1USHA

5'-nucleotidase from e. coli
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
525
structure length
515
Chain Sequence
YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKRVLYTPEIAENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVNTGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray structure of the Escherichia coli periplasmic 5'-nucleotidase containing a dimetal catalytic site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords 5'-NUCLEOTIDASE
total genus 176
structure length 515
sequence length 525
ec nomenclature ec 3.1.3.5: 5'-nucleotidase.
pdb deposition date 1998-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF02872 5_nucleotid_C 5'-nucleotidase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 1ushA01
3.90.780.10 Alpha Beta Alpha-Beta Complex 5'-nucleotidase; domain 2 5'-Nucleotidase, C-terminal domain 1ushA02
3QFMA 1MF8A 3RL4A 1UTEA 1Z2WA 3EGGA 4KKZA 3E7AA 2JOGA 4KBPA 2BCDA 4H1SA 4M0VA 4O5GA 4O4KA 2P6BA 4YKEA 2IE4C 3K7WC 4HD0A 2Q8UA 2IE3C 5B8IA 4Q7FA 5C1VA 4ORAA 1USHA 1Z2XA 2QFPA 3H69A 4JA9A 2HY1A 2O8AA 1AUIA 4I5NC 4J6OA 4LACC 4LTYA 1HPUA 1S3MA 4MOVA 1OI8A 4MP0A 4O24A 4WWLA 3ZTVA 5JPFA 1NNWA 2NXFA 3JYFA 4ZX2A 5JJTA 3PSOA 2O8GA 3HVQA 1XZWA 2CV9A 3FGAC 3QFKA 4FCXA 4OR9A 3DSDA 3DSCA 2NYLC 4V0WA 4ORCA 3AUZA 3H61A 1IT6A 4ORBA 4TUIA 2NYMC 1W24A 3E7BA 1FJMA 1S70A 1TCOA 3QFNA 4FBWA 1U32A 3H63A 2XMOA 3GVEA 4V0VA 2HYPA 4I5LC 4V0XA 3TGHA 3QFOA 2HYOA 2Z06A 4O43A 1S95A 3IVDA 4ZVZA 3QG5C 4B2OA 3IVEA 4H2GA 1QHWA 3DW8C 3ICFA 2WDCA 4UT3B 3RQZA 2WDEA 4UT2A 5INBA 3IB8A 1WARA 3C9FA 2R17A 5DNYA 3ZU0A 1V73A 1OIDA 3KBPA 4TUGA 5IOHA 1S3LA 1JK7A 1QFCA 2WDDA 3THNA 2NPPC 5HPEA 3K7VC 5EQVA 1G5BA 4FBQA 2BQ8X 3RL3A 4UT3A 3H60A 2WDFA 2YVTA 2AHDA 1SU1A 3RL5A 3PSNA 2KKNA 2BDXA 3H64A 3LL8A 5JPEA 5J28A 1S8EA 3IB7A 5F3WA 4DT2A 1T71A 2Z72A 1UF3A 4XPNA 1HP1A 3T1IA 1KBPA 4UWQA 1XM7A 3V4YA 3H66A 3N5UA 1HO5A 1M63A 1S3NA 2Z1AA 3H67A 3H62B 4H1YP 2IAEC 4IYPC 1OIEA 4LU9A 4NZVA 3EGHA 5GTUA 4IL1A 2QJCA 4G9JA 3C5WC 4F0ZA 3AV0A 4DHLA 2QFRA 3THOB 2USHA 4FBKA 1II7A 3H68A 3CK2A 4H2BA 1T70A 4H2IA 2A22A 2GJUA 4JA7A 4H2FA 3P71C 4MOYA 2DFJA 2ZBMA 1WAO1 4DSYA
