1USGA

L-leucine-binding protein, apo form
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
345
structure length
345
Chain Sequence
DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structures of the Leucine-Binding Protein Illustrate Conformational Changes and the Basis of Ligand Specificity
pubmed doi rcsb
molecule keywords LEUCINE-SPECIFIC BINDING PROTEIN
source organism Escherichia coli
molecule tags Transport protein
total genus 138
structure length 345
sequence length 345
ec nomenclature
pdb deposition date 2003-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usgA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usgA01
4HYEA 2MSLA 3DLBA 4XLTA 1M5UA 1ZGZA 1XHEA 2AYXA 2FMKA 2FXIA 3NHZA 2VYCA 3MYYA 5TPWB 3F73A 2IOYA 1TMYA 4N76A 3Q7TA 2HPHA 4JAVC 1BA2A 4Z9AA 3H1EA 2P4UA 3QELA 3RVRA 3EDCA 3BRQA 4QPJC 1A04A 2PUEA 3RH0A 3D02A 1IIBA 2FW0A 2JVKA 3LUFA 4RS3A 1RPJA 3JVIA 3NNDA 3HDGA 1QPZA 4KK4A 1E2BA 2JK1A 2LUOA 4JB2A 1JDNA 5FBHA 1QNLA 3H5VA 5F64A 4EVSA 3W9SA 4QYMA 3HJFA 1PEYA 3EQ2A 4EVQA 3RVMA 2PUAA 2NUBA 5B3JA 3RVSA 2TMYA 4W5TA 4KZKA 4ZJPA 4WXMA 1QP0A 2WMYA 1Y1LA 5E3JA 4DQDA 2R25B 1D2AA 1QP7A 3C3WA 5EWMB 2CWDA 4Z0NA 2N9UA 1RZRA 2RJOA 1JF8A 3NNSA 1ZHHA 3HUUA 5IBQA 4W5RA 4G0XA 2PMCA 1RXIA 4MS1A 3LUJA 3CRNA 1FFSA 1QQBA 3JPWA 5JNSA 2FQXA 1JX6A 5DGCA 2WWVD 1MB0A 2FEPA 2ZAYA 4RWEA 4PICA 3CU5A 2PLNA 2F8SA 3N8IA 1U2PA 4F8JA 2NZUG 2QVGA 4N03A 2GI4A 5KQGA 3SM9A 1JDPA 4IMJB 1F51E 1D1PA 1EWKA 1MAVA 3OLYA 4FE7A 1SXHA 2E4XA 4KVFA 4YLEA 3ROTA 3KS9A 1Z15A 4YV7A 1ZVVA 3QELB 1DCFA 1E6MA 3EAFA 3IP6A 1RZRD 2PL1A 1NXSA 4Z99A 5FWYB 3OQOA 2HQOA 2LP4Y 4ML3A 2PUDA 3OLXA 2H3HA 3F6CA 1M2FA 4RY0A 3SNKA 5IULC 5PNTA 3C3KA 1ZDMA 1P8AA 4Z4HA 4G86A 4N0QA 1WETA 2WY2D 4OTZA 3OO1A 5KI6A 1NY5A 4W5QA 4YR7A 4RK1A 3LUDA 2FN8A 1YVUA 3H5WA 1JYFA 1CHNA 2QVCA 4RY8A 2B4AA 1P6UA 1VKRA 1DP4A 4JASB 1NATA 2MYTA 3M9WA 4Q7EA 5GOTA 2IPAB 3Q7RA 1Z18A 3OM1A 1I3CA 3EGCA 2ZWMA 3FFTA 1QP4A 3SY8A 4MS1B 3T38A 4E7OA 2PUCA 1GCAA 4LE1A 1ISSA 4IGAA 4XASA 3IP7A 3TD9A 1XHFA 2J48A 2L19A 3O2SB 5KC8A 2E4YA 1LBHA 3A3KA 4EGSA 2M98A 3JS5A 3N0XA 4MR7A 4WZZA 5IUNC 2A9PA 2PJUA 2A9QA 3Q9SA 3QLUA 4H3KB 4TMYA 3FDFA 4NCAA 3CKMA 2QV0A 3GWGA 5KQMA 1APBA 3LUCA 3IDOA 4HNRA 3QX8A 4Z4GA 4N47A 3K4HA 2FTKE 4MR9A 4EYQA 5JNUA 3BILA 2NT3A 1BVHA 2E4ZA 3LOPA 2FQWA 3HUTA 3GL9A 2A9OA 5ED4A 1YK1A 3BREA 3FFWA 4B09A 1KMIY 2QSJA 5TPZA 2JB9A 3QEKA 2L18A 1YTUA 2FVYA 4W5NA 4M88A 3GRCA 3MQ4A 3QLVA 1GCGA 1PHRA 2MYPA 3OM0A 5KC9A 3R0JA 3UKJA 1JBEA 5D2CA 1LJUA 4KK3A 3H5IA 2YHBA 2O20A 4O5AA 4GNRA 3L6UA 4RK6A 2IKSA 3O2QB 1GUDA 3MM4A 3OQNA 1YMUA 3CTPA 3KSMA 1U0SY 4KREA 3KYIB 3EULA 2GWRA 5CNJA 1D1QA 1JWLA 2FLWA 1PNTA 2FLKA 3KKEA 3NNNA 3O74A 1ZAYA 1LJLA 2MYNA 2L17A 5DTEA 4PYRA 1DCMA 5EWLA 1NXWA 3H5OA 3I09A 3ROFA 2PUBA 5JS1A 5GQSA 3RVNA 3HSYA 4Q6WA 1NXOA 3OLZA 3KLNA 4G0YA 3BBLA 4YP9A 1JHZA 5BQ3A 3KYJB 2GBPA 1JFSA 2HSGA 3MA0A 1SXGA 4PEVA 4WXEA 4XXHA 5FBKA 3A10A 3HEBA 4EYOA 3KG2A 4JA2A 5C5EA 4ETIA 3QEMA 2JVIA 2XDYA 3LUGA 3O1IC 4N0PA 3HS3A 2Q5CA 4P98A 4IRXA 4UHJA 2BGGA 3E3MA 1MVOA 3G1WA 2QXYA 3QX9A 4H3HB 1Z12A 4KV7A 3N75A 4S04A 1AB5A 2HQBA 3F7NA 1NTRA 4Q6BA 4TN5A 1YMVA 1D5WA 2IPLA 2PKXA 4KFCA 2W42A 1DC7A 2GX6A 1A0OA 3H6GA 4LZLA 4O1IA 5IEBA 3LKVA 1QO0A 2P9HA 3QK7A 5HKOA 3RVLA 1BDIA 3LUAA 4EUKA 2FQYA 3DBIA 3MMNA 4RV5A 3CNBA 3LMKA 2IPNA 2WRZA 4F3TA 5JNWA 3H1FA 2QZJA 1Z17A 4WT7A 4ZPJA 2CD7A 4ETMA 1EHCA 1L5YA 4RXUA 5FWXA 1QMPA 5EWLB 4YRZA 3GBVA 3CS3A 1K66A 1P6QA 2IDMA 2IPMA 4OG2A 5JNTA 3CZCA 3LUKA 2F8TA 1ABFA 5I4CA 2PAFA 1SXIA 5TQJA 2PUGA 3TO5A 4D6XA 4MS3A 3HK2A 4YWHA 7ABPA 4QICA 3SG0A 2MYUA 4KRFA 1DJMA 1DG9A 3HVRA 1M2EA 4G0OA 1QO0D 3GT7A 1W25A 1B00A 2MSKA 1XWWA 3KLOA 3QEMB 8ABPA 1FSPA 1NXTA 2HJ9A 4MPTA 3O75A 1ABEA 1YK0A 3RVOA 4RKQA 2OENG 3IP5A 4MQEA 1JFTA 3DGEC 4NQRA 3HO1A 1VLZA 1R8JA 3IP9A 3NBMA 3RQIA 5ABPA 4KQ9A 4H60A 3URMA 9ABPA 1C4WA 1PUXA 4RK5A 4CBVA 4D6YA 2VUIB 4MS4A 5BRAA 4UHKA 3SQNA 1ISRA 3H5LA 1BDHA 2JRLA 4FB4A 4MYRA 1FQWA 4Z4IA 1DRKA 2FEKA 1JH9A 1URPA 3MF4A 4OATA 1U8TA 1NXPA 4DN6A 5KQLA 2B1JA 3HCWA 1OXBB 3Q7SA 4Z4CA 1PEAA 4O1HA 2YHAA 1MB3A 2CHEA 2FMHA 3HV2A 4ETNA 4RKRA 1TVMA 4MGEA 4MRMA 5IX8A 2PE5A 5FWXB 3LFTA 3KCNA 2FMFA 1Z26A 4G0ZA 4Z4FA 2FEWB 4DADA 1SD5A 1EWTA 2H0AA 2RDMA 3FMVA 4OBBA 4MLDA 4KNYA 1BDJA 4MS3B 4NCBA 4Y9TA 1EFAA 1LK0A 1VRVA 2R47A 4ZMSA 4KPYA 2V0NA 3OMXA 5JNVA 5TE9A 2FMIA 1ZY2A 3B2NA 4LDZA 3O1JC 2A9RA 1JFVA 2FSPA 1GUBA 1NXVA 1DZ3A 1ZGGA 1DRJA 1RNLA 1H9CA 1CYEA 2JBAA 1FFGA 3HDVA 3I42A 4G0MA 5IEJA 3CLKA 4EYGA 1A2OA 3GA5A 4MQEB 5TQ0A 2M1ZA 3H75A 1C0EA 5HQJA 1UDRA 1USKA 1YIOA 1Z2EA 3KTOA 3L49A 3M6MD 4PE5B 4RU1A 5B3JC 4W5OA 5TPZD 3G85A 4LDAA 4IF4A 1ZH2A 4MS4B 4MR7B 4WWHA 4JOQA 5TQ2A 1E6LA 3N0WA 1RXEA 1VPWA 3KHTA 3GV0A 1JL3A 3O21A 3DZDA 1KGSA 3RVQA 4E7PA 4NV3A 4MR9B 2X7XA 3K9CA 4LE2A 4RK0A 3HZHA 1FFWA 1PNRA 3KJXA 2NT4A 4MRMB 5FWYA 1DC8A 3VNAA 5T7BA 1USGA 1T34A 2GKGA 4RSMA 1GLGA 5IC5A 4F06A 5KWSA 1DBWA 1USIA 3O1HB 3I45A 1QQAA 2QU7A 3A0UA 4YO7A 1U2QA 3H1GA 1AB6A 2RGYA 5CNMA 3EJWA 5JS2A 6CHYA 1KRXA 2PL9A 4EYKA 1YS6A 1TM2A 3CG0A 