1USSA

Yeast histone h1 globular domain ii, hho1p gii, solution nmr structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
KASSPSSLTYKEMILKSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENGELVQPKGPSGIIKLNKKKVKLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTONE H1
publication title Two Homologous Domains of Similar Structure But Different Stability in the Yeast Linker Histone, Hho1P
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 18
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2003-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ussA00
5D5VB 4WCGA 5F6FA 1R36A 3LSTA 2YX7A 4EVIA 1E2XA 4P96A 2FSWA 5HLHA 4OIOF 2H09A 4OIPF 2NNYA 1YS7A 4GYGA 4LG0B 3QOPA 4Z2YA 2VOOA 4AD9A 3FHZA 3I59B 3BOQA 2RDPA 2VC0A 4KDPA 4PGHA 1U78A 4A6EA 3F21A 3WTTC 1YLFA 3M7GA 4KFCA 3DXJF 1QGPA 3ZQ7A 1I1GA 3T8RA 5LEJA 1TW3A 3FMRA 5ICFA 5FFZA 1IN6A 5JHUA 3FMQA 1PUEE 5L3EA 1H0MA 2O8XA 3IWZA 1RIOH 1DUXC 2STWA 4LLNA 2PQ8A 3SZPA 1FBQA 4U7BA 4KNYA 4JQFA 2QZ8A 3HSFA 2VOPA 4Q4ZF 3MZYA 2RN7A 3HRSA 2ZXJA 3DF8A 2RC4A 1SMTA 2DPDA 4NQWA 2HFHA 1I5ZA 2DK5A 4AIKA 3WE3A 1C0WA 1W5TA 5DUKA 3KEQA 1YW9A 3TO6A 3P9IA 2P6TA 3R61A 1I27A 4IXAA 1MKMA 4ZYGA 3LA3A 1V4RA 3JSPA 2XASA 2Q2EA 4Y15A 4MGRA 3WTSC 4L18B 1ZHFA 3W6KB 3U9GA 2ZMEB 4U0WA 2UXXA 3R0AA 4NHJA 1OYYA 1LDJA 2Y0MA 1BC8C 4LK1F 5FD6A 4XSXF 2K4BA 2PG4A 2XVCA 3GYHX 3MCZA 4ZZDA 3SHFA 2V1DA 1F1ZA 2Q8KA 2QBYB 4PZJA 2EA4A 4M9SA 1WWXA 3WGGA 1T38A 1K6OA 4PCQA 1YQAA 4RB0A 4MQ9F 2JT1A 3T8TA 5BMZA 2LKPA 2XAQA 1FWZA 1REPC 1KYWA 1RUNA 2VE8A 4ZZLA 2Y75A 3JSOA 4WF2A 3N97A 4EV0A 1Q1HA 2KIUA 4EMSA 4YIFA 2GA2A 2ZNZA 4B09A 1O57A 5JVTA 2FMLA 3R60A 2ACJA 1KQ9A 2FXAA 5KVRA 1JE8A 2JTVA 3GVAA 3ZP5A 1K78B 2O03A 2BV6A 