1USGA

L-leucine-binding protein, apo form
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
345
structure length
345
Chain Sequence
DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCINE-SPECIFIC BINDING PROTEIN
publication title X-Ray Structures of the Leucine-Binding Protein Illustrate Conformational Changes and the Basis of Ligand Specificity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 138
structure length 345
sequence length 345
ec nomenclature
pdb deposition date 2003-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usgA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usgA01
1D4ZA 3I5AA 4WT7A 5KWSA 1YMVA 4KZKA 4Z99A 4RU1A 4TLLB 3DLBA 4M88A 2R25B 1JDNA 4EYKA 3F6PA 1RXIA 3LUCA 2HQBA 2QVCA 3FDFA 4KK3A 1RZRD 4LDZA 3JVIA 4MQEB 2HPHA 2HQOA 3D02A 3OO0A 3FMVA 2IDMA 4RK4A 4Z9BA 1QNLA 2YHBA 5KC9A 3BILA 2L18A 4NCBA 4KPYA 1USIA 3NBMA 4FE4A 3QLTA 3LKVA 3N0XA 3QEMA 2E4XA 4P98A 1KMIY 1ZH4A 5I4CA 4MPTA 5BQ3A 3LUKA 3LUFA 3CZ5A 4PICA 3FFTA 3HS3A 2FN9A 4MYRA 3I42A 2AYXA 2PL1A 3N53A 4IMIB 2ID7A 5EWMB 2MYUA 4MLDA 4Q6WA 1JYEA 1JX6A 1YK1A 3JY6A 5CNJA 3RVRA 4ZYLA 1RZRA 4Z4FA 4LZLA 1XWWA 1ZGZA 3QX8A 3A0UA 5CNIA 2GKGA 1VRVA 1A0OA 3Q7RA 5C5CA 1ZH2A 1YIOA 3MQ4A 3LFTA 1NXWA 3A3KA 4O1HA 4KQ9A 2NZVG 2ID9A 1DCKA 2PUCA 2PUEA 1M2EA 4NCAA 3H5WA 4EVQA 4Q7EA 3B2NA 2FTKE 5KI6A 3RVMA 1A2OA 5HKOA 3RVNA 1XHEA 1APBA 3Q9SA 3RVQA 1SXGA 4ETIA 5BR1A 2M98A 3CKMA 3HXMA 1ISRA 3O74A 2PMCA 4EYGA 3NHZA 4G0MA 1VKRA 4G0ZA 4NICA 3DLHA 2GBPA 3LUGA 2OENG 5KQPA 3OM0A 3H1FA 1EWVA 2PUBA 4IGAA 3JS5A 5TPWB 1L5YA 3P9YA 3RVJA 1GUDA 2FSPA 4ZPJA 9ABPA 3SG0A 1DC7A 1DP4A 4ML3A 2FXIA 3OQMA 3HDVA 1EAYA 1JFVA 3QELA 3IP9A 3IP6A 4N41A 1PUXA 3RVKA 3KG2A 3N75A 3QX9A 4QPJC 3QLUA 3GV0A 1D2AA 1Z2EA 1IIBA 2ZWMA 5JNVA 3VNAA 2P9HA 5E3JA 2F8SA 2GWRA 3GA5A 1D5WA 4Z9AA 2Q5CA 3FFWA 3JTEA 3ILYA 2MSLA 3O21A 3QLUC 5IBQA 1QQBA 1K66A 3IPCA 3M9XA 2FMFA 4KMRA 4YLEA 4DADA 3C3MA 3H6HA 5FBKA 2BGGA 1PEYA 2HQRA 1TM2A 4EUKA 1NXSA 3RH0A 1JHZA 2V0NA 2ZAYA 1M2FA 2VK2A 3O1JC 3ROFA 4RSMA 2FN8A 5FWYB 2QR3A 4EYOA 1NXVA 3I45A 4EGSA 4MAAA 4PEVA 5BRAA 6ABPA 2VUIB 4N0QA 2H0AA 3HM9A 3EGCA 4YGXB 3O2QB 3HCWA 1BA2A 4KVFA 2JVIA 3OLXA 3DBIA 5TPZD 1QP4A 1WETA 5JNWA 4W5TA 2E4VA 2LUOA 3CG4A 3S99A 1DBWA 2MYPA 5TQJA 1H9CA 1Y1LA 3HVRA 4TMYA 1B00A 5TE9A 3DZDA 2PAFA 2FVYA 2KYRA 2WJAA 4HYEA 4RXUA 4YO7A 2L17A 1BVHA 3K9CA 4LRQA 4WXEA 1E2BA 4F8JA 2RJNA 1W25A 2NT4A 4LX8A 4ZMRA 2GX6A 4PZ0A 4FB4A 1TJYA 4XARA 5IEBA 1YK0A 5TQ0B 3O1IC 1P8AA 4W5QA 1Z13A 1RXEA 5TPZA 1LK0A 2NUBA 4XFKA 5EWMA 3OQOA 2YHAA 1VLZA 4MS4B 3HK2A 1LJLA 5JNRA 2L2QA 3CTPA 5DTEA 1CEYA 3HUUA 1DCMA 4P1ZA 4TN5A 2JVJA 3MIZA 3O75A 2LBPA 5KQMA 1CYEA 4LE1A 2HJ9A 5F64A 1EWKA 1M5TA 1KGSA 1ZGGA 3HZHA 3VNBA 3H1GA 4YR7A 3H5IA 3MM4A 2FMHA 3HUTA 3ROTA 2JCGA 3E61A 5ABPA 3OMWA 3H5OA 1BDIA 2PKXA 3DGFC 4EVSA 4F12A 5GOTA 1BDHA 3NHMA 2QW1A 4HNQA 4G0XA 5TPWA 3TX6A 3KS9A 1RNLA 3JVDA 1JL3A 4MS3B 5HM6A 2FEKA 2RGYA 3SM9A 4W5OA 2WB4A 1S8NA 1E6LA 1PEAA 4KV7A 3L6UA 1FFWA 3RQIA 4OBBA 4LDAA 4YRZA 5KQLA 2JK1A 3H1EA 2QXYA 4TLMB 6CHYA 1UDRA 3N6VA 1DRKA 2LP4Y 2FEPA 1DZ3A 2TMYA 3C3WA 5GQSA 1QO0A 3KSMA 3O2SB 4XAQA 4MR7B 5PNTA 1OXKB 3HSYA 1USKA 4JOQA 4EYQA 2E4YA 3H5TA 3FGZA 2VUHB 3LTEA 3NNNA 3LMKA 3UK0A 1T34A 2PUDA 4F3TA 1RPJA 4JA2A 2JBAB 4RY8A 1EFAA 1JYFA 1NATA 2N9UA 2FW0A 1U0SY 1SXIA 1Z12A 2WY2D 1F4VA 5BRJA 3C3KA 5DLEA 3HV2A 1MB0A 1YS7A 3MMNA 5EWLB 1F51E 2A9PA 4G0PA 4N03A 2JB9A 2PUFA 4IILA 3F6CA 4XLTA 1HEYA 1YTUA 4WWHA 4RK0A 5IC5A 1JBEA 3MF4A 5FBHA 1XHFA 4F11A 3UUGA 4Z4IA 3DGEC 4KQCA 1ZHHA 2A9OA 2PJUA 3FFXA 4G86A 1ABEA 1Z15A 2E4WA 4WXMA 4XASA 4W5NA 1QPZA 3OO1A 3CNBA 1GLGA 3E3MA 3LUJA 5T7BA 2MSKA 1QQAA 3JPWA 1Z17A 4ETMA 2IOYA 2IPNA 3LUAA 3MYYA 3CFYA 4HNRA 5CHYA 4YP9A 4GPAA 3Q7TA 2B1JA 1P2FA 2P4UA 4FE7A 3OLYA 5TQ0A 4ZJPA 3Q7SA 1ZAYA 1FQWA 3M9WA 3EDCA 3CHYA 4JAVC 3LOPA 1ZITA 4KK4A 4PYRA 4RXMA 1DBQA 2QU7A 3HEBA 1PHRA 4MS4A 2J48A 1U8TA 2R4QA 3HDGA 4DQDA 3N0WA 4RK5A 4G0QA 5KQGA 4LE2A 1BAPA 2QZJA 5IEJA 1TLFA 2QVGA 2X7XA 2FQYA 4WZZA 5JNTA 5DKFA 4LE0A 5C5EA 4RY0A 2FLWA 4RY9A 4N47A 4IF4A 1ZVVA 3GT7A 3GYBA 2FQWA 4CBVA 1JF8A 2IPAB 2PLNA 3EAFA 1L5ZA 5TQ2B 1P6QA 1GUBA 5IUJC 5JNSA 4F06A 2GI4A 3GBPA 1MB3A 2NZUG 4MS1B 3KJXA 4YWHA 4Z4CA 1ABFA 4JB0A 1NXPA 1KRWA 1C0EA 2NT3A 4H60A 5HQJA 3BRQA 4MGEA 4JP1A 4RKRA 1ZN2A 1NXOA 3EULA 2H3HA 2IPLA 3K4HA 2FMKA 4QICA 5IX8A 1QMPA 4D6XA 3LUHA 4Q6BA 2XDYA 3TB6A 1YMUA 1J56A 3NNDA 4OLAA 1E6KA 3T38A 1U2PA 4MS3A 2A9RA 2HSGA 4H3HB 2E4UA 3KTOA 2LPMA 3CRNA 4MRMB 5EWJB 1FFSA 3HJFA 5CNKA 3KLNA 4H3KB 4L85A 7ABPA 4RK1A 1M5UA 2A9QA 2CHEA 3KLOA 3C97A 1PNRA 4N76A 4NV3A 1P6UA 2OQRA 4ZMSA 4MR7A 4OG2A 3OLVA 4QYWA 1USGA 4RXTA 1U2QA 1QO0D 3RVLA 4YCSA 1OXBB 2RDMA 3D8UA 3CZCA 3T8YA 2MYTA 3SNKA 3H5LA 2IKSA 4RKQA 3EODA 1Z18A 5FWXA 4MR9B 3IPAA 5JS2A 2JBAA 4RK6A 4D6YA 3CG0A 2IYNA 1I3CA 3G1WA 3GBVA 1YS6A 5EWLA 3SY8A 1KRXA 4S05A 3GL9A 1VPWA 3EQZA 1DC8A 3A10A 1EWTA 1CHNA 1LBIA 3H75A 4RWEA 4MR8A 4EY3A 4ETNA 4RDCA 4Z4HA 1JH9A 2CHFA 4UHJA 3A0RB 4DN6A 3CU5A 1R8JA 2WWVD 4W5RA 2FMIA 1E6MA 1DJMA 1GCGA 4S04A 3RVPA 4KNYA 