1P2FA 2ID7A 4ZMRA 1F4VA 4G0QA 1ZESA 3SAJA 1Z2DA 3A0RB 4RZSA 1KRWA 5BR1A 3GYBA 4RK7A 4TLLB 1ZH4A 1EWVA 5KQPA 2I6FA 4L4UA 4XARA 2JBAB 4MQFA 3RVPA 4XFKA 3FFXA 4P1ZA 1W9HA 1Z25A 5EWJA 5TQ0B 1MIHA 4IILA 3N53A 3MIZA 3QLTA 4PZ0A 2QW1A 2JVJA 1K68A 1JYEA 1NXXA 1ZN2A 2L2QA 4IMIB 5DLEA 3UK0A 5TQ2B 5CHYA 3JPYA 2LPMA 3D8UA 4JP1A 4EY3A 2AYZA 4OLAA 4MR8A 4XAQA 3TB6A 5C5CA 3OLWA 1QKKA 3O2JA 4F12A 1TJYA 1U04A 3Q15C 3M9XA 3I5AA 3ILHA 3TX6A 5BRJA 4S05A 2HQRA 4RDCA 2NZVG 3QLUC 1Z13A 2WJWA 3UUGA 3OQMA 3CHYA 4YGXB 2VUHB 2R48A 4MLCA 4NICA 4HNQA 3T6KA 2FKAA 4F11A 4MAAA 4LRQA 3EODA 1LBIA 3DLHA 3OO0A 2JCGA 4GPAA 2LIVA 3IPAA 1D4ZA 5CNKA 3N6VA 3P9YA 3C97A 1SRRA 1ZITA 5DCLA 2RJNA 3E61A 4L85A 4KQCA 5TPWA 2WB4A 3BRSA 3ILYA 4YS6A 4YCSA 1CEYA 4MQFB 3HM9A 3H5TA 2WJAA 3TMYA 5T3YA 1JLKA 2LBPA 1BAPA 3QLVC 4RXTA 4TLMB 4D74A 4N41A 3LUHA 3T8YA 5EWJB 5IUKC 1EAYA 3RVKA 2DRIA 5JNRA 3C6QA 3Q41A 3JVDA 6ABPA 1L5ZA 3CFYA 2QR3A 3N0RA 3IPCA 3RVJA 4RK4A 5HM6A 4OLBA 3VNBA 3GBPA 4RY9A 1M5TA 2CHFA 1OXKB 1Z16A 3OLVA 4RXMA 3F6PA 2ID9A 2KYRA 1YS7A 3CG4A 3HXMA 3DGFC 4JB0A 4MR8B 1DBQA 5CNIA 4WUTA 2MSWA 3LTEA 4QYWA 1J56A 3NHMA 4FE4A 4Z9BA 4LE0A 1TLFA 4Z4EA 5IUJC 4ZYLA 5DKFA 4G0PA 3FGZA 1DBPA 3JY6A 5HSGA 5EWMA 3S99A 3LKBA 2IYNA 1S8NA 4G97A 3C3MA 2VK2A 4EVRA 4LX8A 2PUFA 2E4WA 3CZ5A 4KMRA 3EQZA 3T95A 2R4QA 1DCKA 2E4VA 4HNSA 3OMWA 3H6HA 1HEYA 3JTEA 1E6KA 2E4UA 2OQRA 2FN9A
chains in the Genus database with same CATH superfamily
1QIJA 2DR0A 5HILA 3EFOA 1SC4A 3ZVNA 1AUPA 4MKHA 1W94A 3JQRA 2FSUA 5AVJA 3HJTA 2Z43A 1IWOA 2DSTA 2FXIA 1A2KC 4ER3A 1PGPA 2Q5EA 2H1VA 4JNCA 3RC1A 4I5FA 5JD4A 3F67A 4WK4B 3RTGA 4K03A 5ALRA 3F8SA 3RUCA 3CC8A 3IHTA 3H8JA 1E8DA 4QQ8A 4RD1A 2XXAA 1CFZA 3SXUA 1X9IA 5KX5A 2EGHA 3QEBZ 1GILA 3KSZO 4UE2A 1IIBA 2FW0A 1LW7A 4GP6A 3DEZA 5TC4A 3ES9A 5HTOA 2GF2A 1RRFA 3C3EA 2ZRLA 3DF7A 2GYWA 4B85A 4NBKA 5JD5A 2A58A 4OHMA 4H7KA 1ITZA 3T5DA 4UQOA 4YAEA 3DLPX 4QYMA 2WUWE 3KB1A 3QUCA 2JFNA 3H1BA 1NVUQ 3DE1X 3M89A 4EVQA 2IH2A 1QNFA 3KVYA 2P6NA 5B3JA 4X7RA 2ZPAA 1ND6A 5ICGA 1YQQA 5KWJA 1YXMA 2JJQA 1VFNA 1QORA 4UZEA 4YRDA 1G6KA 1EFLA 4Q7QA 4LA4A 2AR9A 3EMVA 3RIYA 2QYOA 1YE3A 4F4HA 1VCNA 4NS1A 4TUYF 1NI3A 3KZCA 1O58A 3EWAA 1FW8A 1P60A 4XH9B 5TGTA 3ENVA 4QL3A 4EUNA 4BUZA 2P4HX 3E81A 3I01A 4BN5A 1AXEA 2ODTX 4DC1A 2R6R1 3L01A 4OYYA 5SYAA 4ATNA 3LLMA 4B82A 1IVYA 2RB5A 3B1YA 3DOIA 3ETDA 4J29A 2WQ6A 1MO2A 2BR5A 1U2PA 3L6CA 3SJAA 1CR1A 4O4IB 5GP1A 2CJXA 1OIWA 4OQ4A 3SFZA 5HKAA 4FB5A 3VH2A 3NRCA 4V0KA 4C03A 1Z6GA 4YJHB 3ZCXA 3GXOA 1T25A 1Q1AA 2FKNA 1UM9B 5KYGA 2C2YA 2PZBA 3WNVA 4RKFA 2GEFA 2H29A 1DCFA 1V7QA 3IP6A 2P9GA 3NKFA 4G26A 1G98A 5LZ9A 3NRJA 4WASA 1IUOA 1CY4A 2BEUB 2V7QA 3FYUC 3KPJA 4HBZA 4QXOA 1GU1A 1UKYA 2IBMA 3TE6A 2F62A 2BCGY 5FOVA 1LTHR 1PYGA 2VI5A 1MAWA 1N6KA 1OZAA 3OTHA 4LI0A 3D81A 1CJMA 3GN1A 2ZJ4A 4MAMA 5CYOA 1GO2A 3PKJA 3A6KA 4DBLC 5HR5A 1VGQA 1OVMA 1VIDA 1R8YA 4B43A 4MPPA 3DE2X 1FSSA 4JLMA 1AN0A 1UP6A 5IXSA 1JYFA 3GT0A 1Y42X 4DJDC 5JXHA 1W85B 4TV8F 1VKRA 3A1DA 1VIYA 1B16A 2O1XA 4DC0A 3GRKA 4QBKA 4YRTA 1UMBA 5DM70 3IS3A 3NIBA 4BB9A 2MYTA 1Z5NA 2M9MA 1A95A 4BRSA 1YB6A 5JU6A 2YBEA 3WFZA 1QTQA 2JPDA 3ESCA 3FKSD 4CL0A 2WYWA 4ESHA 1E1DA 4Q9LA 2QENA 3JQCA 1G8KA 1W93A 4XASA 4E13A 2JJ1A 4AO7A 1G0OA 1K8YB 2C4KA 2IYSA 4WXHA 4BLWA 5C80A 3JS5A 1QFMA 4WZZA 1MNAA 2A9PA 1NNSA 3C4JA 3F9RA 2IGBA 5AW7A 4PZCA 5GJVC 3VHQA 4TMWA 4RFSB 1WCIB 1UCFA 4PG7A 1EX7A 1GQSA 1PFYA 3K4HA 4OM7A 3ZGYA 1NPYA 4TQ9A 2FHPA 2FTKE 1L8OA 1X1CA 2PS9A 4JX8A 1HFKA 3HG7A 3HYTA 4NYIR 4ZXFA 2P9TA 4GAEA 4NENA 2V7UA 5CT4A 1FNMA 1POXA 2AFHA 4Z8XA 3S55A 3U26A 4UVHA 3HUTA 3VPBA 1N5DA 2A9OA 1X80B 3U7EB 4DREA 1JE0A 1YI0A 5KWIA 4OK5A 3FLAA 3C3CA 4X7MA 1R4NA 5FBRB 1M2HA 5JROA 3MQ4A 3EA0A 1XR3A 3QLVA 3NDPA 2MYPA 4IEEA 2IBSA 1GY8A 1NF2A 2NAPA 3MBKA 4U2GA 4EKEA 5FL7D 3L0BA 2W93A 1TRKA 2Y27A 3OG9A 3FCCA 2OZLA 4BLUA 1A71A 2RAVA 5JQGB 2FWNA 1EE2A 3L8DA 1PVDA 3WJ1A 3S27A 1SELA 3MT0A 1XGKA 1FNSA 3DV9A 1SNYA 1GUDA 3DVAA 4GX1A 4NABA 4QT0A 1UBUS 1FFAA 1GPLA 1IBLB 1D1SA 1U7HA 1BU5A 1XZQA 4ONEA 3B3JA 1YS2X 3O74A 2QA5A 3RSGA 2IYZA 1LQ2A 2ZYGA 3GRPA 3P45A 1LX6A 2CBGA 2KLHA 1DCMA 3GOHA 4PW0A 4F4IA 1U8EA 5LA6F 3SPXA 4ZT7A 3QVGB 4NAVA 1Q1GA 1MCZA 4ZD6A 5BQFA 3AUTA 1MO5A 3RVNA 3ZHOA 1NHGA 2WM2A 1VZ2A 1VECA 4Q9IA 3T3OA 2C3PA 4I6EA 1KO4A 1UPBA 2F3UA 4UM9D 3WADA 2FG7C 2RSLA 3OJFA 4M0PA 1VXRA 2H51A 3FYDA 4W63A 4XXHA 5EY5B 1K7FB 4DQ0A 2ZYRA 1KK0A 4F9EA 1FS4A 2VT2A 5BQPA 4B73A 5DNYB 1F8GA 1J1ZA 1ENOA 1HLFA 1IWBB 2VS1A 2FPRA 1MOSA 3O8OA 2R8YA 1PD0A 3I9LA 2IUTA 3DL2A 3FNHA 1TYBE 1Y80A 1S96A 2P4SA 2PKQO 4EF6A 2YV3A 3DBVO 1YZ3A 3PL5A 4BO5A 5AJVB 4E1BA 2XI4A 4BJHB 1JLMA 4RTLA 2PT7A 1DIHA 1X86B 2JC3A 1DX9A 2DWOA 5IAAA 2VJKA 2RD2A 1D5WA 3MWLA 2ET6A 1SHTX 4MIYA 1H9BA 4C7XA 1ZD4A 2UAGA 1J2JA 1SD2A 2HPZA 2YWDA 3LKZA 3MWEB 1UT8A 2WUFA 5HKOA 3DWEX 3LF2A 3WGMA 3S81A 1E3LA 5ED0A 2ZUEA 3GPLA 3AR8A 4OHFA 1RI1A 2VPTA 1WKBA 4KNVA 4I14A 1TAQA 4OB6A 1PQYA 3FOFC 2C58A 5F2KA 1JFRA 1RRMA 3B1WA 1DAMA 2AW3A 5C8YF 2APJA 3K96A 1N6IA 3PNSA 2IWHA 4JELA 4MTCA 4MROA 3BMQA 3I37X 3RREA 4C3OB 1A88A 2LDXA 