2EV0A 5LGTA 2A61A 4IRHA 5DV5A 1ZGAA 3WTYC 1R5HA 4ZYHA 4UXNA 5AONA 4N9IA 4LB5A 1GVJA 2RGVA 2E7XA 3JTGA 1R1TA 2NS0A 5AIPA 3Q9SA 2UXNA 5JFRA 2WV0A 1W4MA 4UVCA 1BM9A 3P9CA 1O3SA 3HRTA 2R7DA 4YFNF 1ZN2A 2HYFA 2DQRA 1BI2A 5E17F 2F5EA 3RJPA 3C7JA 1IN8A 4ENKA 4BHPA 2P5KA 4IPAA 1G3TA 2RQPA 4L0YB 3W6JB 3KP6A 2A69F 4M9ZA 2VONA 1TBXA 1X3UA 4OMZA 3HTSB 1FBUA 4ON0A 2QYOA 3ZMDA 5E18F 1BJAA 3QP6A 5E1ZB 1SD5A 4KIFA 2YU3A 5LHHA 2M1BA 4L5JA 3GW2A 2PEXA 5CVIA 1BBYA 3HHGA 4EJUA 3ELKA 4EJVA 4LG0A 2G9WA 2V1XA 1SD6A 1LJ9A 3RIRA 5J8FA 4CYDA 3F8BA 1LDDA 3I59A 1SMYF 4UHTA 1OMIA 4ZH4F 3ISPA 3GO5A 3M9AA 2GAUA 1VTNC 3DQVC 2V1UA 2F5FA 4ZYEA 2W57A 2YSRA 3ZMZA 2FNAA 1HKTA 1JHFA 1FNNA 1Z7UA 1O7FA 2OQGA 5DDGA 4HW0A 4IVNA 1XB4A 3E6BA 3LQQA 2VN2A 4I0BA 3KP7A 4RAZA 3E5QA 3IRQA 3T5XA 2HQNA 1BC7C 2L01A 5L3CA 2YR2A 3BY6A 1MZBA 1ZG3A 2CQKA 3CUQB 4CGZA 4OIRF 3WTXC 2A6HF 4RB3C 2XAHA 4LFUA 1L3LA 5FLXK 2ZBKA 1TLHB 4PGGA 5E8IA 1P4AA 3E97A 2IP2A 4LMYA 5ILSA 2YX4A 1ODDA 2JZYA 2L54A 1XCBA 2CWEA 5TRDA 5HS7A 2ZMEA 1K7AA 1TNTA 3B02A 1H9TA 2XIGA 4ENJA 1ULYA 3PQJA 3GZ6A 5ICGA 5BOXA 3E6CC 2QBYA 5BPIA 2EA2A 4L9JA 4M6YA 4XRFA 2CFXA 4H0EA 5K5OA 2H94A 4O3MA 2MBFA 2J5OA 4KN7X 3WE2A 3L2CA 2ZO4A 2H6BA 1S7AA 2XROA 3D0SA 3E6MA 5HLIA 2W24A 3GWZA 3ABUA 3SFZA 4M74A 3F6VA 3E6DA 3QPHA 1TW2A 1K78A 4PDKA 2H6CA 1EV7A 3ZMVA 2HS5A 2XUBA 1G3WA 1QBJA 4MTDA 5ILUA 2ZJ2A 1BIAA 1ZLJA 4HX8A 3K1PA 4L9NA 2Q0OA 1RNLA 4U0YA 1BI0A 3ZMTA 5FB2A 3V7RA 3F8CA 3GLXA 5DD8A 2IA0A 1ZGJA 1WSUA 4N9HA 1J0RA 1W7PD 3BPVA 4HZFA 3MAJA 4AWXB 3PQKA 2DLLA 5CVRA 4EQQA 4I7HA 3HHHA 2VE9A 2DTRA 1PP7U 5FLXZ 3U2RA 1WKMA 3G3ZA 2R7FA 4GO1A 3QPTA 4ENMA 4I2OA 3FWEA 1HW5A 2JPCA 2V6CA 4P55A 1QO0D 1BI3A 1WRJA 5F64A 3TDUC 3ZN0A 1HW2A 4IHTA 1B9MA 