3CS3A 2FKAA 4G0YA 2FEWB 4JB2A 5KC8A 3F7NA 3QK7A 3KYJB 2JVKA 3OLZA 5FWYA 2QSJA 3TO5A 5CNMA 2AYZA 4EVRA 4KREA 3LUDA 4YV7A 4RZSA 4WUTA 4IRXA 5FWXB 1ZESA 4YS6A 1MAVA 2FLKA 1NXTA 2MSWA 2R48A 4QYMA 3CLKA 1ZY2A 1W9HA 3GRCA 3W9SA 4IMJB 3SQNA 4KRFA 1Z16A 4E7OA 2WJWA 3QEMB 3BBLA 4MR8B 1D1QA 1K68A 2CD7A 1MVOA 4Y9TA 3OQNA 1JLKA 1TVMA 1NXXA 2B4AA 3MA0A 5ED4A 3M6MD 2IPMA 1DG9A 1TMYA 3QLVA 3R0JA 1GCAA 3L49A 3T95A 3TD9A 1JWLA 4O5AA 4OLBA 1AB6A 3QLVC 3URMA 1FSPA 2O20A 1NTRA 1YVUA 2M1ZA 3N8IA 4RS3A 3UKJA 3IDOA 3SAJA 4Z4EA 5B3JA 5TQ2A 1URPA 1QKKA 1SRRA 2R47A 2WRZA 4Z4GA 4N0PA 3H6GA 3NNSA 3RVSA 4KFCA 4MS1A 1Z2DA 5B3JC 1SD5A 1EHCA 2JRLA 3C6QA 3QEKA 5D2CA 2RJOA 3T6KA 1DRJA 4PE5B 5T3YA 5HSGA 2PUAA 3OM1A 2MYNA 3EJWA 4D74A 4MQFA 3O2JA 1NY5A 3IP7A 1QP0A 3OLWA 2L19A 1AB5A 5DGCA 1U04A 4L4UA 3O1HB 4MLCA 2QV0A 3KCNA 4RV5A 4UHKA 1JFTA 3H5VA 1BDJA 1D1PA 4JASB 5EWJA 1DBPA 2FQXA 1SXHA 1Z26A 3N0RA 4MRMA 4E7PA 3HO1A 3IP5A 3KKEA 4XXHA 3F73A 5JS1A 4OATA 3TMYA 3BRSA 3Q15C 2E4ZA 3G85A 3BREA 3OMXA 5IULC 1DCFA 4OTZA 3QELB 4O1IA 1ZDMA 2LIVA 2DRIA 3RVOA 4G97A 4MQFB 2PUGA 3GWGA 3ILHA 3Q41A 2I6FA 2CWDA 4G0OA 4NQRA 4MQEA 1PNTA 4MR9A 1LJUA 5IUKC 1FFGA 3KHTA 8ABPA 1QP7A 1A04A 1JDPA 1JFSA 4HNSA 1ISSA 5JNUA 3I09A 2PE5A 3LKBA 5IUNC 3KYIB 4GNRA 4Z0NA 2W42A 2F8TA 1LBHA 2PL9A 2VYCA 3EQ2A 1Z25A 5DCLA 2WMYA 1MIHA 4RK7A 4B09A 1C4WA 3JPYA
chains in the Genus database with same CATH superfamily
4WAUA 4HR7A 3ROKA 4Z99A 3WLSA 1TAGA 2OD7A 4TLLB 4HY3A 5BV7A 1ECJA 3G7UA 2R25B 1QHFA 1ZMBA 1ZSVA 4MGHA 3ZEIA 1Z0KA 5LOVA 3F6PA 4TT3D 4KK3A 3UMSA 4C20A 3ODGA 4M99A 4LDZA 1I10A 2AF3C 4Q03A 3N87A 4Z9BA 1GZ5A 3ZDDA 2IDMA 2QSZA 4HPWA 4U4AA 2LW7A 1RQXA 2QMQA 1SHKA 3GT3A 5HJ2A 3SYTA 4IMRA 4NCBA 3H1TA 3PE6A 1RKVA 3BMNA 3PQ3A 1QZTA 3NWJA 3E3LA 3JAKB 4G85A 4DUGA 1M73E 1GCIA 1JWAB 2V4MA 3GU3A 2IYEA 3NTXA 3UAWA 4B2LA 1NY6A 1ODJA 2OORC 4DIOA 5D51S 1GD1O 2X3UA 4GU5A 2EC5A 4AY5A 2FN9A 1EQ2A 1CJTC 5JAMA 2EDCA 1YQEA 1UZMA 1PS8A 1JIKA 1UBFA 1GIAA 1NI4A 2XNJA 4G4SP 4ADSG 3RVRA 3DEFA 5E0KB 3LXMA 5FBVB 5AR1A 1T0BA 1I0IA 2Q3LA 3QSYA 1YIDA 1D4OA 1M8JA 3JQRA 3JCZA 5AI0A 3IURA 1EGMB 2E55A 2IHNA 1D2GA 3TSZA 5EFZA 2JH3A 3HJGA 1U0NA 4HQNA 3PFGA 5C8YA 1DCKA 2PTHA 2ZROA 5JT1A 1IC6A 1ZOSA 4LEIA 2R6JA 1BXRB 2ZSIA 3ISVA 6YASA 4WN9B 4GYWA 4WFQA 5C18A 4JI4B 1APBA 1WBJB 2E82A 5FPPA 2RBKA 1PNOA 4LTMA 2HO4A 2O9JA 3K0SA 1ISHA 3UAYA 5IYZF 2OCYC 5KNBD 3UM9A 2O2ZA 2BZGA 3DC7A 4B4WA 1SA0A 1VSQA 3TJZA 5HUQA 3E48A 4ZI7A 4IDHA 4OGGA 1CJKC 3WE7A 1Z0ZA 2OENG 1ORDA 4Q7JB 1KMHB 5BR7A 1EWVA 3N8KA 2C96A 4KMSA 1LFDB 3JS5A 1V5FA 1L5YA 3A2LA 4NL4H 5H7XA 1EBBA 4CMBA 4LRYA 3NAGA 3ND9A 3V97A 2BH9A 1HXHA 5C8VA 5CVTA 2ZSJA 3GLGE 2P6MA 2LCIA 4QRIA 1SVKA 1I30A 1ENOA 3QMVA 2XB9A 4PO1A 4Q7MB 1EAYA 3VDMA 2Z9BA 1P1HA 2XQGA 1XMVA 1Z6ZA 4CKBB 5G0TA 3KUCA 4BLTA 3PHJA 2H1FA 3QNWA 3OFSA 3KVVA 4XPZA 2EKBA 2RGXA 3WHLA 3QXHA 4HN2A 2BZ1A 4O2AA 3VHXB 2KPOA 4QFCA 4Z9AA 3ED1A 1JG7A 4YRRA 1GEEA 2B83A 1DAEA 3IPCA 3M9XA 3T3PB 3TIGA 4DMGA 4M1ZA 4AXXA 1QRTA 3S8YA 3C74A 2JCBA 3LZ6A 2QA5A 3FWNA 3QBVA 4P4TA 1XN1A 3BCUA 3ELDA 4BZPA 4TYNA 1GZ6A 1AM4D 1KJ8A 2FN8A 3S2EA 3R5FA 3MINA 3U13A 4JJ4A 3WL8A 1JDJA 4HS4A 1B0UA 1HYQA 4RHTA 1VL2A 2C0QA 4IDDA 3E2PA 3VR5A 1QV7A 5IZ4A 4V02A 3FPGA 3ZD6A 4CTJA 2QJRA 2NYRA 3T5MA 2FPUA 1QP4A 4BN4A 2CXRA 3SLGA 2IU0A 2R6R1 4BE9A 1Q0HA 3SEFA 4YCAA 3DNFA 1DBWA 2MYPA 1JPUA 3MXOA 3QVKA 1JEQB 3BDIA 2VTBA 4ZO8A 3D31A 3JQ9A 4R2LA 1F0PA 1RABA 1UEIA 2L17A 3WLHA 2KWIA 1FBNA 3OKFA 1AV7A 2DUWA 4BASA 5DM70 4MMZB 2RJNA 3A7DA 4MVJE 5CTAA 3ITEA 3FYDA 2IUEA 3OJ0A 4S1NA 3ASVA 1TPZA 1CB0A 1V8ZA 2P3QA 3BFVA 3SM3A 3FDJA 4JA0A 3T5DA 3O1IC 4CEHA 2H3EA 4KPUB 4C0WA 4CT0A 2GO7A 3HZZA 3GLUA 4MK4A 2D0IA 4A0QA 4MZDA 3S40A 4FLEA 5ECYA 4MRPA 3UGQA 2XE6A 4A0RA 2VJMA 2G5TA 2YJ4A 3NHFA 4B6JA 1EFKA 3RHZA 2FWNA 1CERA 3GY0A 4JSTA 4XJVA 2I91A 3ANSA 4IAOA 1X8XA 5K3CA 4PY2A 4MV1A 1Y8QB 3B1JA 2A6PA 1CEYA 3MOIA 2ARKA 2BM8A 4OFWA 4U3JA 1DHTA 3NG1A 2P1DA 1GT91 4G23A 3AL0C 3DXYA 2MTBA 2WYOA 4FHGA 2M6LA 1EESA 2ODBA 4M0MA 3TZQA 3TSYA 1ZGGA 1KGSA 4P7GA 4YJ2A 2YY7A 5DK4A 1UBMS 3ND6A 3H5IA 3L7JA 5LB2A 5MHTA 1DOAA 4OXIA 5CLJA 4D4HA 1XZ8A 2FDCA 2BV3A 4F96A 4YYZA 2QG9A 2ZQZA 1TIPA 3PVSA 3F71A 2OB1A 3Q2OA 5KYUA 1OU4A 3TMAA 3VH2A 4BFXA 5K99A 5K8UA 2Q3JA 4DXAA 5K3FA 2I2WA 3P94A 1MB2A 3U7RA 3ZHXA 4DDUA 1KSGA 2O7QA 1GXSB 2F1IA 2WWHA 3L7CA 4G0XA 1IZYA 4YT5A 3U7QA 4G8CA 3RB8A 1DKNA 5KYGA 3C87A 3TZBA 2QLJA 1OYYA 4HZUA 1G20A 1QQ7A 1WP4A 4RPLA 3V42A 4E15A 1MCZA 4DMHA 3KPYA 1E6LA 4Y6OA 1R16A 1VE9A 5GIPE 2QZPA 4L74A 4FWTA 2MU1A 2JLSA 2VH1A 4JLVA 2WU8A 2UU9B 4BLPA 1TKCA 1ZSYA 5L3ZA 1ZRSA 1A95A 1FW8A 4RPKA 2WKSA 3TI7A 2JAHA 4X6YA 2PY6A 4RCVA 2IS1A 1TUBB 5IXSA 3CCCA 5F73A 2DAPA 1U9CA 221PA 3HSYA 5PNTA 3ZZMA 4AO6A 2LCFA 3R0XA 4M1OA 4N40A 1L7AA 3WLOA 4DKXA 4LHVA 4GSYA 2ZS9A 3RJTA 1G55A 1N2HA 2B7LA 3AEKA 5C5IA 4EUHA 5CEFA 1QF6A 5EXTA 1Z3CA 2H1SA 4IXNA 4LJLA 1SD2A 4HH3C 4IIUA 5HCIA 2UXBB 1X86B 3OBBA 2P5SA 3U3DA 2B21A 3D6NB 1KDTA 1ZI6A 3KV1A 3U7JA 4UZFA 4H1WA 5ITSA 1LLCA 3HXQA 4QODA 2IHJA 2WJGA 2H65A 5ILQA 1YDFA 2WIGA 4NFSA 1XD2A 2I9KA 