1USGA

L-leucine-binding protein, apo form
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
345
structure length
345
Chain Sequence
DDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKGGIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMISPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARSVQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWHADGSSTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structures of the Leucine-Binding Protein Illustrate Conformational Changes and the Basis of Ligand Specificity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords LEUCINE-SPECIFIC BINDING PROTEIN
total genus 138
structure length 345
sequence length 345
ec nomenclature
pdb deposition date 2003-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usgA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1usgA01
3OM0A 4H60A 5BRJA 3CHYA 2GI4A 4W5OA 1SXIA 3FGZA 4N76A 4NCBA 5IX8A 4WZZA 2PUEA 2HPHA 4B09A 5EWLA 4RXUA 2PL1A 3TX6A 4MS4A 4XASA 3OLYA 1USIA 1XHEA 1F4VA 3FDFA 3F7NA 3KLOA 4RZSA 4FB4A 5KQLA 1DBPA 1Z16A 4LE1A 3NNNA 2CD7A 2A9OA 3IP6A 5I4CA 4LE2A 3KKEA 3RVLA 1ABFA 3A3KA 3IDOA 4EGSA 5IUKC 3KG2A 4LRQA 1Y1LA 4DN6A 3Q7SA 1BDJA 1CEYA 1ZDMA 2FSPA 4CBVA 4RXTA 3HCWA 4PICA 3HSYA 2FQWA 3SNKA 3EULA 5FWXA 1ZN2A 5BR1A 1YS7A 4DQDA 5JNSA 2F8TA 1PUXA 1APBA 2RJOA 3HUUA 2WRZA 4PE5B 4RY8A 5KI6A 4Z4GA 2WMYA 3O75A 4P98A 2L19A 2JBAA 3QK7A 3IPCA 1B00A 4DADA 3HDGA 1GCGA 2HQBA 2MYPA 3DZDA 4RKRA 4OATA 3H5WA 4G97A 4PYRA 3UKJA 3IPAA 3KCNA 3HZHA 4H3HB 4MYRA 4QICA 1NXTA 3OLWA 4FE7A 1DP4A 4Z9AA 3Q15C 3Q7TA 2OQRA 3E61A 1XHFA 1DZ3A 3CFYA 1AB6A 2GX6A 2NT3A 4LDAA 1YS6A 1KRXA 3CRNA 3ROTA 2A9PA 3OQOA 4JAVC 3T8YA 2IKSA 5IBQA 7ABPA 2VK2A 4G0YA 2WB4A 1RXEA 2E4VA 4RK0A 1JFVA 3IP9A 5GQSA 3N75A 4HNRA 4W5RA 1ZGZA 2NT4A 1GUDA 5E3JA 4YP9A 3JPWA 4WT7A 1ISSA 5CNKA 2JVIA 4MR7A 3QEMA 3I45A 1JH9A 2JVJA 1U2QA 4Q6BA 2PUFA 2PJUA 4GNRA 4NQRA 6ABPA 3UUGA 2L17A 2M98A 3BBLA 5FBHA 5JNWA 3EQ2A 2FMHA 3K9CA 4HNSA 4QYMA 1L5ZA 1ZH2A 1K66A 4YWHA 4HNQA 3N8IA 4UHKA 2VYCA 3RVPA 4RU1A 4RS3A 2IYNA 2PKXA 3EJWA 4TMYA 2IOYA 3H5LA 3SY8A 1JDPA 5TPZD 1Z26A 1M2EA 2N9UA 5IEBA 2HJ9A 3HM9A 2B4AA 1ISRA 3NHZA 3KTOA 1LBIA 1GUBA 3HUTA 4S04A 5FWYA 1YTUA 2L18A 5ED4A 1QNLA 1DCMA 4MLDA 1M5UA 4Q6WA 1D2AA 2VUHB 3LUHA 3LUJA 1PEAA 1VRVA 4YV7A 1CHNA 3QLVA 4G0MA 4XLTA 1C4WA 2PUCA 3H5TA 1QKKA 1LJUA 1T34A 4RK7A 3RVOA 5BQ3A 1KMIY 4N03A 2ID9A 4KZKA 2MYNA 1H9CA 4MR9B 4EVRA 3QELA 1TMYA 3ILHA 1EWTA 1JF8A 1QPZA 1E6LA 4EY3A 1M5TA 1DC8A 3TMYA 3OQNA 1JFTA 4N0PA 2J48A 2R47A 3CTPA 4Z4EA 3O1JC 1OXKB 5TQ2B 3HV2A 2LP4Y 5HQJA 2VUIB 4MS1B 1FFGA 5ABPA 2PUDA 3HEBA 3VNBA 4Z4CA 4QPJC 3D8UA 1U8TA 1OXBB 1LJLA 3JPYA 3GT7A 2H0AA 1YK0A 2DRIA 1HEYA 3SAJA 3H1GA 1P2FA 4IF4A 4W5QA 1NXPA 2FLWA 4XARA 5HKOA 1QMPA 3TD9A 3NBMA 2ZWMA 5FBKA 4ZMSA 3QX9A 4ETNA 2QU7A 4RK5A 2PE5A 2L2QA 2MYUA 3GA5A 1RXIA 4WWHA 4F8JA 3JS5A 1VPWA 1XWWA 3D02A 2RDMA 2WJAA 5EWJA 3T95A 5JNUA 2E4WA 1F51E 1QQAA 3QLVC 1FSPA 3S99A 2IPAB 3CKMA 3MQ4A 3MA0A 4MR8B 1I3CA 3G1WA 1CYEA 5HSGA 3N0XA 4RK4A 5KQMA 3KYJB 2NZUG 2KYRA 1BDIA 4LE0A 1QO0A 2E4ZA 4MLCA 4NV3A 1D1QA 1DRJA 4OG2A 4MQFB 4F12A 1JWLA 1PNRA 4TLMB 2HSGA 2FMIA 3O2SB 3O1HB 4YLEA 2M1ZA 3OQMA 3KLNA 1NTRA 3O74A 4XAQA 3EDCA 2JK1A 2E4YA 2PMCA 3OO1A 2IPLA 5TQ0B 4MS3B 3IP7A 5D2CA 1MVOA 4XXHA 2FEKA 3OMWA 1URPA 3H75A 4ML3A 3LUFA 3OLVA 2RJNA 1P6UA 4IRXA 3F6CA 2XDYA 3F6PA 2Q5CA 3H5OA 3T6KA 4MQFA 1ZHHA 3RQIA 4FE4A 1EWKA 4G0XA 4D6YA 3QEKA 3QLTA 3EGCA 4YO7A 1NXVA 1A0OA 1ZY2A 3RVRA 1SD5A 3EODA 3BREA 3MM4A 2TMYA 3RVKA 1USKA 1MB3A 4RV5A 4EVSA 3L6UA 1L5YA 4EUKA 4KNYA 3JY6A 3I09A 5DCLA 2ID7A 3LUGA 3A10A 4F06A 3Q9SA 1SXGA 3LKVA 4ZJPA 4Y9TA 1JYEA 3N0WA 5T7BA 3OM1A 3LMKA 3TB6A 4IMJB 1MIHA 2PUAA 5DTEA 4OLAA 1PNTA 3H5IA 2A9QA 3MMNA 5IUJC 4RY9A 3O2JA 2NUBA 1YIOA 4G86A 4EYGA 3C97A 4RK6A 2AYZA 5IEJA 4F3TA 2QZJA 1U0SY 1E6KA 2JBAB 1ZAYA 2QV0A 1P8AA 3QEMB 4IMIB 2P9HA 2LIVA 5TPWB 5C5CA 2E4UA 4Q7EA 2WWVD 4G0OA 1W25A 1JDNA 4JP1A 3LFTA 4MS1A 2JCGA 9ABPA 5JNRA 5TE9A 2V0NA 3I5AA 1D4ZA 4W5TA 1ZVVA 2GBPA 2PUBA 2NZVG 1EAYA 5EWJB 1W9HA 5GOTA 1Z25A 2IPNA 2QVCA 4EYOA 4MR9A 2FQXA 4WXMA 1Z2EA 1U2PA 1ABEA 5JS1A 4LX8A 1BVHA 2R25B 4KK3A 4MGEA 4ZMRA 1BDHA 3C3WA 3OO0A 4P1ZA 2MSWA 4TLLB 2FVYA 3LTEA 3UK0A 1VLZA 1DRKA 1QO0D 5IULC 3VNAA 4RWEA 4ETMA 1P6QA 1Z17A 1Z13A 3HXMA 2BGGA 1U04A 1TM2A 1GLGA 5FWXB 1ZESA 4EVQA 3O21A 2CHFA 2LUOA 4Z4FA 3KHTA 4OLBA 4OTZA 3Q7RA 3C6QA 3OLZA 4O5AA 1PEYA 1Z15A 4KK4A 8ABPA 2PUGA 2MSLA 4Z0NA 1LK0A 2GKGA 4UHJA 3URMA 3GRCA 1E2BA 3LUAA 5TPWA 4LZLA 1TVMA 3SM9A 1JBEA 1YVUA 5DKFA 4KMRA 4KVFA 4JA2A 1RZRD 5DLEA 1FQWA 3H5VA 5CNJA 4RXMA 4RK1A 1DBQA 4EYQA 2JRLA 1YK1A 3CZCA 4H3KB 5CNMA 1A04A 2R48A 1SXHA 3QLUC 2WY2D 4EYKA 1SRRA 3FFTA 1JLKA 3M9XA 1JYFA 4W5NA 3DLHA 1RZRA 4JOQA 3H1EA 3KS9A 4WUTA 3HK2A 4MQEA 2IPMA 3H6GA 4Z9BA 1NXWA 4HYEA 4KQ9A 5T3YA 2FEPA 1A2OA 1QP4A 3LUCA 1QQBA 4MAAA 4YS6A 1WETA 4Z99A 4G0QA 1RPJA 2OENG 3R0JA 4E7PA 4TN5A 4RKQA 1EWVA 2I6FA 3RH0A 5KWSA 1C0EA 3JVDA 3E3MA 3HJFA 3LOPA 3FFXA 5B3JA 3P9YA 3BRSA 1NXXA 3BILA 1MAVA 4GPAA 4N0QA 3RVSA 3HS3A 5KC9A 3CS3A 2IDMA 5B3JC 2A9RA 2FKAA 