1PDNC 3HUGA 4YFKF 3LA7A 1F9NA 2W84A 1J2XA 2XKPA 3DEUA 5HDNA 4ETSA 5LHGA 4I09A 1SD4A 4CO8A 3B73A 4KT5C 3HOSA 1LEBA 2QLZA 2XRNA 3LWFA 3RKYA 4FT8A 2MLKA 1UFMA 2P5LC 2HDCA 3NEUA 4I98B 3EDPA 5CLSA 3ECHA 1T6SA 3R0JA 4M71A 1FYLA 2FEZA 1FY7A 3RYRA 4I0AA 1UHMA 2ESHA 3S2WA 1ZG1A 1EH7A 3WGHA 4LLGF 1PP8F 4DNCA 2XV4S 1HSTA 2DW4A 2A5YB 2FBKA 4Q48A 3WTVC 3HOTA 1OR7A 1HKQA 5HDGA 1SD7A 2H27A 2G7UA 2GXBA 4QLCU 2BGCA 1SFUA 4EM1A 5H6QA 4MNUA 2YPRA 1XMAA 2AS5F 3DV8A 3MFKA 1YO5C 5CVJA 4OIQF 2OZ6A 2FE3A 2WTEA 2CW0F 1IN5A 2GQQA 2FU4A 1ZH5A 3R6SA 3V7CA 4MEYF 2KKOA 3DPLC 3DP7A 4B8XA 4HF0A 3K1NA 3KP2A 1U5TB 1YYVA 4HA8A 3CO6C 1XGSA 3LAJA 1IW7F 4EJWA 4CDGA 4G7ZF 3BWGA 2QUFA 5E1WA 1R1VA 4UV9A 4R1HA 5BQTA 3LAPA 3F72A 2V9VA 4BH9A 3HTUA 1IXSB 3KLOA 3LFKA 4EM0B 1DP7P 4A6DA 4G94A 5E1XA 1SFEA 1STZA 1J9IA 1FYMA 1I6XA 4LJZF 1XDSA 2ZNYA 3GFMA 2UZKA 1ZREA 3CUOA 1T0FA 1DPUA 4LLLA 3GXOA 3L09A 4BYYA 2CYYA 4UNOA 5CJ9A 2DU9A 4OU0A 1GXPA 3KLNA 3RPQA 2EWNA 3HIFA 3GUDA 1R22A 1J59A 2JSCA 1Z6TA 3ZPLA 2OAZA 3I53A 1TNSA 2D45A 5HS8A 1DDNA 3L00A 3MWMA 3O3KA 4XSZF 3QU3A 1B4AA 2ZKZA 3HYIA 1FSEA 5LRRA 2A6EF 2VXZA 3IL2A 1AOYA 4RGXA 2W85A 4A5NA 3H92A 2O61A 3I71A 4F7ZA 1MDMB 3V7SA 1IZ1A 3IHUA 4BHBA 2EFQA 2DI3A 1XD7A 4L5IA 4QWQA 4KICA 4YIIA 4LK0F 3TO7A 3WGIA 4O6JA 1L0OC 1LVAA 2EFWA 4HX4A 3KP5A 5TJJA 2E1NA 2PJPA 1FLIA 1U2WA 1YG2A 1LQ1A 2QQ9A 5KK1A 2MH2A 3IKVA 5FGMA 3ZMSA 3JW4A 2IVMA 2DT5A 2FBIA 1RUOA 3RKXA 3CO7C 3TKYA 3RI4A 3AAFA 2FOKA 1LDKB 1R7JA 3H3ZA 1XN7A 3G73A 5L3FA 2EK5A 5FO5A 4G7OF 3KFWX 2M8EA 5ICCA 5DCFA 2X0LA 1GHCA 2LSOA 3REOA 4XLNF 4RGSA 1FX7A 5HDKA 3TOBA 1YIOA 1Z05A 4FX0A 2ELHA 1FP2A 1UB9A 4HQMA 5E20A 3RPUA 2GIVA 1P4WA 5J8CA 2J5PA 3KZZA 2CG4A 4G9YA 2LF8A 5L3BA 2ISZA 5D5WB 