chains in the Genus database with same CATH superfamily
3QFMA 1MF8A 3RL4A 2DXLA 1UTEA 1Z2WA 3FLOA 3EGGA 4KKZA 3E7AA 2JOGA 4KBPA 2BCDA 4H1SA 4M0VA 4O5GA 4O4KA 2P6BA 4YKEA 2IE4C 2YEQA 3K7WC 4HD0A 2Q8UA 2IE3C 5B8IA 4Q7FA 5C1VA 4ORAA 1USHA 1Z2XA 2QFPA 3H69A 4JA9A 2HY1A 2O8AA 1AUIA 4I5NC 4J6OA 4LACC 4LTYA 1HPUA 1S3MA 4MOVA 1OI8A 4MP0A 4O24A 4WWLA 3ZTVA 5JPFA 1NNWA 2NXFA 3JYFA 4ZX2A 5JJTA 3PSOA 2O8GA 3HVQA 1XZWA 2CV9A 3FGAC 3QFKA 4FCXA 4OR9A 3DSDA 3DSCA 2NYLC 4V0WA 4ORCA 3AUZA 3H61A 1IT6A 4ORBA 4TUIA 2NYMC 1W24A 3E7BA 1FJMA 1S70A 1TCOA 3QFNA 4FBWA 1U32A 3H63A 2XMOA 3GVEA 4V0VA 2HYPA 4I5LC 4V0XA 3TGHA 3QFOA 2HYOA 2Z06A 4O43A 1S95A 3IVDA 4ZVZA 3QG5C 4B2OA 3D03A 3IVEA 4H2GA 1QHWA 3DW8C 3ICFA 2WDCA 4UT3B 3RQZA 2WDEA 4UT2A 5INBA 3IB8A 1WARA 3C9FA 2R17A 5DNYA 3ZU0A 1V73A 1OIDA 3KBPA 4TUGA 5IOHA 1S3LA 1JK7A 1QFCA 2WDDA 3THNA 2NPPC 5HPEA 3K7VC 5EQVA 1G5BA 4FBQA 2BQ8X 3RL3A 4UT3A 3H60A 2WDFA 2YVTA 2AHDA 1SU1A 3RL5A 2DXNA 3PSNA 2KKNA 2BDXA 3H64A 3LL8A 5JPEA 5J28A 1S8EA 3IB7A 5F3WA 4DT2A 1T71A 2Z72A 1UF3A 4XPNA 1HP1A 3E0JA 3T1IA 1KBPA 4UWQA 1XM7A 3V4YA 3H66A 3N5UA 1HO5A 1M63A 1S3NA 2Z1AA 3H67A 3H62B 4H1YP 2IAEC 4IYPC 1OIEA 4LU9A 4NZVA 3EGHA 2ZO9B 5GTUA 4IL1A 2QJCA 4G9JA 3C5WC 4F0ZA 2ZOAA 3AV0A 4DHLA 2QFRA 3THOB 2USHA 4FBKA 1II7A 3H68A 3CK2A 4H2BA 1T70A 4H2IA 2A22A 2GJUA 4JA7A 4H2FA 3P71C 4MOYA 2DFJA 2ZBMA 1WAO1 4DSYA
chains in the Genus database with same CATH topology
3QFMA 1MF8A 3RL4A 2DXLA 1UTEA 1Z2WA 3FLOA 3EGGA 4KKZA 3E7AA 2JOGA 4KBPA 2BCDA 4H1SA 4M0VA 4O5GA 4O4KA 2P6BA 4YKEA 2IE4C 2YEQA 3K7WC 4HD0A 2Q8UA 2IE3C 5B8IA 4Q7FA 5C1VA 4ORAA 1USHA 1Z2XA 2QFPA 3H69A 4JA9A 2HY1A 2O8AA 1AUIA 4I5NC 4J6OA 4LACC 4LTYA 1HPUA 1S3MA 4MOVA 1OI8A 4MP0A 4O24A 4WWLA 3ZTVA 5JPFA 1NNWA 2NXFA 3JYFA 4ZX2A 5JJTA 3PSOA 2O8GA 3HVQA 1XZWA 2CV9A 3FGAC 3QFKA 4FCXA 4OR9A 3DSDA 3DSCA 2NYLC 4V0WA 4ORCA 3AUZA 3H61A 1IT6A 4ORBA 4TUIA 2NYMC 1W24A 3E7BA 1FJMA 1S70A 1TCOA 3QFNA 4FBWA 1U32A 3H63A 2XMOA 3GVEA 4V0VA 2HYPA 4I5LC 4V0XA 3TGHA 3QFOA 2HYOA 2Z06A 4O43A 1S95A 3IVDA 4ZVZA 3QG5C 4B2OA 3D03A 3IVEA 4H2GA 1QHWA 3DW8C 3ICFA 2WDCA 4UT3B 3RQZA 2WDEA 4UT2A 5INBA 3IB8A 1WARA 3C9FA 2R17A 5DNYA 3ZU0A 1V73A 1OIDA 3KBPA 4TUGA 5IOHA 1S3LA 1JK7A 1QFCA 2WDDA 