 3SDSA 4JI3B 4LI3X 4DM4A 3LXXA 4Z7NB 3BUSA 4UBJA 2IUSA 2P3OA 3FA2A 4I50B 1SVWA 1SR8A 2XMCA 3F6CA 4JBGA 4ZVNA 1XDWA 3OE5A 1YHNA 1XVAA 2PLWA 4MRMB 2O2YA 2F62A 1TLLA 1NOJA 4MVCA 1IZ0A 2G5PA 2I2AA 1Y1TA 5JQGA 4XAQA 4N18A 4PX9A 1RI1A 2BKAA 2PS9A 1IBRA 3B52X 4MO2A 4MUAA 3QY0A 1ZEJA 4N54A 2DHQA 2F9FA 1N1GA 2Z9CA 2V54A 4R98A 3GZTB 2Q0XA 4LX0A 4PRKA 4CW7A 3SG0A 2HSDA 4CMCA 3FRIA 2BZSA 2O5VA 1X87A 4GLJA 3V2HA 2Z6AA 2WSBA 4F6LA 4HC4A 4YXWD 1M75A 3ITDA 5C18A 5HRCA 4P3KA 3WLOA 3H65A 4AG5A 4Q9DA 2NV0A 2W2LD 4Z9AA 3NNDA 4QRIA 2QNIA 3LC2O 4G2NA 1QG2A 1DFGA 2D0PB 4DV4B 3D1VA 4ZAVA 4PINA 1CUZA 1WD7A 1YDFA 2J0EA 2VT3A 5FFFA 4AYTA 1S02A 3W6OA 4C7JA 5ADVA 2IXTA 5E6SB 3U3OA 2JGAA 3VAYA 1JRLA 1VPWA 2O0JA 3U3ZA 3OBBA 2FW8A 3UH1A 3BORA 2DUMA 2QF7A 3O2SB 4MQLA 5FR1A 5LP6F 2VZ8A 3I1YA 3TLZA 3G2HA 4OFZA 4YAEA 2D54A 1WHSA 5LQRA 3OZDA 4RKEA 1L1RA 3ORFA 1JA0A 3IT0A 4XEHA 3SEFA 3HL4A 2XEDA 3QTLA 2A92A 2L2QA 3AZQA 4XGKA 5K8TA 1UKAA 1ZD1A 1HDXA 2UU9B 3RUHA 4NIMA 2D4HA 3LZDA 3ZU3A 4UAUA 3DZ8A 1V7PC 2HMTA 1ACJA 3E7WA 2ZBEA 3EISA 4GBGA 1TM4E 4MV5A 4KEAA 2A3RA 3VPAA 3R9WA 3SJZA 1KZYC 2XHEA 1Q0TA 3RAFC 1K4KA 3RQSA 4IMIB 4RGYA 1E7SA 3R0VA 1P0PA 5CD1A 3M5WA 1QO0A 4YMTA 1R6BX 1ESMA 2AFIB 4LNUB 3UW1A 2OQRA 9LDTA 3FFAA 4GZ6A 1H0RA 4FX2A 4EHHA 4TTJA 2AVNA 5EKTA 1KJIA 2WVJA 1P1BA 2POQX 4UJ3A 1HEUA 3QNWA 4MVJG 3R9KA 3DHYA 4HY3A 2XMZA 5JZBA 2Q27A 4EG1A 3N8KA 4IUYA 1ENPA 3DMPA 1PUXA 1I7LA 3I9V6 3QPWA 3AL0C 3Q3JB 4BP1A 4OPMA 2PL9A 5EJ6A 3DT9A 5E4YA 2UUAB 5AKIA 5FEMA 3K5WA 3EIQA 3MOIA 3ZY2A 1IZ9A 2WWVD 1NR5A 2VF8A 2CVHA 1OIVA 1VDMA 3DBHB 2ZBVA 4Z4HA 2F3PA 4KP7A 4E6PA 2FN7A 1F06A 2I80A 2VC2B 4M49A 4N6GA 2WKRA 1RR6A 4FWBA 4CT5A 3BSFA 1P0QA 2H57A 4HJXA 1ADJA 4JQYA 3EFOB 4KQKA 4RHTA 2WNHA 4EY7A 3HBJA 5EHZA 3OX1A 3DXFA 1GNVA 1M34E 1G8FA 3ZDEA 4TSRA 5PGMA 5DLEA 3UT0A 1FRVA 2E2WA 1AF7A 3VR4A 4CR7A 5CLJA 4Q1EA 5F35A 4P4NA 4EVSA 3AINA 3KDSE 4IQ0A 3AUUA 5AJYA 1K7CA 1ID8A 2ST1A 1Y63A 4IM7A 2FN9A 3PQCA 3QW4B 4O1IA 1F14A 1KO7A 2G0NA 3UB2A 4OXNA 1T13A 1PFYA 2A1TR 2GBLC 5JPIA 1FEZA 4PYRA 3JQPA 2F8SA 3NT5A 2WTXA 2OT3B 4HLNA 2ONZA 4ZMSA 1KDPA 2JKVA 4R40A 3AR9A 1NFRA 2JLZA 4BVGA 4RCVA 1HKHA 3QV1A 1JQJC 3WLIA 5AESA 1KSHA 1S89A 3AVTA 3A4YA 3BJRA 3C3XA 1P19A 2R6GA 4PIPA 4Z4CA 2EHJA 4OXIA 4C30A 4HUTA 1XMQB 4BU0A 2WD9A 1YTLA 5DN6A 3OCWA 2Q4OA 1Y5MA 3R3YA 4DCJA 4WXHA 1VG1A 2WYIA 1MENA 2QRLA 2FSFA 1F20A 1R5OA 2QN7A 3AG5A 1NULA 3PHIA 4EB3A 2YRXA 1OFVA 1V2GA 3G17A 4MR7B 3TDNA 1OXTA 1IDOA 2OGSA 4KQ6A 2QX4A 1Z4PX 4HADA 3TIGA 5DJ5A 1QIFA 4HGRA 2ZYGA 2FMTA 1SGWA 2O8EB 1E3WB 3PKZA 3ZU6A 3N76A 1G6KA 1HE1C 4JC5A 4NOKA 1E9RA 5M2QA 1FFHA 3F5DA 3G9TA 4D42A 3MAJA 4Q19A 1E77A 3LUBA 1B43A 1N2CB 4Q4DA 3DDZX 3BFVA 3I30X 2SNIE 3NYIA 2P5SA 2XQIA 2XUDA 1UJ5A 3VV2A 2FPLA 2JFVA 3KR2A 2VYND 3LJKA 2IUUA 2CYAA 4F91B 2ALJA 4HVCA 4KXYA 3PEVA 4RUKA 3TW6A 5GIPE 1A2KC 1FYFA 2OHHA 4OKNA 5AICA 1AGRA 1CEXA 5HKKD 1EIWA 3SBEA 2A1IA 1XRJA 3KLOA 2JW5A 2O52A 3EQ2A 3NUQA 3DPSA 1E4YA 2BUCA 3WKAA 1J70A 3D3EA 5F21A 1U3VA 3KTFA 3WAKA 2WM3A 4DAOA 3H1AA 3OEEA 5CIQA 5CXQA 4DHWA 1WG8A 3B2EA 3ZHUA 2I8AA 3D0QA 1U8YA 1T1RA 1WCWA 2YC4C 3BWMA 4JR0A 4XRRA 5AK4A 5ADHA 1GPJA 3ESZA 3B9RA 4J8PA 3QXXA 5JDIA 2DT5A 1PT6A 3REGA 3CT6A 4F86A 3ZDRA 1W49A 1JPUA 4I1VA 3S1AB 1IQUA 2D74A 2QE7D 4TLAA 3O9ZA 4LGMA 2VS1A 2D4AA 4BPRA 2ZJBA 5C4IA 4KXLA 1I7QB 2RGEA 1D2HA 2C2YA 3AFOA 2RH9B 4A27A 4BEBA 1EMDA 5BSGA 4PHTA 4D8XA 1U9ZA 3BE6A 3CMMA 3FSEA 3V4RA 1I3CA 3AESB 4LY3A 1DIBA 1US8B 2I4OA 5FNVA 2GH1A 5BRJA 4AJPA 4E1VA 1MV8A 5DWDA 5FDFA 3I9LA 3CKMA 4Q9KA 4IDPA 5FYDA 3P9CA 2GRUA 1FDIA 5DSXA 3NNSA 5GZ1A 