3EETA 3ULQB 3V8JA 2KRFA 4BHCA 4RB2C 1TQIA 5J6XA 2P8TA 1T98A 1QPMA 2QWWA 3JAMK 1FYKA 2RV8A 4HOBA 4BQAA 1B59A 3BPXA 3I0TA 4A0XA 3QU6A 4KA4A 2TDXA 5K5RA 2P7VB 1S29A 2L02A 4KMUX 4HLXA 2GXGA 3IWFA 4M6XA 2OQRA 3U1DA 3M8EA 2HTJA 3GFLA 1LEAA 4LD5A 5A2QZ 2NYXA 2HKOA 4HBLA 1B9NA 3VOEA 3M8FA 1ZAOA 4EJTA 4ESJA 2UWMA 4KN4X 3V4GA 5D6FA 2DQLA 2P4WA 1XGNA 2BEOA 4D0PA 2P7CB 1I1SA 1ON2A 4HV5A 2ADUA 5ILVA 1UCRA 1D3YA 1OKRA 3FXUA 2OBPA 2A68F 3TDZC 1U3EM 1TTYA 2DFIA 4WX9A 2Z3YA 2L4MA 1EH8A 1U5TA 1U8RA 5HOOA 2IT0A 2Z9OA 1XGMA 2HOEA 4AVPA 3J81Z 3IRRA 4XLPF 4MTEA 2OZUA 2D1VA 5CVVA 3RYPA 2QM3A 3SXYA 2X4HA 2RNJA 2E1CA 4P9UA 1W7PB 4FX4A 1KGSA 5JR3A 2NRAC 5ED4A 4A12A 4RGUA 2XHKA 1FT9A 2IRFG 2XAGA 1R00A 5LGNA 3JTHA 3CTAA 1OYWA 1USSA 2PMUA 4MQVA 2IA2A 1ZARA 2EV6A 4GXOA 2FNPA 2K02A 4IRIA 3JAMZ 4G6QA 2KIFA 1Z1DA 2XGXA 2QVOA 2FF4A 3BJAA 5D4SA 2DPUA 1FBSA 3WODF 2FA5A 1FSHA 3I5UA 1IN4A 1ZRDA 1KA8A 1J75A 1HW1A 1P92A 4CZZA 3DFGA 2LNBA 2O0YA 4XBFA 2FRHA 2BYVE 1MDMA 1F5TA 2PBIA 4HQEA 3NQOA 5F1RA 2D2WA 2STTA 1RI7A 3GX4X 3WU0A 2IPQX 1V3FA 3K0LA 5JI6A 4ASNA 5L3DA 1KU3A 1JGSA 4KYWA 2E7WA 5IT9K 5DEQA 2JRTA 3OV8A 1JXSA 2DK8A 5HS9A 3T0YA 2BE5F 2A07F 1T2KA 1DPRA 1QZYA 4EGYA 5D8LB 3J80K 2D1HA 3D5LA 2RVCA 1P6RA 5IT3A 1IAWA 4JK1X 1Y0UA 3ML6A 4IRGA 4BNCA 2O3FA 3FXRA 2EFOA 3V8LA 2VBZA 4Y13A 1B1BA 3EUHA 4S04A 1D5VA 1IF1A 2QQAA 2HTSA 4IJAA 1FOKA 4OINF 3BJ6A 2M5WA 3ERED 4EGZA 2VC1A 1HQCA 2B0LA 2F2EA 5HVQC 2K86A 1K79A 2LDUA 2EFPA 3BZ6A 1USTA 3F3XA 3HSRA 4S05A 1H9GA 1R23A 2V79A 1R58A 1S6LA 5BS6A 3HSEA 1S7OA 4HAMA 3J7AO 1IN7A 1G6NA 1YW8A 5BPDA 4WK8F 3WTUC 2HQRA 5LLQA 3ECOA 3EYYA 4MEXF 2GWRA 5DD4A 3ABTA 4RS8A 4E70A 5FFXA 3KETA 2JPBA 3F22A 4I02A 3PFIA 3GF2A 4AIHA 3N4MA 3F6OA 2HGCA 3SZTA 