3THNA 2NPPC 5HPEA 3K7VC 5EQVA 1G5BA 4FBQA 2BQ8X 3RL3A 4UT3A 3H60A 2WDFA 2YVTA 2AHDA 1SU1A 3RL5A 2DXNA 3PSNA 2KKNA 2BDXA 3H64A 3LL8A 5JPEA 5J28A 1S8EA 3IB7A 5F3WA 4DT2A 1T71A 2Z72A 1UF3A 4XPNA 1HP1A 3E0JA 3T1IA 1KBPA 4UWQA 1XM7A 3V4YA 3H66A 3N5UA 1HO5A 1M63A 1S3NA 2Z1AA 3H67A 3H62B 4H1YP 2IAEC 4IYPC 1OIEA 4LU9A 4NZVA 3EGHA 2ZO9B 5GTUA 4IL1A 2QJCA 4G9JA 3C5WC 4F0ZA 2ZOAA 3AV0A 4DHLA 2QFRA 3THOB 2USHA 4FBKA 1II7A 3H68A 3CK2A 4H2BA 1T70A 4H2IA 2A22A 2GJUA 4JA7A 4H2FA 3P71C 4MOYA 2DFJA 2ZBMA 1WAO1 4DSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QFM A;  1MF8 A;  3RL4 A;  1UTE A;  1Z2W A;  3EGG A;  4KKZ A;  3E7A A;  2JOG A;  4KBP A;  2BCD A;  4H1S A;  4M0V A;  4O5G A;  4O4K A;  2P6B A;  4YKE A;  2IE4 C;  3K7W C;  4HD0 A;  2Q8U A;  2IE3 C;  5B8I A;  4Q7F A;  5C1V A;  4ORA A;  1USH A;  1Z2X A;  2QFP A;  3H69 A;  4JA9 A;  2HY1 A;  2O8A A;  1AUI A;  4I5N C;  4J6O A;  4LAC C;  4LTY A;  1HPU A;  1S3M A;  4MOV A;  1OI8 A;  4MP0 A;  4O24 A;  4WWL A;  3ZTV A;  5JPF A;  1NNW A;  2NXF A;  3JYF A;  4ZX2 A;  5JJT A;  3PSO A;  2O8G A;  3HVQ A;  1XZW A;  2CV9 A;  3FGA C;  3QFK A;  4FCX A;  4OR9 A;  3DSD A;  3DSC A;  2NYL C;  4V0W A;  4ORC A;  3AUZ A;  3H61 A;  1IT6 A;  4ORB A;  4TUI A;  2NYM C;  1W24 A;  3E7B A;  1FJM A;  1S70 A;  1TCO A;  3QFN A;  4FBW A;  1U32 A;  3H63 A;  2XMO A;  3GVE A;  4V0V A;  2HYP A;  4I5L C;  4V0X A;  3TGH A;  3QFO A;  2HYO A;  2Z06 A;  4O43 A;  1S95 A;  3IVD A;  4ZVZ A;  3QG5 C;  4B2O A;  3IVE A;  4H2G A;  1QHW A;  3DW8 C;  3ICF A;  2WDC A;  4UT3 B;  3RQZ A;  2WDE A;  4UT2 A;  5INB A;  3IB8 A;  1WAR A;  3C9F A;  2R17 A;  5DNY A;  3ZU0 A;  1V73 A;  1OID A;  3KBP A;  4TUG A;  5IOH A;  1S3L A;  1JK7 A;  1QFC A;  2WDD A;  3THN A;  2NPP C;  5HPE A;  3K7V C;  5EQV A;  1G5B A;  4FBQ A;  2BQ8 X;  3RL3 A;  4UT3 A;  3H60 A;  2WDF A;  2YVT A;  2AHD A;  1SU1 A;  3RL5 A;  3PSN A;  2KKN A;  2BDX A;  3H64 A;  3LL8 A;  5JPE A;  5J28 A;  1S8E A;  3IB7 A;  5F3W A;  4DT2 A;  1T71 A;  2Z72 A;  1UF3 A;  4XPN A;  1HP1 A;  3T1I A;  1KBP A;  4UWQ A;  1XM7 A;  3V4Y A;  3H66 A;  3N5U A;  1HO5 A;  1M63 A;  1S3N A;  2Z1A A;  3H67 A;  3H62 B;  4H1Y P;  2IAE C;  4IYP C;  1OIE A;  4LU9 A;  4NZV A;  3EGH A;  5GTU A;  4IL1 A;  2QJC A;  4G9J A;  3C5W C;  4F0Z A;  3AV0 A;  4DHL A;  2QFR A;  3THO B;  2USH A;  4FBK A;  1II7 A;  3H68 A;  3CK2 A;  4H2B A;  1T70 A;  4H2I A;  2A22 A;  2GJU A;  4JA7 A;  4H2F A;  3P71 C;  4MOY A;  2DFJ A;  2ZBM A;  1WAO 1;  4DSY A; 