1ZWKA 3I8OA 2RG1A 1RXWA 5FYQA 3IAXA 5IJWA 1XCMA 3D4NA 4BJ1A 3MJEA 4KBFA 4EUSA 2Y1LA 5FWNA 1AUOA 1FYXA 3KJHA 3U4DA 2BONA 3K1TA 2EF1A 1BYUA 3A1DA 3SZMA 2C58A 2FP4B 2PGJA 1P2DA 1G9TA 1C3XA 3FWYA 3MBKA 1G98A 1QJCA 2EP8A 2JAHA 4LCBA 4PPQA 3UCEA 5KQLA 5EG5A 1J23A 2NG1A 4EFLA 3IDZA 4EYSA 1AB6A 1N5IA 2QUJA 4B2PA 4NZMA 1OI2A 3DKKA 4Y3UA 3F6EX 2HXSA 3A1NA 4NU0A 4YWHA 1YB2A 2ZSHA 3GP3A 2C3YA 4KNYA 4UAJA 1P7VA 3NDIA 4QDKA 3ZWQA 3RGWS 3JWHA 4OHZA 4MW1A 1ORDA 4AUEA 3W8FA 3GG2A 1Z6ZA 3V46A 1OW3B 1RC0A 2DWOA 4IRXA 4TRRA 3T15A 1Q1ZA 4OBBA 2XBMA 3PICA 5GV8A 3HR4A 1XQVA 2VJOA 3A1SA 3OA2A 8LDHA 1Z0DA 1XLUA 1ZH0A 3FNFA 1L4LA 3IPCA 1XZBA 3WE7A 5BNZA 2QR2A 3C43A 2O23A 3R3XA 4L4UA 4C4YA 5AKKA 4EPWA 2GA9A 4F3CA 3MAAC 1JALA 2OV2A 3PC2A 4ZCRA 3PUYA 4R2IA 3U1VA 5LL6P 1DWUA 5B3KA 4TROA 1IDN1 4US0R 2AYYA 3E3AA 2CUNA 1IU9A 3HJGA 1E3LA 3H87A 4DBLE 1KQGA 2NX2A 1O97D 3HXQA 1ONOA 1P74A 1SA0B 1DC5A 1DLJA 3QHPA 5EP2A 3VYUB 3W0LB 4KRXA 4L51A 4MUFA 2CNLA 1N3IA 1X92A 2AQ8A 3LCJA 1MORA 1J2TA 2XOEA 1SXJD 4RV5A 1UAGA 2QMQA 4TYNA 1I4LD 2NXEA 1PKXA 5CYGA 5H70A 3EGXA 3P4XA 1OBOA 2UYYA 4X9XA 1UMCA 3CIFA 4C01A 1E1MA 5LNK1 3EYWA 1U81A 2QN8A 4PC6A 1O1YA 4UTXA 2F8LA 2OXIA 4BVFA 5KQPA 4CEJA 4Q9NA 2YZMA 3COVA 1R1DA 1KIMA 2UDPA 3RAJA 3LGAA 3VHRA 2JPDA 3L1UA 3VR5D 1GTL1 1NU8A 4O2AA 4KIWA 2B5VA 3QX9A 3HKEA 3FYUB 5DBOA 3LRTA 5KYVA 5JBQA 3HE3A 4JJGA 1JDBB 3ZCTA 5MN5A 2ET6A 2OCDA 1JEYA 3VNSA 3NJ4A 3D2BA 3H5VA 3QQPA 5GGXA 1DT5A 3GNLA 1JKFA 4FFWA 5HPYB 4IOJA 4XSVA 1A1VA 5GOTA 3EMVA 5CB8A 1ZKDA 2EEZA 1HY3A 2GFHA 3GVXA 2H4YA 5CNIA 3KV3O 4DXAA 5ESDA 4HVTA 1E3DA 4K05A 1U1IA 2BFEB 2BLNA 1H8HA 2ZAIA 3O3MB 4XEUA 2VRBA 4MCAA 3UGTA 4CQJA 1G0OA 2A5FA 2YFKA 4P7GA 1A96A 2JI8A 3U7EB 1SM4A 1EWYA 5IRCD 1XHFA 2WMNB 2ZE8A 3LUAA 3TX6A 1PJZA 5FI1B 1G5HA 4IVNA 3WZ2A 3RFFA 5KUTA 1PJ2A 3VKHA 1QHXA 1DZIA 1H1LB 4AN0A 5JH7F 2O3TA 4ZYUA 4BNZA 1JHDA 3OT1A 1G8JA 4JIMA 2ISSD 2QW1A 1N5RA 3RWMB 2GCOA 4HTFA 1MABB 2JATA 4NQRA 1AKMA 2XCQA 2Y0DA 2EWVA 3N8NA 1KAMA 1UCFA 3A4MA 4PGAA 4WXMA 3E5NA 3DQQA 5CYFA 4F3TA 2EJCA 2PU7A 1ENYA 1J1ZA 3UC5A 3EB9A 4GI7A 1AC5A 4MGYR 4US2R 3GAZA 1FZQA 1ZQ1A 3HUUA 3HCWA 3KOXA 3UK6A 3VOSA 5L4NA 5HE8A 3SVLA 3IIKA 3O2QB 4MCIA 3ZWWA 5I7RA 1MU0A 4I1SA 3BM5A 4C1NA 4DUPA 1QP8A 1I30A 4HB0A 4Z9BA 1JIIA 4P83A 3GUZA 4TZTA 5EE0A 4EX7A 3IE1A 1GSAA 2AOUA 4QGGA 2L18A 3GX1A 3L01A 3O47A 1Z5GA 3A0RB 4MCJA 3REOA 5I01A 2MINA 4AIIA 3OLQA 4NTZA 2HEIA 5DSZA 3UO8B 1D8TA 1RRGA 1DUSA 1BCSA 1NT4A 1QGAA 3IOCA 4TTPA 3JQBC 4L6IA 5CX1B 3VHXB 1VLVA 5IWCA 2QPAA 5D5PA 1QHIA 3RLIA 1K89A 1EVYA 3BC1A 5UKDA 3DAGA 4XDYA 3Q3EA 1Q3KA 2CHEA 2ZBRA 5HDQA 4TV8F 1XZHA 1TX4B 2GFQA 2RBKA 3KJEA 4GAEA 3NWEA 1UBTS 2HA3A 4DLXA 2FUCA 2HCJB 3B70A 4IR7A 1T6YA 1Y80A 1I5RA 4KAJA 1KFEB 4LE1A 4UZSA 5FJIA 3HDVA 3UWPA 2ZB4A 1D6MA 3DC7A 1QU2A 1I2AA 3G2QA 1KIAA 3CNHA 3LHKA 3K70C 4W1SA 2VKQA 1Y1PA 1PD1A 3FKQA 3OECA 3EBPA 3IOEA 3MUEA 2BZ0A 3P9PA 3TEJA 1G19A 1O5IA 3G49A 1U9JA 2FPIB 2Y1XA 3L0DA 4HWRA 4ZAFA 4ZEMA 3IBSA 3U4MA 5KYNA 3ZHTA 1OB5A 1HDZA 3OOJA 8MHTA 4E31A 3E84A 4FINA 4N49A 1N5OX 5FPKA 1CUCA 1FYVA 4EVRA 5JJCA 2V45A 3GGJA 3B3AA 1MEOA 4JQOA 5BO5A 2Z9BA 4A15A 4NP6A 1OREA 2FTKE 4LISA 5K3OA 3NHKA 1AQYA 1BRMA 3QKTA 2P9CA 2WE8A 4MR8A 3WLJA 1SUFA 3FPGA 2BGNA 3RYIA 1RWWA 4CT4B 5H80A 1IXYA 4KE9A 1AQNA 3QEAZ 4GNRA 1PI3A 4DHEA 2Q0SA 3C87A 3V33A 1ZL2A 3ES9A 3H2KA 4D9NA 2QQGA 3A4LA 3LHSA 3SEZA 2QU7A 4TLDA 3U1TA 1F6WA 1EKXA 4BMPB 4ZFNA 1QDLB 2ZS8A 1CJUC 3BVPA 1L5KA 2AEEA 3GROA 2RHOA 4C3VA 2VTVA 4A0RA 2JD2A 4KJXA 1T29A 3UAZA 4DC0A 3U61B 3C6KA 4MTLA 4B4WA 1GEEA 3DBOB 4WW0A 2Q3HA 3WK9A 3H4MA 