5LYJB 2M32A 4DXDA 4BKPA 2BJVA 3R5JA 4YDQA 4AFNA 2WIJA 2LXNA 3ZE9A 1OKKD 4R83A 1ZKMA 5FBHA 1W8DA 5I8WA 4CM6A 1EEXB 1WAMA 4OQNA 1X19A 3I9FA 2AJBA 4L6IA 3TLBA 2HBZA 4RZHA 1MIOA 1OWPA 1Q3TA 4D82A 2GK4A 3GH1A 4HDNB 3L6CA 1DX4A 2BM0A 1R6DA 4LVUA 3KR9A 1UXIA 2QLTA 3S44A 2VTDA 1PVVA 1P9OA 2YRXA 1Q1NA 2IEYA 5KSYA 3KT6A 4FM9A 4UEWA 2DE0X 4HFJA 4CXMA 3D0KA 1TX4B 1WZIA 2OD2A 5FNVA 4D26A 1CUSA 2HTFA 2IPNA 4FPXA 1PG5A 4HWPA 4WY8A 4X97A 4YP9A 5L3QA 2CBZA 2P4UA 4FE7A 1US8A 1J70A 4UQLA 2ZOSA 2XR1A 4I9HA 2PSJA 2WYWA 4FIZA 4XM1A 3S1AA 3N2KA 3BJEA 2JHPA 2VP2A 3U7FB 5THKA 4R8SA 1PJCA 2AG0A 1A4RA 4KK4A 5HG0A 3VPAA 4OQEA 1DBQA 1ULBA 5K0ZA 4IH4A 1UXJA 3G2LA 4L3VA 4EYSA 2HWKA 3CVOA 2J48A 2C9DA 1B42A 2H2FA 2HBQA 3HDGA 4OQMA 3HNPA 4XX1A 3SLKA 3AY7A 1LK5A 3ZE2B 5KTTA 5IEJA 1L5WA 3AJAA 2CJFA 2EF0A 2JJ1A 3HL0A 3IHKA 3OZGA 1IK4A 1GL6A 3HGMA 3LLCA 2OESA 1GUFA 1H85A 2ACKA 4P2BA 4RY9A 2NQ2C 5AXCA 1QFZA 4R16A 3ZX4A 2ADOA 1AA6A 3JD2A 1E2FA 1WW8A 1P6QA 4CQNA 1GTZA 2GO1A 3RSFA 3TH5A 3IELA 1AF4A 3NRBA 1U8AA 3CNLA 4FYVA 1SBIA 4HO1X 3KJXA 1IPHA 4S0XA 4RELA 3QSGA 4ZQEA 3SVTA 4AF8A 4QTUB 5DFAA 1P1IA 5BVHA 4BP9A 1Y48E 2VT7A 5HQJA 5HJ7A 3A6PC 1X14A 1RPTA 1JR3A 4B3GA 1K7XB 3ZIAD 2IPLA 2FQQA 3LPLA 4X44A 3UFBA 4ESHA 5FLXA 2G1KA 2FMKA 1Y4UA 4LV6A 1E1LA 2AMVA 2ZIFA 4HDSA 5DWVA 1S8AA 4HAIA 5LSAA 1U5BB 4XJTA 1L4MA 5DJ5A 1E6KA 3T38A 2I7VA 4TWIA 4DBVO 2DWOA 1FFYA 1F0YA 1H0RA 2A9RA 1I4TD 4KSCA 5BWLA 5LNK6 2E4UA 3KTOA 5T67A 1OLSB 2DPXA 3BVPA 3QVVA 4KQ2A 4E32A 3GLRA 2YFHA 4J75A 5CNKA 3KLNA 4YRGA 1AS0A 2EX0A 3TQOA 1M6VA 2AOTA 2VL7A 1GVNB 1KYWA 3E9CA 4HI0E 5C32A 2ZM5A 3U56A 1EDBA 1F38A 1XZFA 1Q6YA 2BAGA 2I6QA 3BXXA 3CUVA 2IEZA 3KJEA 3L4EA 5EEGA 3ZDFA 3A9TA 1E9SA 1TK3A 2ZTUA 2GJ9A 4CV2A 2YX1A 2VHEA 4RNCA 1XCOA 2Z9DA 3UKDA 1ADYA 1G5TA 4ZKDA 1SKMA 4XR4A 4YJ3A 2I87A 4PHTA 2VJNA 2ZWIA 5EY5B 4ICIA 1CDEA 4TSRA 2DLDA 1WBBA 1ACLA 4MWSA 3ICVA 1JXOA 3KO8A 2X42A 5DYWA 3A1FA 3W5IA 1X6VA 3A4TA 1F5SA 1XAJA 3JALA 4C6HA 4F86A 5HQ3A 1P5JA 1PFQA 5JQGF 5A1TA 1SUFA 1Y5MA 2H2GA 2XBLA 3DOIA 3JAWA 4WBNA 2EERA 1VPWA 2XHEA 1JA9A 3W3AH 2FF7A 2HN9A 4OI0A 1AGNA 5GV8A 3H75A 1NW3A 2J3QA 5BT8A 4TRRA 3RSQA 1L5OA 5KHAA 4KR3A 3BMOA 4LXHA 2DHDA 1IWBB 3NC4A 4S04A 1F8FA 1U5AA 4LUCA 4RGVA 3NP7A 1QRRA 3ZDCA 2O3UA 4PCLA 5DCWA 5BT9A 1C3OA 4HLUC 5F3RA 2FE1A 3OLZA 2PD4A 4RVDA 1KH2A 1KEZA 2BGTA 5EE5B 1W7AA 5IC6A 3FHCB 1AVTA 3D7KA 3LUDA 4NXNB 1PJBA 4FFWA 4CR6A 1RTKA 3OU6A 4X20B 1HY3A 3U6KA 1B1AA 4E5KA 1N3LA 4LF6B 1H5QA 2VZ8A 3L5OA 1HE5A 3ZWXA 4EG0A 1JHVA 4A7PA 2FPIB 1GFIA 1J2YA 4OH1A 3AVPA 3LGSA 1U1GA 2MJLA 4NNOA 1PT9A 2F3PA 4KRFA 1Q95A 3OZ7A 2GHIA 1PKXA 3R8XA 1D0SA 4DRXA 4TTPA 5F52A 3FZYA 3ZXIA 2AEFA 3F7MA 4QUDA 3NTVA 2YWFA 1UUFA 3A58B 2O8FA 2X6TA 3P96A 5FUYA 1M1ZA 1G42A 2J7KA 4HKTA 3X1XA 3W5DA 5KAPA 2Q9AA 5ESDA 4C7BA 5LU8A 3KT3A 1LA2A 2J46A 4LYHA 1V3UA 1XMIA 1Z07A 3LSTA 3ZH9B 5KMGB 1SRRA 1H3NA 3ZJTA 4L4RA 3Q3EA 4PIPA 2FRDA 3KBBA 1G9SA 3CR7A 4X94A 2HXSA 3WADA 2XB2A 4UVDA 3QEKA 1GYPA 1N3BA 4WASA 3WDSA 3OQBA 3WFIA 4U7JA 2FNAA 1J90A 4L5BA 4QUIA 2UUAB 3DDWA 2R4TA 5AVJA 3TN7A 1WXGA 2P0AA 1NBMA 3WNVA 3VNUA 2P11A 2ODWA 3MJTA 1NAHA 4XIIA 5IDXA 4PTLA 1ULTA 4NWIA 1MX9A 4E5SA 1TTQB 4KHZA 8LDHA 1CLUA 1B16A 4RETA 4XDZA 5ALJA 1RLTA 4MLCA 4EG4A 1NOKA 1VJ5A 2QV0A 4RHUA 4CMEA 5FH9A 1FRVA 1JU3A 1KMQA 1MEEA 2G1UA 2I3DA 3TIIA 4XSVA 2X2OA 5CB4F 2FZKA 3CXUA 1UOPA 1FS5A 1RRGA 4GO1A 2WZBA 3D3WA 4FEAA 3BHMA 4W9MC 4NOLA 4O33A 1TMKA 1ZK4A 4XD7A 2JZOA 3Q15C 5KDDA 5HZHA 5D8DA 4ZT4A 1YKSA 5JJ5A 1VDZA 3L8DA 3KZCA 4FZJA 3KDSE 1EVZA 3QH4A 3V1MA 2K87A 3A06A 3RVOA 1XJWA 5CFNA 2C0CA 1FTYA 2B8EA 4MVJP 3P9NA 3ETEA 1NVWQ 4PGHA 5CVCA 3Q41A 2I0FA 4J2OA 3G5AA 2HJSA 2FWPA 1VC2A 5CVEA 4X90A 3DEZA 1A27A 1DAGA 1DQPA 4X6XA 1UXGA 1JSRA 3WGKA 3ZZUA 1SZDA 4KUHA 1JHDA 4PXYA 3L1HA 4E07A 5IMBA 4TMTA 2ATXA 2EL7A 1QP7A 1EJ0A 1HKHA 2ORWA 5FL7A 3AFNA 4H7HA 1Z5UA 3WZLA 4LWPA 2C03A 1A4XA 5DHQA 1BWQA 1Z25A 3E70C 4Z0PA 3V4ZA 3RYCA 4RAOA 1XQ9A 3SHTA 3L0IB 1N2BA 1YBHA 4MW2A 1TZCA 2VS1A 3OI7A 3S29A 4KZKA 4J90A 2ZUDA 1Y8RA 3LT2A 2J3KA 1IB6A 3RBZA 3RS4A 4B3IA 1GZ7A 4HDMA 4DF3A 1Q0TA 4YFVA 1M7GA 2H51A 1IXZA 4J1SA 4OY3A 4X7BA 1PTKA 5KPDA 1T35A 5BSFA 1L3BA 2F43A 2I3GA 3RO7A 1TW2A 2QTLA 3UHOA 4XR9A 3I04A 2XLCA 1CUBA 2P65A 4LXGA 4TWBA 4EPTA 4YCLA 1BIFA 4EUFA 2BW0A 1QIEA 4NJEB 4Z4FA 3BILA 2WQ7A 2PS3A 1HFJA 4LHSA 3DB1A 4A2PA 1PZNA 1U9IA 3NW9A 3TTTA 3LY5A 4BNMA 1QZXA 2WU0A 3PNKA 1OD6A 4FE4A 3U4HA 3WMXA 4PCVA 2EWMA 3VTFA 5KCMA 3RTGA 2PFSA 2C9MA 3LP8A 4UHCA 3ZGOA 1YR8A 1IBLB 2D7DA 4ZIRA 4PPGA 4RHCA 1FW6A 2H8GA 3DDUA 2C0PA 1S6YA 4X54A 3HFRA 5CDFA 2WU4A 3RIGA 4MYRA 4HEJA 3GGSA 2PL1A 3W2HA 2IOFA 3S28A 4DFDA 3HTXA 4KW7A 3I6IA 3UW3A 2H4XA 3MILA 3GFOA 1M2WA 3KJGA 2D5IA 1NWHA 2AN3A 1C30A 2OCXA 3NORA 4PYLA 4WOKA 4I1RA 5AFSA 5C5CA 4KMMA 4OK5A 2YXEA 3E9RA 4OPMA 5CURA 4FGKA 3FJYA 4EMUA 4CM9A 1D3AA 5EIAA 4KXQA 1VZ2A 4DLAA 1VMEA 2NAFA 1PWHA 1YVRA 3CH7A 4R1QA 1JT9A 3M83A 4F6RA 4UNQA 2J4FA 4WOJA 1U0FA 3UN1A 1KR2A 4G26A 5L6LB 1M2HA 3X1DA 4P81A 4AMBA 4C6TA 2M98A 5BR4A 3H4IA 2O8EB 3ROEA 4KODA 5L7YA 1P7PA 4MYTA 4H16A 5L8VA 1JIQA 