2CK3D 2P3SA 1H6DA 1XQ1A 2NXWA 4JL8A 2JLAA 2WFZA 1M7BA 1QB8A 2HIHA 5D86A 2RIPA 5I4CA 4R41A 4UTPA 2PKYX 3KSUA 2PUGA 3TO5A 2CVQA 5FBWB 4DNPA 3UENA 2IEBA 3RHZA 6Q21A 4WKBA 2CHQA 3TSWA 1SOWA 3ZJ4A 1O87A 2GERA 2V97A 4UTNA 3I9KA 1F2UA 1DFIA 3UMMA 1MHTA 2QAGA 4WNAA 4GKAA 2AK3A 2DPLA 3A9SA 1U9YA 2GJ8A 2NUPB 3OOYA 4MW6A 4MYHA 3PVSA 4UMDA 5G4KB 4LHXA 2HW8A 1XZFA 1FMLA 4R0MA 1IZ0A 1I6KA 4KFSA 3HQ4O 4ZOLB 5G0VA 1JJBA 2A7QA 4DQUA 3CUWA 2WUVA 2EJBA 4RF3A 3VTKA 5C5IA 4NARA 1JQBA 2QW8A 4W7IA 2RGDA 4Y0NA 2O23A 1G4HA 4Y6SA 1XMJA 1LK5A 1N5MA 3PZBA 1LBSA 4OXQA 3PL1A 5FI3A 4B4KA 3V8EA 2UXDB 2JL1A 3WAKA 1FIUA 1FFXB 2ZW9A 2XYQA 3LJKA 1E1MA 4O0LA 4JJIA 3QG1A 4TPKA 3T1YB 4JLUA 2I6SA 1O6FA 5J47A 2J59A 1YZFA 1VLLA 1JDZA 3AI7A 3CSDA 5HRAA 2X4IA 4LVCA 2BRUA 3G2LA 3RJ5A 1I4OA 3P2JA 4BKPA 1J06A 4J0CA 3GLHA 1LNSA 5TSDA 3CLTD 2H85A 3O7MA 2FMFA 2C5LA 2PT5A 1N34B 1LPOA 1A9XB 3MS2A 5KOIA 1DC5A 4LOKA 2XGMA 4P4TA 1KEPA 1W49A 5HDQA 1P9WA 2XADA 3RNOA 2V3WA 4X91A 2XBLA 4RQBA 1RPTA 2P9JA 1CSEE 4P5EA 1ZUIA 4AJ2A 5H02A 1ICEA 1QUEA 1LK0A 3M6WA 3MUFA 5M29A 3UJPA 1I5EA 1IEQA 2XCOA 2A59A 1CJSA 5DHUA 3HC7A 5E7MA 3IIKA 1P5FA 1T4DA 3AG5A 2ZRCA 1BGWA 3DE0X 5BN4A 3NIFB 1Z2OX 1GFZA 1U9IA 2HLHA 5JISA 1QF6A 3P0FA 1JECA 2HGZA 3D9QX 4GX0A 3KEOA 1ZOLA 3VBEA 2WJ4A 4LZAA 3RK4A 4MA5A 5ARBA 2JCVA 1AQLA 5EZ5A 2P1RA 3GGGA 1PG5A 3O90A 1DB3A 3RNLA 1USKA 2YCBA 4CKBB 2HHAA 2C2WA 4Q4AB 5J59A 4IF4A 3CB4A 4TVOA 5C7YA 5LUBA 1WABA 4FGKA 4EJSB 5HIAA 1Q1ZA 1E6LA 4MV0A 5HX7A 3WDKA 3T35A 2GD6A 2H1HA 3P8ZA 3LY8A 3S70A 1VPWA 4EPVA 3I2FA 1JEYA 4RE6A 3L77A 4UNPA 3DBLB 3ZE9A 5B36A 1L7NA 1JL3A 2AN1A 3JYHA 3WLAA 2A33A 2BEKA 1GWNA 2J3IA 4D43A 3ETJA 2VEOA 1PR4A 3PSHA 3SX0A 1CVIA 2BL4A 2JASA 2JGFA 4GICA 3G2OA 4I1OA 4RJLA 3NQ41 5A5VA 1UBJS 5CMLA 3W79A 3BC1A 1SB9A 1J99A 2BGMA 1RXUA 5BR7A 1KK1A 4DXAA 4X45A 3EXG1 3P9XA 5AVVA 3EPHA 1KARA 2ZT6A 3BJRA 4ROSA 5IN5A 4QJ4A 4QRIA 2IVFA 1M54A 1ES9A 2P8SA 4EMSA 2PL9A 3BCSA 5ICMA 1CZUA 1MO3A 1P2FA 1TADA 1U28A 2JGDA 2ZYUX 3HZOA 2Q7XA 5JLAA 5L6LB 3K94A 4UKDA 2NU6B 1NJ2A 3HXTA 3VSAA 4XSVA 4CDRA 4D3FA 4IDBA 1MV8A 1HDRA 4YT8A 4EFKA 4QG3A 5DP1A 3C87A 2R44A 2H1LA 5KJCA 3CRMA 3R0XA 4NXMB 3B48A 5HMMA 3F3YA 1IC6A 1NSTA 3KXLA 4RHCA 1Q0LA 1TKAA 2I4IA 2OCYC 3DMTA 3FFXA 1NUPA 2ZRFA 5AKHA 5E2AA 1W9HA 1OT5A 1VPLA 1M3SA 2GO7A 2MTBA 1KPIA 2VXYA 3QX7A 1TK9A 4BNTA 3R41A 4DNQA 1QHGA 3OKAA 3URKA 1JWBB 2AKAB 4G5HA 4A2PA 2AZ4A 4OXIA 4D3XA 2JVJA 4MV5A 4A8JC 1ODCA 4I66A 4E70A 4KVAA 3ZJTA 4QTXA 1E2KA 1LTKA 3B3GA 1T9GS 4NOMA 4FHGA 2P35A 3KHUA 1RZUA 1VL0A 2VYQA 2Q3LA 2HA4A 2UYHA 1PWYE 4RJIA 3NOOA 3RM3A 2ZXEA 4J75A 4YK7A 2PWAA 2HSJA 2O8DB 2BE7A 2FUNB 5AKIA 1W34A 1RKUA 3DXFA 2C4HA 1LRKA 1S7GA 3I5AA 1JKJB 4JI3B 3TX6A 4CL2A 1GG8A 4LF4B 1SVIA 1MC4A 1NY6A 3ZHCA 1JEJA 3LV8A 4R6XA 2EX4A 4TXMA 1HORA 2PH1A 1BXZA 1FY2A 2BFMA 2NUTB 4UDYX 3WHPA 4HNVA 4CEJA 5LYJA 1WUTA 3I52A 1HT3A 1A9QA 4HL6A 3VH1A 3GZTB 3LGXA 1LKZA 1HQDA 1P72A 4X00A 4ZODA 3W2IA 3DUFB 5K8IA 2P75A 4IG9A 1S02A 2VWPA 1T5LA 4HDRB 4JMPA 2GA8A 2MSNA 3EEOA 2Q50A 1UR5A 2J32A 3VYWA 4WBNB 1ZUD1 4N8DA 1R6BX 3X1YA 3WOHA 4F5EA 3HM9A 1C3JA 1MB4A 3PQ7A 4RYLA 4YS6A 2P0EA 5T3YA 1U1FA 3LYHA 1FDWA 5F7ZA 1JHVA 2GBLC 3BJIC 1WWKA 4Y1RB 1FP2A 2BPOA 2XMZA 1P29A 4ENVA 5LP1A 4TYYA 2RK3A 4LPKA 2H4YA 4ZQFA 1JEAA 3ECSA 3AF4A 4OLBA 2LD4A 2IEGA 4E5PA 3IQEA 1ISFA 2WWRA 2N3ZA 3TRIA 5J1TB 1JIVA 2L69A 3I83A 4ZV9A 3H2JA 1J8YF 1U11A 2W2KB 3UA3A 4ERNA 4X95A 4Z51A 4JUAA 4QLAA 2O7SA 3ZH9B 1YBAA 3PLRA 1S1CA 4C7KA 2YHSA 3B9BA 3I9MA 4OHWA 5T67A 3UYKA 3VU3A 2Y6VA 2WR8A 3SVLA 2UYQA 5IUJC 3VM6A 2ZUUA 4ENPA 3GMIA 5AUNB 3VPAA 4OQNA 3OHSX 1OTXA 3UMBA 2MDTA 1RWBA 3O6VA 4QODA 1XCPA 4XUEA 3FJYA 3QVKA 1ZNYA 4DLVA 2QPLA 3ND6A 2HSEA 4KE9A 1SGWA 1FCJA 2QRMA 3EZNA 4DA8A 9GPBA 4MDFA 2CJFA 3H9UA 4W1PA 4HEJA 2JEYA 3B6JA 5AK5A 3FZGA 2OOSA 4G8BA 1HEYA 4CKWA 3KKNA 3VX3A 1TK3A 3GP8A 2WPDD 3LPCA 2ENWA 1PQPA 3F4BA 4LY9A 3TN7A 4MMXB 3ETHA 1L5MA 2R1ZA 4KQHA 3LLCA 3RUFA 1WEKA 4QG7A 3DSRA 4HZGA 1TQ6A 3IQWA 1O96B 4PAOA 1BYIA 5DBIA 1P3Y1 4QDXA 1TJ5A 1VE7A 2HA3A 3Q6IA 4N0MA 3I2IA 1FMTA 4HPXB 1QO9A 1XE3A 2D74A 2KMLA 3VNRA 2AJ8A 2AOWA 1HNWB 2ADOA 3JQ9C 3NDJA 3JQ6A 1XCOA 2JW5A 3GRZA 3ZNQA 4DG9A 4ZGGA 2PUEA 3EVZA 3RH0A 3UHJA 1P31A 1QPZA 3HDGA 5CAEA 2FMTA 3MILA 1F3LA 2ZSBA 1E2BA 3EUFA 1L1EA 1W0KD 3UK1A 1MJNA 3TIGA 2WVJA 5FTMA 4BDSA 4D9FA 4JWKA 3SQLA 3CPJB 4A16A 1E9AA 3LFUA 4U2KA 2FZLA 4V0NA 5JS8A 1SKMA 4GLOA 1PE0A 2GSDA 3FAZA 2ZETA 3JQPA 4X3OA 2H4WA 1FNCA 3D2AA 4KIUA 5F3WB 4FSXA 1JR3E 5EKUA 1O03A 3S1SA 1QG6A 4DV7B 5E6UA 4HX2A 1F5SA 2BE9A 5JFTA 3FGNA 5AR1A 4XIJA 3QVUA 3BSSA 1FJXA 1O89A 7REQA 3HZRA 3TRJA 1QAOA 1T4CB 1XQXA 2HM7A 3JQ7B 4EF5A 4O4JF 5GGYA 4OGFA 4FFNA 3ZCVA 2XUIA 1DDGA 2P6OA 4LRXA 2WF9A 2B5WA 5BMVA 2VQDA 2G36A 3GUYA 2ZREA 5BV1A 5LA6B 3GLGA 2IH4A 4YRSA 2AFIB 1G16A 2O57A 1Y7PA 4N48A 3SKXA 4FNOA 4B7XA 4R1QA 3HKDA 3GPIA 3BS4A 1QH0A 2FY8A 2ODNA 2WSYB 3B6EA 4L6CA 4G0WA 1E2EA 1NYRA 1KDYA 1IY8A 4KQMA 2ACWA 1N77A 4N7MA 1MAVA 4RZHA 3GFRA 1JAYA 3ROTA 1R00A 5MN6A 1R6VA 3AETB 2IYPA 4HVAA 2DHQA 2NXNA 3EXIA 1UM8A 1YRHA 3FKSA 1YDGA 3PUHA 2LP4Y 1O9BA 4R69A 