2X7XA 3LUKA 3MYYA 5JS2A 4F11A 4Z4HA 1EFAA 4KRFA 2FMKA 2ZAYA 1JL3A 3MF4A 4MS3A 2QVGA 3JTEA 1DCKA 1YMUA 3F73A 3JVIA 1YMVA 3CZ5A 1D1PA 3B2NA 4IILA 3I42A 2PAFA 4ETIA 1QP0A 3GL9A 1DBWA 3DGEC 3HO1A 3KJXA 3FFWA 4N47A 1R8JA 2CWDA 2B1JA 1JX6A 4LDZA 3G85A 3HVRA 4Z4IA 1NXOA 4KQCA 1ZITA 1S8NA 1M2FA 3A0UA 2HQRA 3L49A 1RNLA 1USGA 3HDVA 1NXSA 3NNDA 2FW0A 5KQGA 1VKRA 1KGSA 1FFSA 3NNSA 4G0ZA 4MPTA 4MR8A 1NY5A 4KPYA 2CHEA 2P4UA 2QR3A 4RSMA 1Z2DA 4ZPJA 1DCFA 1JHZA 3O1IC 6CHYA 1LBHA 3O2QB 3NHMA 2AYXA 3OMXA 2JVKA 3M6MD 4YR7A 3RVMA 5JNVA 4D6XA 2H3HA 5DGCA 2GWRA 5F64A 2MSKA 1QP7A 2HQOA 3C3KA 2FEWB 3K4HA 4MS4B 3EQZA 3N6VA 4G0PA 3N0RA 5CNIA 3DLBA 3C3MA 3KSMA 5HM6A 1Z18A 1Z12A 2WJWA 4JB0A 3RVJA 4M88A 3DGFC 2FQYA 3CG0A 2W42A 4ZYLA 1EHCA 3N53A 2MYTA 4KFCA 3A0RB 5KQPA 2QXYA 5TQ2A 1KRWA 4MRMA 1GCAA 5CHYA 3CNBA 2FN9A 5JNTA 2YHBA 5TPZA 3QELB 3DBIA 2LBPA 3ROFA 2R4QA 3CLKA 3RVQA 4O1HA 3LKBA 1BAPA 3GV0A 2FXIA 1TJYA 1DJMA 3LUDA 4YRZA 4KREA 3Q41A 3IP5A 1DC7A 4KV7A 4L4UA 4RDCA 2E4XA 4JASB 2YHAA 1BA2A 2LPMA 3MIZA 3W9SA 4WXEA 4N41A 3FMVA 3KYIB 3OLXA 5EWLB 4NICA 5IUNC 3SG0A 5FWYB 2FMFA 5TQJA 3H6HA 5BRAA 2PL9A 3QX8A 3GYBA 1PHRA 4PEVA 3CU5A 1K68A 4NCAA 1MB0A 4S05A 4E7OA 1AB5A 3M9WA 5KC8A 1IIBA 1NATA 4MQEB 4XFKA 1UDRA 3SQNA 3BRQA 2FTKE 4RY0A 5IC5A 5EWMB 2QSJA 5PNTA 2RGYA 4IGAA 2FLKA 4YCSA 1TLFA 1DG9A 2FN8A 3H1FA 1ZH4A 1JFSA 3GWGA 3GBVA 2PLNA 3ILYA 2F8SA 4OBBA 1ZGGA 3CG4A 4YGXB 3GBPA 5TQ0A 3EAFA 4QYWA 3QLUA 1FFWA 4PZ0A 2JB9A 1D5WA 5EWMA 1E6MA 4MRMB 2O20A 3TO5A 4JB2A 4MR7B 5C5EA 3RVNA 1J56A 4O1IA 4D74A 2QW1A 3T38A 4L85A
chains in the Genus database with same CATH superfamily
1T35A 5GAJA 1RXCA 2CZGA 4NCBA 4AP5A 1NR7A 4JQCA 5EWLA 2P3QA 1IHUA 2VHZA 4GG1A 5JXGA 1ZBDA 2PTGA 3U17A 4RZSA 4MQUA 3PQ8A 2PQ6A 4JJ6A 1X80B 1OFIA 3C8DA 1XBTA 3Q3EA 1O9HA 2VT3A 3D1JA 3WO1A 3HFSA 2BY4A 2QL9A 5F77A 4QFMA 3V48A 3T7DA 1A8SA 1O03A 3LS2A 1P61B 4TSRA 1RCFA 2QD3A 3CNOA 2JZNA 2AJLI 4BBPA 3PYXA 1JLHA 2B21A 2IH5A 3Q2OA 2O0JA 3TI7A 1ZD4A 3TKAA 2HXGA 2QGNA 2FSPA 4J6FA 2NG1A 1AM4D 2MIIA 1T9AA 3MJRA 1MZPA 1R0SA 2W8ZA 1XD2A 1AKVA 1WCXA 2EWMA 1E2GA 1ZN2A 4BFCA 5BR1A 4DQDA 4M0FA 1YS2X 2ACVA 5K0GA 3E9CA 3VVLA 3CCBA 5CLQA 1QOZA 5FI3A 1F12A 2Y93A 4L6AA 4EHDA 2GYVA 4NPAA 3UWOA 5B12A 3NH9A 1UWKA 3NM4A 4DUPA 1IYZA 5SICE 3U4AA 3S29A 4B6QA 1FPMA 1L5VA 2VJQA 4F4FA 2C57A 3NANA 5FOXA 3UZUA 4YP1A 4E31A 2QY9A 4EENA 3CLVA 3WMGA 4JI4B 4MVJP 3GOQA 4TWRA 4UU7A 4CLXA 1W93A 1AKEA 2X3FA 3P2MA 4NATA 2Q4BA 4PYRA 3GN2A 5BPHA 3J80A 1XK7A 2IOFA 3OQIB 6GPBA 2GEDA 1N36B 4OQPA 3HZOA 4B7XA 2UZ1B 3Q7TA 4GE0A 3OQHA 4C3ZA 1BXKA 5H7XA 4RH1A 3VTAA 4ITVA 2NT3A 3KLPX 1J2RA 1YS6A 4XIJA 3AB7A 2HHHB 4ZXFA 1FB5A 4PZUA 4ENVA 5IKMA 1E2JA 3NHAA 5A03A 4WDRA 1MXHA 2Q3JA 2VSNA 4NG5A 3WYCA 2AFIB 4G0YA 1SK8A 1W49A 1LW6E 2VH1A 3K2EA 3LC2O 2AWOA 2HLNA 3WI7A 1HDZA 3TZ6A 3IH5A 2FP4A 2I76A 4IO0A 3MMSA 1YB1A 4ARIA 5BV2P 3GFFA 1RTTA 3I72A 1DIRA 1SVIA 1TEVA 3IHTA 5FUMA 3I9LA 3ZC3A 2V45A 4PXYA 5EJGA 5HJ2A 4Q6BA 3RHSA 1IG3A 1BWSA 4UM8B 5GP1A 6ABPA 3ESRA 2M98A 4F4DA 2QGFA 2YXDA 3COPA 3T5CA 4EWLA 4O4JB 3E9MA 5CDFA 5HVNA 2N75A 1RRFA 4M54A 3ZI7A 3AVWA 1G9SA 2OYRA 4RIGA 3VHQA 4KDFA 5E4YA 4LC9A 1SEVA 2Q6KA 2B7BA 1Z26A 4NOJA 4P7GA 1Q0UA 4R69A 3ICWA 4YRRA 2B4AA 4BRUA 2BZGA 4HVCA 2A30A 1YTUA 3JASA 3GRKA 1H2XA 2QSYA 4ZYWA 3ADOA 4BKMA 3KNZA 4OAPA 4XEUA 2II6A 1CX9B 2ZT6A 4B3MB 2I3DA 3QPVA 2JH8A 3UJAA 1YCGA 4ZVTA 3H83A 1KJYA 1H2WA 3VPHA 1VFNA 2FHPA 2P0YA 3L6EA 3L7NA 2Z43A 1HNZB 1NZDA 1VRVA 2HO5A 3L4BA 3QLVA 3MHTA 4FDUA 2YTZA 1W85A 1Z9BA 2RC5A 2PWZA 3H9GA 3KVVA 1L3CA 1U4NA 2H1IA 2YQ4A 3WK5A 3A6DA 3HLKA 4OQQA 3F4LA 4EJ6A 3C3CA 2CLKB 4PSVA 5GJVC 6REQB 1WKCA 4PN3A 1S02A 4L57A 4DRZA 1Q57A 4WAUA 2QD5A 3REFA 1B15A 1HR0B 1NURA 2V03A 3RFVA 4WASA 4E6EA 5DIZA 4OJYA 1SCDA 4S2UA 4UUAA 3OX4A 2R47A 1BO6A 2FZCA 2OZKA 3ZEAA 4AJHA 1K63A 3KOWA 4ZDWA 3W7AA 4TVSA 2X40A 4EA6A 4H1UA 4RO0A 2Q3DA 2JEOA 3AFNA 2GRUA 3ZYZA 1B7GO 4HCJA 1SVSA 1YBHA 4MYDA 5DLQC 3HYLA 1AGPA 4QPJC 4AL4A 3ZVLA 4L8YA 1IATA 1KAHA 2JFOA 3IGFA 3HGQA 2FK8A 5K09A 3WOVA 1NW9B 2X15A 4YVFA 1SXJD 2AHOA 3G0BA 3AOEA 3KBBA 4DWVA 5JSFA 3QX3A 1ZIPA 2PLRA 1N1EA 3E0XA 3P0FA 3F9RA 3T9FA 1N5MA 4NECA 1FOEB 2GPAA 1NW5A 3UB4A 4YJDA 3CGGA 3UOGA 5I4IA 2DETA 3QEOA 2NX2A 2PGIA 1V1RA 3LP8A 3N28A 4RHXA 1UOOA 3NBYC 4D92A 3NALA 4CF5A 2CFIA 1PR5A 1YGYA 3ER6A 1OWPA 2VDVE 3RYHA 4Z6KA 1R6AA 3EGXB 2OB2A 2Y4NA 2J33A 2P2ZA 2Z2XA 3RJ5A 4F2WA 4RTJA 4FNMA 3P5BA 5H8WA 1N9KA 2QRQA 3MJEA 1GLNA 1ODCA 4L9WA 2BR3A 3L9XA 4LVOA 1XQ1A 4QHYA 3MXOA 2FP3A 2NXEA 3W9UA 3IV7A 1O58A 4JBIA 1Y6GA 2L0XA 1OLXB 4O8CA 4Y2GA 2ZGVA 1USUA 4ODIA 5LQUA 4MQFB 1UDWA 1JWLA 3GJ0A 2GD2A 2EJWA 2HSGA 5CMLA 3WGLA 5HK9A 1UMKA 4JJAA 3K2IA 1J70A 3FSRA 3B12A 5JVDF 1NTRA 4XAQA 3ILVA 2H63A 4BNXA 1J39A 2FPIB 3JAKB 2I2AA 3K73O 1PQ4A 4KU4A 3GJTA 3AR3A 1JJBA 3SD7A 1QGOA 2FEKA 4ISCA 1SN7A 4IDAA 4WECA 4WLOA 1WWKA 1P6UA 4LYDA 2H7YA 1GGVA 2WDPA 4TWBA 2W6IA 1F6BA 2Y6VA 2HGSA 4FCWA 2FN3A 2NZJA 2QLFA 2C82A 4G0XA 1TD1A 2P9TA 2GEBA 1Y8AA 1VFPA 2J6CA 3DFMA 3FUCA 3GYGA 3OUZA 4PHGA 4WOBA 2Q3HA 3MC1A 4CMJA 3DVLA 4BKOA 4B2IA 1LPAB 1Y7HA 5DFAA 1YR3A 5EQFA 