1GLNA 3STYA 4A2WA 1OXMA 4FDVA 5H70A 4MKRA 5JE8A 1CVIA 1W52X 1ZKDA 4OL0A 4L2IA 1Z0AA 3RW9A 1L5HB 2BUBA 2ZJYA 4IGAA 5TPWB 3HYSA 5L3VA 3OQIB 1MTZA 4S35A 5TGTA 4CUKA 1DC7A 1XLTA 1JQJC 2E85A 4H7PA 2QJOA 1IL0A 1SHZA 3UF0A 2IIPA 4FFSA 1WA5A 4G1BA 4K26A 1GL3A 5CX1A 4EJSC 4L5AA 2W6MA 2WD7A 3MTIA 1MHPA 3QKTA 3FR7A 5BWOA 3AERB 3L8YA 4XVCA 1I7QB 1CS0B 3WWZA 1TM7E 2D2VA 5CMLA 1OR8A 1LPSA 1YJCA 2E87A 2O1WA 3EQ7A 2GFIA 4PC6A 3V8VA 1EDOA 4FMBB 1JMVA 4YJGB 5K8CA 4RLSA 2CVHA 2CVPA 2KB0A 3BD8A 3WJ7A 3QFFA 4RDXA 1QGDA 3IQFA 4GXRA 1KPHA 4KR2A 2AMJA 1OHHD 2HQRA 1EB9A 5C7YA 1LS6A 5FTJA 3TJMA 1PL7A 2ZAYA 4UAJA 2PT9A 2BCEA 1BHO1 3HRIA 2AX4A 4GI1A 3R9KA 3ROFA 2NO7A 2QR3A 3N05A 1NXVA 2FYTA 3MPUA 4DARA 4TKVA 4HRYA 2WJZB 5LUAA 1XLVA 1IN7A 1RM5A 4HYTA 1ZUWA 2DWQA 2V8BA 3FLEA 4YDRA 3RG2A 6ABPA 4AQYB 4G5RA 1GRVA 5BSKA 1SOVA 2QN6A 4EAAA 3BGVA 3BWDD 3FPCA 3DMTC 3IDSA 3K3PA 2ZDQA 3I5MA 5LYJF 3KYBA 3VYUB 4ACBA 3H18A 3FDXA 3TDNA 4RQUA 3V1KA 4EG7A 1VLMA 2Y9PB 3EN0A 4LBZA 1XQWA 4H0NA 1XPJA 3IUQA 1DKMA 2BEWA 2LUOA 3S99A 5BMVA 3MWDB 3D3JA 3G2QA 1SIUA 2YXBA 2Z8YM 3KRTA 4IIFA 1FMFA 4J0IA 2Y6UA 4F3KA 1I3KA 3HKEB 3NPMA 3J80A 4QYIB 1RD4A 1XMSA 1I94B 3QG1A 4I1VA 3PDCA 2A3NA 1I1NA 4WXEA 3TRFA 1X1AA 3OZCA 1GRCA 1DJNA 2D62A 3PSAA 3WKAA 4D98A 4OQDA 4CKEA 1M1NA 2D0PB 1XAIA 2D5CA 2O23A 3EF3A 3LZDA 4P4NA 4ITRC 4LZJA 4GNKA 3COJA 2J6BA 3RROA 2CN1A 3UK7A 1V39A 4Y7DA 4EO9A 4EI7A 1PNQA 3BMQA 3FPSA 2C2OA 2LDBA 3JQ6A 3NU1A 3ITNA 5E7QA 1AURA 5AH0A 3R0QA 3DZJA 2G7MC 4GLOA 1CQIB 4G2TA 1JIXA 1AUOA 3CTPA 3FBTA 3K16A 4GE0A 1YQQA 2PWAA 4K8OA 3V8RA 2B30A 2XDQA 3B9PA 3PX2A 1V3VA 2VPIA 1ECBA 2PGIA 3PC6A 5EYPA 2HGZA 5CA1F 1EQUA 2VQSA 2D1FA 1AOXA 2NV2B 1NT2A 4LY0A 4YAIA 4BO7A 3V6LA 5I6DA 2W8ZA 2ZT8A 3ICOA 2X0FA 3WA6A 2PH5A 3IMEA 4YCBA 1T4DA 3AFIA 3FVTA 4DYHA 2JAUA 3KLPX 1XQYA 4QZVA 3ZWYA 4TVOA 3SJCA 4EUNA 3D3NA 1DNPA 2Q4DA 2SICE 4EVSA 1I13A 1QG2A 4K5QA 1GR0A 2R00C 2BRUC 2QG6A 4OP3A 2QW1A 5COAA 1HDEA 2YMPA 1H6DA 2YYSA 1KZ6A 3NIWA 3Q2IA 3OJCA 5EZYA 4B32A 1XQXA 4D80A 2COEA 3TJRA 3VX3A 4C3VA 3ZK9A 4B9AA 2HWUA 1JL3A 4MS3B 1UPFA 2NGRA 1SMKA 3V34A 4MI9A 3ZUGA 2ZETA 4OBBA 2HC9A 5JHGB 5KQLA 3EB9A 4OAOA 6CHYA 1P8JA 3JVVA 3N6VA 5D6OA 4PS1A 4DR5B 2WWFA 3IMFA 1R6AA 4FN5A 3I4CA 4J0FA 3SKYA 1OBOA 1SQ0A 2QYSA 3I2YX 2DTXA 5FDFA 1L4UA 4PFJA 1JG6A 2NSLA 2TMYA 1QO0A 3Q2KA 3DZFA 4XUCA 1G8MA 4G63A 2O1XA 5BUSA 1XTZA 1J20A 1JLLA 2A33A 3I6MA 5HIAA 2UUCB 1UC8A 3F7TA 4L9AA 3HGQA 3K1AA 2WOOA 1FDIA 1QYIA 1BC5A 3P2KA 4AU1A 3I6ZA 3LMKA 2FLVA 4D43A 1FFDA 3WDLA 2RH8A 3NT5A 4F04A 1EFAA 1QAQA 2CC2A 3G5MA 2OQVA 4QWMA 2AJTA 4I6JA 4M9ZA 3SIPA 3FRIA 4YAGA 1N4AA 1R6VA 3VQTA 1MOQA 3SJAA 4K6CA 5I51A 3LNCA 4NCJA 1NLFA 2W2QA 1SKYE 4PONA 2ON6A 5TF0A 2D1QA 1NVVR 1M2OA 1SELA 2QTHA 3OIUA 4K46A 2FW9A 3GEGA 1ILEA 4XSHA 5INTA 2QIOA 2D4AA 3LH5A 5JEDA 5ADWA 1BA3A 4DJTA 1UZLA 4JXKA 5GZ6A 3H8WA 4V0OA 1OVGA 4CODB 1O97D 2H4YA 3B9RA 4ZDIA 3LXRA 1EA7A 1GNVA 4MW5A 4IG4A 4XVHA 4L9SA 2P9ZA 1MJNA 1BQ3A 3WOVA 2E3JA 5IAJA 5FYDA 4QU5A 2VUTA 1FRQA 1Z47A 2FZWA 4M0LA 3LUAA 5LD2B 4DTIA 3DE2X 3BBPA 3ZIDA 2DLCX 1TTPB 2VF8A 1UODA 4ZHQB 1RXVA 4I8IA 4KE8A 2UUBB 1XTIA 4MDHA 3W8EA 2BPOA 4BX2A 2Z2XA 3EDCA 3RV4A 4G5YA 1ZQ1A 5ALPA 1XPOA 2ZVDA 4BUCA 3QYAA 3B78A 3VGPA 4E21A 2PV7A 3JVEA 4HB0A 3EZ7A 3EJ6A 4MVXA 4CQJA 5KREA 5KQGA 2B94A 3B13B 3GHYA 1Z2CA 1UOQA 4UNRA 3LC0A 3KZOA 3QV2A 4RY0A 1X7XA 1N8KA 4ZU6X 3GVCA 2OFPA 2P2CA 3ZHQA 3UK2A 4FYXA 4URVR 1JF8A 1HZZC 4NBTA 1L5ZA 2QHXA 3RI3A 4L75A 1JFFA 1WTCA 2P0EA 3LW8A 5IUJC 4P53A 2YJ6A 5CYPA 1NONA 5IYZA 3GEIA 3UWPA 4BUJA 4JBIA 1G7CA 1P5ZB 2J3IA 5DK6A 4Z4CA 1P4RA 5A1JA 3OZWA 2JARA 1ADBA 2BONA 3I53A 3PEUA 5I45A 5CGZA 4WLFA 4D44A 3OPQA 4J43A 4LYDA 3GOHA 3D7RA 3FHJA 4QPCA 4S05A 3WIDA 1QO7A 5KHOC 3QFSA 4RTOA 4JSYA 1R50A 5FP0A 1T24A 5F3DA 1U3UA 3R5XA 4QFMA 1P2BA 1QO9A 1OMOA 3EXEA 2PVCA 4I50B 3FLBA 3O7MA 1Z56C 2P3LA 4JI1B 1CXZA 4UUBA 1U2PA 4LYGA 3GDWA 2F3TA 4XRGA 1OFHA 3P4UA 4FHZA 3VNVA 3M6UA 1MNQA 3OIYA 3GUCA 3FCCA 1FFSA 1E20A 2W6PA 1XGKA 2B2CA 2F1KA 1AHIA 2YBEA 1S2LA 3DKKA 4GFDA 5G4KA 2XXAA 4KLZA 4PC3A 2VDQB 3UNXA 4V39A 3SR4A 4OJNA 4M54A 1TGVA 1C3LA 1Y81A 4XUGB 4J91A 2X8LA 3BB3A 4BHTA 3C43A 3OZRA 3RNOA 3WWYA 1Z5WA 3UY4A 4JL6A 1N2JA 2CT8A 2W22A 3PC8C 3R7LA 3CLRD 3TAUA 3ICWA 4QUKA 2X4GA 5MN4A 4MGZR 3SNKA 1LW7A 3L06A 2WIKA 5CBPA 1QG4A 1P7ZA 1IPFA 1KDZA 2ATEA 4ERNA 4E2WA 1MP0A 1R66A 2IP4A 1ULAA 2MDTA 3DBOB 4CWAA 2IYNA 4YI5A 5FBQB 3ZVKA 1CCWA 3JQAA 4KQHA 4G81A 4IEFB 4PGMA 4RE5A 1YS6A 4CR7A 2X19A 3GL9A 3EQZA 2I55A 1CU1A 4RZ2A 1Z75A 3A4NA 1CHNA 4F9EA 4MR8A 2HNBA 5CLLA 3V3KA 5K05A 1W34A 5A9SB 3IEPA 1YL7A 3OFVA 5B6JA 4A10A 2BY4A 1RI1A 2QENA 2NU9B 4HGQA 2RE8A 2EAUA 1QRSA 1RJ9B 4UUPA 2JVKA 1N8SA 4YQYA 2RGCA 3WYDA 4G67A 1N9KA 1I2AA 4IXMA 5AIBA 3NTUA 1FP2A 2J09A 2N46A 3D64A 2WE7A 4WUTA 2P3SA 4LF7B 1TU3A 1FBTA 3ZHVA 3WOHA 2N1MA 2DETA 3U4DA 2QD3A 1ZY2A 3U31A 1O6FA 5FJJA 5JY1A 4JYZA 2QL5A 3P2EA 3C3PA 3FYCA 2XHZA 1W1IA 4LDNA 2YJNA 2QTFA 1P4AA 1QOQB 4FLMA 3RDPA 2CUKA 2DFKB 4MA4A 3PRKE 3JXEA 1NXXA 1H42A 4EKYA 2OYRA 5HDQA 3T3MB 1XAGA 5DNVA 3ZLVA 3L5KA 2W7TA 5TVGA 4M7PA 1XQVA 