4D9GA 3GP8A 4KO8A 4BO7A 1BXGB 1RWQA 3HGMA 4YCAA 4TGLA 4C4RA 3CA8A 3SP1A 2R5NA 4CF4A 2ATEA 2PVPA 3JRWA 1XT6A 2I1LA 3JV7A 3QUAA 3WNVA 2VQSA 4PNZA 1AE1A 2GD0A 3VPSA 4GPIB 3JXEA 3KJXA 2XQFA 2NZ8A 3PRKE 3FHOA 2Z1DA 3Q2KA 5C8DA 5DGHA 3INNA 1YS1X 2B3DA 4D46A 2XWPA 4V0LA 5K8LA 3G8AA 1LPBB 4IFBA 3UM9A 3WV5A 3RVPA 2VLIA 4Q7EA 3T5AA 3GIDA 5DM70 4TMTA 2DG2A 2O8DA 1LI4A 2FRDA 2JJQA 3I6ZA 4YCJA 5HIMA 3MWDB 2JLBA 2CVFA 4IVRA 5EIWA 1KY3A 2HR1A 5IN4A 1XCBA 2I6UA 4PHFA 4XR9A 4AF6A 4LGVA 5B2FA 4GP7A 1Q5PA 3OMWA 2XMBA 1KMIY 1QO9A 3WQBA 3RRNA 4UPEA 1YUNA 1X7WB 5KTOA 2XCOA 2G7ZA 6ABPA 1CUBA 1FRFS 2FEKA 4BC1A 4NCAA 1SMKA 4FFMA 4KQ1A 4RQUA 1YI8A 4RQBA 1EM8A 4ZTBA 4CIDA 1SQFA 2P9YA 4Q05A 2E1RA 1XAIA 3U4GA 2HFJA 2EW1A 4F4IA 4DANA 4RK7A 3AB7A 2HMSA 3P2EA 4QPNA 5EQJB 5ICEA 3ESBA 3T12A 3QFHA 1GZ5A 2OHJA 3DUFA 1CB7A 1KYTA 4P36A 2QTVB 1M1YE 3P2OA 1NM5C 1MC5A 3M2TA 3IKLA 1NG9A 2RGYA 2VNAA 4E5NA 1JEEA 4OMFG 4S1NA 1TKRA 2AQKA 3KKOA 4X84A 1CR2A 5A5GA 5JYCA 4XA8A 1SRQA 2LIPA 3WSVA 4DR6B 1SH7A 3IR6A 2IE8A 2A9VA 5G2OA 3DH0A 1JBQA 1JQDA 1VRCA 2DHCA 2O07A 2G76A 3RSFA 4J9VA 4NZZA 3TX2A 3WK8A 2JFBA 4L74A 3QEMA 4MVJF 4TN5A 4Z9FA 2BDEA 5JNSA 4HLUC 3OQHA 4R8KA 5KMGA 4U63A 3LUKA 4IUBS 1BXRA 1TM1E 2BI8A 1BGXT 3M6FA 3QM1A 1A8UA 1II0A 1JHPA 1T9GS 2Z2KA 4NS4A 4RTMA 4CEHA 2ISCA 4MQ6A 4BNDB 1R4NB 2JIOA 3RF7A 3W4KA 3JRXA 2C7RA 1C1XA 4FEEA 4RMGA 2CLMB 4LDZA 4AJ1A 1X14A 3NQ41 1FP2A 3BTUA 3A31A 4JC4A 4LOKA 3TD9A 5BWCA 1ZD3A 5C5DA 2R25B 5AK0A 1SQ0A 4Q9IA 4FGUA 5AJUA 2VWHA 4NMMA 3D59A 2B7BA 1QHSA 1P3DA 1IRIA 4FGWA 4KE8A 4QUEA 1U31A 1RJ9B 1U0RA 2HHCA 1VE5A 2V0NA 2WE7A 2ZYWX 2ZE6A 3LWNA 3HU5A 3QBTA 1CX9B 2WYUA 3ABRB 1X0VA 5JCJA 3ZDYB 1W36D 1CLEA 1SPXA 1UWKA 1MH9A 4Y1GA 3EVBA 5TLSA 2REBA 3MG9A 2H17A 4WV3A 1PT5A 4EUHA 5EINA 1IHXA 2B3TA 1BNCA 1KY5A 1D6JA 5I3ZA 4WOPA 4B4KA 3CSSA 4IILA 4GMKA 4G4GA 1ZJ4A 2ZT5A 4ZJUA 3NVMB 4Q4JB 1Y6FA 1M6EX 1QGZA 1GPBA 1C0IA 1DC6A 3QLVA 4Y6GB 1HA3A 4DNXA 3TEFA 3IP6A 3D02A 1GZDA 1LSSA 5FD8A 3U09A 3VC7A 3T52A 2QX9A 4HT3B 1SUPA 5H82A 4QYMA 1GSOA 4JVMA 5CU7A 3KEGA 1R66A 3OQPA 5DULA 4B7XA 4R2WA 3ZQ4A 3JAWA 2LKCA 1Z07A 3M89A 1T0IA 2ES4A 3NLLA 5KOYA 1GNRA 1SUEA 3T4EA 1H2WA 2XXAB 1GPAA 1R4MB 1SUAA 2WWRA 2J4CA 3O0TA 1ZW6A 1IVSA 2V6MA 3QPBA 3TQIA 3QLUC 2IOFK 5KWIA 3LBAA 1ZNZA 2GCNA 2QD2A 1H9AA 1VTKA 3Q1KA 3BT7A 4BFLA 5AH0A 3K8ZA 2VAXA 5I7UA 1COWD 4B9EA 4L2IB 1V7QA 1TD1A 4RIGA 1JHYA 3GGPA 3N0VA 2C9CA 3K6RA 4JLPA 3RHZA 4AIRA 3AHJA 1ISMA 3SPXA 1SQSA 3BRWA 4YAFA 4ICIA 4XVUA 3R41A 1QYWA 3C98A 4Z2YA 1KRHA 4RV9A 1CF9A 4H59A 4J90A 2CJWA 2WT8A 2Y1DA 3I6YA 1Y8RA 4U9UA 4AJJA 4B5KA 4GT1A 2A59A 4K0KB 1YZ3A 3BDAA 2VR1A 3PGVA 3HL0A 3RVDA 1WVMA 4HCJA 5L3RA 4ARZB 1KEKA 4ER5A 3O4GA 2W0MA 1W5SA 5TJHA 1U2GA 4D5EA 4G0OA 3X1DA 3FUXA 4FHDA 4K8OA 2BE7A 1WU8A 3I9JA 1CJVC 2J32A 3FPLA 4G1MB 4LXQA 1ZN2A 3RRJA 1RXVA 4NECA 5G02A 3A11A 3LVQE 3QMVA 1LA2A 1M5RA 1Z68A 3GT4A 5JCPA 4WKBA 1D6SA 1N92A 1QF7A 4EB8A 1VHDA 1B2LA 3DD1A 1RNLA 3IBTA 2CV0A 1P9WA 4B7UA 1N3LA 1Y1RA 4IDQA 4D4JA 3LP8A 1D2CA 3WGUA 1CDEA 2IUFA 3L1KA 4JJFA 1V16B 3JWGA 4PLZA 4V0OA 3FIJA 1G16A 3KJIA 4LVUA 3W6UA 2XTNA 3B1JA 4OU5A 3GELA 4NAUA 1M5UA 3OPMA 4G0VA 4FR2A 2ERCA 2RG7A 1WUTA 2WDZA 1XQXA 4V24A 2D7JA 4S3MA 4Q7KA 1W0KA 5ICFA 4ROTA 5TS2A 3STYA 3Q40A 2EZ9A 4OXXA 5FWYB 4YRAA 2X1LA 4EZEA 1KRXA 2R4QA 3CXUA 3CZAA 3OCCA 4ZCIA 4HNAB 4FEYA 1JPNA 5FOVA 4OHYA 4RD1A 1PFVA 1FX0A 3QK7A 2OL4A 4OJTA 4Q0MA 3PDCA 4NCHA 4D3YA 2ZUVA 1YVRA 4OHCA 5TF0A 4D57A 5B5SA 3K0CA 4L75A 1IOLA 2Q1XA 2ZDHA 3E9ZA 3K73O 1CUAA 4WY5A 4M22A 1CUXA 3Q6IA 2W5UA 3EGIA 4OBXA 1GD1O 1WKBA 2FWNA 3RG8A 1RQNA 