4YACA 3EFOA 4QOJA 3CH7A 1L4EA 3EDRA 1XDDA 3JD4A 2ETVA 3QFRA 1UK8A 4PX2A 2EIHA 4XGRA 3FKSD 3T9EA 3NR2A 5IHXA 3BA1A 4BNJA 1DAKA 3IRVA 5DV9A 3PFFA 4BB0A 3LPLA 3ZY6A 2EYUA 5A4KA 2VP5A 4YFVA 3NT5A 4QA9A 3QTTA 2XB8A 1S3GA 2BHTA 3JAWA 4DSTA 1WXIA 3SF8A 2QDKA 1ULHA 3QVKA 4REQA 5EFOA 3ILXA 5EKDA 3PUHA 4C6HA 1KWKA 1UMBB 2NUBA 4IJWA 1A5TA 1QGUA 3LBIA 1ZKMA 3WL6A 2QXTA 2H18A 1E9DA 2QYOA 5K3BA 2JBAB 2LW7A 2ZZNA 2DHRA 2V1XA 1FTQA 3W5SA 4AJ2A 3BIWA 5CDSA 1Y7IA 3LDGA 2OCYC 2E4UA 4G5HA 5AJHA 2CNKA 5DSZA 4Q7EA 2WWVD 3MIIA 5KOJA 4PN7A 1PTKA 3TSOA 1IE3A 2DFNA 1N0UA 3LFTA 4MS1A 1JEJA 1XI2A 3ZHZA 1E60A 1T3GA 2AXPA 3R3WA 4Y2YA 3TUIC 2PUBA 3DHEA 1HG1A 2BRUC 4RBNA 2BCJQ 3EXEA 4FD3A 3SJ7A 1XZGA 3RRXA 3AIIA 3IQXA 1E7MA 4LJ9A 1Y9ZA 1MAWA 3O4VA 3ZZUA 4GR5A 4CUJA 2HJSA 4CLRA 1V43A 1U2PA 4U8HA 2XTMA 2FHSA 1XRMA 4BCBA 2P11A 1V0JA 3IPYA 1F20A 1NKTA 1YE5A 5KMGA 3GJQA 4QUBA 3ZXUB 4EJFA 4DSAA 3RG2A 1R5OA 3GJ5A 4HNGA 2MTBA 1QKJA 2WWGA 2MSWA 4P80A 1ODJA 2FVYA 3LTEA 5KCZA 4I2NA 2G71A 3IVGA 4MOWA 3AVXA 4A0GA 3AY0A 1UODA 4I1YA 4ZCSA 1MPXA 1TKRA 4I9HA 5DM0A 2BGGA 4FFBB 3FIJA 4C76A 2BTOA 4ILEA 3C4JA 2VQ3A 3QWIA 3WKDA 1F4LA 4DPMA 1JSZA 4PLCA 2FR0A 1WU8A 2DR2A 1H93A 1P77A 3V34A 1ZD2P 2OCDA 2R6GA 3R23A 1QIJA 3D3WA 4W1SA 3VVMA 3HXLA 1KJJA 1ZI6A 3K0KA 3D54D 3GAZA 1XTQA 5K0EA 4XA8A 3LCUA 4PZYA 3BXHA 1RABA 3QBJA 3ESXA 3KUUA 3DLAA 1KDYA 3TMKA 1XTVA 3OC6A 2FE4A 3X1JA 1SXHA 1RAAA 1DBIA 1B76A 2PRSA 2FPMA 4RQBA 2DT5A 4V1CI 2DBQA 2OAQ1 4ZZ3A 1EVZA 1UJBA 421PA 3V42A 1ZRSA 3HM2A 1JR3E 3QVTA 2AN4A 2GESA 4Z3KA 4D8TA 3PNBA 2WAMA 5F23A 1F8YA 3DAHA 1VA5A 9LDBA 5JXHA 3BMNB 1E9VA 2WW8A 2WAYA 2YRWA 4E07A 1ISJA 2C42A 5DGXA 2HF2A 4R31A 2G6TA 3M89A 1FRFS 2CB9A 3R0XA 5JZVA 1EG2A 4JZKA 4U7WA 1S2OA 1MOPA 1M2HA 1PWZA 1E9EA 2IZ5A 3FPJA 4PIPA 1GLVA 5LJLA 1XD9A 2IS4A 2JI6A 4HWRA 4Q00A 4ZCIA 4JP5A 3ANYB 2P9YA 3BKXA 3EVFA 5JZSA 2HDOA 2HJGA 4BRWA 1SVWA 2D0IA 4LNHA 2VTKA 2FA9A 1I51A 2B78A 2FKAA 2VJMB 2X7XA 1AKRA 3H3JA 3JYLA 3QHPA 4G5OA 5KDOA 4EHLA 1OGJA 3DBLB 4IHJA 5F2KA 2ECKA 4A0HA 5CITA 2ZBDA 1XZJA 4JH0A 2GS9A 3EN0A 2ZRHA 1AXEA 1EDDA 2W43A 2GERA 4HO1X 5ALFA 4B8YA 4BGUA 1U3WA 4C4YA 4IOJA 5TF4A 2VATA 1EUYA 1DBWA 3Q1LA 2J3EA 2YWGA 1R7RA 2GCGA 4MVWA 1YQ9A 1UKAA 1R5BA 2IZ1A 2JIBA 1L1FA 4QXRA 1JHAA 2Y66A 5K6AA 3ZK7A 3I9V1 1NVAA 3L49A 1PR9A 4GZMA 3NTVA 4RLHA 3ZDDA 4Z54A 5CYOA 3CY6A 3SVZA 5HHTA 2RHCA 1KI4A 1GADO 1VDZA 2K4MA 3RVBA 1YB7A 1BS9A 3AI1A 5FA6A 3ETDA 3OKPA 5LA6F 3L6CA 2B1QA 4J4TA 2R6HA 4ARSA 1XQXA 3M6MD 2R11A 3DCJA 3QSGA 4YCJA 4B4DA 5BVHA 2D1RA 2I78A 3ZNQA 4BE7B 2L82A 4CG3A 1M7HA 3WIBA 2GAIA 2AG5A 1VE1A 3GDHA 4YMWA 3UC9A 1IONA 3TQIA 1T9GR 2RGUA 1O97C 2FPKA 2WKQA 1HFJA 4BGVA 5D86A 5JASA 1CY4A 2XQFA 2FLVA 1X8KA 3N0RA 4MV9A 4NE9A 4WESA 3O3CA 4LRTB 2B8JA 4ZYUA 1C0KA 1O1YA 3AUSA 4DIOA 2C8VA 4X20A 3L1VA 2FYTA 3MAAC 4ARUA 2BI4A 4HDSA 3ZCVA 5DTMA 4UHCA 2X0KA 4AZ3B 2YVQA 5KNDA 1X92A 2NU7A 2KB0A 2WG2A 5CM8B 3RI3A 4D9JA 2P4HX 4DT1A 3O8OB 4FM9A 4U7PB 1AZTA 2BGKA 3OJOA 4J0KA 3RRBA 1C9EA 3MRSA 2PMFA 3TD6A 4IDGA 5LOVB 3OF3A 3TOSA 1QIDA 2LBPA 3NJ8A 1KP2A 1N8SA 5JDCC 2QSUA 3LKBA 3WJ1A 3FOAA 3WGHA 4HN2A 1O94A 1DZIA 1ONSA 3PEVA 4RHEA 1K75A 4PPQA 1DJMA 2YMPA 3FTQA 4LFBB 3BK7A 1RAIA 1SXJA 2BDUA 4HGRA 4CM9D 2IW3A 1G8HA 2IYYA 3WR5A 6AT1A 1W34A 2OZLB 4ZYVA 5K8VA 3OCJA 3H0EA 1SIOA 4ZEVA 1L7QA 1B0UA 2HRBA 2CMDA 5TQJA 1BTOA 3QJ5A 2ZIXA 2Y1FA 3N8HA 2BTEA 1TM3E 5EIWA 5I45A 1P2DA 3FVWA 4R6XA 4GKVA 1AB5A 3A4NA 4M53A 5C37A 1FFHA 3WGUA 4X8OA 2IYAA 5K3SA 1JA1A 3NHRA 4MITA 3SYNA 5TSDA 4P38A 3GDFA 4BJ3A 2A0YA 4IGAA 1EX1A 1X0XA 2R3SA 1OJ7A 5I9SA 4DLYA 2QAIA 2HA4A 2DUWA 3K94A 4OHVA 4TRRA 1G0OA 4KQ2A 1UOQA 3IIKA 4AJ4A 3UH1A 1N7HA 2HCTA 4I1SA 2XXAB 4L4ZA 3F9CA 1M6YA 3JD2A 3RS7A 4M36A 3WLPA 1I7QB 2OCXA 1XXHB 1DX6A 1MDFA 3HBJA 2P62A 3F49S 1C30A 1MJ5A 1SBIA 4Q3AA 4PWZA 5CLLA 1R6VA 2OBXA 3DV9A 5EWMA 3TO5A 4DV6B 5C5EA 3A3OA 2PKCA 5T4FA 1J56A 1ZA2A 2HCRA 2JGFA 1EFLA 1IDOA 4B6OA 4CTOA 3LA6A 1M8PA 2AVDA 3BWBA 3PE3A 1RAGA 2ZLBA 4PG5A 4Q3LA 1UMDB 3HXKA 1X9GA 1OBCA 3ENVA 4M2LA 4RJLA 2P2GA 3EDYA 1BMFD 1R66A 1T36A 1Y1QA 4QPZA 5K8IA 3QE4A 2YYAA 1YO6A 4M0MA 5JXWA 1BG6A 5KVAA 5FOUA 1KS2A 1YMQA 1FK8A 3I1YA 5ADUS 3ICPA 3BE8A 3PRKE 4LTNA 5JADA 5CAEA 1CW2B 2B6HA 2FGKA 2HL6A 3K15A 4KQKA 4R1MA 4UPDA 1MNQA 3VTFA 1NJ2A 4ACBA 4L50A 5CFQA 3WLSA 4QLOA 1C7FA 1TI7A 2CD7A 5DNWA 3OHMA 1XA0A 3IP6A 4DCSA 2BFCB 1G3UA 1YZVA 1C3OB 3SWWA 5DCUA 3F5SA 5ALLA 5AXCA 1GNQA 2X0DA 2WF7A 1FJ2A 2CXRA 2DOKA 3MWKA 2J9ZB 4EGSA 3RG8A 3VC3A 1ECBA 3V4FA 4DN6A 1V4NA 3NOQA 2NO6A 5EMHA 5EHZA 3STWA 4KN5A 3UK2A 2LKDA 1VI2A 1Y1TA 1I6WA 3U1VA 2J59A 3SBOA 5HF8A 4IOLA 2CEKA 4B2PA 4PICA 4DRYA 2OGTA 3R9IA 3ORYA 4MV4A 1OTHA 3SNKA 3UMGA 3EIHA 3NIFB 5IVDA 5GVSA 1NMYA 5KOJB 3QYAA 4UHHA 3IURA 5F3DA 4MKGA 2NADA 1Z07A 1KVSA 2NU9A 3IO3A 1W52X 4OLFA 3Q9NA 1SPXA 1JNXX 3OFND 1CV2A 3PNOA 1YQDA 5E2AA 3TGPA 2O48X 3H9EO 1JALA 4ENPA 2O14A 1VHJA 2V7TA 1AD2A 2VQ6A 4IS3A 5F35A 5FNVA 5H3HA 5EKUA 4TRMA 3UHOA 5DF1A 3BA6A 3SF8B 1ORTA 2BRUA 4HEHA 4K9NA 3SLKA 5KSYA 4BDSA 5MN6A 4YQYA 3OZGA 5A62A 2GX6A 2ZR0A 3PGXA 3TVYA 4U8GA 3ZHTA 3WFJA 4DANA 5FBLB 3O93A 3RFTA 3WKEA 