4RVOA 2HXGA 4XWWA 1KI6A 4FJ2A 3RANA 1QVAA 5CXQA 1FSPA 1ZGJA 2W6ID 4QAJA 3PNVA 4AY6A 1T3HA 1QS0A 3OTWA 1YB2A 1WLSA 3PC2A 4R5HA 3C3DA 2YXDA 4J0EA 4MS1A 2CKDA 2HRCA 4F5ZA 1PZFA 2M6SA 3O6VA 1U7TA 1BD3A 2FR8A 2GCNA 5AHRA 1JE1A 4GZ6A 5HSGA 4P7BA 2JEYA 3PPIA 5BPFA 5JBQA 2P9CA 1UM9A 2OFXA 3MCUA 1BW9B 2QE7D 3U44A 3U9TA 2GYVA 4LC0A 2VXCA 2D00A 2YY5A 3G0OA 5JAQA 1DQRA 1G21E 1XCLA 1ZOPA 4G5FA 4QOFA 3WV5A 2ZI9A 2ZIXA 4JZKA 4K3UA 4Q4HA 2IZOA 3F6SA 4Q34A 4U2FA 3WSWA 3ROQA 1E1NA 3AEZA 5E6SA 4NK5A 3STVA 4LJSA 4HYYA 2HCRA 3EFHA 2Y93A 4K81B 4R68A 5EWJA 1J0XO 2ZR8A 3G68A 4OQ4A 4LY3A 3BJZA 3UA3A 1OF1A 4XXHA 2VP6A 5HVNA 3F96A 3IOMA 1JHUA 1JAIA 1XVIA 4HX2A 4ND3A 5ALDA 3TE6A 3G85A 1CZHA 1XDSA 2GUGA 3I2HA 4AZ0B 4MDEA 1FYDA 4C7OA 2AGVA 1GG2A 4X85A 4LNAA 8AT1A 4O1IA 2DRIA 4NF2A 4UMVA 1E2LA 5T8KA 3H7IA 4MIEA 3QKWA 4L3WA 4NBNA 2WFMA 5G02A 3GAMA 5HKKA 4D9NA 4PPFA 5BYAA 1Q14A 4UTOA 1VTKA 3IIEA 1UPAA 1ZRMA 2I4LA 4PYMA 5E6RB 2GCGA 2XF8A 2ZI4A 5D87A 4C6TB 2OVBA 3UV7A 4LOJA 2KQUA 1PEKE 1PNTA 4UUNA 2LNDA 4UNIA 5DLDA 5A4DA 2G8LA 3NTQA 3OJLA 4WTOA 4UU0A 3RYIA 3SMQA 4B8ZA 3P4YA 2HGSA 4M86A 2ONKA 3VH3A 3I0MA 2JIQA 2R5FA 3NTLA 4MI3A 3Q7QA 5IUNC 2VDMB 2VQDA 2X14A 2X58A 5AJUA 1O96B 1F06A 3LK6A 5HE8A 3B60A 3F4KA 3IODA 3LWDA 4JDPA 5CLHA 4BLOA 1H0HA 3HY4A 3K5IA 4X9XA 5FWAA 2FCAA 4TRNA 3VZSA 1Z9BA 2V4ZA 4G5GA 2R8PA 3W7AA 7AT1A 5LLSA 5C3MA 5LQUA 2BMVA 2X8AA 1TKBA 3AFOA 3UJ6A 2ZZNA 3WY9A 2JGFA 3D8BA 4ZV9A 2XMGA 3H2HA 4D97A 2VHVA 4UE6A 3NEJA 3T1QA 3CF6R 1JDUA 2OK8A 4JB8A 4CFZA 2RI6A 2H7CA 4PLFA 3GP3A 5FKJA 4URYR 1D2NA 2VAWA 2Y76A 4FW9A 5LBIA 3WLMA 5CITA 3KHKA 1TAUA 3IO3A 4EUEA 1XP8A 4A8HA 4MQEB 2HPHA 5DN6D 1WVGA 4IFTA 4TQAA 3LNTA 1IOWA 3TQSA 4ALNA 4RTQA 1NR5A 5LJLA 2Y66A 2I3AA 4JZYA 2QQ5A 3ZU6A 1PT5A 3IFSA 4PU0A 5C4MA 3GFBA 3ADBA 4JI6B 2CJYA 3BE5A 3H0CA 3ADOA 1NVAA 1EH5A 1D8TA 1NJ6A 4GXNA 4RVGA 3TLMA 3ZVLA 4GRDA 2E4XA 4N9QA 4P98A 4ZCMA 3TZKA 2O1EA 1Q16A 1XZJA 3LUFA 4D57A 4TL6A 5FTKA 1XXLA 3S4YA 3NFRA 4GR5A 3GLIE 5CLGA 2HDHA 3HS3A 2K4MA 3NKLA 2FG5A 2YOHA 1N0WA 3JTMA 3GLSA 4AYWA 5KYWB 2BSQA 1EWQA 1Y5RA 3FNGA 2QRVB 3U5TA 4LZLA 1CUIA 1QGZA 4RKEA 2BTOA 3KEQA 4DCSA 4OMCA 1QH8A 3Q7RA 1F3LA 1Q1ZA 4N4AA 3AILA 5ICSA 1N92A 4Z8YA 2CL5A 3G8DA 3M6AA 4PCAA 4DPLA 1F5NA 2JI8A 2MSNA 1AGRA 3TLGA 2XE8A 4NCAA 2XMQA 3E7DA 2J3JA 4O4HB 5HEKA 1CUVA 1DBVO 4BV8A 1TQ2A 1A2OA 3SS9X 1N7IA 5G2OA 3NAMA 1PQ4A 4NDAA 1W96A 4PTYA 2GVDC 1HEUA 1QH1A 2AE1A 3VO2A 13PKA 1UMCA 3FUUA 3PNYA 4TZTA 3RU9A 4ASUA 5KJ6A 4LJ6A 2J3MA 3RTDA 1DAKA 1NUAA 2NTVA 3ZCRA 2CFSA 3NIBA 3DMDA 4KIWA 1EJ2A 4S2EA 5KYYB 4L8FA 3NHKA 1ZMRA 2NM0A 2VDWB 2CLHB 2E4AA 5BN1A 4CGZA 1RVDA 4CG1A 3FPFA 1IHPA 1F7VA 1A1VA 1U0RA 4QOEA 5HDBB 5C34B 3QM1A 2IIQA 4ITVA 1PD0A 4JP2A 4XB6B 3GPBA 3NKVA 3WO1A 4ZCRA 4RYLA 2DB3A 2BUCA 4R1OA 5A0FA 1NR1A 3OAAD 4FNMA 2P7IA 3OJWA 5IM5A 4G37A 1A50B 2YJ5A 4C4SA 1VPEA 1D2AA 3GV0A 3LC7O 4IDOA 1L7XA 5DHAA 4CQMB 5JQGA 2DBRA 1FIUA 3QVLA 2F55A 3SBOA 1YS2X 3GZNA 2SKDA 1WWKA 3UCFA 4BP3A 5DW3A 2HF8A 1DIBA 4R7GA 4MYSA 1I5OA 3ZWNA 2WSSA 3FOFC 2VRCD 3EY4A 3AI2A 3UBMA 5EP4A 5CFPA 4V3BA 2O2SA 1PZXA 3EQ9A 3DR5A 4GKAA 4J7AA 4Y1RA 4EYOA 1O94C 5BV8A 1LLFA 2NG1A 3KZKA 3O73A 2DPYA 4DAEA 1T9HA 4G01B 3P32A 2ZYTX 3T5AA 4LY6A 1YE3A 1GPUA 2GLUA 4IDAA 4C4TA 3HWWA 2PBLA 2QWXA 4Q02A 5KOJB 2GRUA 2JVIA 1ZU5A 3ZQUA 1MJFA 4P86A 3CJTA 5NLLA 3H87A 3RFUA 4B74A 1MJGA 2Q1TA 4YCNA 2WBLC 3JWJA 1DX9A 2ZPUA 3EA0A 2DXIA 1AKYA 1XL1A 4N3NA 4CTNA 2OTCA 4EP1A 2ZRFA 4QUGA 3R4CA 3ESXA 2PAFA 3R0IA 5K6AA 3L41A 4YO7A 1QRAA 2GESA 1G8GA 4J4HA 2PN1A 4PSVA 1WEKA 3K9CA 2LCQA 3CLTD 5IHXA 3U16A 1KEWA 3NYWA 4IXWA 1XTJA 4HWKA 4NYJR 3V33A 5EGNA 3WICA 2VH5R 2WMDA 4BX3A 1GR1A 4ZCSA 2L0XA 3WLTA 1MN6A 4EPXA 2JJ2D 3GAAA 1DQYA 1JQLB 3KQVA 5KJ1A 3KZNA 4BLVA 2J9YB 4MP3A 4GXQA 5DTJA 1P8AA 1VB5A 3RUHA 2V7VA 5U9CA 2GSWA 4A73A 1A4IA 1WX1A 1YQGA 1FYWA 2RD2A 3I4LA 2VWHA 3KKMA 4JJAA 4ZHQF 2HMUA 1QTQA 2NPIA 1PJLA 3A1UA 2H07A 3ETLA 4XFKA 4X7PA 4I3FA 2GXUA 4YMIA 2EZ8A 1H2BA 4DG5A 3V7WA 2HSJA 2ZJ3A 5C4GB 4B83A 3HK2A 4UTPA 4LBVA 3D4PA 5BN5B 3G0IA 5DTEA 1NW6A 3THWB 5BNWA 5FCDA 3MIZA 1P7YA 5KQMA 1BXRA 3IUMA 2DP4E 3JQBC 4RCZA 4I6GA 4WN9A 2XKJE 3NYQA 1NP3A 4WZAB 4HWRA 1KK3A 1G8YA 2PD3A 1WSWA 4HDKB 4GZ3A 5AKEA 3DG9A 3KR2A 1PSDA 3G2PA 3P4XA 2PSEA 4UUMA 5T4FA 3SYKA 4UOEA 4W82A 3V7UA 3T06B 4NFLA 2WPDA 3ZCXA 2YNMD 4EKNB 1CQPA 4OQYA 5AW2A 1Z6PA 2AXEA 1C7QA 1E2PA 5GOTA 4HGNA 1KMHA 1BN7A 2AD1A 1O95A 5J2TB 4DV5B 1O0SA 5BN3B 4G1MB 3MLEA 4B48A 1Q0ZA 1IM5A 1JN0A 1FY2A 1TC1A 1T5SA 2DECA 3JVDA 4M9QA 5I9TA 4Q4JB 1S8NA 4I50F 1TEVA 2I76A 3G2NA 4R1LA 1G2QA 1XUOA 3IDFA 4CKBA 3GUZA 1N4DA 3D8TA 1H6BA 2WM3A 2ZBFA 1JVSA 5DISB 5HF9A 2GRJA 2UVPB 4V3CA 4YCJA 2GHQA 3D54D 3L43A 1MB4A 3VPGA 2GN6A 4XAQA 3RRBA 1G5RA 1PIWA 1UAGA 1TQ8A 2H1IA 2Y27A 3L0YA 4Q1VA 3VHXA 1ABBA 4HAZA 4DMKA 4UQPA 1L5KA 4B8YA 2V7QA 1RVV1 1XTTA 3H2IA 2JAPA 1XWFA 1E6EA 1XIVA 2R6CA 5KSZA 4RFVA 1N0UA 1JHRA 1Z3IX 2VUHB 3ME5A 4ALLA 3L2OB 4GM1A 4UATA 4H6XA 1NIPA 4TYQA 5AVUA 2J0SA 1F12A 1FA9A 1UAYA 1UWVA 2CLMB 3KB1A 1JYFA 4UKDA 4XX0B 1M34B 2HLDD 5DLEA 2Q3DA 5EWLB 2FN4A 4QX6A 1ZONA 