2JVKA 3JYQA 2A5LA 1NDHA 3LG2A 3QH4A 4GLBA 4GM4A 2WHYA 4C1BA 2FK7A 3NRBA 4OFWA 4ZRDA 5EIHA 1SXIA 3GLIB 5FUXA 1BU8A 1CK4A 5C4MA 1XGKA 2HRZA 2JBWA 1YDWA 1BJTA 2A9FA 3LUFA 3R3UA 4MO9A 4UZEA 4L3VA 1CVRA 1D04A 1G5IA 4LIPD 3AKZA 1TZBA 2PSJA 2AF4C 4YQZA 5IH7A 3TLKA 2OHIA 1EXVA 3ZQUA 1VPEA 3LX8A 4PYKA 2QG4A 1JQ3A 1PFKA 3BZBA 4A1FA 5CB4F 3EVEA 2E7ZA 3NC0C 4HGPA 3HKCA 3B1VA 4CVNA 3BTVA 1PFGA 1OXKB 2BM1A 3E5MA 3KSDO 4NBLA 4N3AA 4ZPJA 3T0GA 3D8RA 3SXUB 3JQ6A 4V2UA 4MVWA 3P45A 1RXCA 5BV1A 1T8PA 2IX3A 1ICIA 2Q8QA 3CEPB 3WIUA 4LGCA 2MWMA 2VUIB 5EYPB 1K6EA 1MO2A 3BN3A 1BHO1 4TKVA 5H4HA 4F4JA 4O2BF 4RK5A 3MJRA 1L8AA 4NNPA 5FA6A 1BS2A 4EBBA 4WNYA 3B6MA 3SZGA 1K7XB 4ZOCA 1FFSA 1UQRA 4CL8A 3A27A 5ENDA 5I3CA 5LNK6 1KYZA 3WIBA 3DKIA 2PZJA 4M1WA 1ESCA 2JAUA 4HPXB 5TPWB 3UA4A 1DQZA 2BFDA 4XFJA 1E69A 2EOAA 1Z7WA 2HTFA 2XOXA 2WA2A 3JSAA 2EIXA 4ZVTA 3OEHA 4KAFA 4N3GA 1D2AA 4HZGA 3ZC3A 1IEWA 2C03A 4FHZA 3KUCA 4OQPA 1DIHA 1RHQA 1SHJA 4U02A 5K51A 5I48A 3DPUA 2Z3WA 4U6NA 2Z5LA 3WK6A 4YDQA 4K6OA 1G5TA 2HF9A 5F76A 1X7ZA 3W90A 1YB1A 1L8OA 3LUGA 2B4YA 4HUQB 4JC0A 1TTHA 3DWEX 1X3SA 4U0KA 3NM6B 1BHSA 2OZLA 2D1TA 1FFAA 3OJCA 1FUKA 2BZ1A 1T34A 1GYRA 3ND5A 4RLQA 4ZVMA 4YCSA 721PA 1MA0A 2WZBA 4MWBA 1BX3A 3MNFA 1UBJS 2CNKA 4BDSA 3N5KA 4LXTA 3W2HA 3AETA 2FQXA 3EGCA 4R41A 3DTTA 5KX5F 1BEUB 1XTVA 2XUQA 3T9FA 3BEOA 2SCUA 4MGEA 2AYXA 2ZE7A 1JB1A 1ZMXA 2ZU0C 3ITKA 3ONEA 4L3WA 3SDBA 3QKUA 4LF6B 1JDPA 2O7RA 1E9VA 1OZGA 4CI9A 1YQTA 3QPCA 3OMLA 1AUVA 2FPSA 4J16A 4GX5A 1M2WA 1PL6A 4DXDA 4FFNA 5B1SA 1PR5A 1MJ5A 2R1UA 5EKXA 4IHJF 4JBXA 1EE2A 3QVGA 3H0KA 3RVNA 1KP2A 1PR2A 5F78A 3ROMA 4W5JA 1KKMA 2V5AA 3COPA 5KQSA 2OOSA 3OZCA 1K0UA 3EEIA 4CEHB 2ATXA 1TJ5A 2WYWA 3CVYA 1ZN7A 5EMHA 5CA0B 3GLHB 1H9BA 4P4SA 4JY7A 4FKMA 2ZUWA 4CDGA 5I7OA 1JLLA 4EJMA 5CDTA 2CKDA 4N7RA 1BFDA 2AL7A 4PQYA 1V7CA 3ZU4A 1R5NA 5H02A 2H08A 4WLEA 4C7KA 4Y0NA 2J5QA 3GJ4A 4PYQA 1X1SA 2JGMA 3EQ9A 3GFSA 4OQEA 5ELLA 5THQA 3Q7IA 3F3KA 3IEMA 5IKMA 3K70B 4HRAA 4KIGA 2VJCA 1OAOA 3LPAA 3LUJA 4I9GA 2SKEA 3RRXA 4LVOA 5EWMA 5DASA 3ZKWA 1NKTA 3ZI4A 3HEAA 2OWEA 2OZKA 2P9EA 4GH5A 5INTA 2FEWB 3QA3E 3BBLA 1BOFA 4HYQA 5ALOA 4G5GA 2NMVA 3CNBA 3R6TA 1L7MA 3L6DA 5HZHA 2J9RA 2V7QD 5FBZA 3THXB 3VR1A 1PTKA 4L6CA 4RA9A 2VDWA 1MBZA 2XLBA 4W6QA 3BWYA 1UXKA 1P2BA 2F90A 3VZDA 4DSNA 1E4EA 4YR9A 3F67A 5F4ZA 2I71A 2Y0BA 3FTPA 4DR5B 1MAVA 3ICOA 1ZGCA 4DQUA 1WD5A 1MZPA 4UOZA 5C46F 4MW7A 1X7XA 1T6ZA 3QFFA 1F4VA 3QU4A 4NU8X 2G04A 3V2GA 5CVTA 5AR1A 3QUCA 3HA5A 2Q9AA 1VL8A 1XVIA 2VQ6A 1WDWB 2ZUTA 3IDAA 4ZIRB 1MG5A 5EJ9A 1B1CA 4FLEA 4M37A 1OV6A 2J9XB 2XVAA 3ZR4B 3E53A 4O33A 3RJ9A 4M0LA 3U44B 1IBLB 1XROA 4OF4A 1Y1KE 1KQPA 2XCSB 1T9GR 4HP8A 3ADCA 2IUTA 4ND1A 5C8ZA 2YJGA 3CV3A 4BWVA 3OQNA 1DAHA 1WDMA 1RWVA 2C2XA 4QHYA 4ETIA 4X62B 1FFBA 2BEUB 2BY4A 3DB2A 3NRJA 3UWDA 1O77A 2QN2A 1JFLA 5COAA 3M9XA 3W4JA 1B26A 4F97A 4BO3A 4HAVA 1PQ4A 4WTOA 1JL3A 3EDCA 4OL9A 3K9CA 1Z6XA 4YP6A 5ILQA 3FCXA 5LYJF 3PJRA 3PWSA 5J2UA 4TPKA 4A10A 1P75A 3FVVA 2NYVA 5CFNA 3WGJA 4S2EA 5KYXB 3THXA 2FN4A 1N6RA 4LYHA 2A0KA 1UBRS 2YH2A 3OIFA 1MEEA 5HVNA 3GJRA 2HA5A 5CB4B 3NH6A 2YCLA 4P81A 4MYSA 1DS6A 1IN1A 4WY8A 3EZ6A 4AC9A 1SC9A 3GMTA 2GVNA 1G2QA 1A2OA 3A4VA 1D2EA 3L0ZA 5EMLA 2J3MA 1JILA 2GZRA 2EKZA 4X64B 2VDMB 2G1KA 3PHLA 5EHNA 2FPUA 1SB8A 2I2WA 1WR8A 4H6XA 2DKOA 2FR1A 2J7PD 2PSEA 3TSAA 2ZIGA 3N53A 3MBIA 4B2IA 4B76A 4DLAA 1XEAA 4YA6A 3B7WA 2DLDA 1RVDA 3ZHCA 1ZMBA 4CCAA 3ZS9A 1QQTA 1XUOA 1ZN9A 3OUZA 2E4ZA 4L6AA 1TE2A 4CG3A 1FA9A 3ETDA 2AFIE 1AK9A 3ZGOA 1RW4A 1WHTB 1PG0A 3EMDA 5DI3A 2XXBA 3TQQA 3A4NA 3ENQA 3JD2A 