3LRPA 3SYRA 4TYNA 2E4VA 2W2LD 3BJRA 3FWNA 1K3TA 3PF9A 2IEIA 5HCUA 5LXTF 1A2BA 3PDJA 1GGEA 1NF8A 3VZRA 3PC8A 3NPMA 3QEAZ 1KP9A 4DMGA 1EFPA 1EZ1A 4JC0A 3K09C 5KIAA 3A6EA 2QTNA 1SK9A 2AOVA 1WKBA 2G1JA 3BX1A 3UMYA 2IS6A 1A1SA 2IZOA 1NF9A 1AK2A 1ZN7A 4I19A 4LXUA 1IN1A 1HYHA 4RGQA 2PUFA 3OZSA 4KX5A 4Q93A 3AI7A 3PXCX 1P3JA 1IY0A 1Z4IA 1HKUA 3L8DA 4J7CA 2JATA 3EYAA 3VR3A 4MEJA 3HVHA 3NU1A 4MAFA 1FMJA 1JEOA 4IW3B 4NZOA 3AIMA 3DVQX 1FSSA 4B4OA 1KVUA 1K7SN 3JVVA 4DA6A 4P22A 4WY2A 1YI1A 3E8XA 1VZ2A 3R5FA 4HNQA 4DCJA 2MU1A 2IEZA 3RVPA 5CW1A 2VHUA 3NFYA 2QJWA 2J30A 1KHHA 2N9UA 1IZ9A 5BWBA 5C53B 5IEBA 3V7NA 4URWR 1E2EA 2OYCA 1SA0A 3NHZA 4CQMD 1K9SA 4DZTA 4QQ8A 3L43A 5CLIA 4HVAA 5K8LA 2B4KA 4GQAA 2L18A 1L4LA 3SFZA 1I9GA 4DTCA 4MVJE 4UULA 2ZSIA 3GLIE 1DJLA 3FB1A 1N5KA 4GS5A 1KYXA 3C14C 1R15A 1U9CA 2ACWA 2OORA 5HBGA 3OBIA 4LNAA 4QNNA 5FOTA 2TMDA 4DIEA 2BN4A 4KBFA 1KVQA 3MOIA 4TMKA 1U0NA 1DAIA 2WYOA 3ENNA 4NNOA 3MWGA 4DEXA 2NYRA 3LCCA 1NSYA 1V5EA 3PXEA 4V0RA 1TT7A 1BGWA 4OL0A 4EI8A 1SEPA 3K5WA 1K89A 4KMOA 2ID9A 4YXFA 2XKAA 3P9KA 1TM1E 2Q6LA 5AI0A 3O8RA 4IMRA 5JD3A 4X90A 2ZRAA 3EZNA 3R2JA 1ZOOA 3S1LA 4EY3A 2DTXA 1JQ3A 1LDYA 1ONBA 2ZVPX 3O91A 3QTLA 5G1OA 1SHLA 1KJQA 2JAPA 4FE3A 4P33A 4PNZA 2R1ZA 1XR3A 5IXSA 4BNMA 3QI7A 3NMUF 3JR3A 3H7AA 4CN9A 4RHUA 1DHTA 2VZ0A 1FTGA 5JJIA 1CIJA 1P8JA 2ORED 5DI9A 3V1NA 1T1IA 4FB5A 3THXA 3OD5A 2WE8A 4C7VA 2Z83A 2BE7A 4QKQA 3RGWS 5LR6A 2GO7A 4DC0A 1UCFA 3NQ41 1YHYA 4B73A 1RJWA 5B57C 1Q12A 4F3NA 4R51A 5HRUA 1IMOA 1HEYA 1VHLA 3WK6A 2ZE8A 4EUEA 4BNWA 3EZ6A 1BEEA 2QI9C 3BCSA 3KXPA 2CY0A 1VYUA 3BCUA 4FMDB 5TX7A 5LQKA 1TC1A 2XYHA 3T54A 3PD1A 3NATA 1NXPA 2YYSA 1T5IA 3LLMA 1WV0A 1TYDE 2CC2A 4FK8A 2XTZA 4B87A 3DMRA 1HDOA 4QU9A 5ALPA 1GOTA 2E49A 4M7WA 4KPFC 4Y2UA 5H9VA 1GFZA 2BSXA 1NM5A 4RE6A 2VBFA 5EUQB 4N0DA 3BIOA 2WM3A 4G0VA 2O6HA 3JTMA 3RIEA 1YE8A 1ZMTA 1NASA 4XGQA 3N7AA 1V8FA 5IYZF 1NSTA 1P9OA 4IJ5A 4XD7A 1QVRA 5AFSA 2CVZA 2GEUA 1CQIB 3U4DA 1ETHA 4KSYA 3FMOB 1E62A 4IEEA 1DUIA 2CHGA 4L1KA 1NV9A 4MLCA 4MLZA 1PD1A 2WSSA 1DEKA 3LIIA 4NV3A 1WVGA 4XSVA 4WY8A 4AN1A 1PNRA 3UG7A 2GEJA 3O1HB 2M1ZA 4UBKA 1CZLA 3S2UA 3T4EA 4HEA1 1U7PA 2NN3C 4URYR 4TYWA 1AH2A 4MS3B 4JVSB 3GAAA 5D2CA 4JGBA 4TQGA 3E2PA 4TWIA 1GYPA 1A69A 1GT91 2WABA 3MD9A 5J59A 3P7MA 3F6PA 1JB9A 2IZZA 3WDKA 3OZUA 5IAOA 1OYWA 3GJ7A 4DNOA 2WNIA 5D5HA 3EOBI 1EWKA 4DIKA 2C29D 1YZLA 1RYYA 1XZCA 2OO5A 3OCXA 2OHJA 2Q1XA 2WT4A 1MJFA 1ZA1A 1Z0DA 2OBYA 5EPEA 3R0VA 5CB6A 4K6CA 5KNDD 1MQ9A 3G88A 2UVQA 3I01A 3LBNA 1KJ9A 1QS0B 5M5BA 1J0CA 3SEAA 3JY6A 4U2GA 2UZAA 5FR2A 3WBFA 4UDYX 2ZCUA 4OPMA 3E5HA 1N9GB 3M6XA 4G5YA 2AOUB 2WU1A 3ZPXA 2I3BA 4YAWA 1B3RA 3BF7A 3DV0A 3WGOA 3ADKA 2F9MA 4CF4A 3C8ZA 4W9RA 3KB6A 1Z8FA 5HA5A 3B2EA 4YHHB 4HRAA 3P0IA 2XPCA 5CURA 1GU7A 1Y4ZA 1VHTA 4GXTA 4UKDA 3OY7A 4ENUA 3Q98A 2XKBA 3GUYA 4G86A 4KB5A 3NTXA 2V6FA 1LPBB 3PCTA 3N05A 1NTOA 4K8OA 1ZK0A 1C4XA 1FFAA 3UAOA 1ZVMA 1L4UA 3PUWA 1B74A 2XVXA 4CT5A 4EJSC 3T0FA 5E6SB 1RADA 1DAMA 4UE3S 2LIPA 3AF3A 1KNQA 4E2XA 3DO5A 3M0EA 4PX3A 3UK7A 4ESOA 2O8BA 3D4PA 4JIGA 5D7BA 1WZEA 3S3TA 2B3DA 3REGA 2HCJB 2Z4RA 2WB2A 3TR6A 1BGXT 2IPOA 1Q7TA 3KXLA 2W93A 3C3AA 4II3A 3IP8A 1C1YA 1P1KA 4MGZR 5ALGA 2QP3A 3U49A 1KMNA 2JJYA 4DCMA 2QSZA 3CNNA 5A2GA 2DU8A 2Q9UA 2FQXA 1BWRA 2Q2OA 3PNLA 3PXAA 1J8YF 3SXPA 4WJLA 5H02A 5LUBA 3C8HA 4P35A 3W05A 2R25B 3G0OA 3IJRA 4GMGA 4WOKA 1UXOA 1JDZA 1RJ9B 2GMWA 3GGOA 1CP2A 5CA1F 1R10A 1DAPA 1SVKA 3M49A 1XZLA 3U56A 1D2GA 1Y5LA 1KMMA 2RK3A 4URXR 4FLFA 3UVEA 4FMPA 3AFMA 4TKUB 4UEQA 3LO5A 3SXUB 1SCBA 1WZNA 3L1JA 3M9LA 2OLEA 5LKRA 1K4MA 1Z82A 3GMTA 2XCLA 2RCYA 3O8QB 1L4BA 2GRJA 5DCWA 3KQLA 2WFLA 3DDZX 4OKIA 1KC3A 2XUAA 1VYVA 4B35A 1MQSA 4V1CA 3COVA 5FX2A 2VA8A 1SZDA 3DM9B 5IKXA 4J16C 4OFWA 2C5AA 2CSXA 3TRFA 4KUHA 1J1ZA 4LNUA 1J1IA 1MOQA 4N5NA 4D9KA 2PUGA 3L02A 2B8NA 3WBJA 4Q9KA 3IKTA 3AEYA 4KFSA 1RMQA 3GRAA 4YGYA 4P7KA 1ZQ9A 2JLAA 4HDRA 4ZVOA 4C0SA 1ADJA 2QUKA 4HQ0A 1G1AA 4IMPA 5BOVA 1BCSA 2VWPA 3CZCA 1VG8A 3CUUA 3UOAB 4CTJA 1EUZA 1WAMA 2O3SA 3AT1A 2CMFA 1UF9A 3Q40A 2CNOA 2VNIA 4GZLA 2FFAA 5F33A 3ND9A 5JCOA 1KS9A 3IAM1 4OJKA 3HBNA 1NP6A 2LDXA 3FNQA 1GT6A 2BFNA 3HNOA 3WHIA 4EAQA 3ND6A 1P7WA 1RJEA 1UKYA 2RHBA 5COBA 1ADBA 2KI5A 1JMVA 1N9GA 4GR9A 2DPYA 1EFDN 3D7NA 3G8AA 1VCMA 1Z5OA 3MMPA 4IZ6A 1HQDA 3P4YA 5EL0A 1JSRA 3MJFA 1FFEA 5DNCA 4X64B 4RKQA 1Y4SA 4K5QA 1G5PA 1NYTA 2I6FA 5CX1B 4IGFA 5L3ZA 2PL5A 1UJ2A 1YGPA 3T7EA 4ATNA 1RKUA 3FOEC 3C16C 5FR1A 1PFVA 3KKNA 3FCSB 4QNMA 2BHRA 1QDUA 1VKNA 1ZXXA 2X8JA 4GPAA 1GG8A 1KYZA 4KIJA 4QQRA 3E5MA 3WL3A 1U0TA 3MN1A 3CS3A 3GJYA 2IDMA 1M5RA 4N65A 5JS2A 1JQDA 4Z4HA 4CL2A 1CF4A 4HXGA 2YUIA 3IMFA 1YMUA 2VCYA 3OUTA 3Q3VA 1PUJA 3NHYA 4PCLA 3TI9A 1JLRA 4B9AA 4AIIA 4YDSA 4LXTA 3L0BA 4UQOA 3S4YA 1E18A 2DTEA 3GGSA 4N47A 1IY8A 1A7KA 1GU1A 2EXXA 1XAGA 5ALQA 1JDVA 1WPQA 4OSEA 3S0JA 1J9GA 2GILA 1NJ5A 1M6HA 2HV9A 1OYVA 2PUWA 1CQPA 3DO8A 3MG9A 1S3FA 3MYRA 1QNFA 3JD0A 4HQ6A 5FO0A 1NZJA 2WJ6A 3EWIA 4BGDA 2FPOA 2FWRA 2QJOA 2AYYA 2CCKA 5EIAA 1KVTA 1QZZA 1O0SA 2HSDA 3S5JA 4ENSA 1KIMA 3SPXA 1XA4A 2IYWA 1X7XA 2Y9PB 2YBDA 3D0RA 1DCFA 1IVYA 