1OYIA 4EJOA 1W5SA 3RDIA 1BOAA 1ZLKA 5D5XB 3H3UA 1JHHA 4NB5A 3O6BB 2MH9A 3TGNA 5K1YA 3CUQA 2ETHA 3OOPA 2Z99A 1SAXA 5D6EA 4OOIA 2CO5A 4P5OA 4CXFA 1GXQA 2C6YA 1IRFA 1QNTA 1ZG5A 5K5QA 5EEHA 4HYEA 2OD5A 4UUVA 3E5XA 3I58A 1J5YA 5IT9Z 3GEZA 2XKOA 3HRMA 1CGPA 3I54A 1CF7B 5LGUA 2CGPA 3QRFF 3V8KA 1XCVA 1QQIA 2IJLA 1O3QA 4OMYA 3J80Z 2VODA 5LHIA 2Z33A 2IA1A 3F23A 1O3TA 5H6RA 1D8KA 6PAXA 1Z91A 2CSOA 1HXDA 2IW5A 4K2EA 3LQRA 4ZYDA 3I4PA 1XSXA 2Z5UA 2ZFWA 2VBWA 3DPTA 1XGOA 4L9TA 2A3SA 1RZ4A 4KIGA 3EYIA 3FMSA 3BJOA 2PFBA 3T1BA 1ONVA 3M1EA 5DYMA 5H20A 2PLYA 4HLYA 1NHAA 1W7PA 3TQNA 3GZ5A 1XSVA 1YW7A 3SQNA 3QP5A 2MLGA 3CLOA 4HV6A 3R4KA 1SFXA 4KUMA 2NAZA 1TQMA 5LRSA 2W25A 2EFNA 1E17A 3RKWA 3NRVA 2PI0A 1S3JA 5D4RA 2G7HA 2HWVA 4YG2F 3CJNA 2L3DA 2M87A 1BIBA 5E8GA 2DBBA 3L7WA 4MHGA 3WU1B 4IF4A 1G4DA 5A2QK 1P4XA 1YS6A 1KU2A 2P6SA 1XMKA 3IC7A 3EQLF 1FC3A 1O7LA 5DCMB 1U5TC 4O5VA 2M45A 3C18A 1Z9CA 3C3WA 2MA3A 4RGRA 4KIBA 4UVBA 2MC3A 4WXDA 1D8JA 3FXQA 5CYVA 3KP3A 4CICA 4ESFA 3ZN1A 1MJBA 3KEOA 3VEPA 2NNNA 3BDDA 5ERIA 2PN6A 1G3SA 1R1UA 3C1DA 2QQBA 3HRUA 3KZYA 2F5CA 2OU2A 4GYIA 2GA1A 1MJ9A 3F8NA 1P2FA 3P9KA 5HLGA 4TV7A 1MJAA 3ZMUA 4RB1A 2VT3A 2K4JA 4R8HA 3J81K 2EV5A 2MD5A 3K9TA 1KYZA 3MZHA 4GCVA 4EM2A 1J7KA 4G6DA 3K2ZA 4YFXF 3RTRA 3FZVA 3COAC 1XSDA 3P7NA 1LNWA 3Q5FA 1Z6RA 1S8NA 1IXCA 2EB7A 2L4AA 1FPQA 1FP1D 4LB6B 2ESNA 2RKHA 1KQ0A 3ROUA 1KU9A 3IKTA 4FHTA 3MQ0A 4DQ2A 3F8MA 5AIQA 4Q5SF 2ZCWA 1O3RA 4BAYA 3FF5A 1ZRFA 1HBXG 3K69A 4L0ZB 2OA4A 4AIJA 1R5GA 4UVAA 3VODA 1EH6A 2BBYA 2KJCA 2Y48A 1IXRC 2COMA 2O6GE 3CDHA 2AXLA 4HX7A 1XDUA 1TQPA 3GFJA 4U0VA 1U6GA 5ICEA 4RAYA 4U7DA 3E5UA 1A04A 3Q9VA 3VB2A 2EJRA 4LGWA 3WTZA 1UHWA 4R79A 3FX3A 2HEOA 3VFZA 3FM3A 4L9VA 3L9FA 4A0ZA 