1GUDA 5FUMA 5KOHB 2ZVPX 3EH2A 7MHTA 5ALQA 4ZHQA 2GK6A 4D4HA 1LLCA 1Z5VA 3Q7QA 4TOIA 2C5HA 3DTVD 4RPIA 2ZJOA 4KIJA 3NALA 5IUJC 5BW5A 3I01A 1KDTA 2VDKB 1H69A 3OBIA 1DKOA 1T5DX 4EK9A 2JNWA 5A5EA 2PRKA 5FBVB 1ZCBA 3FNGA 5TX7A 5JASA 1KAOA 4MICA 1XYYA 3MMPA 2FLKA 5KYUB 4LV6A 2P6MA 3KHUA 1CVLA 1U2PA 3WHKA 2EAUA 4B9AA 5TARA 1Q16A 2N9UA 5HF6A 1ACMA 1C4OA 1H5QA 3P8ZA 4TRJA 3KOUA 4X63A 2F3QA 3UMGA 1T4BA 3E27A 2GSWA 2P2SA 3AHHA 4EHAA 1N3YA 2X4DA 3MOSA 1G59A 3VTKA 3FUTA 4X00A 3RHSA 5YASA 4QTYA 2WOOA 5CNJA 3NEJA 3WQSB 1NT2A 1FP7A 2QW8A 4KG7A 2F43A 4RD0A 1ZVMA 2NZWA 4IUCS 3I4CA 1OFHA 6GPBA 4R7ZA 1O96A 2FWPA 2H63A 3L1JA 3MCWA 5G3YA 2FQ1A 4KPFC 4QGSA 1WMDA 5M34A 5EVCA 3P2YA 2PUAA 2GZ1A 4JA0A 3W2GA 4CKBA 4DSUA 1EGHA 3ADDA 3KDPA 1TT5B 3BK7A 4B4DA 1QIJA 1E96A 1PQWA 1T3HA 4LDPA 5B37A 4R7TA 3U7IA 3ZV7A 4BQRA 3LHIA 3KLBA 4IGKA 3V8VA 2NTJA 5KEIA 3L7JA 2I2XB 1KTIA 1JAYA 3EUAA 4JWKA 3KTDA 4F5DA 5DNUA 1F8UA 3GRPA 3IQDB 4D41A 2WSMA 1OXBB 3ROZA 2F1OA 4URVR 1XB2A 1V9LA 1M2HA 1K7YA 2PRIA 2ZB2A 3GZ4A 2RCNA 4WK4B 3T35A 3TXAA 3CF6R 2LUOA 5KVSA 5C37A 2PWAA 3QUTA 4RAOA 4EKYA 4CM5A 1U1EA 2PV0A 3ENVA 1NLMA 2PRZA 1WPRA 3VVMA 2Q9CA 3I53A 1TYCA 2B99A 5JU6A 1WUIS 4L9AA 4QLBA 1NIJA 2W6ID 1Z2PX 1P7WA 4WLUA 3T7EA 3ZD9A 1YK1A 4DZTA 2FF7A 1ODSA 4BU1A 1UMKA 4JL6A 1UBOS 3L79A 4G07A 1QP0A 2MTBA 5CCEA 4MKRA 3X1ZA 3ACDA 2ZVJA 3WADA 4IZIA 4MWTA 1K5PA 4HQNA 4MWSA 4GOXA 1BHQ1 3LO8A 3NW9A 1R9JA 1M34A 2XD9A 3M1AA 4FMCB 2A88A 4JR1A 3ZVRA 3ZD6A 4A0QA 2CXQA 4ZDKA 2HU5A 3B78A 3JW8A 5G1PA 4OXQA 4YXFA 3P20A 5FL7D 4C6TA 2ZSJA 2ZYSA 1SUCA 2B1GA 2XNDD 1N2CE 3DKVA 4CN9A 4OHOA 1LK5A 5I7WA 4W7HA 4X20A 1I33A 3PE6A 2XIJA 2QXYA 5AHRA 4JQCA 4LRWA 3A2LA 1E99A 5E2AA 1SG0A 1U2DC 2YHIB 4L5IA 5B4TA 1T0HB 4RANA 1N9KA 3RTCA 2B36A 3A70A 1T1SA 3NRCA 4NG4A 4GKVA 3NOVA 4QOJA 3U0BA 4DWJA 4H3HB 3SZ3A 3U3XA 5MN4A 1ADYA 1X6VA 1MQ8B 4M9ZA 4NCNA 4YV0A 1J0XO 1KH3A 5AHWA 1DJNA 1TZCA 1VE9A 3EQ8A 4BBJA 3AFMA 2DFKB 1UINA 2ZDQA 3OO0A 1P2VA 1KKLA 1XCGB 3H83A 3HCAA 1LQTA 1BZYA 4FFDA 4Q3NA 4MWCA 1PGNA 1QDEA 1WF3A 1XXLA 2BHSA 3K0FA 4PO1A 4XYGA 5BSMA 4FYIA 3U4IA 4BRWA 1W581 1FS6A 2JGRA 1ECJA 3F8TA 1YTUA 1U0LA 4IV8A 2HA2A 2P0EA 3A4IA 3O91A 4BMCA 1GPMA 4X41A 1IM2A 2B1JA 3BEDA 4K9RA 3AY7A 4YACA 3COYA 1N7IA 3QEJA 2JI9A 5HMMA 1C7IA 3ELWA 1OLOA 3Q98A 4RV4A 5CXUA 5A2QA 1FTQA 2TS1A 2YXDA 3E1KA 1GQQA 2E5WA 4MS1B 1E94E 1L5QA 1RI4A 2X22A 3TSCA 3VYVA 3KUXA 4FIZA 3WWCA 5C8XA 4QYSA 3MMZA 4OHPA 5FBKA 1CNFA 1N36B 1KDZA 2PUDA 2FHSA 2MSKA 3HCRA 1TFRA 5ALGA 2I1VB 4IEEA 3C41J 3TAXA 3M4XA 3SQWA 3REQB 3G7NA 4ND8B 1AO0A 2EIHA 2FUG1 3GH1A 2NZXA 1AO3A 1D3AA 3IUQA 2REOA 2W6MA 2OPBA 3AEQB 1ZHHA 5DEIA 4M8LA 3WFZA 4GHWA 4FFLA 3IL2A 4GUDA 3I61A 4KSYA 2XMPA 2Q1WA 3F4BA 3ZGLA 3OQJA 4FN5A 3WO0A 3L7LA 4NCIA 4ZT5A 2FFBA 2OK7A 3R7SA 3RM3A 3TQSA 2DUWA 2WKPA 4FMBB 2Y0EA 3T3OA 2LTAA 5HTKA 1HL3A 2Z0MA 2ZYTX 4MWEA 4O2LA 1IM8A 1GKLA 1GZVA 1ZSVA 2GEVA 3IAEA 4MS3B 3EPKA 1LY1A 4EBFA 1EFLA 4AXBA 3FVWA 4C2UA 3FMVA 4OQZA 4K9NA 3U48A 4BKQA 1YDMA 2ZT6A 3EGVA 4W8OA 4DR7B 1VI5A 2HU8A 1O6ZA 1Z25A 3H7AA 4L9RA 2QM8A 4OBEA 2NYAA 1QP7A 4KWIA 1UK8A 4Z2AA 3OWOA 2X4LA 2RE8A 4JMLA 3O2JA 4QL3A 3RS2A 3TVDA 3ZE7A 3H18A 4B0OA 4JI8B 2VI5A 3RD5A 3Q7PA 2XB2A 1HT2E 2J48A 3KZKA 3UGQA 4PG4A 3WLEA 2NYRA 4RFLA 1VC2A 1FSZA 1MJGM 2ZWAA 1A8IA 2OC9A 2IHTA 4YPOA 2E87A 3IFSA 1SBTA 4C78A 3PQ7A 1SWVA 3GFRA 2VAWA 2VP2A 1R5JA 2D2IA 2YWJA 1SBIA 2GHRA 4FFRA 4LRXA 2EKPA 5D7BA 2C5BA 3R0IA 3AM4A 1TO6A 2VNKA 3FKSD 1N2XA 1M2FA 2OR3A 2Q49A 2FEXA 3ITNA 3KD3A 1CUGA 2VPWA 4OP1A 1CDZA 3KP1A 1QO0D 1O4WA 4GG1A 4HB4A 1XTUA 4X97A 5REQA 2WJ3A 3HO1A 