1IXZA 2F1RA 1AS2A 3I9OA 4O1MA 3IT0A 3JWGA 3QVGB 2WHEA 3OMXA 1D6SA 1L7MA 5BR4A 4TWZA 5HPYB 1XZPA 4YASA 4LXQA 5EHNA 4RETA 5GONB 1QB7A 4BX3A 2QD2A 3WGJA 3FR7A 3IAS6 1Z2CA 4N40A 5EN4A 3V9AA 2VDUE 2C4MA 3DFKA 4XVCA 2ZUSA 2JD0A 4GZ3A 1IEXA 1RWPA 1VL1A 4OMDA 2AT1A 2RBKA 4YH1A 1JHQA 3NGMA 1XMQB 1YA6A 2WV9A 5DM2A 1AKWA 5C2JB 2XUKA 2XWPA 3RTDA 4RCZA 3RBZA 5HFNA 1GTMA 1K8YB 5C3MA 4I8IA 3QY0A 3NP9A 3FWHA 5FADA 3SEFA 2RAPA 4V0OA 3DGFC 5E0OA 1DEXA 5G0SA 5JCPA 1G5QA 2SCUA 3GFTA 3KZCA 2A1UA 1CF9A 2I03A 3I6MA 1E1QA 3N53A 5FBWB 5TQ2A 1MG0A 1KO7A 1ULTA 2ENWA 2PYDA 1GCAA 1JQBA 1QRAA 1YBFA 4X7BA 3AERA 5DGIA 1DRUA 5FV7A 4QE3A 3DDOA 1L8LA 1U98A 4LECA 2E6UX 3TQSA 4IHQA 4O1HA 5DYNA 4Z4QA 1P17A 2I3ZA 3WYGA 4ZAVA 5CM9C 1TJYA 2UYCA 4FDLA 1WF3A 4YRZA 3Q41A 5A7HA 1Z73A 1DC7A 4LF6B 1MF7A 3LHDA 2EW1A 4MWCA 3CVUA 2A5JA 2AJ8A 3UXEA 4QFDA 1RKQA 2RGWA 1KAEA 3K9BA 5AI6A 2NP6A 2QK4A 3PQ4A 5EOVA 5TF0A 2B5OA 4Q4HA 3THYA 3A9CA 2Z6VA 4V02A 3EF1A 4S12A 3H6HA 4I1VA 1YDHA 2GNOA 4HH0A 3ZD8A 3HJHA 3O8LA 2PL9A 4GBMA 1ODIA 4GYJA 1SUSA 1DEHA 4UMEA 4CM4A 3GLHB 1TK3A 2PZGA 4B31A 2ZJBA 1KY2A 2C84A 4MQEB 2HLPA 3TRDA 3UAZA 4BX2A 1U90A 2C3OA 2R8YA 4RY0A 3F3YA 3EEQA 4JT4A 4CQJA 3GGCA 4E13A 5EIFA 5JANA 1RW4A 2GXAA 1KNXA 2IYLD 1P7PA 2FN8A 3B5EA 1QO7A 3VNSA 1E77A 4KVAA 1FYVA 2IP2A 4K9QA 4P32A 5ICFA 1ISIA 1DIHA 3SIPA 2XI4A 2QT0A 3CZRA 4MQLA 4OBBA 4DY4A 4LF4B 2OXIA 4RJTA 1TUGA 4OGLA 5EFZA 1PTJC 4QYWA 4REOA 3PD0A 3COYA 2A59A 1CZOA 5I47A 3FPFA 5K8UA 4MR7B 1V41E 3Q3HA 4P3YA 4Y1FA 2AMYA 3TLMA 2C4NA 1R6UA 3FA2A 4NZNA 3GLUA 2ZR9A 3U7FB 4QGBA 2HHCA 2QPTA 3A05A 1EXDA 5BQ5A 3OA2A 2XMRA 4N18A 3D3KA 3OJWA 3NWBA 3VBEA 1CR1A 1OB2A 2AZXA 4B09A 2BM8A 3C5HA 3ELDA 4HPXB 3LGSA 4RWZA 4W9NC 4R7GA 3WK9A 2PL1A 4MP6A 2O52A 4DQKA 1IXYA 4FSHA 5A9SB 4RHCA 3D59A 4ZO4A 4JSTA 4Q34A 4CTNA 5IM4A 2YXBA 1VLJA 2EG5A 3P52A 4U5XA 1Y81A 4JL5A 4X7PA 4LGVA 1YR8A 3OQIA 4HZIA 1GGNA 3IDSA 4R4JA 1K5DA 1YQWA 4BHTA 3KKEA 2WWIA 3LV8A 2X5KO 2QMEA 3MLBA 1R0ZA 1XJ5A 4V0NA 2HJVA 4JLOA 3T15A 4HLNA 4GIBA 1Z63A 5JECA 4MMYB 4YRBA 3MCAA 3NB0A 2ODAA 4KE6A 1Z4KA 5HJ7A 2QUHA 6ADHA 4JVLA 4NZZA 4EECA 5K3DA 1NW7A 2ZXFA 4JA0A 4QUJA 3ROMA 3VH4A 3CLSC 4CKEB 2X1LA 4PZAA 2JGLA 2Q0QA 1HETA 1TYZA 3EIOA 4EZBA 1V8ZA 2WMYA 3O75A 2BFDA 3DF9A 2C59A 3WRVA 1RLUA 4A0QA 2VYQA 1KZ6A 3V00A 3SXUA 3PX7A 2XA9A 1WP9A 2CNNA 5FL7A 1XDSA 2H2HA 2EFJA 3V80A 4BMZA 6REQA 5F9FA 1LBEA 2WU8A 3OZAA 4RNCA 5B6PA 3L4SO 2A84A 4FZJA 2KBFA 4H3HB 4QICA 2VYND 5ERXA 3O83A 2LRHA 5AKZA 5EJEA 4ND6A 2GM3A 3I6BA 3CFYA 5CX1A 2W6QA 3RHZA 4Q1EA 5DOZA 3GT4A 4XUDA 1JW9B 2GPYA 1X6VA 3EYWA 3L93A 2FWBA 1GYQA 5GPBA 4G4IA 3E1SA 1R8SA 1M10A 1IJFA 4O02B 3ZWPA 4ER0A 1TPYA 2LTAA 4A2QA 5BV0A 1KYYA 3CT4A 4GVPA 3RYFB 4ES6A 2DT8A 1KK3A 2J0UA 2FKNA 2BJVA 4FYYA 5CNKA 4JJIA 4D3XA 5ENVA 1KJIA 2J32A 3LECA 3QEMA 4IDBA 5AIAA 4BUCA 2W4MA 4U63A 1I2CA 2PJUA 5GZ6A 4CF6A 4EPXA 1BFKA 3H2KA 1I01A 2LCQA 1EK2A 1B6SA 1E5VA 3MTQA 3IUPA 2C00A 3N9IA 3AL3A 1CVIA 1YBAA 2EBHX 4REQB 1R0BA 4YWHA 5JZBA 4WXRA 3SYLA 2IK8A 4CQNA 4BVKA 4YRFA 4BC1A 3E58A 1EK6A 1H4QA 2OBBA 3INNA 3PPIA 1WD5A 3KOYA 1TW3A 1S8OA 4G9EA 2QL7A 4MQ5A 3C3PA 5KJCA 2Q8NA 1AV6A 3HZZA 4WLVA 3AUFA 3VR2D 3W79A 3RFXA 1DOAA 4M6WA 3WIOA 2WTBA 1ZWLA 3DOJA 4Q9HA 4QUHA 4Z1OA 2V7WA 2IODA 1R6TA 4YNBA 1M5UA 3LX4A 3V4LA 2PMBA 4Z1MD 1N5DA 1CUGA 4YJ3A 5CK4A 1FX1A 5DHSA 5JY6A 4FFSA 4MRSA 3ZWCA 1CHNA 3MBIA 3UMMA 3B3FA 2I6QA 1HYBA 1EWRA 4LXHA 4MKXA 4MVCA 1TO6A 3X43A 1HEUA 3I9MA 5HF5A 4EB6B 4U7DA 3S1AA 4BVHA 1E3SA 3PVCA 5CA1A 3LKZA 1M1NA 4HTFB 2DE0X 2JHFA 3IODA 4M8IA 3HYRA 1U8FO 3MTGA 2Y1EA 2GJ8A 3ND5A 4S1VA 1E6LA 4YMVA 4N5DA 1D2RA 1JQEA 2JZCA 3PE6A 2BDEA 1ZU4A 1YUNA 3GGJA 1N2SA 3QF4A 4CCWA 4UTPA 3AERB 1JFTA 2OBFA 4ZZ1A 2CFOA 2DMRA 1J97A 1JXAA 3CTPA 3O1JC 3TPCA 1OXKB 1X2BA 4PLZA 3PIIA 3AUTA 3WA6A 5HQJA 2WWXA 2X4GA 1WY5A 3I1IA 5E4FA 2R84A 3IUJA 2P75A 4JEMA 1S01A 1N6PA 4Z7QB 1G20E 5KAPA 5F9MA 3ZDFA 4NYMQ 1LJLA 1OW3B 3GT7A 4IQ0A 1PV1A 2CE2X 3BXOA 4BGIA 3U16A 5IT4A 1MGPA 2HXYA 1AVTA 3DEAA 1ADGA 3CMMA 5BW5A 4INAA 5DOVA 5L4LA 4W5QA 4JI0B 2JLBA 2PYIA 3HP4A 4GQBA 3TD9A 3WDSA 5KOIA 2ZWMA 1TZBA 1FIUA 1Z45A 4KYVA 5K4HA 1K4KA 1NVUQ 3C87A 1ZX1A 3ANNA 4F2GA 2BGWA 1E79D 2F2TA 1C8VB 1GTJ1 1JU9A 4N8EA 2R6JA 2R6DA 1OFUX 4RADA 2D1TA 4WERA 2E4WA 4GZ6A 4MVYA 1UKVY 4Z8YA 5JARA 2J4FA 4FZ5A 2REXB 4DSZA 2D5LA 2BMAA 2EERA 3IUSA 1E7YA 4LAFA 1VJ5A 4UTNA 5IYZB 4D41A 1TE2A 1X1QA 2PJDA 2NZUG 4HYQA 4K1LA 4EG7A 1AHPA 4JBGA 5F76A 3WDMA 4YEDA 3IAM6 2X0EA 5LYYA 3ZXSA 1P62B 5ILQA 2DM6A 4UU0A 2PS3A 1W75A 4LGCA 3IDZA 2ZRFA 1MO4A 4OXYA 1NG9A 1VPLA 3SZRA 1E7RA 4EJ0A 3EQ9A 5LLTA 2APJA 3H75A 3R3UA 3RSCA 1ZOLA 2XBUA 2WYVA 3CF2A 3VUEA 2X5NA 5AVUA 2GAFA 1O54A 1NG1A 5HGJA 5C5IA 3DC2A 4IDOA 3N2EA 1Z6AA 2X0RA 4JVMA 3IE2A 4CXMA 4AAYA 3IO5A 4GLLA 1BW9B 5A9SA 1P73A 4Q66C 5JAMA 3DYIA 2ZQ5A 5IDVA 3I53A 4IHKA 3VFDA 4KUGA 3R3XA 1TPZA 4CM7A 2GUWA 3C1OA 1U0BB 3GJXC 1WD7A 5AJZA 1E1DA 3G0DA 5DCLA 3UFBA 1GKIA 4PFSA 4XUCA 4Q1VA 5E9WA 2GYYA 1PK9A 2GAOA 2JPDA 2LVBA 1KL7A 2D74A 1FY2A 3BGVA 3GRFA 4EF5A 3OE5A 2CJWB 4R1TA 1Z34A 2JL1A 1KF0A 4EMBA 3VPFA 2NGRA 5BWMA 2HT6A 1NN0A 3MMNA 3R6GA 2EKZA 2NTJA 