4BDTA 1PBNA 3M0EA 1NFQA 5BW5A 1EG7A 1KQFA 2JB9A 4M2LA 3R9WA 1KQ3A 1SCJA 4LF5B 2Q9UA 2R6DA 4MW4A 3IVMA 1B7GO 3M9LA 2GB4A 4DLXA 3R3ZA 2Y1KA 1QPGA 5DNUA 1SXJD 3K9LA 4PSAA 3PWZA 1ABEA 3PTZA 4J0CA 1VMDA 2RAVA 1V1MB 1JEQA 3DPSA 2O5RA 4KN6A 4N3CA 4IX9A 1D2MA 5ARBA 2XNDA 1FTGA 5TGZA 3ZGYA 3IUBA 2QN3A 2H16A 3KWFA 5K6RA 4GI3A 4C4ZA 5TRTA 1OZAA 2GJ4A 2AJ8A 2C1ZA 2OB2A 3BQNB 3V1TC 4EECA 2Z1NA 3W1VA 1SM4A 1VFNA 2RGEA 2VNKA 3AB8A 3EG9A 3EZLA 4KDCA 4URUR 5IKOA 3G0CA 4S3MA 3LU1A 1VPDA 3WR5A 4ZJPA 1ITZA 1ML4A 4IUDS 4KPUA 4U8GA 5I4BA 3PEVA 3W34A 3EVGA 4RX1A 4GDMA 4PZUA 1TKRA 5H8WA 1JAYA 2EGGA 4P7KA 5DHRA 2Q1WA 2DFTA 2QU7A 4FZVA 3TLCA 3DW1X 2H4ZA 4RK5A 4M1TA 2R8BA 4RM3A 4B87A 5KTMA 4AD8A 1KK0A 1LGYA 1FX0B 1ULUA 1WMEA 1Y8QA 2FQYA 2QUHA 2W2MA 3E2MA 1RE0A 1L8AA 1J1ZA 4RM2A 1M1XB 3JQFA 4BFUA 5JNLA 2CJWB 3TQCA 1M6EX 3W5CA 2I71A 4RKWA 4KLAA 3A28A 5CB8A 3NUQA 3ZHTA 2AG5A 4C9BA 1DE0A 1OV4A 3MJCA 2GI4A 3Q0EA 3I83A 1E98A 4B2IA 4I7EA 4D25A 2ZAMA 4PAWA 1Z7YA 3V9AA 3L7DA 5CT8A 1I14A 1NXPA 2IHVA 1X7HA 3MPOA 4YUAA 1L4FA 2C5EA 5AUOB 4F5DA 4EJ6A 2I62A 4M0CA 1KTIA 1P2DA 1EGAA 2HK8A 1QHEA 2RAPA 3C7DB 3I76A 3OOJA 3ZY5A 1GXSA 4QICA 4OHZA 1GU1A 3KU4A 4DQKA 3PQCA 4JJFA 3L4KA 1WHSB 3SZGA 3ER8A 1NJSA 4J9VA 4AI6A 4ZQCB 2J6CA 3OWXA 4KI0A 4M37A 4QSHA 3PT5A 4AZ3B 5LLTA 1K0UA 2V96A 4KZPA 1EIZA 2BFMA 3NETA 4C7VA 3TKLA 2R1UA 5CBPB 1L2TA 1UQRA 1KJNA 4K9MA 5B3AA 1E1RA 3W6OA 3EQ8A 5DZSA 1NSTA 3Q0TA 5BSTA 2QRMA 1TUBA 3U4MA 2AG1A 1JA0A 1SG9A 1JZSA 2AJLI 3ZYCA 3WL6A 2JFYA 2QTCA 3Q11A 4EKIA 2IKSA 5CH3A 1JV2B 2PWZA 3TLJA 4UFPA 4D8UA 1Z18A 5FWXA 3COZA 2BFBB 1E3WB 1W2GA 3FTNA 4A6DA 1E60A 4F71A 1W1UA 2IYQA 2GZRA 4KQ6A 2YFQA 4DV1B 4EA8A 4N1AA 2HU2A 1T6YA 1G5PA 1QYXA 1LFAA 2WG0A 1F0NA 2ZUCA 3CNHA 2UYQA 4Y2RA 5LYJA 1J0EA 4IDFA 4NFHA 3UCXA 4CG0A 1J42A 1N2CE 1P4GA 1RI5A 1V1JA 2YOGA 5JLAA 3RR2A 5KTNA 1W36D 3A0RB 1DARA 5EKXA 1MR3F 5KVCA 3ND5A 2ZBEA 3E9NA 3QI2A 3WP1B 4M1SA 4CL2A 3LC1O 1WV1A 5H4HA 1BE0A 1BGXT 3MGCA 3MNFA 4X8HA 1AE1A 3UH1A 1DAPA 2ZTMA 1EUDB 2DZDA 2SCUB 4HDNA 1E1DA 2VXBA 2XWQA 2OGUA 5FNZA 3S81A 2GPNA 3KALA 3CZAA 3HP7A 1HGXA 1JNYA 3GRYA 4B81A 5KNCD 1MT0A 5D3MB 3EPLA 3PGXA 3OIFA 1ZESA 2D5AA 1N9ZA 2FG7C 2BMAA 3GFSA 3A6JA 4MWDA 4XFDA 3GQVA 1ZHFA 3Q7IA 2G6TA 4FDAA 1CQZA 2AN4A 4YMHA 4G4IA 4M1KA 3ZU5A 5CM9C 4JBLA 1CX9B 1U8EA 3E53A 1DADA 5F2OA 4I6EA 4RIGA 3CCFA 2JGLA 5CRIA 4D81A 2WUWE 4FFDA 2X0NA 5LDDC 4L95C 3RNLA 4FKMA 1SOAA 1DG9A 4JBGA 4PG8A 4CPDA 1GCAA 1RCUA 1RZ3A 1XRPA 2ECOA 2EEPA 1Y37A 4MI1A 3ESCA 5CDUA 3T3DA 4DCPA 1S3IA 4PWYA 5JU6A 3EEIA 5CA1A 3HP1A 1K6IA 4MB2A 2QVYX 3EGOA 3SAJA 2ICAA 2PA0A 3AP3A 4J07A 1SBHA 1URPA 1YKFA 3FHOA 5JARA 1A77A 1IJFA 1HH4A 4AO7A 2CE2X 4FGWA 4TX1A 5C80A 2E0IA 5CXXA 2ZYRA 4QTXA 1MNAA 4ZI2A 3HB9A 3KB8A 2YYYA 5EHZA 2IEGA 3HLTA 4QXQA 1NT4A 2XA2A 4Q3KA 1A71A 3C7KA 4U7GA 5KU7A 3DHWC 4FYPA 3MS4A 4QTZA 4O4HF 3FMGA 4OSOA 4Q4DA 4RHFA 4NPCA 5AVQA 1LQUA 3UXYA 1UBRS 4HB3A 3AU9A 3OT4A 3VPFA 5BQXA 1BROA 1QZZA 1KI2A 1NP6A 1U5BA 2HMWA 1FS4A 1LV7A 4FINA 4DNFA 5ESWA 5JSFA 2CGEA 1MEOA 2AXQA 2WAMA 5H3HA 1OIXA 1ZSNA 4B17A 1WBDA 5H0IA 1OLSA 5T41A 3N0RA 4OJKA 4GR9A 3AVOA 5KSOA 4BQRA 4EJSB 3H0KA 4M1EA 5KVAA 1AKMA 2W2LA 4G36A 4QAQA 1RMQA 5JS1A 2OO7A 3C15C 1VOTA 3QMMA 2YHIB 3DT8A 4HWSA 4P0PB 1SU4A 4DKJA 5CM8B 3RSGA 4XCQA 4CT5A 4RVSA 1N2IA 5E2BA 1Y7LA 1LVGA 3P71T 4V38A 1DG3A 5B4UA 4BN0A 4FCCA 4KQIA 3WTCA 4DRZA 1DC4A 2OYSA 3FSGD 4GBMA 2W6CX 3DE6X 3P45A 2I6FA 2KLHA 2WUFA 1ULHA 4CEIB 4N5NA 1HQKA 1OSNA 2RCNA 1L5VA 2EGUA 1Z5NA 2VSFA 2IHYA 3OPMA 1Q7GA 4XZ3A 5ECDA 2W9XA 1Z5OA 3C5EA 1IZ7A 3N8HA 4H4CA 2PR2A 2XYQA 3AJRA 4FMDF 3NM5A 1QX4A 4YTEA 1N78A 1RADA 3NBQA 4O8CA 3WZ2A 2V1UA 4Q9AA 3UWDA 3KDAA 3NP9A 5IJWA 1FDOA 3BXGA 9ATCA 5JO9A 1E1KA 4UCWA 3VV3A 3WBFA 5LCXA 3TVYA 2JIBA 2IZ1A 3VR4D 3BPSA 1T2FA 1PFUA 3NTOA 4EVIA 1QGUB 2XNCA 3BXFA 3D4BA 4MYUA 1NM5C 1YGPA 2Z5VA 1GSIA 4ANFA 5H83A 4UD6A 2WAOA 1RC8A 4YAKA 2DFVA 3H2YA 1PGOA 4M8SA 2WSYB 3ILSA 3WLFA 1Z2PX 4X20A 1WB5A 1HE8B 5AW0A 5IXJA 3O8DA 4UBJA 4OD0A 3ZCTA 2R0QC 1R4NB 2FPIA 2ZUTA 3MTGA 4WV3A 3O91A 1PSWA 1OTHA 3X2FA 4A3SA 4MPTA 4IJ6A 1Y8CA 2FW8A 3M5WA 1YJBA 2QMHA 1I3NA 1NE2A 1T1JA 1LV8A 3H8SA 2ZU6A 3A6LA 4MV0A 2IWRA 3ZC3A 2Q46A 4QL3A 4D4JA 1ES9A 1YGYA 2QJWA 3H99A 2DWUA 4UMDA 1DXQA 2O6LA 4W63A 2IUFA 1EMDA 3V6MA 1KYZA 1CP3A 1TCAA 2HJGA 4C3UA 1SVMA 3G9ZA 1WY7A 1TVCA 3Q8LA 2NVUA 4WBXC 3UMFA 4QGHA 4G25A 3F1LA 1IXSB 4WCDA 3ADCA 1XU9A 1KDVA 2RFLA 2HMTA 5KMGA 3CQ9A 1WKVA 5AXDA 4NBKA 1GZVA 1UBTS 5FOWA 2PUCA 3K35A 2B7BA 1HE3A 3PIDA 4R8MA 1M2EA 3LCUA 1GLVA 3B2NA 3ZXSA 1A5AB 4AX8A 5B6PA 2BZSA 3BZBA 4HLQB 4RMIA 5DM2A 2QGNA 3MFQA 3Q9SA 4PQGA 3RVQA 2OBLA 3D2AA 3O8OB 1V5IA 1DAOA 1DG1G 1HTBA 1HURA 1Z7GA 5B3KA 3QPCA 1F1BA 4X91A 5JMPA 2IT1A 4I46A 5ED0A 2VUSA 1GGJA 1LU9A 5D6NA 3WK4A 3ZDYB 1T9AA 4PRYA 1ML3A 1E0JA 2EJUA 2GM4A 4OHXA 1UEJA 5K0NA 3W3ZB 2HLPA 4QGSA 1KY5A 3IQHX 1ODKA 4ML3A 5DRYA 2ANCA 1Z7WA 4TTIA 5BQOA 1ODFA 3CH5A 3UK1A 3OQMA 4NH0A 4LNHA 2CNBA 1H1LB 4XW2A 3DDHA 4EJMA 1JT2A 5L95A 3FX2A 3CLSC 1C9JA 4AS2A 1BMTA 4B0PA 5AVWA 1YQTA 3IP9A 1OOEA 5TLSA 1PUXA 1MFPA 3RVKA 3AUKA 