4A2UA 2HYGD 1G3YA 1ZYRF 4IHSA 2FBHA 2KJBA 2LF7A 4Q47A 5DUIA 1MD0A 2HZTA 4G8XA 3TO9A 3K1MA 3WTWC 3MEXA 4Y17A 1AWCA 4M72A 1KQ8A 3KCCA 1MGTA 5D8KB 3F8FA 1QZZA 3DKWA 4HDVA 5EEGA 2DAOA 4UV8A 2K7LA 1CF7A 2WWYA 2QENA 3QAHA 3I64A 1ZRCA 1WQ2A 3TOAA 2ISYA 2M30A 3WG9A 1T39A 2F5DA 2K27A 1OPCA 2DO7A 4ESBA 1F4KA 3LA2A 3FM5A 4JBAA 2FMYA 1B6AA 4GGGA 2HKXA 3GFIA 1IUYA 2KIMA 4N0BA 5LBQA 2R3SA 2VT2A 4A5MA 2PMHA 4WXHA 4CHUA 3E3VA 1LB2A 5D5UB 3CUQC 3KP4A 2HR3A 2XAJA 4WXCA 1KU7A 1WI9A 1IRGA 4HF2A 4P9FA 2XAFA 4HF1A 4M73A 4G7HF 2VBYA 4I01A 5LEKA 3O2PE 4ENNA 2FQ3A 4A0YA 1BI1A 2WC2A 1HSJA 3BP8A 4WWCA 4HDUA 1BN5A 5FD5A 1FZPB 4BXUA 1YTYA 4KMFA 1YFHA 4M9XA 5L3GA 2GZWA 3BROA 3KE2A 5CVUA 2P5VA 1ON1A 1HKSA 5DCMA 2VBXA 4U88A
chains in the Genus database with same CATH superfamily
2X48A 5D5VB 1Y6IA 4WCGA 3BR5A 5F6FA 1R36A 2CUFA 3LSTA 3LSKA 2YX7A 5EZGA 3D5SC 2MABA 3DBRB 4EVIA 1E2XA 1FJLA 3AG1H 5KAIC 4P96A 3VYRB 3BR1A 2X51A 2FSWA 5HLHA 2KRHA 4OIOF 2H09A 3H9GA 4XKCA 3S17J 4OIPF 2NNYA 1YS7A 1U9OA 4GYGA 3L2WA 4LG0B 3QOPA 4JX6A 4Z2YA 4XICA 4BEHA 4OWRB 3FXKA 4D5FA 2BXYA 4DW6A 3O8GA 2LY1A 1VQNI 3VPRA 2VOOA 5GP9A 4AD9A 3FHZA 3I59B 3BOQA 2RDPA 2KFDA 2CU7A 2AQEA 2VC0A 1RKTA 1N78A 4KDPA 2N8GA 1FOWA 3PL8A 1A35A 4PGHA 2LYCA 2IXSA 1U78A 1JI8A 2M2EA 3EUAA 4A6EA 3ZQFA 3ZQLA 1ZELA 4XQFA 3F21A 3WTTC 1YLFA 4IKFA 3M7GA 1H8AC 4KFCA 2VJ5A 2YS9A 2XSDC 3KEYA 1A6QA 3DXJF 3RCOA 1MH3A 1QGPA 3ZQ7A 2Q1ZB 1I1GA 4PJ0C 2HVQA 3T8RA 5LEJA 1GVDA 1TW3A 2ZXHA 3FMRA 5ICFA 3OR1C 5FFZA 4ZDLA 1W0TA 1IN6A 1GUUA 1QHGA 5JHUA 3FMQA 1PUEE 3CF2A 3IH2A 2Z16A 2L2OA 5L3EA 2RREA 1H0MA 2O8XA 1WI3A 3IWZA 3S1RJ 1RIOH 1DUXC 4PFPA 1JJ6C 2STWA 2F48A 4LLNA 4PJNA 1N75A 1IJWC 2PQ8A 3SZPA 2M3AA 2WB1N 1FBQA 4RAGA 4U7BA 