4O2AB 1L7RA 1K08A 2VCEA 1XQYA 2VVTA 3GLGB 3K0AA 4M7OA 1T2AA 2GLTA 2HHJA 1LLCA 4C0LA 4RD2A 5BUSA 2IV7A 4II2A 5HGXA 1SR8A 3PUXA 4RF2A 4F8YA 3RKRA 1T4CA 2V7GA 1E9BA 3LCRA 3LDAA 2QTCA 1NKSA 2ENUA 3N1UA 1HWYA 1J22A 2BR5A 4WZBA 4ZVPA 1Z29A 2OHXA 1JYSA 3LCJA 4RL4A 4TT8A 2IU0A 5CFZA 5I7OA 1EQAA 1F8UA 5IWAB 1WMSA 4EYSA 1J0BA 2VHQA 1QR6A 3ZKWB 3DG9A 3E9ZA 3F6BX 3O8QA 4WZAA 1SOVA 5F1KA 4BU1A 3TUJC 4YV1A 5IAJA 1H5UA 2NZVG 1EAYA 3O9ZA 4ZAWA 1R88A 1YH3A 1JJ7A 4BNFA 3N86A 3TG2A 1S1MA 3V1UA 1XO1A 2DFLA 4ESVA 4R81A 3O90A 3CVXA 3K0HA 2OT3B 1ABEA 4MI6A 1CUXA 4P8RA 3CR7A 1QM5A 1SXJE 1J2EA 4CR7A 4MDEA 3AB8A 1A9RA 1JDBC 3PR3A 1C50A 7GPBA 2P2LA 2C5FA 3FFAA 4YJ3B 3WKCA 4EUNA 2QL5A 4R84A 4LHXA 3FUXA 1SCIA 4B3XA 3BMQB 4DPKA 1U0FA 2JIMA 3C6XA 3KTAB 1HORA 3AM4A 1JEYA 2ASEA 1L5OA 1DARA 2VHEA 1A95A 1UP4A 2DYKA 1EFRD 2EL9A 2G7ZA 1NX9A 2IHTA 3QKWA 3OY2A 3LHIA 1OI7A 3ENKA 3FKSA 2CHFA 3G79A 2GPTA 3RYIB 3ZE8A 3AILA 1NVVR 2V59A 3DCNA 4F3RA 3B3QA 4GOMD 2QTMA 1RWOA 2IOFK 5JROA 4UHJA 5AM4A 2BCEA 1E2BA 1RLIA 1K7EB 1VJGA 1QGUB 3PFWO 4WTOA 1JBEA 2G9UA 1PJBA 5FPTA 5JS7A 2E5LB 1OGYA 1G8KA 1PZEA 2CLOB 5FTLA 3N2YA 1JKIA 1TB4A 3BHMA 4Q4AB 2RHHA 4TXMA 3ROQA 1Q0SA 1GNRA 1VSUA 2G4LA 1EVJA 2X8JB 1H69A 2XNDA 1JI0A 4HSGA 4K81B 3ZTTA 5LMCA 3KQKA 3R4VA 1U28A 4O29A 5H82A 1ZOPA 4YN3A 2VAWA 2AR0A 3WLHA 4RD6A 4QOSA 5MN4A 3IT1A 3AVOA 2P79A 1JEQA 2H8GA 3AB3A 3I2GA 4TTSA 3MBOA 3SQXA 2IUUA 5BURA 4YJ2B 1DIOB 2WAAA 4RE5A 4TN5A 1T26A 4IV8A 1OPRA 5EHIA 4DUGA 1TT5A 1VCIA 3BTSA 2AC4A 1CZRA 4R9VA 5KNBH 1P33A 2NXNA 4JBLA 4YMTA 2NM0A 4PZLA 2IEYA 2X7JA 4WFQA 1XLUA 2ZUDA 2ZDGA 3NONA 3P0HA 4TOIA 3BHIA 1MJNA 4H9GA 4BMDA 2QRLA 4S1WA 4H18A 4DF3A 1PJ4A 2CXQA 5KC9A 3CW8X 1GSAA 3ZHYA 2QQ0A 3DVRX 2FZVA 4YCMA 1HZZA 5FAKA 2Z6UA 5AKGA 3AYZB 4CLEA 5FOQA 3ZDCA 2P6RA 2C94A 4KTTE 3FE2A 3GFSA 4N9QA 1E3DA 3DXFA 5U4QA 5GMOA 5JVDA 4RKWA 1QP0A 5HOQA 3DE2X 1XNJA 3HI6A 1XIVA 2INGX 2RHMA 2AZDA 2JHPA 1QCCA 2CNLA 4XQ9A 2RIPA 1XU7A 1ZITA 3KLMX 1XYYA 3L5KA 2RK4A 3KKZA 2HQRA 4O63O 2Z95A 4E5KA 2GM4A 3NNDA 6LDHA 2EZ8A 1FW8A 1TYBE 5FNZA 1FFSA 3UH0A 2JIPA 3WRYA 2A0UA 5D00A 3ND7A 1RRMA 1X7YA 3O2QB 1ES9A 1XKTA 2AYXA 2ZJ8A 3WWDA 4CDGA 4AMUA 2WSBA 3HPRA 2DAPA 4C3OB 4QJIA 1GCUA 3NKVA 1EGAA 5FJJA 1E94E 1MW8X 3U40A 1E3JA 5ALSA 1L7AA 2PGLA 4Z49A 2Q1TA 3RKUA 1ORVA 1NUUA 4R40A 5DT9A 3WLAA 3G7NA 2C58A 2B9VA 2VTVA 1NJGA 2D06A 1GZVA 1M54A 3LX5A 3RHFA 3VZDA 2R7LA 5THQA 5T4BA 1GD1O 3DMHA 2PGJA 4HNVA 4HDSB 3KYCA 2W42A 4ND8B 4BO2A 1CG6A 1EHCA 1Y9JA 3QEJA 1DLIA 1J9EA 4ZYLA 1YKSA 4HNTA 4IFTA 1ATZA 1GL6A 2C2GA 2GXQA 3HEMA 2QTVA 2FVXA 4HYYA 3ZGXA 2Q5EA 1PU2A 4WFJA 2O8CB 6YASA 2GLXA 2W2TA 3STYA 1CCWA 4D9BA 3OOWA 5IARA 3AUAA 2BMFA 1BAPA 1ZN8A 2VA9A 2GHRA 2R79A 4ZK6A 2BZ1A 1UT8A 2GZRA 3DMTA 3KE8A 3LW8A 1YT5A 2HWUA 3N87A 3ZCRA 1XTTA 4Q03A 2VRNA 1FXWF 2XLBA 2YVLA 3UWDA 5C1OA 2FPGA 5HZGA 2H2WA 2ONYA 3PDWA 2CF5A 2YJZA 1JDTA 1S2LA 3KSZO 1BA2A 2WT8A 4L9AA 2PQMA 1ZFNA 3C5EA 3MWEA 4YPFA 3NHKA 1RYHA 1G3QA 1S2IA 1R00A 3MFQA 4HN4B 4NOLA 2HIAA 4DZRA 2WM8A 4BX0A 5KNBA 1N9ZA 2OM2A 2X8BA 3KUDA 4RVFA 5C4MA 4PPFA 5LXTB 2OCLA 4F6RB 2IJGX 2Q27A 5F73A 2EZUA 3HKCB 1AKUA 4A26A 2YMMA 4FYXA 4P6VF 5FB3A 5PGMA 5JCXA 2R8EA 2ZITA 1M2JA 1C0PA 2YCLA 4MNTA 5I9MA 4R1UA 1QHEA 2OECA 3NJRA 4JC8A 4TVKA 1RXUA 2ZSDA 2RH5A 4UARA 5PNTA 1UBFA 5AKJA 4D8VA 1PQUA 1OLSB 4Z9YA 4RTPA 3RWBA 4F5YA 3Q2IA 4RL6A 2ZB7A 5AJUA 4BP1A 3WLMA 4HDMB 4JEIA 3TF5A 1R4AA 2CCGA 1UKZA 3VVCA 5DN6D 5JR3A 1T2NA 1QZ3A 3C3EA 2GQ0A 1KQNA 2F48A 3GBPA 4S35A 1EVLA 4FP9A 2V7UA 1N2CE 3K70C 2UUOA 4KRYA 1GO2A 5SYNA 1RCUA 1HURA 3RAGA 1X8LA 1T9HA 2QWXA 3QP9A 4DBZA 3EVGA 3WYAA 1U65A 2XOKA 4DT1B 3NEPX 2CV2A 1HKHA 1M33A 2ZANA 2VHJA 4G89A 4LDQA 1RPTA 4QYXA 2QQEA 3IEKA 1ICEA 1RJDA 4IIDA 3K8QA 3BWXA 4LY0A 5I8ZA 4CIDA 2FW1A 3KWLA 2M6SA 2WIBA 4CL0A 5I9BA 5T6BA 4X3CA 5LQJA 4XLZA 3TLBA 3K8YA 1OLOA 4OQ4A 4RXUA 4YLGA 4K26A 2YWBA 4TT3D 3LYAA 1YUBA 3ITEA 4YV0A 3EW7A 1HRKA 5KX5A 1FL9A 3GFBA 5KTSA 3CO5A 3QKTA 4YRDA 2QR5A 3VNRA 4YREA 1V4VA 1F0NA 4KYUA 2XVMA 3G5TA 1DBPA 2UZ1A 3G5UA 1JZSA 1RYNA 1YB4A 2E18A 3I8SA 3HL0A 2OK8A 4R7TA 1Z0SA 3D8BA 4I1OA 4ERNA 3ES9A 2X23A 1S9DA 4R5MA 4UUMA 3DP9A 3RVLA 1GZ5A 2C9BA 2GJSA 1UUFA 3SJAA 3Q5DA 1VC2A 4OBXA 4TTIA 4B4WA 1MAAA 4L5AA 1RD4A 1U2EA 2DKOA 4WCFC 3WHPA 1RPZA 4E3WA 1LEHA 1WE2A 4AUNA 3JU3A 4R98A 2PKRA 2I55A 4PXAA 2Q62A 2Z5FA 2B2CA 2NACA 5BSMA 3HCWA 2EKPA 4E6PA 2G82A 1WG8A 3HKBB 2IYRA 3PQEA 2EP5A 2H1FA 3VR2A 3CF4G 5TMEA 3ZV4A 4AK9A 2F8TA 2FPPB 1RT9A 3DEZA 4EGFA 5CEEA 4EJMA 2WG0A 2Q5HA 1G8YA 1VI5A 1FRQA 4OHBA 3ZNOA 4CM1A 3F7TA 3BWVA 1VYHA 3KJZA 4TLBA 5LOVF 1W5TA 2PNFA 4OJTA 3WL4A 4G37A 1XL1A 4KGDA 1H8HD 2ZBVA 4AO8A 5FTMA 5J1SB 1R8YA 5HZKA 1US8A 2J41A 2HI0A 3HBFA 2J0EA 2PKQO 4G1FA 1ZJZA 3FVQA 1HZJA 2VBGA 2HCBA 4WUVA 1RKXA 3LQ4A 1FFBA 3ZDYB 2XTAA 3RRZA 1UAAA 1MZVA 4DV1B 3CVVA 1E3WA 3C24A 4U39A 4OMUA 4D9HA 5ALVA 5JBNA 2AA3A 4LMPA 4PIVA 3T8YA 4ZI3A 2P68A 3T3NA 2C5SA 4OA8A 1G7TA 5LJIA 3FGNA 4UEOA 2XMGA 2YCBA 3F2VA 1EX7A 3SVTA 3MJHA 4P58A 6NULA 3N8KA 4II7A 2OFOA 2A2ZA 1CF2O 3UYLA 4KMSA 4MV6A 4MVJA 4DLZA 1FQKA 1GUFA 1EGVB 5AJTA 2WVGA 4TS3A 4H1WA 4UNQA 3OQBA 