#chains in the Genus database with same CATH topology
 3QFM A;  1MF8 A;  3RL4 A;  2DXL A;  1UTE A;  1Z2W A;  3FLO A;  3EGG A;  4KKZ A;  3E7A A;  2JOG A;  4KBP A;  2BCD A;  4H1S A;  4M0V A;  4O5G A;  4O4K A;  2P6B A;  4YKE A;  2IE4 C;  2YEQ A;  3K7W C;  4HD0 A;  2Q8U A;  2IE3 C;  5B8I A;  4Q7F A;  5C1V A;  4ORA A;  1USH A;  1Z2X A;  2QFP A;  3H69 A;  4JA9 A;  2HY1 A;  2O8A A;  1AUI A;  4I5N C;  4J6O A;  4LAC C;  4LTY A;  1HPU A;  1S3M A;  4MOV A;  1OI8 A;  4MP0 A;  4O24 A;  4WWL A;  3ZTV A;  5JPF A;  1NNW A;  2NXF A;  3JYF A;  4ZX2 A;  5JJT A;  3PSO A;  2O8G A;  3HVQ A;  1XZW A;  2CV9 A;  3FGA C;  3QFK A;  4FCX A;  4OR9 A;  3DSD A;  3DSC A;  2NYL C;  4V0W A;  4ORC A;  3AUZ A;  3H61 A;  1IT6 A;  4ORB A;  4TUI A;  2NYM C;  1W24 A;  3E7B A;  1FJM A;  1S70 A;  1TCO A;  3QFN A;  4FBW A;  1U32 A;  3H63 A;  2XMO A;  3GVE A;  4V0V A;  2HYP A;  4I5L C;  4V0X A;  3TGH A;  3QFO A;  2HYO A;  2Z06 A;  4O43 A;  1S95 A;  3IVD A;  4ZVZ A;  3QG5 C;  4B2O A;  3D03 A;  3IVE A;  4H2G A;  1QHW A;  3DW8 C;  3ICF A;  2WDC A;  4UT3 B;  3RQZ A;  2WDE A;  4UT2 A;  5INB A;  3IB8 A;  1WAR A;  3C9F A;  2R17 A;  5DNY A;  3ZU0 A;  1V73 A;  1OID A;  3KBP A;  4TUG A;  5IOH A;  1S3L A;  1JK7 A;  1QFC A;  2WDD A;  3THN A;  2NPP C;  5HPE A;  3K7V C;  5EQV A;  1G5B A;  4FBQ A;  2BQ8 X;  3RL3 A;  4UT3 A;  3H60 A;  2WDF A;  2YVT A;  2AHD A;  1SU1 A;  3RL5 A;  2DXN A;  3PSN A;  2KKN A;  2BDX A;  3H64 A;  3LL8 A;  5JPE A;  5J28 A;  1S8E A;  3IB7 A;  5F3W A;  4DT2 A;  1T71 A;  2Z72 A;  1UF3 A;  4XPN A;  1HP1 A;  3E0J A;  3T1I A;  1KBP A;  4UWQ A;  1XM7 A;  3V4Y A;  3H66 A;  3N5U A;  1HO5 A;  1M63 A;  1S3N A;  2Z1A A;  3H67 A;  3H62 B;  4H1Y P;  2IAE C;  4IYP C;  1OIE A;  4LU9 A;  4NZV A;  3EGH A;  2ZO9 B;  5GTU A;  4IL1 A;  2QJC A;  4G9J A;  3C5W C;  4F0Z A;  2ZOA A;  3AV0 A;  4DHL A;  2QFR A;  3THO B;  2USH A;  4FBK A;  1II7 A;  3H68 A;  3CK2 A;  4H2B A;  1T70 A;  4H2I A;  2A22 A;  2GJU A;  4JA7 A;  4H2F A;  3P71 C;  4MOY A;  2DFJ A;  2ZBM A;  1WAO 1;  4DSY A; 