4S2UA 4ZCMA 3M1YA 1UBLS 1NRIA 3CSSA 3U4HA 1ZDMA 1E2FA 1QV6A 1RAIA 3N87A 3RS5A 1EWQA 3OQ6A 1NVGA 1XTPA 2DMRA 2ZJ5A 3HMKA 1IYZA 1G7RA 4PQGA 1DC3A 3BDAA 2YWJA 5KYWB 4GYYA 1HLDA 1U1CA 3CISA 1WQ1R 3GDHA 3MTAA 4XW2A 3U9SA 4E5VA 4FXPA 4MDEA 4J9VA 5AVUA 1DP4A 2FLVA 2ZJ0A 3DJFA 4G5QA 1ULAA 1ZJ5A 3SFTA 3ZYCA 7YASA 1K8ZB 3WB1A 4CMCA 1QKJA 5HK9A 4KXVA 5LLDA 1G8SA 1J97A 1JSCA 1TF2A 1Z83A 2F43B 1RWMA 1V8FA 3B89A 3VC7A 3WMGA 2B0CA 4AWBA 5AUQA 4I9UA 3NONA 3ZWBA 1NBOA 2IHZA 3F6SA 2Z09A 3KJIA 4DT1A 1ISSA 4P86A 3QE9Y 2F1KA 5I7VA 2C94A 3M5PA 3OKPA 2E4YA 2PGNA 2Q4OA 4W82A 1K08A 3L9XA 1E3WB 4L3WA 2NU8B 3ZHVA 3CLSD 3BE4A 4KU4A 2SNIE 1E6EA 3L1KA 4KQXA 3ESBA 3QLUA 2A4KA 4X20B 3WMWA 3CIOA 3N76A 3R7FA 3VXKA 4LRWA 4NCKA 1EXDA 1RYMA 1IXSB 4EHFA 4BZWA 3C98A 3E58A 1P44A 3ESRA 3GWGA 4WCFB 4AL4A 4H0NA 4DUGD 2V6MA 1IN6A 1RR6A 5BY2A 1GP2A 3L43A 3GJ6A 1E2QA 4HMQA 2NTJA 2Z5VA 1QC5B 3MTGA 3WIBA 3SQWA 4O2BF 2ZWIA 1P9RA 2OE2A 1E9VA 3LOPA 4QUEA 3NI2A 5CLIA 2DKFA 3H05A 4NFHA 4TLDA 4WKOA 3N59A 3BREA 4E08A 5KTNA 3GAFA 4NLLA 3AEXA 1TLLA 5TPZA 3IEIA 4P6VF 3BHNA 3A27A 1WHSB 1GTG1 2JKZA 2OV6A 3AZPA 3PGXA 4MKIA 2C2BA 5LZ8A 1EA7A 4ZCTA 3TNLA 5B1DA 5LQSA 1T36B 2PRIA 3VYUB 5ARCA 4QKQA 3A4LA 2OLEA 3GEIA 4FFDA 4BIIA 2XE8A 4UD2A 2NACA 2HR1A 3V7UA 4RGYA 1XA3A 4BLOA 3NAMA 4EEXA 5MDHA 1VG9B 5FBVB 3AV3A 2HZ7A 3C39A 3FPKA 2WUDA 4B17A 4PO3X 3UHPA 1R5OA 2V5VA 2AW5A 2CNLA 3BORA 1CDDA 3Q6MA 1ZAYA 2MYNA 4PGFA 4FWIB 1EUDB 4KDRA 3BIJA 1G63A 3AIIA 4Q1EA 5EWLA 3T7AA 3A6FA 5KOHB 1H4SA 2QRZA 2ZS7A 4N7RA 4NBSA 2P6MA 2VJAA 3VVCA 4EL0A 3K0SA 4WY8A 5ESXA 4QGAA 2JBWA 5BYBA 4G0YA 1L5SA 1IPFA 2C0PA 4BRWA 1TAGA 5C5EA 1V26A 1JSLA 1GGEA 1VKJA 1AS2A 5HF6A 4EDFA 2GZAA 4WZBA 1I5OA 3UV7A 7MDHA 3QEMA 2OB1A 4OBXA 2B4TO 1EFUA 2BDUA 3IIIA 2MIIA 3TGLA 1QAMA 1KYQA 1RJ9A 2GZHA 1GVNB 1E61A 2BGGA 2NIPA 3LDGA 5P8WA 3SHQA 3W7VA 1WXQA 3G0BA 4KV7A 4ZCSA 3PUXA 2DT5A 2IYUA 3WB2A 1QGAA 1XMXA 2QMOA 3QPUA 4HLCA 2GCEA 2PVCA 5D87A 1KDVA 2GLXA 3SKVA 2FP4B 2EVWX 4WLEA 5LFAA 1L4MA 4C6RA 1ZQ1A 4U7GA 1R6UA 2PH5A 1Q7BA 4LK2A 1O0BA 4WJZA 2MWMA 1CWUA 3PC8C 3VTFA 4AZ0A 1AGNA 1N7GA 5JAOA 1NHWA 4D4LA 1I33A 3SSAA 3TNJA 5CIWA 4JXZA 4RC9A 3II6X 2ZULA 3H1FA 4KJZA 1KZ6A 3NH6A 3WHIA 1WZEA 4RXUA 1IIRA 4W8OA 4QT4A 1CJKC 1ULTA 2D0OB 2XQGA 4OU4A 2FUEA 2RARA 2NXCA 4RD2A 1Y8AA 3T5GA 2Y99A 3BGWA 4FD3A 1E1KA 2JF0A 4QVKA 2GPSA 4IIJA 1V16B 2GBFA 4TM8A 5JJCA 2JFHA 3GLFA 2OBMA 2WJPA 1BRMA 1M2OB 3KCQA 1VLVA 5EJIA 3N7UA 1WY5A 3EDYA 3GJZA 3X1KA 4TWIA 2H3EA 5KOJB 4IDDA 5CCEA 3CKLA 4DXHA 4D97A 1Y3AA 2EBUA 3KLOA 4K0KB 1NXTA 2FEXA 1RCTE 1BE8A 1DOHA 1TT5B 3ILVA 4RIEA 1YK0A 4RKQA 2I4LA 1QYDA 2KHZA 4DR7B 4IJWA 1DI0A 2LWIA 3ZWAA 3K71B 1E5LA 1S3FA 4C6HA 2YWXA 3F1LA 3OAAD 3GEMA 3EH2A 3PQ8A 4IQ4A 5E0KB 5FBQB 3NYWA 3TTTA 4K2AA 2WYIA 3KKPA 3URMA 1C4WA 1KJWA 4QXPA 4Q3NA 1W4ZA 4IYJA 1GPAA 4O8ZA 3VZCA 5HOEA 5SZHB 4KWCA 3OT5A 5CDUA 5F33A 1UMDA 2DU8A 4LOLA 5D3MA 5J1SB 3OCYA 4FZ3A 4L27A 3O1LA 2ZFUA 3QSGA 1H5NA 2C2KA 1CX9B 2HEGA 4G07A 4M8KA 4MW5A 2R79A 4UTOA 4BNXA 5BPFA 2DLCX 4O0MA 2GEVA 5JPDA 2WAAA 2O19A 1P3JA 1IOVA 3ZZ1A 1EVKA 4N5DA 1OAOA 1OI3A 1ORRA 1X7YB 3K8ZA 4GHWA 4OIMA 4RMHA 3I6IA 1JR2A 1DAPA 3OUUA 4MH0R 3KDSE 3KZVA 1FVHA 3R3SA 1E5VA 1LF5A 3FWNA 3PGMA 5F9MA 1GZVA 2CZCA 2R47A 3NBZC 1KFCB 5SY6A 1KEWA 3NATA 4X60A 4BVHA 1E89A 1WL8A 4ZYVA 3VO2A 2ZJ8A 1N1GA 1CDZA 4KIFA 2I1LA 2I0FA 2ZZKA 4FCCA 1TVKB 4QEZA 4EHKA 1JYSA 2HK7A 3ECCA 1F12A 1NXVA 4JWTA 4ZCLA 4K9LA 5IKPA 4XIFA 1F0YA 1W19A 2EFCB 5ICFA 2B30A 3K6SB 1SXJB 4EGFA 5JWRA 5JCOC 2OVBA 1SZPA 1EZ1A 2XQFA 3H13A 3OWXA 3BUSA 3TZQA 1XTQA 1UDRA 2WABA 2ID8A 2XUHA 3QNUA 2B5OA 2OTCA 1C4XA 4KI7A 3KJFA 3K2QA 2TMDA 5ADVA 1OUMA 2HA6A 4TMZA 5AI6A 3W5AA 1KTVA 2ZB3A 3AHIA 2PYZA 3NUZA 4L8YA 1SOMA 3TXAA 3GFVA 1M0WA 3P9KA 5EPUA 1O3YA 2J9FB 3HUFA 2XYRA 3CBQA 3SEZA 2FSSA 3C3DA 1RP7A 1Y34E 5T64A 4ZJYA 4CG1A 3GO4A 3CUKA 4URWR 2AV6A 4W1RA 1GJRA 3H2HA 1L5VA 2DJIA 3KXIA 1UODA 3LT5A 1GLGA 3HFJA 1NU8A 3HYNA 3T34A 4JIGA 2LCIA 4DR2B 1FJHA 1WKCA 1EH5A 4ZIRA 5I4BA 1Z4LA 1ODJA 4ZTBA 4BFWA 2X23A 3KFVA 3LA8A 4EYKA 5DBEX 2GO1A 4UUBA 4S1PA 4YDRA 1YH3A 1CY0A 4UTZA 2VXOA 1ZESA 1Z7GA 3BSYA 2E0IA 3A0RB 3S8MA 5KVCA 1CUWA 3ZZNA 5BR1A 2JGMA 3NEJA 4DEVA 1H8ED 1QG0A 2FR1A 1ZH4A 2JH3A 2PIAA 3IHKA 4TLLB 1AVTA 5DT9A 4IQ8A 5AVOA 2HMAA 3K09A 5AK0A 2NPOA 4G1BA 5DASA 1XRMA 1VTKA 1KR5A 5I9MA 5IAOA 2UZ4A 1AKYA 5AW1A 1G66A 2XIQA 4LZPA 5DYGA 3H1PA 2PQMA 1BQ4A 3IDAA 1NUAA 1N1DA 1OXTA 4FFLA 1H9AA 4Q3CA 2XE4A 4X94A 1SIOA 1WSDA 1NXXA 2ZUVA 2OV1A 1UQTA 1R88A 2AI1A 4E51A 1WPXA 5DNWA 1CY6A 1U2DA 3JQBC 4PX2A 5AJXA 3CNOA 2BI7A 1Q1QA 3LCVB 1Z3IX 3CWQA 3ZHUA 4XAQA 3TB6A 4DR3B 1FUYB 3EBOA 1B3RA 3O31A 2GFQA 3IKVA 3K92A 3PCRB 5A4MS 3QBTA 2XPCA 3BE5A 4QOIA 4C4RA 1N2HA 1BXGA 2FR8C 2PS3A 2XOXA 3MTDA 3EEIA 2FPSA 4JP5A 4NBTA 5COAA 5DOVA 4TYWA 2HLPA 2AX3A 2OO7A 4P93A 4YRMA 2HU2A 3OQMA 3T7KA 4X7BA 4Q82A 3DWIA 5FPTA 5DGDA 5AM0A 4HDKB 1HTWA 2O7VA 4HLUC 4OGWA 3ROPA 3P5SA 3GLKA 2R7KA 1XEWX 4F11A 4M2LA 1GXSA 1V8OA 3PHCA 1OLUA 4H31A 4MKGA 2SICE 2XYHA 1LBIA 3ICWA 3IVRA 1DDOA 2O2YA 2F67A 3H9EO 1Z0UA 1C4OA 2C54A 2FSVA 4ZVVA 1R8SA 