5LFAA 2NSLA 3K9CA 4RVDA 3BGWA 4U6NA 5AH0A 3C6BA 4MYSA 3CN7A 1XLWA 4TN1A 3E2MA 1J23A 1KO4A 1KI6A 1W19A 1UANA 3FLBA 3KJEA 3L1IA 3MT9A 2C1EA 5BYAA 2WU4A 1DCTA 4E1BA 3AUUA 2JLVA 1USWA 4LBWA 4JHXA 4A36A 2WJPA 2J3LA 4NFSA 3RRJA 3U3RA 2FCAA 1UBTS 2GF2A 4OVKA 4D4HA 1EI9A 2VN8A 1ISRA 1LUAA 1TUBA 2R65A 1KY3A 1GUBA 2XXBA 3G0IA 5KREA 3MRXA 3UWPA 1KU0A 1WMFA 2I34A 3EMDA 1UBHS 2D0PB 2QM3A 2W48A 4J16A 5G41A 2OBLA 1IHOA 3KTFA 4DW8A 3W77A 1M2OA 3ZR4B 3CSUA 2WU3A 4TX1A 2OUIA 4P5DA 1UBLS 4LZAA 3CZ9A 3T1OA 1Y48E 1Z0AA 2B37A 3RU2A 3UUWA 1NPTO 3IELA 1LDGA 4JL6A 3TECE 4A91A 1LB1B 4O4HA 2OC4A 1ULAA 1RI2A 4OSOA 2YR0A 5IAGA 4URVR 1ZVQA 3C3BA 4FU0A 1KMIY 2HIMA 2QJRA 3S2YA 1GWNA 4D25A 1UK7A 1OE0A 4MR9B 1UEIA 3ROEA 4A8JA 2QN8A 4E5YA 5CRIA 3RO7A 2X5JO 1SOWA 4FYMA 3ISTA 4Y2RA 4NH0A 1JPUA 3UJ9A 4I4TA 3V1YA 4E5DA 1A77A 3GPIA 1OLXA 2GUGA 1DKRA 3PFGA 2XRZA 2GVZC 1AK9A 1TYCA 1CQIA 2QX6A 2WVAA 3E7WA 4PFQA 1S1CA 5ALYA 4MS1B 3MWLA 4J90A 2HJHA 3MGBA 1M2KA 1KJNA 1E3IA 4Z4CA 3H04A 3K8OE 2ZBRA 2Z2ZA 2CK3A 3SIRA 1MC4A 5BUCA 2W6OA 1KH2A 4XQGA 3Q88A 4E5UA 1Z06A 1OXBB 4CM9A 1S8FA 4KWCA 4B6EA 2ZULA 4OHUA 2R7AA 4LBZA 3H1GA 4JMPA 4RIHA 3BBPA 2O8EA 5BVGB 3HBMA 3E2IA 2J3JA 1G66A 2DQKA 2VWHA 3CZ4A 1AKTA 4CZ2A 5CA1B 1PE0A 4L51A 4IBOA 3RU9A 5JXIA 1NLFA 5KTOA 3HR4A 1I7LA 1LRLA 2PJRA 1KEWA 3HCEA 1QMPA 4XRGA 3IE1A 4ER6A 4JUBA 3PZBA 4EFMA 3K5PA 3HYSA 1TCBA 4ZVQA 1B8UA 1NOJA 3FTNA 4RIIA 2RHLA 4C3UA 4ETNA 3N7UA 1RXIA 2OR3A 2X5OA 2NUTB 2P0AA 2Y6UA 1NRXA 1QC5A 3QU7A 3PQCA 4KO3S 5LYJB 5K0NA 1O97D 3A6LA 2YVUA 1WB4A 2OV3A 2BP7A 3EQ7A 3LK7A 4FXPA 4RA9B 1PRYA 2R8ZA 4CR8A 2QD1A 1Y7PA 1RPNA 2HBYA 2IPAB 2PIAA 3HY6A 3Q7QA 4ID9A 4LKOA 4R5HA 5ER9A 3ZCQA 4DIBA 3N0XA 3UOWA 2B8WA 2AJBA 2IY9A 4ZVVA 1KE2A 4IX1A 3PJFA 5CIWA 4G8JA 1NUAA 5LC1A 3MSCA 4S1NA 4AZSA 3VR4H 1KERA 2WYWA 3C39A 4XDHA 5JVDB 1KOLA 1P1BA 1HE3A 4BWGA 3ROGA 2PXAA 2Q4EA 3K1ZA 3WP0A 3EH2A 3D5EA 1WM1A 2V55B 4C22A 2R8OA 2EZTA 1FA9A 5LD2C 1P9LA 3N58A 3A1UA 4TYQA 3HACA 4EMSA 3F6EX 4EJSB 1V7ZA 5JCJA 4C4SA 5JMTA 4X1YA 4GZ5A 3T5DA 1TK9A 4ML3A 1SQ6A 3IHLA 4OUDB 2JCYA 4HEA6 4RPCA 4DNXA 4W9NA 4CM6A 3CPHA 3RNLA 4US2R 3KYDA 2YASA 2W11A 4KXFB 4MW1A 1EJ0A 1E8MA 5IDXA 2HYDA 2TRSB 1N25A 3IYLW 1GY8A 1Q20A 4EA7A 2WUGA 3I4FA 4HXFB 4M99A 3LK6A 2ZJOA 4JWTA 4E09A 1JHDA 2K2WA 3BMNA 2X9GA 2XODA 3HR7A 2H2IA 2VJBA 3P20A 3NH6A 3RVKA 3R6WA 1ZIYA 1ZD8A 3FDZB 3AGPA 3MTIA 3NFRA 4ZCMA 2VLBA 1CEEA 2I4LA 2H51A 1PCXA 4DV4B 4GE3A 1U2RA 4B79A 3IS3A 2BCGY 5AVQA 1FU8A 4M89A 4FGKA 3WLLA 3DOCA 2X1MA 3H1BA 3LKVA 2WTUA 3O5AA 2QZZA 4C06A 4JR1A 3X0DA 4LFAB 5AK3A 3ZV6A 1NM5C 1W5AA 5E3IA 2FZ5A 1A5SB 1A4RA 3DPUA 4G09A 1OAOC 3E9RA 1OYOA 4KC0A 1W1IA 4NYJQ 1TF5A 4JI3B 2QZJA 1TCUA 3L8ZA 5L7TA 2AK3A 2ET6A 3R76A 2O8CA 5AICA 3TTTA 1U7XA 4LCBA 2PS1A 4PFKA 5JFTA 5C5CA 3C74A 3LYUA 4ABYA 2AEFA 2IA5A 5C18A 3WGIA 2B2NA 4KLRA 4MQ4A 4ENTA 4JOBA 4DZZA 4NFLA 5BW8A 3IVCA 2RGNA 1ESEA 1XRLA 1UEXC 1PQWA 4DA9A 3K0SA 2V98A 3DMFA 3QYJA 3AV0B 4BYMA 5LQNA 5FXMA 1VMEA 3SZ3A 5HKKD 2ZTLA 2P3LA 4TKLA 4QTYA 1H0RA 2VHXA 1GQOA 4F6CA 3V8BA 5K2OA 1SUAA 4I55B 4NR0A 1FX0B 4TWJA 3PYLA 2DR3A 1H2FA 5GWXA 2BVNA 4PIMA 5JI2E 2ACEA 4TMFA 1M3SA 4BNVA 4BNDA 2R1VB 4TXNA 1KU6A 1XKQA 2H5IA 2CLIB 1OD6A 1NRWA 5CVDA 3VR4A 5IULC 2Z58A 5LA6A 3ORSA 2YJ5A 3VTKA 4AJ9A 2ZBPA 5DHQA 2A57A 1GRCA 1XCJA 4WZAB 1O5TA 3WB0A 2LUOA 4Z4FA 2J7PA 4O2LA 3EX7C 3UTCA 1QQTA 1FNSA 1UADA 4EA9A 2MT9A 4WCVA 1GPYA 3KEFA 4DMCA 3V4RA 2V8BA 1NJ1A 4FS3A 3E9YA 4TV8A 4PYMA 2C9DA 2DXIA 3RUDA 3THOA 4R9NA 5TPWA 1JKFA 4A16A 4CJXA 2N0SA 3ELYA 1OI4A 3KV1A 3DZKA 4RK1A 5KNDH 1ZG3A 2CNWD 3WNBA 3R75A 5HUQA 1G7CA 2Q2VA 2LE0A 1A04A 3RPEA 3I9V6 4IX9A 2H9YA 2FQ1A 4WOCA 5FWDA 1KMCA 3DJFA 5FI0B 1R4MB 2TMKA 2RSLA 1ZHOA 4DRXA 1VE3A 4IIGA 3E4DA 2YY5A 3CRMA 1YOBA 3SK0A 4YXWD 1LFDB 2WPDA 1KEZA 2VG8A 1WBJB 2IPMA 4CKWA 1C1XA 1VIDA 3C7CB 3PFIA 3B5IA 3KQQA 3QKSA 4PSKA 5B30A 1P0FA 3L01A 5CB4F 4F3CA 1NPDA 2ZIXB 3MXTA 3FTEA 4B84A 1E2FA 4XCXA 2ESRA 2X0JA 4Q02A 7YASA 1QYXA 1U6KA 3DFFA 2PO5A 1LFAA 1YB6A 4DC1A 1FXWA 2QVYX 1PJRA 3OEWA 2CHVA 3QM1A 4MWTA 4TTPA 1T8WA 1FMLA 3W7BA 3I04A 2G76A 1RFGE 1BU5A 3P9YA 3TG8A 1SCNE 1NLYA 3FPEA 4JU9A 3QPWA 2BMDA 3EAQA 5IBCA 1MV5A 2C3MA 4PGHA 5H83A 3SC2B 2EJVA 2YY7A 4LN1A 4OK5A 7REQA 2ZAYA 3H2JA 5EZYA 3CVWA 4W6QA 2GCIA 4US1R 2ZWOA 1VJTA 4PLFA 1PKEA 1VDMA 3QZUA 2PSSA 5CXSA 1V5IA 4PHTA 3H86A 5EMMA 1UPCA 2BKUA 1O6GA 1T15A 4OAQA 3UMBA 3OZVA 5JAHA 4Z4IA 3ZDQA 2HNAA 4A2CA 1SHKA 1M75A 3EBLA 1FBTA 1UAGA 3HDVA 1NVGA 1KGSA 2HU8A 4G0ZA 3A1DA 3KE9A 2D4AA 3FYUA 4ENWA 3KOOA 4I6EA 1ORDA 1EB9A 2X0NA 1I32A 2QMYA 4JI1B 4AP9A 5KYXA 1JHZA 4M0CA 2X2FA 1JAHA 4IG4A 3ICOA 3L79A 3NHMA 1W2GA 1CXZA 2BHSA 3K53A 2ZIUB 2NUTA 2JVKA 1ESNA 1XSEA 2DQSA 4GKBA 3IEPA 1TTQB 2ZYAA 2A33A 3L2OB 4I99A 2P2YA 3RAPR 2C7OA 4H7HA 4PR3A 3QXXA 5CG2A 3PK0A 4OU5A 4BO3A 1HC7A 2VP2A 1GGKA 1QONA 3GEPA 5EYPA 2AMLA 2PEZA 3FCYA 5ALUA 3QQ5A 1YDGA 1J21A 3HR8A 1QK5A 3LF1A 4BJ1A 4DA8A 1WSWA 5A5EA 1L7NA 4OX9B 1KAMA 1FJXA 1D8AA 4ZCPA 4C21A 2QP4A 3PD7A 4CMBA 1P0QA 1ZL2A 1YZQA 2ZUCA 3B1VA 4L95C 4AZ3A 1XVAA 3LFHA 4BMCA 4D0GA 8AT1A 5LSAA 4DOMA 2ZEJA 2GB4A 3KPJA 5KEIA 4O3MA 