#chains in the Genus database with same CATH homology
 3QFM A;  1MF8 A;  3RL4 A;  2DXL A;  1UTE A;  1Z2W A;  3FLO A;  3EGG A;  4KKZ A;  3E7A A;  2JOG A;  4KBP A;  2BCD A;  4H1S A;  4M0V A;  4O5G A;  4O4K A;  2P6B A;  4YKE A;  2IE4 C;  2YEQ A;  3K7W C;  4HD0 A;  2Q8U A;  2IE3 C;  5B8I A;  4Q7F A;  5C1V A;  4ORA A;  1USH A;  1Z2X A;  2QFP A;  3H69 A;  4JA9 A;  2HY1 A;  2O8A A;  1AUI A;  4I5N C;  4J6O A;  4LAC C;  4LTY A;  1HPU A;  1S3M A;  4MOV A;  1OI8 A;  4MP0 A;  4O24 A;  4WWL A;  3ZTV A;  5JPF A;  1NNW A;  2NXF A;  3JYF A;  4ZX2 A;  5JJT A;  3PSO A;  2O8G A;  3HVQ A;  1XZW A;  2CV9 A;  3FGA C;  3QFK A;  4FCX A;  4OR9 A;  3DSD A;  3DSC A;  2NYL C;  4V0W A;  4ORC A;  3AUZ A;  3H61 A;  1IT6 A;  4ORB A;  4TUI A;  2NYM C;  1W24 A;  3E7B A;  1FJM A;  1S70 A;  1TCO A;  3QFN A;  4FBW A;  1U32 A;  3H63 A;  2XMO A;  3GVE A;  4V0V A;  2HYP A;  4I5L C;  4V0X A;  3TGH A;  3QFO A;  2HYO A;  2Z06 A;  4O43 A;  1S95 A;  3IVD A;  4ZVZ A;  3QG5 C;  4B2O A;  3D03 A;  3IVE A;  4H2G A;  1QHW A;  3DW8 C;  3ICF A;  2WDC A;  4UT3 B;  3RQZ A;  2WDE A;  4UT2 A;  5INB A;  3IB8 A;  1WAR A;  3C9F A;  2R17 A;  5DNY A;  3ZU0 A;  1V73 A;  1OID A;  3KBP A;  4TUG A;  5IOH A;  1S3L A;  1JK7 A;  1QFC A;  2WDD A;  3THN A;  2NPP C;  5HPE A;  3K7V C;  5EQV A;  1G5B A;  4FBQ A;  2BQ8 X;  3RL3 A;  4UT3 A;  3H60 A;  2WDF A;  2YVT A;  2AHD A;  1SU1 A;  3RL5 A;  2DXN A;  3PSN A;  2KKN A;  2BDX A;  3H64 A;  3LL8 A;  5JPE A;  5J28 A;  1S8E A;  3IB7 A;  5F3W A;  4DT2 A;  1T71 A;  2Z72 A;  1UF3 A;  4XPN A;  1HP1 A;  3E0J A;  3T1I A;  1KBP A;  4UWQ A;  1XM7 A;  3V4Y A;  3H66 A;  3N5U A;  1HO5 A;  1M63 A;  1S3N A;  2Z1A A;  3H67 A;  3H62 B;  4H1Y P;  2IAE C;  4IYP C;  1OIE A;  4LU9 A;  4NZV A;  3EGH A;  2ZO9 B;  5GTU A;  4IL1 A;  2QJC A;  4G9J A;  3C5W C;  4F0Z A;  2ZOA A;  3AV0 A;  4DHL A;  2QFR A;  3THO B;  2USH A;  4FBK A;  1II7 A;  3H68 A;  3CK2 A;  4H2B A;  1T70 A;  4H2I A;  2A22 A;  2GJU A;  4JA7 A;  4H2F A;  3P71 C;  4MOY A;  2DFJ A;  2ZBM A;  1WAO 1;  4DSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...