2AL7A 4NCXA 2C7PA 1ZITA 4FFMA 4IUBS 4DIOA 4TTSA 3UAGA 2EZ4A 1KO1A 4NBRA 3SS9X 2CNNA 1LWOA 3O4FA 1OLXA 1MENA 1UZUA 3IMCA 2ZT7A 1ZRSA 2ECPA 1W5AA 4RXTA 4V0QA 4GRAA 3RKRA 1ZNXA 3VKVA 4B4DA 2F55A 3C6QA 4G1CA 2V7TA 3E8SA 4WRRA 3Q41A 4R2LA 1L7PA 1GRCA 1P1KA 4WK2B 1K5HA 3N0RA 4V03A 2DBZA 2ZWOA 2J7KA 4AY6A 5B37A 3VR4A 2ZI7A 4XEUA 3DTYA 1E58A 2V54A 2VPQA 2WPDA 3GJTA 3EEFA 4ZI7A 4PZZA 3GEPA 2H5JA 2GHTA 3G7UA 1X1TA 4PGMA 3GEBA 5CU7A 2KYRA 4FSHA 1O1YA 2E9SA 2AB0A 5CNIA 1SCDA 2XDAA 2WJ6A 4R2HA 2B7CA 2Z83A 2IOFK 3DDWA 3TD2A 1K06A 3KV3O 4BNIA 2GEUA 3ILSA 4CRWB 4CIXA 4HZUB 1GPJA 5H83A 2IYFA 4Y2QA 1SU6A 3KZKA 4IV8A 1TIPA 1X0VA 1EP2B 4YWJA 2PR7A 1VKHA 4QE3A 3PXUA 4WPGA 4RMGA 1PZEA 2IW3A 3L7MA 4HH4A 4I0WB 2E6UX 5B6JA 4NJOA 2NO9A 3T3HA 2P9YA 2D7DA 2ATIA 1E6KA 1KI1A 2E4UA 5FPSA 2F4VB 2FU5C 2RH5A 2F9FA 3CZAA 3G8BA 3K31A 4GMHA 1HRDA 4PM4A 3VYVA 4L0MA 1C3LA 1HE3A 1WHTB 1RAGA 4GYKA 2PBRA 5ALVA 3W5CA 4PHGA 1I4DD 1YWGO 3FY4A 2H7YA 3FB1A 1KEUA 2DTXA 4F3NA 2A5FA 2FFJA 3CJRA 1UOEA 1EFHA 1USWA 4I4TA 3ZWCA 4DUYB 3I2JA 3FPBA 4JI8B 4JAVC 3VZBA 3ZE1B 3BHJA 2HMYB 4J90A 3B51X 1QQTA 4J4TA 4ND2A 3CMMA 2YIJA 4N12A 2VJQA 3OEHA 1NVVQ 5E1DA 4C43A 3PQ2A 4IHJF 4B48A 3OZDA 5EQDA 1KOLA 1VE1A 3HH8A 3LBHA 1UFKA 2FQ1A 4W7HA 5D3ZA 4LQDA 4MHSA 4QASA 2B7BA 1JDNA 3E7DA 4KTTE 3CVXA 2D54A 3M81A 3PDUA 4OGLA 4LJ6A 1GZ7A 1P4SA 3G17A 3DZIA 2OAP1 2IE8A 3DTVD 3BKXA 2QMYA 4LKRA 1CS0A 1PL8A 4YCBA 2W2NA 4EB6B 2NUBA 1P2GA 1T9KA 1U5BB 5IZCC 2WSLA 2GN2A 2R4TA 1PUIA 4IX1A 2AOXA 2E89A 4E12A 3DKIA 2O8FA 2ZUTA 2PSJA 3GD5A 1NMXA 4YBRA 4PPYA 1KA9H 4RTOA 3ONDA 2DPHA 1V3UA 2O1WA 4JGIA 1N2XA 5CH3A 3GNTA 3IKTA 3ML1A 2ZI4A 2PD3A 4WNIA 1VSTA 2H5EA 5FEMA 4U7TB 1NKSA 3FPGA 4DCCA 4O59O 4URXR 4BNMA 1JX6A 3MUEA 4MQUA 2H16A 3QVWA 3CVOA 5U9CA 4PICA 3LQRA 1ZLXA 5HF8A 2A8YA 1RPNA 3LRPA 3Q3GE 3T1VA 4O3MA 1Y3BE 1P1RA 1YAJA 2ZB4A 3BB4A 5D00A 4PWYA 4MRVA 4X8HA 1P0IA 4L74A 1ZW6A 3QEAZ 3TL6A 2P6RA 5K8CA 4XDYA 1NRXA 4HAZA 2ZVDA 4ZVUA 4A0SA 5L3QA 1ZVVA 5G02A 5EJ9A 3O7WA 2OQIA 3SI7A 2J5RA 1BW9A 4BS9A 1PYOA 5FT9A 4FEAA 3LC7O 4EI2A 2CL7X 3PPYA 1FQKA 1ZM4A 3ZJ5A 3IKJA 1ZCFA 5DTIA 1J9GA 2CBZA 1VI5A 2WMNB 4IDAA 4CQLB 4F6LA 2VSQA 4ND5A 4UZFA 4N0QA 3RUPA 1T3SA 5GONB 4ZOBA 3NHAA 2W98A 2P30A 2JCBA 2AZTA 1VBMA 4LDPA 1OF1A 4O33A 4YMGA 1G20B 3ZE8A 3H5WA 2F9LA 2Y1XA 3I6ZA 2HYIC 1O97C 4DR1B 4QU9A 4WOPA 1Y3DE 3V5NA 3LWNA 3NIGB 2B4AA 5BSUA 1H2FA 1A2QA 1NWCA 2C4WA 3WMRA 4E31A 3W5IA 1UPXA 1F9AA 3CN7A 4Q7EA 3K7EA 4TXNA 1Q7EA 1PDOA 1EFPB 1GEGA 1Z18A 4M60A 3TIIA 2WM9B 4BEVA 5CX1B 3ZKWA 2VSNA 2Y1EA 1U3UA 4LE1A 3OT1B 1KORA 4HUJA 4IPTA 3OE5A 2WSMA 2BCJQ 3D8SA 3QYJA 3VR2D 1ZPDA 1LBHA 1P2BA 4F3CA 4YRJA 3T3NA 5DX8A 2A57A 2WKQA 3RYCA 2BIFA 1JJFA 1R1DA 4GZMA 4KDEA 5KCMA 3GJ4A 5K8UA 1KZ7B 1DS6A 3KL4A 1E2NA 1LPAB 1OZGA 3FMGA 1D9ZA 3R5TA 4BAUA 1WDWB 2UXBB 1XXHE 4BEJA 2GM4A 2ZJYA 3T1QA 2IU0A 1M76A 2Q1SA 2BGUA 2E4ZA 3PS9A 2P4EA 3JALB 3K15A 1QS0B 4GMGA 4Z4HA 1JHAA 2W6MA 4IXTA 1TLTA 2QJOA 4P4LA 3EWNA 4B6PA 3NDIA 1R6TA 3EF3A 3G9UA 2XMDA 3EOAI 2VKQA 1ZH6A 1JKFA 2G1AA 1Z7EA 2HHJA 2Q3BA 3WB0A 2PGLA 3O95A 3RR2A 4OSEA 1DWUA 2QY6A 5IFKA 2Q0QA 1X94A 4G9EA 1JBEA 2DUMA 1XK6A 4AG6A 2O2JA 1GNTA 3AI2A 4B6SA 4PG8A 4BB5A 2Q8PA 2A9VA 2NZWA 2R1TB 4EVIA 4ESVA 1T3ZA 3ZD6A 1JAXA 4JKYA 3JWEA 1JPJA 1VLQA 3GVCA 1YKGA 3QOYA 1DOZA 3KR2A 4WDQA 2IHJA 3GG2A 3DO6A 3A3PA 2UXCB 2EFEB 4DIDA 2I2WA 1QOZA 1R6AA 1JIUA 2L17A 3TUJC 1LNQA 2GPWA 2Q3CA 4OP2A 2R6JA 2BBWA 1Q1BA 1R0ZA 3IRUA 4DLLA 4X63A 4WEQA 1C3VA 1NV9A 1SKYE 2VDVE 3G8DA 3GDWA 3PGJA 3DHWC 4YP9A 1E9FA 3KBOA 2NO5A 3C5HA 3FJOA 4KXLA 5BQ3A 3K70C 4FDVA 3PGVA 3FF4A 5JC1A 3UB4A 3V80A 2HADA 1MQSA 2PSHA 3ENZA 4ETIA 1QU3A 1RDFA 4UPDA 4D8YA 5DRTA 1Q0HA 4EAAA 1BVRA 3WKBA 3DPIA 4DCVA 1JRLA 1VSBA 2Q5CA 1DNPA 3DE6X 1XJCA 3G1WA 3W8FA 4H6PA 1QB7A 5LOVB 4OFZA 4ZHQF 2EQAA 2Z1MA 1Z12A 4XFJA 4Y2TA 4MHTA 5DHTA 1ETUA 4DMHA 5D6NA 1VIAA 5EXSA 1KH2A 1YB1A 3SM3A 3X1ZA 4TL9A 2PBFA 3TTYA 5LM3A 4TSRA 1KAMA 3FWHA 4KFCA 3PWTA 4B81A 1DRVA 1B8PA 1LWNA 3DYIA 3A58B 2PFGA 5EP1A 3WO1A 3JAKB 4ARCA 1G8PA 3IFSA 2NNWB 5GM2A 2DWUA 2B8JA 4PYMA 2P9HA 1B7GO 4LW8A 3H2KA 3L04A 4FMBB 3RVLA 3UK2A 5LU9A 1GV0A 1OYWA 4BNNA 1Z4PX 1Y9AA 4CCAA 2ZSEA 2WRZA 3A4VA 3I8XA 2P41A 1EBUA 3RG2A 3F47A 4FDTA 3I6YA 1O95C 1EX1A 3OCUA 4YT2A 2AOUA 2NZXA 4MV9A 5AK4A 1DLIA 1A3CA 4Y0VA 4CLHA 2GNOA 1HYHA 3HPQA 1THZA 1LPSA 1VHDA 5CA1F 1ZJZA 4AF7A 2PCLA 2QQFA 5IDQA 3VNSA 2QD3A 2YVKA 4QIHA 4K0RA 1XAHA 3AJDA 1YC2A 2HIGA 3AINA 4KQGA 1J9ZA 4ZCPA 2EATA 1SQFA 2G83A 1HA3A 1PFQA 3V4LA 4MS3A 3RWMB 3HK2A 2OV8A 1M0TA 3LZDA 1Z4MA 3NEPX 4R2IA 4FU0A 4MWGA 3FKJA 1A9PA 4HFJA 2FZCA 1I7DA 4KRFA 1KQFA 1JT2A 2Y3IA 4ACAA 4YUXA 3HVRA 5HCIA 2C7VA 4MO2A 1UEIA 3RWBA 3V32A 3FPJA 3OU7A 3ONFA 2DWQA 2P3LA 1MGPA 4KE8A 1TIBA 5HKLA 4A5SA 1RJFA 2HJ9A 2XNHA 3B1FA 2QSYA 2HB6A 3FGOA 3O75A 3OZCA 4LOAA 5FNVB 4MK4A 4E3WA 3NASA 5BOVA 1RQ2A 2BHTA 1TPZA 3L8ZA 3IR7A 4MGYR 4KR6A 3I6MA 4XUDA 4GBMA 1TTTA 4DLNA 2PX8A 3F1KA 1XDDA 5CJJA 2BSXA 3PC3A 4YA6A 1R8JA 5E2IA 4DZTA 1AK1A 1JLLA 2R97A 1P81A 5ABPA 3O8CA 1FVFA 1NKVA 3L4BC 3MBIA 1P33A 4RV4A 3QKSA 5HTKA 1Z45A 5K6AA 2HMVA 