4GYJA 3KG2A 4NECA 2GBIA 4K05A 3FAKA 2IYPA 1JXQA 1UC4B 1YFKA 5EJ9A 2X5KO 4US0R 2QQ0A 2JCXA 3PKZA 4U7PB 2DKOA 4QUJA 1U6KA 3PX3A 5AM5A 2IXTA 3M81A 2WG2A 2K2QB 1SU6A 2I4MA 1C9KA 1C2YA 3O21A 3K1ZA 1U0EA 3KJFA 5E9JA 3ZV7A 1IY1A 5AVVA 4KDRA 1Z0JA 3UYLA 4QFDA 2ZRQA 3BA1A 1D6MA 1SXPA 3HCCA 2V0NA 1E9DA 4EHJA 1NVBA 2YMQA 2Y1LA 1K8QA 4WQMA 4TS9A 4GVLA 4JYBA 1UWCA 1YONA 4D7AA 2I2AA 4MAAA 1CY7A 5C35A 3R0VA 4C06A 1XCBA 2O2EA 3EVDA 4H3VA 1H1TA 2OXIA 4I4IA 3RTBA 2P9YA 3IIMA 4YGXB 1LRKA 1YVEI 4L6AA 4OI1A 4DWOA 3O8CA 1HI9A 5AVRA 2A30A 1XU7A 3MBKA 4X8LA 4B3BA 1IZ8A 5JNWA 1JR2A 1K89A 1TB4A 3THYB 1T5OA 5KNLA 1HX7A 2XTJA 3CG4A 3UGTA 2F3QA 2A5GA 1W49A 2IS4A 4ZT2A 3NTRA 4WKGA 1ECGA 1TD1A 3PDUA 2JFPA 1QTIA 2KYRA 3ODPA 4RXUA 5CUQA 4ZOLB 3JZAA 2ZWOA 4M6WB 4YRPA 2XCIA 4KNVA 1X92A 4R1PA 4YALA 4ZQFA 3W8NA 1X42A 3LHSA 4F1KA 5KTKA 3A9UA 2Y0BA 3R7NA 3U7EB 3WQRA 3K72B 5TGDA 5KJFA 5F9HA 1L7PA 2BKLA 3DTNA 4NE2A 2GX6A 1FFEA 2H7YA 4EI8A 1TA4A 4W5QA 2O3TA 4BDSA 1Z13A 4MV7A 2Y1DA 5EP1A 4DQUA 2FEMA 1UK9A 4G8JA 1DAIA 4JOCA 2B25A 4L7QA 4B6GA 3NDPA 1P4JA 1QONA 3TEMA 2YV2A 3OD1A 4YMUA 4URZR 2PNJA 1GTG1 1UT8A 1MO3A 1Z2OX 1QIIA 5LB4A 3GO4A 1R15A 1YS1X 1QHHA 2QXUA 3ZIUA 1UEXC 2IU4A 4JBYA 4KXXA 1RCTE 1BYIA 2AFRA 4M21A 3B7GA 4BVJA 3U26A 2JVJA 4RZXA 1PTJA 2ZRKA 1JW9B 3QWBA 4BO3A 2ZYWX 1MZPA 3KE9A 3ASYA 2VA8A 3PGA1 3LLVA 1K2WA 5B3JA 3WLAA 4PNZA 3ORSA 2VI5A 4UPDA 5H9WA 2O0JA 3KKLA 2ZATA 1T4CA 2PSFA 4OMFG 5H5JA 3ZW7A 3NV7A 3RS3A 3WBBA 2FEAA 2O8EA 4NBWA 1YRYE 1JVNA 4PIVA 4I66A 4ABYA 1L8OA 2AN1A 1V8FA 2IEBA 2JLAA 2PFKA 1CY1A 2NYVA 5GVRA 2G9NA 3U1VA 1SCDA 2PGLA 3RBVA 1IY8A 2I1WA 3BULA 3IEIA 4D46A 1GDTA 3U48A 4F12A 3R3XA 1KOGA 4ENRA 1E0KA 3DAYA 3GQBB 5FOQA 1L5HA 3QXCA 1FSSA 5TMPA 3LQ2A 4FDLA 4HNQA 4HH4A 4RBNA 5GM1A 5TPWA 4QEDA 3OQIA 4D0SA 3VH4A 3RBAA 4YHHB 3GLQA 4A8TA 3E8XA 4EEZA 6REQA 4PV7A 4I1OA 1SZCA 4KV7A 4LOLA 3W2TA 3KNZA 2AUMA 2AYYA 2X0IA 4DHWA 2UXDB 4P93A 1UXOA 2CFIA 3OZIA 2M6KA 1XZHA 1EPUA 5D5PA 5ITVA 1GGFA 4WOCA 4N3GA 3AERA 1T29A 3RJZA 1MKYA 4INOA 1CS0A 2XEXA 3CRMA 3A4IA 3KSMA 1TD9A 1CUEA 4JOQA 4L51A 4YJGA 1C14A 2IGBA 3QPDA 2H18A 3RLIA 4KSYA 1VHDA 4EZBA 4EF6A 1YUBA 1RXSA 3GELA 2OV1A 3BK7A 1IDOA 1L5MA 4JYCA 5HTOA 4MKXA 2QUKA 4RY8A 3FN4A 4O59O 1RP1A 1Z6XA 2NADA 3AF4A 1F4VA 5GGYA 1PR1A 1N36B 1YS7A 1DKPA 1HYBA 2GMWA 4XQCA 2RHJA 1QGAA 2GNOA 1KR5A 1U02A 2QW0X 1EFPB 1PJ2A 4X93A 3TRDA 3B5EA 5JBIA 2IXFA 2J9XB 3EVBA 4LZNA 1T1GA 2GVNA 4JP3A 3OIDA 4WWHA 4YO8A 2VH2A 3G2KA 2RHWA 1I7SB 1JSLA 3TZHA 1HDRA 5SZKB 8OHMA 3AVXA 2P69A 3K70D 3QU5A 2ZITA 3MWDA 3DKPA 1T10A 1Z15A 1G6Q1 4WXMA 5JCJA 4IO0A 4W5NA 4ZC1A 1KJIA 2VN8A 3HKEA 1VYTA 4LCJA 4QYIA 5LQCA 2P6PA 3CNBA 1GLGA 2VTKA 2W2OA 5FR1A 5FPKA 1X0XA 5T7BA 4E14A 2APJA 4BBPA 3EAGA 3EVAA 3VPXA 4C3ZA 3MXTA 4PLCA 4LOKA 4OYRA 3OZFA 3IP8A 4YROA 2B1JA 1RZVA 5DSXA 4BNDA 2C2BA 2V58A 4NAHA 4QXAA 5T6MA 5C1IA 1VXOA 1ORRA 3Q7SA 4I4TB 1XCGB 1I01A 5H4GA 2O4CA 1BZYA 1OAOC 2YIDA 1C4OA 4RXMA 4EOGA 1DO2A 1VL6A 1L7NA 2G6BA 4GKVA 4OBWA 4QHYA 3D5QA 1U8TA 4DQDA 1HDGO 3KAJA 2ZB2A 2I6GA 3PSHA 1BAPA 1CQIA 1GTVA 3BCRA 5LQSA 3AKZA 4EPYA 1TLFA 1CF2O 2QVGA 5EXSA 3FGPA 1Q17A 3CXRA 3PV0A 4KFSA 4KPFC 4CR8A 1G2PA 1RYMA 1Y8AA 3LAWA 4YRIA 5C5EA 4FC6A 2XBMA 1XYYA 1NHWA 1E63A 3F2VA 3TG2A 2A5JA 2VYFA 5ES4B 4UNNA 3AX6A 4R2KA 4A4DA 3CVXA 5E1BA 2PZKA 1Q2UA 3H0EA 2JBWA 3F5MA 4IUCS 3CRW1 1PGPA 1JEDA 2PGJA 3C39A 4CLDA 4QDKA 1C0EA 1OJ7A 4QUEA 3SDBA 3UXMA 1A82A 5HRUA 3BRQA 2WTMA 2Z9CA 4P5DA 1OI4A 4TXHA 2W8BB 2FR0A 2PK3A 3E0XA 3MJEA 4OCZA 2R8OA 1E3QA 3KOXA 1NVVQ 4PAOA 1QMPA 2YBDA 3LUHA 2Q27A 1CIPA 2BBOA 2FQ1A 1PYGA 2XNHA 3KETA 3EC2A 3E8MA 4FJ0A 2O50A 4OXNA 5JFTA 3KQNA 4MS3A 4OLAA 4N7JA 1WY5A 5AVSA 5KYKA 2Q4TA 3PR2B 1TUEA 1SUPA 5HW0A 4YBZA 1WKCA 4IJ5A 1U0HC 1VBKA 1TZMA 3R3UA 5IVIA 4WJLA 2O5CA 4Z53A 1T4BA 2ROQA 2IYSA 5BUCA 1YE5A 4F9GA 3G7SA 4ZMSA 1U4NA 3N2YA 3FY4A 4J0HA 2ZJ6A 1XMJA 5HFJA 2CHUA 3V2IA 3ICQB 3V55A 5P8WA 2BHTA 2R84A 2HWYA 2J5QA 2Y68A 3GRVA 2MYTA 1VSTA 1XDUA 2PH3A 3USCS 2BKVA 3IO5A 1SH7A 2IXBA 4MWTA 4WKBA 4XFJA 5IM4F 4D6YA 4UARA 1NX9A 1YQWA 4HNAB 4YCMA 4D0GA 2GBCA 3CG0A 2JIRA 3DCJA 4HRAA 1I3CA 4TV9B 3UAVA 3LTNC 1GEGA 1RBYA 1KJQA 1Z06A 2D0OB 5F5LA 1EBUA 3WWDA 4BLQA 3F6RA 3AK4A 3JWPA 3IYLW 2QV7A 1JMKC 3M6LA 3AXTA 5A9TA 3PWKA 1V9CA 4R6XA 1CSEE 2B69A 5TB5A 4C0LA 5IJ0B 1DJMA 4ZICA 1ZZEA 2J9FA 2UYYA 1Z8NA 1EFUA 2AFVA 2QD5A 4NU6A 4JDUA 2FEWB 3I3SR 1NBAA 5JWHA 5JMOA 4BATA 4NZNA 3W78A 3Q1KA 3PNBA 3BC1A 3ZBPA 2C3OA 3IPYA 3KSUA 1OX4B 2UYCA 3H97A 1XTVA 4Q4AB 3GUVA 2CLSA 1DV1A 2AUNA 1SURA 2GBLA 4DIMA 2JZCA 3AIOA 2FLKA 4IVRA 2C5GA 1V8DA 1XK7A 3QBJA 2C8VA 3VMMA 2DT8A 4AG6A 1IE3A 3I62A 5ECGC 1JHQA 1TQ4A 2DCUA 4ZHQA 5HQTA 3AP1A 5DBOA 1HC7A 3SQNA 3TSWA 1B8NA 2NO6A 1UJ4A 1V47A 1XCPA 2QL7A 3QJGA 1SPXA 2QP3A 2CK3D 4Q3CA 3VI3B 1QCDA 2ZCJA 3AM5A 4D9JA 3ESZA 3QLVA 3RYTC 5IT0A 4RESA 5CA0B 2YY6A 3PIRA 3T95A 1YHYA 1Q6ZA 4NYIR 2GM3A 4IIDA 4O5AA 4OHOA 4KXUA 5EPEA 4Z1MA 2PX2A 2RARA 1P9WA 3IDOA 1I2BA 1R8QA 1OUMA 3IDZA 3NHRA 4KXWA 1NW7A 4Q5IA 2PKRA 5AI9A 5DYNA 1ADGA 4HJRA 2LR0A 1CUGA 1FTNA 1U28C 4NBRA 1MOSA 2P8JA 3DV2A 4U2EA 2VR1A 