5TPZD 3L9WA 2XCIA 2D5AA 3ONVA 2OFPA 2FN3A 1PWEA 1XC7A 1W1UA 3PG5A 3O7MA 3G82C 3ZJ4A 1ZK4A 2NM0A 1P4AA 3ZH2A 1V4VA 4PWZA 4PGGA 2Q8NA 4GQBA 2VJYA 5M3BA 4AJ4A 5CVVA 1QVAA 3A2KA 4W7SA 1RYYA 5KNCD 3MJCA 4I1IA 2FK8A 3G2PA 4H9GA 5EUQB 4MEBA 4L5CA 3R5KA 4YJHA 5CW2A 3PPWA 1M72A 2EJBA 2FZVA 1NXPA 4JJZA 4L4XA 4A26A 2G82A 4F1KA 3SC3A 1HSOA 3OAAA 4EA6A 4S35A 3U7FB 1H0KA 1IOZA 4J76A 3SE0A 1D7AA 1O58A 5JS8A 1FS5A 1FTYA 1QE3A 3H0EA 5EY5B 5BOVA 3UUWA 3NHUA 1W5EA 4BATA 4GXNA 4PZAA 3U5TA 2MR5A 3UMJA 2B9EA 4AWBA 2HYIC 1EFUA 3OTOB 2H00A 1Y8QB 3TSZA 3HGTA 2GPNA 2X8JA 4OGWA 4CT0A 1YSCA 3V55A 4F8JA 5ALIA 3W1WA 2P1RA 3EEQA 1Q0RA 4RESA 6NULA 4IDNA 4H3VA 2Y1GA 4KWEA 1D4AA 1UK6A 3GCZA 2Q2OA 1GWNA 4FD3A 1GVNB 2WTMA 1C0LA 4W9NA 5CJJA 3KJFA 4F4FA 3OQIB 3QOXA 5DNDA 2H51A 1QONA 5JD5A 1NW9B 3TE6A 3JRNA 4JBIA 4BO9A 1UADA 3U7QA 3LWBA 3N3AC 3C3BA 2FX5A 3FH0A 3UXHA 4OYLA 2DETA 2B94A 2Y9MB 1NAIA 2RONA 2ZIWB 3NGLA 3NC4A 3TM5A 4QOIA 5LJLA 3QTTA 1NF8A 3GEHA 4Y6LA 1Q7BA 2JF0A 2ZIAA 5LCXA 4BQSA 5C9ZA 5KCZA 3AUJB 3T7JA 1CUUA 3C8ZA 2Y77A 3HB9A 3KAQA 2OFOA 2NUTA 4BMDA 3D8TA 1EH5A 1QH1A 1S2MA 2OK8A 4L4SA 1TDJA 1DBRA 3CLUD 3H4IA 3OA0A 5NULA 2W2KB 5DRTA 2IYNA 3DBLA 5EWLB 3CH7A 4GDFA 3JZFA 5LQJA 4RM2A 3RRZA 2D1SA 3IT2A 5HQTA 1A4IA 1TMYA 1W59A 4DV3B 5ALEA 4KRFA 4M38A 3EXFA 1MAHA 1ZUHA 2DOKA 4R1PA 5G4KA 3QSYA 1KEPA 2OBXA 3HEMA 4OATA 4OGKA 4LBYA 2UUPA 3OF5A 3M9LA 4OI4A 3R40A 2C2OA 3KQUA 4MDHA 2FGKA 1XAHA 4MUKA 4ND5A 1CU1A 1FBTA 2O50A 1VZ2A 3I92A 5AJHA 5BQOA 4BFVA 2IBTA 5EP1A 1Q7RA 1UBHS 2W6JA 2O6LA 4COKA 3C8UA 3FDJA 1N2HA 3OSZA 1Y5RA 3ONFA 3MT8A 4GMFA 4IIBA 5A05A 2G77B 2ZSAA 2BHNA 1TC2A 2B5WA 3T3GA 2QY9A 4DDKA 3MWEA 3TLGA 3R6LA 2OC4A 3DSRA 4M4SA 1MO5A 5K0ZA 2VPTA 1DOHA 3PFKA 1T1EA 1HUQA 1CVIA 1PDOA 2JEZA 3L8MA 4HDRB 4BNKA 2QTNA 2NTVA 1DARA 4ZGWA 4P1ZA 3AFHA 4E5VA 2JCVA 1Y3HA 3LYHA 1CPYA 1C3LA 3R4VA 1IWPB 5FX2A 2RC6A 3KM0A 5HP4A 1VIAA 2NO9A 4Y2GA 1Y6GA 1ZK0A 3V1NA 2XMRA 3I04M 1VIDA 2YIDA 1CBUA 1QGUA 2C1ZA 2D5IA 2ONJA 1CCWA 4UJ5A 3FNHA 4KV7A 1U3GA 3N1UA 1P29A 3B20A 4DNPA 3L2OB 3OE1A 3AVUA 3S28A 4ZI7A 4JSRA 1V39A 1YQ9A 5EJ8A 1W34A 1IXKA 2IHUA 4DLBA 1Z5WA 3MMSA 5A4JA 3EIFA 4KITB 5KYGA 5L3QA 3V1MA 3Q41A 3QKRB 1Y1QA 1UBEA 1YCFA 3NTVA 5MGBA 3BHNA 2IS1A 2GA8A 1XPJA 3CX7A 5LZ4A 3MERA 4TXNA 1O9HA 1PTJC 2XGOA 1Z83A 4Q9AA 2PKCA 1CQXA 3PQ8A 1Z39A 4MROA 4AP6A 2ZWVA 1JMKC 5EZYB 3V5NA 3K0AA 2I6QA 2ZIXA 4QYWA 4CLRA 3RWBA 4B09A 4BNTA 2R85A 3KOYA 3N8DA 5BW8A 4S1PA 2Q3BA 1Y6ZA 2X3UA 3ASUA 4GOMD 5A71A 3TGLA 4ESHA 3AJDA 4MUEA 3NBZC 5FP0A 4WK2B 4YROA 3SFVA 4JEIA 1BROA 5I7AA 4BQPA 1ODFA 1H6AA 1P44A 1QORA 5DBEX 3RVJA 3WYEA 1XTKA 3I5YA 2JGNA 1KPIA 3FVRA 5EN4A 3HV0A 1EFRD 2IPNA 5C51B 4A7PA 2H0QA 1UP4A 1Y9AA 1PJTA 4WDRA 1YR9A 3WB2A 4FFBB 1UDCA 3ZHYA 1J09A 1OX6A 4QGBA 4X7PA 3SQXA 4AY6A 1Q95A 2CSUA 3ZDAA 3QYJA 1YBVA 1KBZA 3UWMA 3WMFA 4DXHA 4WA7A 1MT3A 1JG3A 1F2TA 3WTBA 3TLMA 1BWSA 1L4BA 1NNLA 2BDTA 1Q77A 1H2HA 2H1FA 4TV9F 3BGWA 4ZEWA 2PUEA 2CLEB 3V4PB 2Y92A 3M6VA 3PXAA 2I8CA 1NG1A 2OXCA 4B3XA 2A5DA 1NFFA 1JJIA 3B5EA 5BYBA 3V2UA 2YZ7A 3GVHA 4IFEA 4MPPA 5IYZA 1MO6A 5HQ3B 5LOVB 1WCIB 3I9FA 2IU4A 1Q0UA 4ZQEA 2CUKA 3MILA 4Y2SA 4ZXPA 2CY0A 5DYYA 4NBUA 1YB5A 1N75A 2QVGA 3QMMA 2Q5EA 4L16A 5JI3E 5I4IA 5AKEA 1L7XA 1FVXA 3DD5A 3R0JA 3HM2A 3AJEA 1GT6A 2QLNA 3IO3A 3KJZA 4WASA 5K6TA 1T1JA 1B41A 1M2NA 2H54A 2X14A 5FXMA 3GLGE 1QIDA 1A77A 1ZI9A 3TCNA 1O9GA 3JQFA 3RVLA 1I3MA 1O87A 1W6RA 1NW5A 2OV8A 2WIGA 3FMOB 4LA4A 4BCCA 3SI7A 2RGAA 1W4BA 4Y18A 3ZZMA 1GV1A 2Q3EA 3WRVA 3ZHSA 3KYIB 1KWKA 5HZMA 4AI6A 4FFPA 2RHWA 3WGIA 4MV7A 2AGVA 3DBRB 3LS2A 4POAA 2C5FA 