3U62A 4R2XA 4DS3A 3FYUA 3SE0A 2HUPA 5JXIA 4BVLA 1U5AA 1XDWA 2R11A 1G4UR 3X2EA 1II8B 3WK8A 3QI2A 4M9CA 3DZGA 2ZIWB 3NFYA 1RS0A 4BBAA 2RHTA 2XQIA 2HF7A 4TWRA 3RRFA 4F92B 3REFA 3ZY5A 5C46F 3U5ZB 3TLMA 3EMBA 2A1UB 1WIWA 4P7JA 4I3GA 3UGQA 4UJ3A 1EP9A 1TD1A 5CYFA 3E23A 1DUVG 3OIFA 3L1UA 4IS3A 4FMCF 1L8LA 4BTEA 4H1HA 1TECE 3AU8A 1OR8A 4KKVA 3C7AA 4MV3A 5K5EA 4IOJA 3VH4A 1P7YA 4OBBA 4QFMA 2DH5A 3VVLA 4BO1A 1K8RA 1STOA 4D9GA 4F1KA 4A4DA 4F96A 1DAOA 3EWIA 3UN1A 3EIXA 4CG0A 5E4FA 4MUYA 1JR3A 5H0IA 2ST1A 3CLRC 3ZK8A 2GR9A 2AHRA 3ND5A 1EGQA 2O59A 4OKSA 1K3UB 4KLNA 3FZQA 3EY9A 2M6LA 1XDSA 1HDXA 1PWZA 3AHCA 4GI5A 4EKGA 4PTYA 4YJ2A 3THWA 1KMHA 5IEJA 3QV1A 3KB6A 3PHBE 3TTVA 3LHKA 1PEKE 1TF5A 5BWBA 3AFNA 3GROA 4NYMR 3VV3A 421PA 4C6TB 4QLOA 3TAUA 1WVGA 3S2YA 2MT9A 3N2EA 3EF0A 4I08A 4KQ1A 4M1EA 2PKQP 4MS4B 5CVJA 3BB1A 1GPUA 2WBLC 4IIYA 1YR8A 2NO6A 3FZEA 3NJ4A 2C57A 2QB5A 3DCJA 1LF0A 3HA7A 5KQRA 1P4RA 3R5JA 3VBCA 2GTHA 3HRKA 1TM1E 1H8EA 4QPDA 3FCSB 2CXOA 3B20A 3VMFA 2PCJA 2X5KO 1GLNA 3RVQA 1D5CA 4E7PA 4NE2A 4N0EA 4UAJA 4D9EA 3HJRA 3GP3A 3A9UA 3TQQA 5KX5F 1IOZA 1G8FA 2HXYA 2YN2A 3GAZA 3PUKA 4XR4A 1QM5A 3W7AA 1KI6B 3A6EA 3HCBA 4LXUA 4RANA 4UUQA 2EEPA 3ER6A 1NN3A 3ON5A 3OUTA 4HUQB 4N39A 3SHOA 3TW8B 2QN2A 1K4KA 5DDIP 5FV4A 1OB5A 3R5SA 3W5UA 1Y7TA 1U2QA 3H1GA 5EZYB 1AB6A 2Q62A 4BLSA 3LX4A 2F3SA 4MVJI 1YS6A 2YJTD 4YUWA 2QDKA 4EY5A 2C2MA 1P1FA 1TMKA 1VHQA 1ZWLA 3DO5A 1SA0B 2EBFX 4EG1A 3BFJA 1U0JA 4XGQA 3WO0A 3DTTA 4R31A 1XPJA 4PPFA 2IUSA 3GJ0A 4TVBA 1ZA2A 4X0EA 2NSLA 4N01A 5ALUA 4A9AA 2CLIB 3HP1A 5AKZA 4WJKB 3JTMA 4AD8A 3FTFA 5JCXA 2GRUA 1X42A 4L8WB 4KWTA 4CV2A 2A1TS 2FZVA 3C2QA 1DWOA 2X3YA 5HWSA 4R2WA 4X9XA 3GB9A 4EW1A 1QHYA 2VDUE 3JZFA 3LO8A 3V4ZA 4MUNA 2YS6A 4NBVA 5ALPA 1V71A 2FWMX 3IUBA 1JILA 3L3BA 1DKUA 4KFTA 4ALIA 2Q6KA 5FOWA 4ZYTA 3B1KA 5JVDF 2ZTHA 3JPYA 3EIFA 5MF6A 5A4FS 4NU6A 2AVDA 2CNKA 3LG2A 4DG8A 5CH8A 1UPCA 2G6BA 3HYLA 3OIDA 1G2IA 4UOZA 2OMEA 1FBTA 3QXGA 4IXWA 1IUPA 3JQ8A 1YR1A 3GA0A 4FR5A 1R18A 3T3PB 3ZPXA 1TYZA 1GCOA 4LPSA 4BTVA 5BORA 4WXRA 1ZK4A 3TOVA 3BK2A 3BA6A 2IV2X 3TSAA 4D96A 1VL6A 3MELA 1RHMA 1YA4A 1B2LA 1Q3TA 4ZO4A 4LQ4A 4V1CA 2YHIB 3CLVA 3OQ1A 5EYPB 2B35A 2QN9A 4JR2A 5EMJA 4IZIA 5GAJA 3FYTA 1Q0PA 4FM9A 3E8MA 3OFNA 3MGGA 1U2ZA 1BOFA 1LY1A 1BH6A 1RYEA 2CJWB 2OCKA 3M5DA 3IAHA 3MFQA 1LZLA 3M6LA 4OU5A 2JCGA 3W8EA 2CDCA 1CUSA 4KUGA 1I32A 4R3WA 5BWCA 1YKFA 2PYIA 3IEMA 2VC2B 2XCRB 3ITDA 5JPCA 3GLIE 2V0CA 4DWVA 3D8NA 4R0NA 1P0PA 1TGVA 5TPWA 3SF0A 2FMUA 3VPDA 1E6CA 2W6NA 2VDNB 3A2LA 4RVFA 5JMTA 1Y8QB 2FPIB 4QUGA 3VHLB 4WVLA 4LMRA 4H3VA 3LLVA 1O2DA 1ZL2A 2C92A 2HC9A 1QQ6A 5JWHA 1QE3A 1EBBA 1RKQA 3CNQS 1AXRA 4V3BA 4QLBA 3V7WA 4QFBA 4URUR 3TLXA 1Z68A 1L5HB 3AEUB 3IPCA 3GFGA 5AXAA 4QQNA 3NT4A 2IPXA 3U7FB 1NQ5A 4PSKA 4C05A 2XRZA 1NBAA 1SK8A 5FUMA 1VQ1A 4UEOA 4Y1EA 4LYYA 3WNCA 1YZYA 3I9FA 4C4PA 2SHKA 1TZ2A 2VYFA 1FRQA 3FWPA 4GPD1 1FFYA 5CJ2A 4LFBB 3DQZA 1UC9A 2OV4A 3C6MA 4O4LB 5GZ3A 4IBOA 1XZBA 3CO5A 4RLFA 5KREA 3AF0A 1J1UA 4NKRA 4PLWA 2XTNA 1QZTA 3FPAA 2ZM5A 2VRCD 5P21A 4P4GA 3ZX5A 5IVDA 4DC9A 2J46A 5A3VA 4B3BA 3QUQA 1XPRA 4NMHA 4XWTA 4EQ6A 2FXVA 4HNSA 4OFXA 3VFDA 4URFA 3TRHA 1SKUA 3I9OA 4XB1A 2I6GA 1BVYF 2N1MA 2WNIA 2HT1A 2ZSJA 4F71A 3DTVA 4ZVQA 2YIDA 1Q3HA 2YMLA 2XNJA 2AOTA 1XQWA 1POWA 2P91A 5I9SA 2Q3FA 5JCPA 2HA2A 1YHNA 1FUEA 3OIWA 4NHEA 3N07A 1YTLA 1M1UA 3JYPA 1BMFD 1L5RA 3BRCA 3V1NA 5ALXA 4TLEA 5CLHA 3FG9A 3WDSA 4PIMA 2V8OA 3JQEA 2QR2A 2VJBA 4X1YB 5JE8A 4HEA1 5H59A 4HRXA 4X1IA 4DRYA 2JI4A 4CMIB 2RHDA 2W2PA 3D02A 3P32A 4B35A 4C3ZA 2V3CC 2VZ8A 4U2DA 4JC8A 1WTAA 3LPDA 1SKBA 3BQMB 5FYDA 1W5FA 4I81A 1N9GB 3IP8A 3ZNNA 4OY3A 1E2PA 3FUXA 2PSEA 4BMVA 4CIDA 1MTOA 5A2GA 5BVHA 5IFLA 5KSWB 4S24A 5IDXA 1SG6A 1EX6A 1Z6ZA 1YRYE 3T52A 4EVSA 1AKEA 2PYDA 4FJ2A 4XZ3A 1NC3A 3EQ2A 3H7IA 1BSVA 3JX9A 1Q16A 1K4MA 1QHNA 1M1ZA 1XYVA 3KVNA 2FDRA 3JQGA 5FXMA 4D9HA 2TMYA 2I29A 2WQZA 1J1IA 1CUUA 1U0FA 2EOAA 2WMYA 2FPKA 2VHVA 1LFDB 5E3JA 4N5IX 1ZH0A 1Q0ZA 4PFJA 3N2KB 3NBKA 1SM4A 2N9UA 4EHDA 3N9IA 3WKAA 1GITA 2Q4TA 4OI0A 2P5SA 2I2DA 4LY3A 2PH3A 4WLOA 3OSZA 1Q57A 2F17A 4P80A 3V4OA 1BKDR 2LE0A 2G5TA 3NB0A 3ZV5A 4AUEA 3O03A 1P2TA 3HXPA 1FFSA 3LUJA 1RP1A 2FWAA 1RXYA 4JBIA 5CYGA 3SLKA 4JEUA 3KZOA 4QOSA 3VZQA 4AZ3A 521PA 4AY2A 2NO4A 1ZIXA 1MVNA 1Z7WA 4M86A 2PO7A 3QXSA 4GZ5A 2I4RA 3PE6A 4B3FX 4OHZA 3RTAA 5BNWA 2VP0A 4R8LA 1U2GC 2VEDA 1PHPA 2KS6A 1CXZA 2RBKA 4FILA 2Z5LA 4H4CA 4N03A 1T8SA 5KQGA 3SM9A 1EFRD 1GN9A 2L82A 1RBYA 2QS9A 2WI8A 4FHZA 2OXRA 2ZI9A 4NRDA 1QDLB 3NGMA 5BT9A 4DTCA 2G4LA 4HEHA 3K32A 4MIOA 2YY5A 4QTUB 4KVFA 3V3TA 1XRJA 3E4DA 4LVUA 4Y2RA 4PG6A 3NP7A 4M21A 1MQ9A 3QELB 4ND8A 3EAFA 2CLFB 1WMEA 2PL1A 4INOA 2PUJA 1BGXT 3UGJA 4HDOB 4KXQA 5H5JA 3JCZA 3IPRA 1CRWG 3N39C 3VR2A 3NHSA 4A2CA 5KKCA 2HSZA 4G5SA 1W76A 2VWQA 1M1YB 2NOAA 3FZYA 5HKKD 1OGIA 5FQNA 4HT3B 1PZNA 1XTKA 1LRLA 1EXMA 1SVOA 2GF0A 4US1R 4X93A 4E6EA 4LF6B 5CDSA 3UA4A 3WQSB 4LY6A 3H86A 1G55A 3L6RA 2WDZA 4WV3A 3TOCA 1RYNA 1D2HA 5K99A 1ZS9A 4A8JA 2ZAGA 3H5AA 1RLOA 3OD1A 1MABA 4H08A 1U94A 5JO9A 4F7WA 4QYIB 5BR8B 4GG1A 3KXDA 5GOTA 