1GRQA 7GPBA 1INLA 3HDHA 4CG2A 2WYVA 3WGZA 3OPVA 3T35A 4CI9A 4XUDA 1R5JA 3DFIA 3IP7A 5ALVA 5L3SB 4OYLA 2NU6B 2VZ9A 4Y0VA 4NZYA 3ZHYA 3DLTA 3ZR4B 4CVNA 4EGJA 1UIRA 1T2DA 3FNFA 1A9SA 2NLOA 4I50A 3O1HB 4UHKA 4U6QA 1LSOA 2J3LA 1XCMA 2Z2ZA 4R1NA 4TMFA 3CKKA 4XWYA 3TKAA 2C4WA 4PN3A 5IK2D 1P33A 4X24A 2P68A 4LYFA 3U3MA 1EFVB 3NWOA 4YMGA 3W2EA 2IS2A 2Z3WA 5EE0A 4DVJA 2IIVA 2ZTLA 3F49S 4JVSB 4LKOA 4OA5A 1DFGA 4OB6A 1IUNA 4ZOEA 2QD4A 2F67A 2F6RA 3ZQJA 4H7KA 3L46A 4Y2YA 5EUQB 5A71A 1JIJA 5IULC 2WTXA 5DOVA 4KQEA 3BL8A 3QELB 3ISTA 3V9PA 2BFFB 1HMPA 1YS4A 2F90A 4QOGA 1BHSA 2FAXA 2GYUA 5JC1A 3PRJA 4GP9A 2PKWA 4H0FA 1E96A 4WXHA 1Y4SA 1R27A 3ICPA 3ILHA 1K4KA 1SOMA 2VHXA 3BS4A 5I4IA 3MYRA 3RODA 2J5BA 2I4RA 2VJDA 5KVSA 4LNUB 3C3JA 2PEYA 1D0VA 2C4MA 2HY7A 1CY2A 4ARZA 2BJWA 4WESB 4DIFA 5SV2A 4ZOCA 4GOMD 2WJ4A 3OTOB 4BZZA 1NF2A 4GKJB 3LKBA 3WGLA 1YR3A 2BGRA 2BF7A 5K7SA 2QXTA 1XG5A 1UCFA 3LV8A 4AICA 4Q1CA 4Q3EA 5DCLA 3WYAA 2ISCA 4DUGD 1A7AA 2O2GA 2ORED 3X1JA 5A9SA 1HLFA 3EG5A 4QQFA 1KVRA 3K4QA 3NT4A 4WCFB 3HO6A 4P31A 4CIWA 2NU9A 3N2GB 2O8NA 2IHUA 4PXAA 4ZO6A 1RJ9A 1V11B 2XYRA 3A1CA 1OBFO 2GSDA 5A5DA 3K70B 4CNQA 3A6FA 3DWEX 4TWJA 5JDCC 3UTDA 2YN4A 3WMEA 4TTJA 2I2DA 5JAIA 2HA6A 2W4IA 3A2KA 3GVXA 3N86A 4ZAXA 1DEHA 2C2YA 1ZVJA 2WF8A 1V48A 5G53C 1E5TA 2R66A 1N57A 2FJ0A 2A5DA 3TOCA 3Q6IA 4QU0A 2D0DA 1HT2E 2OORA 3AR7A 5EMJA 5BQ5A 3WRYC 5KKCA 2ZE7A 2JGEA 3QLTA 3G0HA 1C8LA 2YWJA 4ZOLF 3WL3A 1H5NA 4WDRA 3H9JA 3UCEA 3WGMA 16PKA 1VIMA 4E2XA 4AN4A 1DOHA 1UP7A 1VJGA 2CMGA 3T4XA 4RACA 4ZVMA 4DCCA 1XZDA 3ELBA 3NIFB 1CKEA 2IF0A 4IMIB 4MLDA 1GRRA 4Q6WA 5IT4A 4NU8X 4YH1A 3F9IA 4Q05A 3A3PA 4ZD6A 3IKVA 3WWEA 1E79A 1HE4A 2ZUBA 5CNIA 1UKYA 5DM1A 3T12A 4QUHA 3HA2A 3RREA 3OU2A 3V5NA 3BWEA 3UICA 1DXOA 2VYVA 4CMKA 3M8KA 4RHYA 4EBFA 1E3TA 1VRCA 4RY2A 2EJTA 2CNLA 4HGRA 3V7YA 2PUEA 1MRSA 2FSVC 1C0LA 3QMWA 4RL6A 3NYRA 4JX8A 1RJDA 1GL7A 2WAAA 4NMHA 4O25A 3RVNA 1Y1QA 3ZBQA 1H2YA 1BW9A 4GPD1 1L4BA 1KK1A 4Q9IA 3UT6A 1N2EA 1WDMA 5BR1A 5KTOA 5KZMB 3Q7PA 3K6SB 1RQNA 4GEGA 4K6KA 5EINA 3WQHA 4EPWA 5JATA 4OQQA 1NL3A 5KVQA 4KGVA 3GNTA 5E7MA 4C0SA 1N6HA 3AF2A 4DB4A 2D8AA 1TVEA 4OREX 2VRBA 3MAJA 2Q6IA 3LDUA 2GA8A 3C1UA 2O06A 4PNEA 2P6NA 2WJ6A 2CJXA 3JARB 2I5PO 3ZEAA 2WLTA 1XVAA 4MUAA 4AZ0A 1T6XA 1W5EA 3E1SA 1O1YA 1X7DA 2IXGA 2WHQA 3FOBA 4KSBA 3GGGA 4QPPA 4ENUA 1F60A 3IP6A 2JFWA 4IGFA 1OH5A 2QX4A 1RLIA 2XUKA 3BXPA 1RHJA 3IBYA 4IJQA 4BVHA 3Q85A 1ECFA 2C4HA 2GM9A 4FU0A 4QPJC 3T0IA 3VR5D 1EFLA 1UT6A 3T1VA 1JRLA 1Z2EA 3QXSA 4OGWA 3EPRA 3TEFA 2R6ZA 5DBIA 5E6RA 2QRZA 2RCYA 3VNAA 1IWOA 1E2IA 2WWIA 3LVBA 5K3EA 1KU0A 5ALZA 1NYLA 4RTMA 3GFQA 3TQFA 1S2IA 4OAQA 4D79A 1EB8A 1MD9A 4ZVSA 1F6WA 3GCWA 3IVRA 3O94A 1SUAA 9GPBA 4DV7B 4C0XA 1WXWA 5KC8A 1LPNA 4A5OA 1O96A 2ZIZA 3RFVA 5JD6A 4I99A 1RXWA 2VJLA 2DKFA 3T7SA 4EGSA 4F2WA 1RP7A 1X38A 4C5BA 2VUIB 1GPKA 3OOHA 5K4HA 3GLHE 3NHBA 2OMKA 2R6HA 4BV3A 4DZTA 4ZTZB 3S68A 2FCRA 1YNOA 2QG4A 4LMAA 1SQ5A 4NOKA 5JSQA 2AIRA 3CISA 4K9PA 4DV2B 1G9XA 1KE1A 1NN1A 4JJ8A 4GBJA 2PRKA 4IVPA 2EHDA 4PBRA 2E4VA 3EVTA 4NV1A 5E3IA 4HMPA 3K8YA 4LSWA 1YWGO 2VT2A 1TTHA 3B52X 3LDFA 4ME6A 3SIRA 3WAKA 4JVLA 2AW3A 4BWYA 3IBGA 2VXYA 2WJAA 1I0LA 2O2CA 4GT1A 3PJFA 1SD1A 2GEJA 5EPOA 4PG4A 1GKIA 3G9TA 4ODIA 1C0PA 1I3LA 1DPFA 3PFBA 4OO3A 2PKEA 1TIKA 2ZI6A 4H1UA 3WLNA 1IYZA 2EEZA 2BGIA 4M9SA 4MWGA 4X3OA 3C7TA 3LCVB 4JHXA 2B78A 5A4FS 5LMNB 1P7WA 1TJYA 2ZK7A 3GFRA 5IEBA 5CLQA 3SP1A 2W6QA 3A6KA 1OTYA 1ZWKA 1Q0RA 3UJ3X 4DPKA 5EFOA 2O4UX 3HXKA 1NZFA 1LK0A 1K4YA 5KYWA 4I4TF 4EITA 4B3CA 3CRQA 3KYDB 2QRVA 1QK5A 3DA8A 2VSOA 1YVDA 1Y42X 3FKQA 1SU7A 1DSSG 3QWHA 3AJ8A 4LXTA 5JNRA 1QFYA 4DC0A 4W8HA 1MRNA 3THOA 4AXBA 4D9BA 1KMCA 1XBTA 4U5XA 4LXQA 1TEHA 1YRWA 2DUJA 3MMSA 9LDBA 4QELA 2YV1A 1IBKB 1KL7A 1TEZA 3AEQB 1R5NA 3KKQA 2XY4A 4WLNA 4O4HA 1M5TA 2H31A 1U90A 1W581 2WYHA 3PX7A 1E9EA 3E4DA 4WD3A 3HL4A 1QF9A 2Q5HA 3FNQA 5K0JA 2FMHA 2V6IA 5GPBA 1W5AA 2JCGA 2CV1A 4QDTA 4NBLA 4CGYA 4ZGGA 1U1IA 3IKLA 4Y2UA 4HXFB 4OLJA 4BTEA 1U0JA 4LJ5A 1F4PA 1YV9A 3E7PA 3SNHA 1XT6A 4C0QC 1O6BA 3IQZA 4ZO7A 1GVHA 4M1MA 4BTVA 1WHTB 4QM7A 3QW4B 2VDWA 1U7PA 2Q8QA 2BJHA 1U1CA 4ISBA 4F4IA 3DM9B 2PJRA 2FEKA 4I36A 5DX1A 2WIDA 4W5OA 3QVXA 1CRPA 4BB0A 2VAXA 2XGGA 3BL6A 5F2NA 5DNYB 4DLNA 1G7SA 2BGJA 2HA7A 3Q5GA 3D6VA 4IINA 3EPHA 2DR3A 4E3ZA 1WQ3A 2UZ1B 2H2HA 3BXZA 1P39A 3G9QA 3IJEB 1GYRA 3OCYA 3UKOA 4RAQA 4BLUA 1L3IA 3UPUA 2YXPX 3CUTA 3VPHA 4NYJQ 4YYEA 3PRYA 3O2SB 4CQMA 1JFLA 3RS5A 2ZTVA 3LT5A 4EY6A 4X95A 2A7XA 4UVIA 1J24A 1M7BA 3LJKA 5AKLA 4F92B 3H5TA 1XZAA 3I2FA 3E7FA 1R2QA 2YMMA 4XH9B 4P2GA 4TYYA 1THGA 1VKHA 3IS3A 3KOMA 4R98A 3GLHB 4AVYA 3NNNA 3QEBZ 1A2BA 1QIGA 4NCNA 4BEJA 1NVXQ 5M3BA 2C7BA 1WV0A 3IT3A 4B3FX 5JLJA 3T3GA 2NXEA 1TK9A 4ZPXA 2WY2D 2AE2A 2LVBA 1SHLA 3HV2A 2BI8A 1Q0LA 2V3VA 4TV9F 1N6PA 3R9XB 4AWBA 4KO2S 1NBOA 2CV2A 3CEPB 2ZRPA 1Q22A 2VHUA 2FWJA 5F51A 1TVKB 3S7ZA 3TM5A 2GH1A 3ND7A 1JBEA 1GITA 3IMCA 1TU0A 3TL2A 2Q2NA 2CL6X 1VLJA 1XZQA 3MTEA 5JD5A 1NV8A 3NEAA 4G5QA 3EVFA 3HACA 4L9WA 3OE1A 1DRWA 1K0FA 1FU4A 1IZ9A 3PTLA 5CFZA 2XLBA 5KHLB 3PVCA 2VT3A <