4L4YA 2CZQA 4YGXB 1B23P 1V8PA 3E22A 3AF0A 4UM9D 1GTVA 3DHEA 4YMWA 4RJTA 2XDQB 4Y2RA 2BE9A 2WIFA 5J58A 5C8YF 3EZYA 4J2HA 3GFVA 2WUVA 1LF0A 5BORA 2XPCA 4UTRA 4G1FA 3DFZA 3LT0A 4DC1A 3NV7A 2W4IA 4DQVA 4N5IX 1HDCA 2A3NA 2DQKA 2R1TB 5SY6A 3CEHA 5IDVA 1C30B 2GQ0A 2GNPA 1H8HD 2BFFB 3GRKA 3M1IA 3W77A 3LHDA 4N0QA 5AKHA 3GRUA 2HY7A 4JSTA 3U40A 5DXFA 5A4FS 3UBTA 4BY9E 2YNMD 3P9RA 1LI7A 2UZ1A 4H3KB 4QUHA 1QFYA 3WO1A 1FIUA 5JJLA 2OO5A 1S3FA 1HDEA 1XNGA 4BIMA 3RSLA 4QOHA 3TD2A 1JMYA 2CLDX 2E4XA 1BE0A 3WGHA 1VYHA 1G7RA 1LB1B 4H15A 5CLIA 3AGQA 1CHDA 4JSYA 3ORRA 5D1NA 4AO7A 3BE5A 3C7AA 3CPJB 4DLSA 4EQ6B 4JLSA 3DE5X 3G8DA 3NBFA 4RSHA 4XGQA 1AS3A 1TW2A 5BRNA 4E5SA 1C8BA 3I45A 3WWOA 1AQUA 2ZTLA 1AQIA 5J1TB 4QU8A 4ENSA 4MGHA 4IQ8A 1L5OA 2H31A 4TXMA 2CCKA 1PL7A 1W44A 3JYLA 2AMFA 2JLWA 1BG6A 2NU8B 2RKWA 1T4DA 5JPCA 3KVNA 4G01B 1KSGA 4L5YA 3RBXA 2I6SA 5K9ZA 2CNBA 3MUOA 2WHPB 2B8WA 2LGJA 2CVPA 2G08A 4S04A 2OFXA 3V3KA 2CD7A 3LX4A 1X15A 3ZDDA 2ENUA 5T4BA 4RZ3A 1NDQA 4N40A 4TT8A 2A67A 1K8QA 2VDRB 1OY1A 4AKIA 4FYXA 3VTAA 1XZCA 1QNLA 1V37A 2QK4A 5FBHA 3HJAA 3EXIB 4Z5XA 4ARCA 1Z0UA 4O29A 5KB3A 1ZVQA 1ONNA 3OPQA 2POCA 1L5WA 2AMVA 5CK4A 5DGCA 5ALRA 1ECFA 3W3ZB 3WBBA 4R0MA 1G9SA 5IW8A 1RAEA 1JH8A 4M0MA 1K92A 2BEWB 4QXMA 4AYWA 3IA2A 5HGXA 1FRZA 4JI4B 4D8UA 1UM9A 3PFCA 2OD7A 4UNIA 1OT3A 1DXYA 1FDSA 1ZDMA 1QFMA 4WNAB 5ESWA 4FZ5A 3BMOA 4Q15A 4D8VA 3R0ZA 2A2ZA 5DCWA 3GR6A 5DYNA 1GJRA 5BN3A 1GCUA 3KSMA 3ZJUA 4RK0A 5G0UA 2BGKA 4CG2A 1BKYA 3PJEA 4IHKA 1QV7A 2OUIA 3AR2A 1PBTA 1JR2A 5JAMA 2EDAA 1RM3A 5JVDA 1MFPA 4JLDA 3TTUA 1PJQA 2PVSA 4BMZA 3OKFA 3DL0A 3PR1A 4KKVA 4KLAA 3ZE8A 3U16A 1E0SA 2R8EA 3MYYA 4O4JA 1XD2B 3OTHA 4XGIA 4G1BA 3WWYA 4DRXA 3BFKA 5EIAA 1LBQA 4NCXA 3HWSA 3FSJX 5KYUA 2CXPA 1O57A 1KERA 2CFTA 2UVPB 4RVFA 1GGHA 1SC1A 4DMMA 2EYUA 3B1ZA 2AOXA 4BLUA 4EUEA 1X7HA 4DCGA 4ER0A 4OA8A 1WXGA 4NXNB 1PLLA 2CC2A 4FGJA 2HDNB 4H2DA 3KUUA 2KI5A 1XA0A 3ZOKA 9GPBA 4B8YA 5ARCA 5B4VA 3JU3A 4M7OA 1QKIA 5AKZA 2YJ5A 2WIAA 1Z2CA 1IHOA 1SD5A 2AD5A 3PQ5A 3PJDA 3RCBA 2JLQA 2YMLA 3N2GA 4PFJA 3TR0A 4JASB 2P9HA 2ZYHA 1E8DA 2AE2A 2G6BA 2XYGA 3Q87B 4PG6A 2BI4A 3H9JA 1DAKA 2RI0A 3BRCA 5CVJA 3VC3A 1IN7A 4RTKA 1LPPA 2P6OA 3C6YA 2NADA 5EJ7A 4M0KA 1L4HA 4R8LA 4ZGGA 4JZYA 3NPMA 3UB4A 4Q1BA 3BJIC 1OVGA 3HN2A 1J4AA 4NQZA 3HHEA 4II2A 3S7ZA 1R0WA 5EHIA 5CEJA 1GQ2A 1EI9A 4ROSA 4ZT4A 5KNBA 2YHUA 3WRYA 3GLIE 2ZUDA 3GG9A 1DAPA 2HJVA 5AIBA 1YZQA 2FW7A 3VU1A 1UWVA 3QPDA 4CM6A 4DREA 4DT1B 3K0SA 2DY1A 3KUDA 3OY7A 5GJCA 3AONB 3TSYA 2ADFA 4D9MA 3QEBZ 3ND9A 4HJRA 4F4UA 5KYKA 4OYRA 1NSTA 3R23A 4HL6A 3CVXA 4EJ2A 4EKIA 1JAIA 3ETLA 1T8TA 2A0FA 3O03A 4D6YA 1C2TA 4E2YA 3G85A 4MVJE 1GQYA 2KX7A 4NBNA 4QG7A 4R8SA 1B8VA 3IQXA 1NJ2A 5B64A 3JPYA 3E9QA 3AXSA 4JKOA 5LZ7A 1YOVB 2XEXA 4Q16A 4QDJA 3S0JA 4BDTA 4V1CA 2G83A 4DR2B 3JALA 3ABOB 1HM5A 4V2IA 4ALNA 3YASA 2DTEA 3E15A 4N3NA 3CRZA 1I51A 1H6CA 1UAAA 4MQFA 2ZAYA 3DE4X 4HFRA 5ECYA 3B1KA 2IDKA 2R00C 4LUCA 3E3NA 3PUHA 2XXJA 5C8YB 2JIBA 1F8XA 1RC1A 1XP8A 3E3OA 3NEAA 1WW8A 5CVUA 4ZARA 2FPPA 4OM8A 2VPZA 2DX7A 1D1PA 3HZZA 4Q4AA 2IXAA 2XT6A 4A4DA 2C9MA 3V4LA 1I1NA 3LKVA 2AJBA 4G23A 4LOIA 5HF5A 3MF4A 1QMGA 1IATA 3L0YA 4MPTA 3WSWA 2RJ3A 3KYDA 4G5HA 3VR2A 1FLAA 3DPIA 4HDOB 1Y8CA 3LPNA 1KVUA 5B1EA 3KB1A 3OJWA 4JXXA 1OYYA 5G3ZA 1FOEB 1DJOA 5CM2Z 3SJUA 2BM0A 1PAUA 1W19A 3HZRA 1EVJA 3F73A 1ZAYA 1TYAE 2WNIA 4MZDA 1X74A 2GAFA 1FQOA 2H1CA 2ZPAA 2IYLD 1LJUA 1P73A 3N0WA 3D0KA 3QVLA 4OUKX 1A9XB 3EEYA 3EQ6A 2ACVA 1B00A 1WKVA 2C7VA 2I54A 2VP6A 1WUKS 2PJDA 2IYUA 3WRXC 2YUIA 4DLWA 5JZMA 5HJ5A 5I9SA 3E48A 3LPMA 2IOYA 1N7JA 