4B5LA 1GDHA 1S4QA 2JCXA 2P79A 1PV2A 3K0FA 3ROQA 4YRIA 4D0LB 1RQPA 1R9GA 1ADCA 1XRNA 3QMWA 4JXKA 1W0CA 4KYUA 1D6NA 3SY8A 1CZOA 1TO6A 4F86A 2HNKA 1X1SA 1WDKA 3SC6A 4IGAA 2FPPA 1S3GA 1ZSYA 3KQQA 3QYFA 5A3RA 5C4IA 1CEQA 1U8FO 3LX8A 4PONA 4Q9KA 3R23A 4M46A 1DT5A 1Z2CA 3TW6A 3HBAA 1HYQA 4FKZA 4DCMA 2QVBA 3VKUA 1QCYA 3K0EA 4PX9A 4ZK2A 3CKMA 1NI4B 4QUIA 1I7QB 5A7FA 3PTLA 3JZMA 3LUCA 5DTMA 2G1JA 3E8XA 2BSAA 2O3TA 3DBHA 4ZOQI 3EXFB 1GZDA 4I55F 1LSOA 5E6RB 4BJ3A 4DGSA 1KVRA 3BILA 3CUTA 3OX3A 1QHXA 3JQAD 3LH5A 2O8EA 1VP3A 1GPWB 4K46A 2I1QA 4I1RA 4DCSA 1YK1A 1BEUB 4B09A 1A4UA 1ORWA 3ANXA 1R3UA 5K4HA 2JB9A 1DIRA 5K1ZA 3SR3A 4F6RA 4ISCA 1YA8A 4MWDA 5DXFA 1UMCA 4WOBA 6AT1A 3PGA1 2GAJA 4J2OA 1PHRA 2AG1A 3F98A 1X74A 3KOZA 7AT1A 5KC9A 5CD1A 2GBLA 2GVZC 4QHSA 1LSSA 2OBNA 5IM5A 2FF5A 4DJ5X 3RJMA 1UBNA 1QWSA 1KEEA 4QA9A 4BLRA 2VR1A 1H6AA 2EG5A 2J5QA 3MM4A 4RQAA 4UNQA 2GN9A 4S3MA 1Z63A 2QLTA 1D6MA 5BSTA 4C4OA 1U1DA 5KUTA 3KSMA 1KO5A 2C5GA 1Z33A 2I4OA 3N70A 4YQYA 4OQLA 1D1QA 2YXPX 3ZHZA 3KKEA 3RKSA 3NNNA 4LCJA 5KWVA 2PPLA 2VAMA 3L6DA 1SC9A 3FBGA 2ZIUB 2X13A 3DE3X 5HIJA 1R5BA 1P7VA 5HE9A 3I0NA 3ROFA 4HDMB 5LL6P 2ZSDA 2OWEA 4GI3A 2P9CA 5CHEA 4GEKA 4HB2A 3EC2A 4MLPA 3BIOA 5I8ZA 4I6JA 3VR3D 1OSNA 4L50A 1JHZA 3D7SA 1GQYA 3L06A 3V1TC 1AKRA 2VSOA 5AK6A 1AZSC 2FUKA 3HEBA 3GJXC 2VHZA 3SOPA 4CKEA 1YNSA 1WDLA 3P0IA 4GE3A 1FP4A 4B6QA 1U7OA 4BFUA 5B3KA 1QGUA 3BMNB 3MERA 4JYMA 2I5PO 1RI4A 2HWYA 5AKGA 3JD0A 1CUHA 5A4JA 3DMGA 4G1EB 4TRMA 1BCSB 1Q7TA 2MSCB 2FWIA 2ZQZA 3N2GB 1CJCA 3IT0A 4PAWA 3HNRA 4XIGS 2F00A 3WDLA 1QIMA 4HTFB 4R1MA 1O9GA 5ESRA 3ZXXA 2XUOA 1YDFA 4J7UA 4GYJA 2I62A 1W36C 1R0SA 1ML4A 5JSUA 3FD8A 2WYHA 1C9KA 2YCLA 5JG7A 2SKCA 1N2JA 4GT1A 5IKXA 1EVJA 5H3CA 1RXVA 2V9CA 2LKDA 3JQ9A 1MJ5A 2V03A 4IQFA 4R01A 2JI7A 3KEMA 5B58T 1XNGA 3WWYA 2EHDA 4KN6A 3SX4A 2NVBA 2HQSA 4K6HA 5H7XA 1M2JA 1KY5A 2HRQA 4Y3UA 2IS4A 4NPAA 3DBIA 2NLOA 3PWKA 4KOAA 2I22A 2XOKD 3IQFA 1SCUA 3TUZC 4OYLA 3VKFA 4KPUA 3VKHA 4ZEMA 4HI0E 2E5LB 2XDQB 2GCOA 2FG6C 4DCTA 1KI9A 1EXWA 5KDDA 5TT1A 1ZC3A 4WAUA 5DEIA 1QMPA 2BMAA 4GYWA 1JIQA 4M1SA 4CLOA 2ORYA 2W2OA 3KR1A 3R5HA 3U4DA 2ADMA 3AFIA 3ED1A 1RTTA 3LCUA 3VPXA 5C34B 1L4KA 2CXTA 2XV1A 1ATIA 2FRXA 4J6FA 3BJEA 1I1OA 4KI0A 4UPVA 3ODGA 3BULA 4KMMA 4KMSA 4LZJA 5AO9A 4YWHA 2YBDA 1G291 5EJMA 3G2KA 5FLKA 2POCA 4HAWA 4BQOA 3FCOA 4CVNA 1XVTA 2AEJA 1FSPA 1P9OA 4B6OA 1V2GA 3WGJA 4BECA 3QE3A 4LWZA 1V8BA 1H05A 121PA 3EBLA 1XMSA 3RGGA 1G1AA 4Y7DA 3EZ2A 1V5IA 4IM7A 4N65A 3INTA 4HGYA 3UMSA 1N6OA 1XQYA 2AQ8A 2OBBA 4PYQA 4DYVA 4BMPB 4EW3A 3MJDA 3HLYA 5LYJF 4XLZA 1JHPA 3D31A 3S5JA 2IYVA 2PZJA 3V2GA 1FLDA 1U6JA 2WD7A 4XWKA 2VYND 5B30A 1EFDN 1N0HA 2I4TA 2ZYDA 1OYYA 3IPYA 4LXYA 4A3SA 1GCIA 3OPNA 4UHKA 4D6YA 3IEVA 2NO7A 3U0BA 5AW2A 2WK1A 2IX9A 4HR7A 2O5CA 5DGXA 2WLTA 5AJTA 4Z4IA 1XDUA 3DLAA 4D1YA 1ONPA 3DMDA 3WGLA 4TWZA 2XW6A 2ZAIA 5B6PA 2C29D 1NQXA 2X8JB 4IOKA 1OXBB 2WTBA 3REQA 4CWAA 1RI5A 2D1RA 4QEDA 1AHHA 5K09A 3L5OA 2JGRA 2BZ0A 1W5SA 3KQTA 4MQLA 2CV2A 3BWMA 5HIMA 1QV7A 3ADKA 2IS2A 2CLKB 4G81A 3KETA 4XYMA 1JLHA 2GTIA 3C5WP 5IC6A 3RC9A 4RL6A 4B3HA 1UJCA 4FJ0A 2AE2A 1LVUA 3M1LA 3HUEA 2ECQA 4WK0B 3RS2A 4D8VA 5BYKA 1GFSA 2DPYA 1NW6A 4MLDA 5ALGA 2YFQA 4KNYA 2JD1A 2YY7A 5JD3A 1J6UA 4N4AA 3N5CA 1U2SA 3N74A 4PGAA 3SKYA 4LEIA 4BLQA 1CZKA 2C82A 4TVKA 5K6TA 3FTCA 1I3NA 3I34X 1GUBA 4RWZA 3T54A 1DZ3A 4Q21A 1KVUA 2VF4X 4L8GA 1J8DA 3BWEA 1R16A 4FXOA 1Z0SA 2GAFA 2ORWA 3KX2A 1E1LA 4ZALA 2GCNA 1O97D 4AJNA 1PWEA 2A0KA 1DARA 1U1GA 3KTOA 3UV3A 5FLEX 1OMOA 5IT4A 1Z8FA 4WNYA 4BNUA 4YTEA 2I65A 1ZH2A 1IXRC 4LZNA 3A28A 4FLMA 5FNZA 3L0IB 2MSEB 4LF5B 1BEZA 3NPAA 1XFAA 2J67A 1ACLA 3NT5A 2EJWA 3UOWA 5HMLA 2VJLA 1T2NA 1THTA 4EX7A 1TUIA 3G1TA 4GP9A 3R4CA 3RBVA 1SG9A 4MWBA 4L4XA 4YROA 4CIYA 4YMIA 4ID9A 5CP8A 4RK0A 2YICA 5T41A 4NENB 1ECBA 1AA9A 1T9DA 1UBOS 2AFHB 3SF8A 1DC8A 3RD5A 2GVDC 3AIOA 1YHZA 2GKGA 1H2WA 2WKPA 4Q24A 1NPDA 2H7XA 2H4JA 2O6HA 3A6HA 3TCNA 1IZ8A 4FEYA 1QQAA 1T5BA 4RTQA 4DV6B 1R4NB 2J5KA 3UW3A 3EOZA 1GTSA 2QLNA 3PYXA 4IH1A 4ARSA 3VZSA 3NZEA 1SQ6A 3H04A 3T06B 2FNAA 3ERCA 1H0HA 1E3TA 3HR7A 3I9NA 4BJ6A 4CF4A 5JO0A 2WHRA 1CQJA 2XUKA 3UUWA 2OB2A 4JVMA 2P2LA 5G4LA 3GK3A 5AHOA 3WSTA 1FFCA 5CCDA 1A2BA 3RAFC 5I9NA 4KIGA 3W2HA 1UZNA 1E7QA 4M1OA 3RRZA 3VPSA 3WLJA 4EPXA 2XJ9A 1K5PA 3G49A 4RVSA 1Z25A 3ZBTA 1D8TA 1KGDA 4I1SA 5BMVF 3DHYA 3FI0A 1XA4A 1L4NA 2DVMA 4H7JA 3LP6A 1ZMBA 4UCFA 3X3HA 4BEBA 4JROA 4BWVA 4EUHA 4BKMA 4IHKA 1EG7A 2C2XA 2VZ0A 3ITNA 4Q47A 1LVGA 1D03A 2AYZA 1XXHA 1T3TA 3GAMA 3S68A 3IKMB 4P08A 1KQPA 1CDEA 3D3WA 1CUVA 4RNDB 3D4LA 4ZAVA 4YCNA 1TJYA 1XCLA 2IYQA 3O8OB 5GVRA 2G7ZA 2WJIA 4OJKA 2NUAA 3BF7A 5DYIA 1JE1A 4ZZ1A 2BM9A 2ATXA 3H2ZA 3K70D 2YZKA 3HY4A 4M1QA 4X54A 4JJZA 1RPZA 2GN6A 5AJWA 4B0PA 1X2EA 3ELBA 2QZ9A 4CMEC 2Y4NA 4Z3KA 3OPYA 1YO6A 1H6BA 2QTCA 1OGJA 4G5YA 3KV1A 4HNQA 3V8VA 4YI3A 5L3SB 3ODPA 4BBJA 3OICA 2Z0MA 4Y6LA 3S8YA 4JK3A 2FP3A 2XTZA 3QENA 3S2ZA 1WBJB 4IWNA 4ZEXA 4D80A 4X41A 2UV8A 3WIEA 5F9HA 3NR2A 3NVKI 3KUCA 1LRJA 5AW4A 1XZJA 2X5NA 4ENWA 1EDBA 3R1IA 1A82A 3SLGA 3GQBA 1OT3A 4XTRA 1EQUA 