3EVBA 3DMGA 4RYLA 3ZWBA 5KQPA 4BXOB 4WX2B 1C3LA 1ZICA 4GI2A 2BGMA 3M5PA 1QFZA 4PAWA 1DWQA 3JQ8A 5AUOB 1UZLA 1NC3A 2RG7A 2ZI9A 1Z47A 4K9KA 5MN5A 3NKLA 1SC9A 2I22A 2Y27A 2Y1LA 3DSRA 4HUJA 4L76A 5J1TB 4BP3A 4YRIA 1RXVA 3A6JA 1X7WA 4UZFA 2W58A 1RQRA 4KV7A 2CDNA 4O4HB 1BDIA 4L4YA 4YQZA 3T3HA 2CK3D 2VBIA 3FSJX 3TUZC 3GNSA 3LHKA 2PKQP 4YY3B 4N41A 3I8OA 5ILGA 2R96A 5TRTA 1DIAA 3ZS9A 1I3NA 3PCRB 1DS6A 2MSEB 5TGTA 1II8A 4PZDA 3L0CA 521PA 2KWIA 2GNAA 5JFOA 2VDOB 1JHRA 3HLYA 3KRTA 4BP9A 4RVCA 5J4HA 3BQMB 4L4RA 1H9AA 5D1HA 1TZMA 4YJ2F 1F7VA 1I6LA 2WF5A 3ESZA 3DHVA 4FFPA 1I2BA 2NU6A 1IBSA 1UJMA 1K6XA 3C43A 4UCQA 5IC6A 4BZXA 4L8VA 2GXSA 1RI1A 2ZWVA 4GM4A 4FYJA 1LZKA 1ZH4A 3PGJA 4HT3B 3GWGA 2IWRA 3P9ZA 3UJ3X 1Y6JA 3GBVA 3UT5A 4PQRA 2YNMD 4B82A 2Q50A 1A88A 1FFWA 3WS7A 4ARCA 5KWIA 4LC0A 4JDPA 3WOHA 4DLVA 1NKVA 2C4UA 4MWDA 2VQEB 4V3BA 3TIGA 4ARBA 4PS1A 5JISA 3BB1A 3I8XA 3IEUA 5LQDA 1BVUA 2VF4X 2BEVA 4KYTA 1EH5A 2HOQA 4WK0B 1MEOA 1TF2A 3GK3A 4LSWA 4OJMX 5EE9A 1AMOA 4CDNA 3H2HA 3TAXA 1SG9A 4U9IS 1QKIA 2XD9A 2BD0A 5LYJA 5GIPE 5AKHA 2OXCA 2Q07A 4YMHA 4QELA 5CW2A 4FB4A 4QTTB 2Z2YA 1C8BA 4EB8A 1IWBB 3I62A 1RU3A 3FAKA 5EI5A 3AJ9A 4WN9B 1HE8B 2H52A 1KDPA 1Q0ZA 3RV4A 4RCYA 4C2TA 4DNQA 3R9KA 1DIBA 1N7GA 3PHCA 3PSAA 3KEQA 4IXNA 4TTAA 3JZDA 4TMWA 3L4EA 2Z0MA 3BORA 3TIVA 3GLIA 1Z4NA 4RPKA 3LXRA 3L40A 4Q3KA 3AM1A 1BSVA 4MJ3A 3T1QA 4GECA 4HXEB 3T1HB 2W00A 2QAGB 1ZDMA 3ROXA 3BXGA 3SXJA 5GOZA 5IFKA 2BH9A 5KB3A 4GF5A 1TTHA 3C85A 4GP7A 4DM3A 1Q7EA 1XZIA 4C6TB 4DR5B 3M3PA 1LBQA 1APBA 3GDGA 3K1AB 5BNFA 1N6OA 5ESRA 2JKZA 2IS1A 2XDAA 3IBFA 5FEMA 2ZR7A 5I5GA 4C43A 2KLHA 2IUFA 1O08A 4Q9DA 5C1DA 1PS9A 1AIPA 1QVZA 4MARA 1EG7A 1MRNA 3OT5A 4GL2A 1B00A 1KEEB 1H8HA 5BW4A 2MYPA 4YRQA 1BKYA 4BN0A 5KKCA 2C61A 3HSSA 1GGMA 4WKCA 4CV2A 1A2QA 1ZNXA 1GXSA 2XY4A 3FGOA 3SKVA 1G19A 3V4SA 2IPXA 3RV3A 2HREA 1TL7C 2P1ZA 4I55A 3EZYA 4P4TA 2HJRA 1Q83A 1QVVA 1NMQA 1OXVA 3E61A 3EFEA 1SU4A 4KAFA 5FUVA 4KG7A 4UC0A 4P0TA 4JXKA 4KR9A 4GP6A 1P39A 2XHEA 1KOGA 2A9PA 3GJ4A 3SKXA 3O9MA 1TVEA 1VKHA 1Z8DA 4NG4A 4AECA 3F47A 4RK0A 3WV4A 1LVGA 1GPBA 1OZFA 1V6AA 2BEUB 2E9SA 3FPAA 3N75A 4WH0A 3UF0A 1ZW1A 3VM6A 1IAVA 4I1PA 2HU5A 3BCRA 3E9DA 1R4MA 4RD1A 4MUNA 1F2UA 1YF3A 1EX6A 2ONKA 3E48A 1UFRA 2V7BA 2Y77A 4ZYZA 3B52X 3RTEA 2JVJA 4TTRA 1JH9A 2G5TA 2EW8A 2D2FA 3PLNA 3VHXB 3BBLA 3BQ9A 2P4QA 2CXOA 3GPLA 5SY9A 2BEWA 1WIWA 4RZIA 1AN9A 4RJ2A 1ZH2A 3QBVA 2RGDA 1K66A 3HL4A 4LRXA 4UAVA 2YHSA 3DZBA 1POXA 4GP9A 4UE6A 4XTCS 4FFVA 1HRDA 3IALA 3PRJA 3P97A 4EB3A 1JECA 4LHVA 3TFWA 3JALA 3K0EA 3U7JA 3VU0A 2WNSA 3L77A 3H5LA 4EABA 3CVOA 1GV0A 1OIWA 1XNRB 4FMBB 4YYZA 1RYBA 3INTA 1AKQA 4JY7A 1M0TA 1XCBA 1CNMA 4K05A 4DTIA 2BDTA 1HV8A 1XP8A 4IDHA 3DHWC 3EF0A 3W5BA 1T9CA 3HB5X 3QU9A 1QHHB 3AJEA 3SZMA 1DINA 4UE2A 2XJ9A 2PU5A 2D13A 1A71A 2B7LA 4D8UA 3TEMA 5BMOA 4WA7A 1G20A 1MAHA 2M6RA 5JYBA 2GZ1A 2PUCA 4L72A 2GN0A 4GWKA 4CFZA 1WMEA 1FSGA 2MYNA 2QTBA 3JQQA 3A9RA 1QBGA 1TMYA 4L8GA 2PFSA 1JF8A 4X94A 2NU8A 3ZWDA 3AVVA 1JP7A 3KJIA 4Y6PA 4X45A 3GUUA 2P9QA 5EJ8A 1U02A 1A7JA 3D1VA 3E7DA 1LLQA 2W2QA 2YS7A 4DCCA 1KYQA 4I8XA 4NEGA 2ST1A 4M37A 4OQXA 2FEOA 4MMZB 3WLRA 5DEOA 1T3ZA 3HC7A 5LCXA 3IEIA 1PBNA 1PFUA 2P9FA 1D09A 2C96A 5G0WA 1DUSA 1SC4A 1U2ZA 4J0JA 5F3WB 1MKYA 2PO7A 3K8ZA 3DB1A 3EBPA 2P3OA 1E58A 1EP2B 2VXYA 3A6HA 1L4NA 4LXXA 2XGMA 4MCHA 4YPVA 2ARKA 2DRIA 2QOEA 3W1WA 3IUQA 3QV1A 2HHLA 5AW7A 3JV7A 5SZIA 4MUGA 2FEXA 4NK4A 4RJIA 2CL7X 3TFOA 5IC4A 4O2BB 1VZ3A 2IYZA 3ECCA 4JLVA 4XARA 5B2ZA 4LIPD 3SS7X 4YJ3F 4AWAA 1JHYA 1WUHS 2A5DA 3ASYA 3PZRA 4D0RA 5LWHA 3QSYA 1G55A 2OQIA 1OMOA 2M9MA 5U9CA 5G1NA 3JS5A 2P41A 5CDHA 1XWWA 2JH9A 4RHFA 2H2AA 4YUXA 2YS6A 3GLGE 1RMYA 4CQLB 4MROA 1X86B 2CDBA 2QF7A 4QBTA 4H15A 4FGUA 4A0RA 1K6EA 3B8HA 1HLPA 1E1LA 3QBEA 4R71A 1U3UA 4N12A 2PVSA 2SBTA 1D9ZA 4EG6A 4YLEA 3UTDA 2B30A 5DRTA 2C4WA 3FYCA 4MUBA 2KHZA 3OEEA 2EEPA 3UMCA 2OZPA 5TQ0B 3ZZTA 2YOGA 3W0LB 4FN5A 5AK5A 4P82A 1M1YA 1NONA 2QA5A 3DF7A 2FN4A 2P9CA 3BM5A 3F7OA 4RVNA 5FF9A 4YT4A 4UQLA 3VNQA 1RHUA 1X80A 4MA4A 1T24A 5H0IA 2Q5CA 3H87A 1WXFA 3DQZA 3IDFA 3IIMA 3V5NA 4FE4A 5BWLA 4L8FA 2YRFA 3PCXA 3H3FA 5H3LA 3CLTD 3IPRA 3V7WA 2V9ZA 1DFHA 3VYVA 2DPMA 2V5AA 4M6WB 1E2PA 2VDPB 2WWHA 3T5TA 4I5EA 3H11A 3AFIA 2RH9B 2V4UA 3ESQA 3LX6A 4B3JA 4X6LA 4EUKA 5C8YF 1OX4A 3ZWKA 2OHGA 4EDFA 3LC0A 1JEQB 2J0QA 3QE2A 4QQKA 1GPDG 3LE8A 2J5QA 2ONZA 3CX7A 3HYTA 4XJTA 3FZQA 4OYLA 2VTBB 3PXGA 2XUJA 4I6GA 1XTJA 2WSYB 4MDYA 2XMCA 1HK7A 3A6PC 4X1YB 1BE1A 1VPEA 2FCRA 3VA7A 1HL7A 4KQHA 1ICIA 2C2BA 1RQLA 3PEFA 5C0OE 4E46A 5A4JA 2HTEA 2I54A 1S9HA 2ON6A 2OYSA 3R20A 2VTDA 4IDQA 1ST2A 3ZDRA 3S8YA 2FJUA 2JGJA 1DO0A 1XN4A 3B6MA 1ZAYA 1A3CA 2IXTA 4EFKA 3NI2A 2P9HA 1P9WA 2PH3A 1E3LA 2Z8YM 4RZXA 1Z68A 4H6VA 3QVUA 3ABRB 1ZGAA 3DYBA 4CU2A 3ZOKA 4G0OA 2VSYA 3KDAA 1RXWA 2NUPB 1ESMA 3JPWA 2OHIA 1WSBA 4EPRA 4DMKA 1GSIA 1JLLA 4HWSA 4NBVA 1XK6A 2FJPA 4F6RA 1QYRA 3R74A 2XZDA 4KIGA 2YJNA 3CRQA 5JCZA 4AY5A 5HR5A 4H4CA 2BGLA 5GOTA 4C7OB 1Z25A 2FWJA 1N4AA 4JKOA 1DPGA 3U4IA 5AKEA 3GLIB 2BFWA 2VZLA 2YDXA 2IXFA 2X9NA 3RAEC 4HX2A 3SQOA 1IEVA 1EP1B 3EIUA 4KK3A 1RE1A