2FZGA 2BSQA 1ABFA 1WNTA 3OZEA 3VTZA 1II9A 4HDAA 3V7UA 4GPZA 3A9VA 3UJ8A 4XR4A 2ZP1A 2E85A 3KRTA 3VKWA 5KWEA 2HK8A 3OC0A 1KGDA 4WN9A 3SYKA 4XVCA 3NAGA 1RJFA 3ZW9A 3INTA 3FLAA 1V5WA 4Y2JA 4TZ6A 1Z5NA 1N6LA 2GERA 3CH5A 4FS8A 2A7QA 4OIMA 4RETA 4KQMA 3LO5A 5JCJD 1A8QA 1KYVA 3HJBA 4JS0A 5GZ6A 3GPCA 4ZK6A 3ZE6A 3F8SA 3ZKWB 3VPHA 4KMSA 2X58A 1USKA 1XU9A 4OXYA 3UEOA 3GXOA 5I9NA 4QATA 2QG9A 1P31A 2VHVA 4CEJB 1DTWB 3AHIA 1QH0A 3UB3A 4H7HA 3ZGYA 1XEXA 2ZRFA 3DCIA 4YV2A 4CR6A 3GFFA 3RSCA 3HJFA 1Z4JA 5TE9A 1O5TA 5T4HA 1AV7A 2WF7A 2OG1A 4CKWB 2XLCA 3ZGXA 2HDHA 2YWDA 3DXZA 3IX7A 3A9WA 1UZLA 2H9IA 2V8BA 2AI3A 3BIFA 1DHRA 1LW6E 2H6EA 1RZUA 1NBHA 2W83A 1H1TA 2P4QA 3RHTA 2JJMA 2N46A 3D6NB 3A6HA 3KXLA 3LCVB 2G71A 3CZMA 4GW3A 3KR1A 4HH3C 1YJ5A 3T1HB 2ODAA 1JIQA 5JEEA 3RROA 1SOWA 5C7IO 4XKJA 2CNDA 3HNPA 5BT9A 4PQEA 3RGGA 4CM8A 5JO0A 4INPA 4RZIA 1MX3A 4HNGA 1JUDA 2KJQA 2PKWA 2ZCVA 3B60A 5IVDA 4N4AA 3VSAA 1SCUB 2WWXA 4C03A 4CLDA 4AICA 4QRDA 4OYHA 3KLNA 1REQB 2XECA 4MS4A 1EK6A 5J2TF 3PDWA 2ZJYA 3LUCA 2GPSA 4P34A 2F8TA 5MN6A 4G5SA 4Q6BA 1PYDA 3R74A 1XTZA 1YJCA 3FHCB 3HCFA 1E1CA 2YINC 3LPLA 1BWRA 5TF4A 4ALIA 2OHOA 4UBOA 4Z1OA 2Z6UA 3F1LA 1NBAA 1WZIA 4L8GA 1CUEA 4BO6A 2IYQA 3C5EA 5A62A 3O8NA 5F2KA 3BRWD 2JK0A 1XHEA 2BGRA 1CDOA 1T4CB 1Q15A 1V0JA 1GAQA 3IIIA 5EKUA 1EWRA 4PTLA 3UA3A 1EUZA 5JCZA 8ATCA 3SC2B 1H4VB 2ZSEA 3AERA 3GCWA 1H2AS 4RKQA 3R8FA 2XMGA 2CXRA 4DADA 2NZ2A 2W00A 3K0EA 3ZYCA 3MXOA 3ZCSA 8GPBA 1IBKB 5I9BA 1K6IA 2AW3A 4R5MA 4EFKA 4IW3B 2B8NA 4YEDA 5TQ2A 1M1UA 3HKBA 5GGYA 1H5NA 5K0LA 3G5MA 4E0BA 2HIHA 1MB4A 3MS2A 2GILA 2GX6A 3O93A 1YFLA 2EW8A 4E5MA 3VYWA 3SF8A 1XU7A 2Z57A 4IHQA 4EGAA 1QU3A 5CB0A 4G4JA 1MW8X 1DFIA 2EF0A 3WKBA 4DLVA 3ZDFA 1KEWA 5C1BA 3TQTA 2ODTX 4IKPA 3VKVA 1H85A 3IALA 4I50A 4AG3A 1DC8A 5JSFA 3A1VA 2GZMA 4DE5A 5ESXA 4H31A 3SNHA 3AUFA 2G70A 2PQ2A 2JLCA 1UKYA 1XSEA 2H7XA 2W37A 4K9KA 3MINA 4QNMA 4BO8A 1C14A 1N2JA 1IHPA 3WBKA 3N9IA 4PFKA 4FOSA 3VM6A 1V3TA 1U0BB 5AM2A 1C50A 1KARA 3BDVA 2QVZX 3N7AA 2FE4A 1PS0A 4YALA 4BL5A 4DV0B 1XNRB 5ED4A 5I45A 5CM8B 1V11B 2DLCX 1EGAA 3JQ8A 3ZCQA 4EB0A 2GCGA 2VHXA 3LCUA 3H6HA 3WKEA 4BEWA 1XPUA 1YC5A 1HYEA 2PMBA 1GFWA 2CDAA 4QBIA 1XJQA 4BFSA 2ZM5A 4S2UA 2CMFA 2PFKA 2ZB3A 3V4FA 3VZCA 5G40A 2BFBB 3UAXA 2DFPA 1CRQA 4NV1A 5AOAA 2GOYA 1YONA 5KJFA 2QYSA 4WHMA 4RZ2A 1P4SA 1N0UA 1VCHA 1RKXA 1ODCA 2ZROA 4GRAA 5E7IA 1KSFX 5DIZA 1KVTA 3U9LA 2IZ5A 4E5YA 3IXLA 3GOQA 2EJTA 5F52A 3NMUF 3VVBA 5FUYA 1E1RA 3CLKA 2NU9B 4XPIA 5DTQA 5L3SB 4HX2A 3L4JA 3LLSA 5LQKA 3RS0A 4U5QA 5BV2P 2NPIA 3I4LA 3AEUB 4DDVA 1XEWX 2PX0A 2YR0A 3HNOA 4BZPA 5FTMA 4CCYA 5CEFA 5I51A 2W2PA 1M8KA 2G9ZA 4JK3A 3AF5A 5JC8A 2C95A 2PRYA 2HQ1A 3QF4B 3SSNA 3WIDA 2A30A 4H7EA 4AJ2A 3CSUA 3JTMA 1ZUD1 3PPIA 2JGDA 3WLSA 5HUHA 2XYPA 5AHXA 3SJAA 4JB2A 2C20A 1KDVA 4PEVA 4NMXB 3IBCA 1E0KA 1DO8A 2HCTA 5DXAA 4TLLB 3CC8A 5J9FA 1B93A 2YZKA 2VJAA 3ZXSA 1AHHA 1JDTA 2PQMA 4RVCA 2WOJA 2C0PA 3B3QA 3L8YA 1OTHA 3EW9A 2OGWA 4KI0A 3TNYA 1KVRA 2C3UA 2ORIA 1JFFA 4ALKA 5AW5A 4TRNA 1GPH1 1YZFA 2JCXA 3GRFA 2COEA 2IW1A 2VF7A 3P2KA 1VCIA 2C4TA 2PPVA 2XIQA 5ITWA 4UMDA 1TOAA 3IIJA 1WMSA 5FQOA 2AXNA 1RWPA 4UNPA 4WESB 4F5YA 4QJ3A 1Y5NA 3DVRX 3DQZA 1XFDA 1EA5A 4KYTA 2WP0A 4URUR 2VF4X 5JZSA 1SXQA 3ICEA 3E8XA 3Q11A 2VTEA 2CXOA 1GU0A 1NUHA 4K26A 4LXHA 3ZHBA 4AUKA 4E5KA 5A6SB 4QXRA 3OZUA 3QITA 2QUZA 3U37A 3O3OB 3IMKA 4D02A 4EGFA 2XUGA 1ZP6A 1M6VB 1LFAA 3OZ7A 1QAOA 4A0SA 3EA4A 3HJNA 1XELA 4AECA 3U49A 1NVFA 1Z36A 2NTEA 1L4KA 3A0UA 1PR6A 3LD9A 5H1YA 3ZX5A 3NTLA 1C1HA 1USGA 1T3LA 2P2DA 4CV1A 1THGA 2A5YB 3K15A 4KUEA 5J2TB 1GO2A <