1PLLA 2O2SA 4II2A 2VRCA 1UJ5A 4ZC8A 5JSZB 4JB3A 1IB0A 4QJBA 5IYZA 4PG5A 1MDBA 1EAYA 3NCTA 4ENUA 4X66B 1T9GR 3RIXA 3ICQB 2OHGA 4FYJA 3BMQB 4LYAA 3R7AA 1RAEA 4YALA 4ZO9A 3LNTA 1DAEA 2R85A 3GBPA 3RW9A 2DHDA 4TYNA 2RHLA 4GKKB 4TTAA 1DIOB 3F5MA 5K0TA 1O95D 5KTYA 3DL0A 4U7WA 4D9MA 3RGWS 1E94E 3GRFA 1UXHA 4CEHA 3UWMA 3BXZA 1K8QA 2ZDHA 4NONA 1FFBA 1Z0KA 2G0AA 1BMFA 3H0EA 2H48A 4WNAB 4PZ9A 5KDLA 1Y1RA 4RZUA 3IEKA 2V58A 4BNDA 1U0RA 4R83A 4C78A 2QIOA 4Q9AA 1Q6ZA 2IIQA 1UMKA 3FIUA 3HB1A 1LB1B 1P0FA 4FFOA 4JSRA 4Q4HB 4ZVTA 4MRRA 1SUFA 2OGZA 4ALJA 1DCKA 1HBJA 2XUJA 3CEHA 5ADHA 5KYUA 1RC0A 3T0FA 3H6HA 2OCBA 5A4IS 3FUWA 2AEFA 2ODBA 3FXAA 3L8FA 5KWEA 5DM1A 1C1HA 2BFEB 2WOOA 4V38A 4B6EA 4TVSA 5IKMA 1EP1B 4MI9A 3PFBA 4ZAYA 5C1IA 4ALMA 2BTQB 4YJGA 3AW8A 4ENTA 1ZHOA 1E2UA 4PYNA 2VYCA 1CF4A 1PQUA 2JHPA 1NKTA 4J2TA 4B2LA 4X85A 3V4PB 1O94C 3WLFA 3DLTA 1E7YA 1WJGA 4YRNA 2UVPA 3UHOA 1LV7A 4EHJA 2JAQA 3A4TA 3NMUF 1WAMA 2PXAA 2XGJA 3GJ8A 3SJCA 1XU7A 5EL0A 3UPUA 5BSMA 4QSHA 3FM9A 1QF9A 1F14A 1L5WA 2AJTA 2J9GA 4NY1A 1ZMOA 3NNDA 4Q3LA 3V46A 4H15A 5D85A 1BFDA 4D92A 2DG2A 2JAWA 3PICA 1RLJA 1YQ9A 3UT5B 4BWFB 5AW6A 1QIEA 5F64A 1QLJA 5JCOA 3A4NA 3EW9A 3BA1A 3LKDA 3U37A 3ZXSA 4ARZA 2FHSA 1EFRA 2VK4A 3T4EA 4EYSA 4YGYA 3R4VA 2ONYA 2HD4A 4DA9A 3IVCA 1Y1LA 4NV1A 4EAQA 8OHMA 2EFYA 2OVFA 2ZE6A 4CEIB 2OGUA 4B8YA 4H6XA 3B1VA 5ALEA 4RULA 1Y1QA 1GSOA 1JLSA 1WXFA 5B55A 2CDNA 1T2VA 4O25A 3MGAA 3HWX1 4G0UA 3MJEA 3ZH2A 3CLRD 2Y2UA 1I9GA 5SY9A 1XDBA 1NZDA 5DF1A 1PG2A 4AI6A 1N8SA 3KSDO 4LC1A 2FQXA 5HKKA 1QVVA 2WIDA 5BV8A 1MB0A 4LXQA 5CVUA 1F1JA 2V96A 2ZAYA 4GXRA 4CHTA 3FX2A 3QKUA 4HWTA 3LZCA 1FVXA 2ZI5A 3RKUA 4IXDA 1XNQB 4NC9A 3BKWA 3NHLA 3R3WA 2CUTA 3R6TA 3LHIA 1G9SA 1BD4A 1JDPA 2Y6UA 4LCEA 1O8BA 4OAQA 5BQOA 1R27A 2W9XA 3BB3A 4XJSA 2UUCB 5KINB 2HCTA 1QLWA 2CNDA 3OIVA 1RQGA 3WLEA 4YV7A 1UIRA 4A91A 3H42B 4ID3A 4PYOA 3WZMA 1JSRA 4R9UC 1YQDA 1IPHA 3MCWA 3LC1O 3THXA 5CM2Z 2QI9F 4EJSC 5LCXA 2H11A 3S4YA 3OLXA 2OQVA 3FIJA 2DF8A 4AULA 4NMWA 3HWWA 1M2FA 4DV3B 3SNKA 1JG1A 4OLHA 1I8TA 5CXQA 3F3SA 4UHDA 1JU3A 5C1BA 3T0GA 4BE7B 1DEOA 1A69A 3K30A 3KELA 5A02A 4A27A 5A7GA 3UFBA 4HV4A 3GVIA 2VTBA 2IU6A 2JGDB 3L18A 2J4CA 1IJFA 1COZA 3GELA 3GPBA 3OF5A 1H2RS 4TT8A 3RUIA 1H23A 2KBFA 4OXNA 3RV4A 1P6UA 3EA4A 3EXEB 2ABWA 3QNMA 5ULLA 3JQAA 4JASB 3SYNA 1GG9A 3N5KA 1R6DA 3JQBA 3O4GA 3PCTA 4I55B 3BXFA 1TCCA 2NVUB 4CCSA 3OM1A 5B4TA 5DNCA 1R50A 2DM6A 2YZGA 3CH7A 2ZWMA 3MLBA 3FFTA 2IEYA 3IUQA 3LXUX 3PJFA 1QK4A 4YONB 4BGVA 5CCBA 1JPNA 3F96A 3SC2A 3ACCA 1MIOA 3TD9A 2B78A 1OH8A 1A8PA 2CYBA 3R8CA 4QPNA 5BNZA 3AM1A 3IRVA 1B8OA 4H7PA 1ZXBA 2WU8A 4D44A 3K1TA 1YFKA 4B3SB 4PSUA 1F8UA 4CMKA 3PYLA 2D0IA 3KKMA 4FGUA 1NJ5A 4L2IA 4LWOA 1K7CA 5C3MA 1F0PA 3QBEA 3RAJA 1P9LA 1SBQA 3IQGX 1E9EA 2XWSA 4HLUA 3ZZUA 2H2WA 3ZHSA 3KJGA 4DDHA 5A6SA 2EKBA 5JNUA 4HS9A 4KO2S 3EDOA 5F1YA 3VOBA 2C61A 5BUCA 1MN6A 2XUQA 3UTDA 1S3SA 1WP4A 3KLMX 5HBGA 3U7QB 3E15A 3WLMA 1KMIY 4EG7A 2FRDC 2QSJA 4K28A 4Z6KA 3TBFA 2L18A 3BD8A 3DDCA 3ZQ4A 4O2RA 4M88A 4Z0PA 1U7PA 1VC2A 3R44A 5C8VA 3U4QA 1PJAA 1AOXA 1GCGA 3VR3A 5LP6F 3WYEA 5NULA 4DA4A 4UD6A 1JQ3A 2H17A 3AL2A 3PA8A 4P3NA 1ID1A 3LY7A 5EIXA 4D4MA 4D8WA 4I9HA 3RIGA 1F0KA 3PRKE 1M9NA 1GPMA 4GOKA 4YVFA 4C4YA 2BKUA 2A9KA 4E4YA 1DTWA 2HCRA 5I4KA 2Q45A 2A92A 1EHIA 1HZZC 3H2GA 2Q2OA 3HO8A 2EQ5A 2WZDA 4DMGA 1PRYA 4F97A 3X44A 4QU0A 1I14A 3WBKA 1UFOA 1SPXA 1U6IA 1V5GA 1CQPA 1FDOA 1WZUA 2PQ0A 3NALA 4G5OA 4ICIA 3IAEA 4QTZA 4TLBA 2GK7A 4IIFA 4YHBA 3RYIA 2R60A 3VGPA 2JG3A 3OM9A 4R8KA 2NVOA 4JITA 5B58C 3QMMA 2CUNA 3FVVA 5TS3A 1LVHA 5G0SA 4D46A 4H1VA 1IBCA 1IHPA 3H0KA 3OLZA 1ZZGA 3KQMA 3DVLA 2R8EA 4Q4DA 1WO8A 4UAVA 3F46A 4H3SA 5TF4A 1ONSA 1TTHA 1BQ3A 1QHHA 4PLPA 1GTRA 3EY4A 4AJPA 2X1HA 1TU4A 1VDZA 2JDID 3L7AA 2WU0A 5IBCA 2XUFA 3ADCA 1LLUA 3GY0A 4M9RA 2Y1DA 1PWXA 1UXGA 1IHXA 1NBME 1P4AA 2F48A 3HJCA 3LPMA 3NJRA 3PI6A 3HL4A 1E2IA 1LLDA 3G02A 2Z2YA 5EE5B 2H18A 2ZBUA 2QX6A 1V8PA 1EXNA 1B74A 3D8HA 4R4JA 3IT2A 1PVOA 1YONA 4MUKA 5EE3A 5EJ6A 3BHIA 8LDHA 3E22A 4RV9A 1RVDA 3B3QA 4A1OA 2G06A 3NW9A 4CKWB 4J0FA 4LJLA 2I2BA 4F91B 3GLIA 1ZUHA 1OVGA 2WYOA 1XP5A 5K3BA 1C3XA 3SS8A 4XTCS 2CWWA 4YMWA 1LSUA 3OE1A 3O91A 3QK7A 2IYLD 3WLKX 2J45A 3FB4A 4DA0A 2FQYA 5CK4A 3SXPA 2R6DA 1A7JA 4X8MA 4YRGA 2IPNA 3THSA 1DKMA 1XHLA 2H1WA 3TMKA 4YUVA 1L5YA 4ZAZA 5C8YA 3R3UA 3L0YA 2X2PA 4OMUA 4RX1A 4CQMB 2BGTA 3O3MB 5IZCA 1BFUA 3CS3A 4MVJM 2W22A 2VYNA 1C5KA 3CX6A 3I8SA 4MW2A 4WKGA 3C8ZA 4CMBA 2B1RA 2LTAA 1SXIA 4LQLA 4QDUA 2A1IA 3ZWVA 3CGWA 1PZHA 1CUAA 2DX7A 4ZA2A 5LZ5A 4MQBA 3CE6A 1BHSA 2O8CB 1XD2B 1O6BA 5YASA 1T6YA 3K9QO 4F45A 2C5BA 3W9BA 5B1EA 3E1KA 1KAQA 4CHGA 3Q0TA 5KIAA 3ITEA 3DVQX 3JARA 4FYXA 1KSGA 3G2QA 1JG6A 1JHYA 1JEQA 8ABPA 3KAKA 5KYVA 1GUZA 4MGZR 5J4KA 4QELA 1Q7RA 3BVPA 2J6BA 5K4GA 2ZXUA 1M73E 1XXLA 2D4AA 4WGGA 4OA5A 1XDGA 1G1MA 2PZEA 4H35A 4HN4B 3SIWA 4ASUD 3NBMA 4MINA 1V4VA 3D0QA 3ORHA 1ODKA 4ALNA 1P62B 1R8QA 1RIIA 1DSSG 3FHLA 5EMLA 5GIOE 1E3QA 4LRYA 4YRFA 4DLSA 3PEVA 2JRLA 4R3UC 5THQA 1UXKA 1FQWA 5CVEA 4NDAA 2Q9UA 3RSLA 1AGXA 1P5ZB 4BO0A 1OC4A 3IO5A 2ZIVB