4KNYA 4JQFA 3WHCA 3FXOA 2QZ8A 1IC8A 3HSFA 3CCEI 2VOPA 2CQNA 4MFEA 3MZYA 4Q4ZF 2RN7A 4AIDA 3HRSA 1WJDA 1UG0A 4C9YA 3ASOH 4BY7J 2ZXJA 3DF8A 3Q0UA 5FLVA 3NAUA 2RC4A 1SMTA 1QHHD 4ZDPA 4BE2A 2DPDA 4NQWA 2HFHA 1I5ZA 3QWLA 2JVHA 2VB6A 3LSHA 2DK5A 4AIKA 3GTOJ 3WE3A 1ITYA 1EA3A 1F36A 3RPUD 3HGYA 4Y3OA 2VPRA 1C0WA 1W5TA 4A3LJ 5DUKA 2KHMA 2E5ZA 3DLLF 2GBYA 1X1DA 3KEQA 2VLAA 1YW9A 3TO6A 3P9IA 3BCBA 3KYLA 2I8DA 2JUGA 2P6TA 3R61A 4XLEA 1I27A 2HZDA 4IXAA 1MKMA 2UV1A 2NVQJ 4ZYGA 3LA3A 2LD5A 2NVUB 2IS4A 4XNFA 1V4RA 3JSPA 2XASA 2Y0SA 1FTZA 2MYSA 2Q2EA 4MGRA 4Y15A 3MMYB 4CCMA 2NS7A 3WTSC 3I55I 2YU9J 2X6WA 3MKWB 4L18B 3HOYJ 1ZHFA 3W6KB 3U9GA 1VQ6I 2IGNA 5FRNA 4EATA 2ZMEB 4U0WA 2UXXA 3R0AA 1YIJI 4NHJA 4PK4A 3ZXSA 1OYYA 2AQFA 1K83J 1ETKA 2IGKA 1LDJA 2Y0MA 2BY0A 1BC8C 4LK1F 5FD6A 4XSXF 3HXLA 2HI3A 2K4BA 3DEWA 3OIOA 2PG4A 1YJNI 2LFBA 2XVCA 4D5CA 3GYHX 5J4VA 1BJZA 3DPUA 3S1MJ 3MCZA 4ZZDA 3SHFA 1DP3A 2V1DA 4D1QA 1F1ZA 2DYSH 2Q8KA 5GAGJ 3CD6I 3FXJA 2QBYB 3VYTB 4PZJA 2DA6A 1Y1WJ 2EA4A 4BQQA 3JRHA 4M9SA 1WWXA 3WGGA 1T38A 3VWBA 1K6OA 4PCQA 3L2RA 3TW7A 1YQAA 1X19A 4RB0A 5K7ZA 4MQ9F 2JT1A 4RA2A 3T8TA 1BL0A 3OYFA 2HDWA 5BMZA 3PNYA 2LKPA 2XAQA 1FWZA 3KX2A 1REPC 3OR2C 1KYWA 5IY5H 2E36A 1RUNA 1X1AA 3EPZA 5J1YA 2VE8A 2FJ1A 4ZZLA 2Y75A 1E3OC 3JSOA 4WF2A 3N97A 4EV0A 1Q1HA 2KIUA 2O7OA 1MBGA 3V42A 2B63J 2PMZA 2ME6A 1YX5A 4EMSA 4YIFA 2GA2A 4V2FA 2ZNZA 3I3LA 4B09A 1O57A 2X1EA 3FBIB 2NVTJ 3Q0WA 4ANJA 5JVTA 2FMLA 1TWCJ 3R60A 4FISA 2ACJA 1OISA 1KQ9A 3HZJA 2MD0A 2FXAA 5KVRA 1JE8A 2COBA 2JTVA 4FETA 3MKZA 2CW8A 3GVAA 9ANTA 3ZP5A 1ZGWA 2ZJPF 1K78B 3ESWB 2O03A 4J01A 4M3DA 2BV6A 2EV0A 2K40A 3SDGA 3S2DJ 5LGTA 2A61A 4IRHA 5DV5A 5EG0B 4KJZA 3A02A 3GTMJ 1ZGAA 5JLXA 1PYVA 4B4CA 3WTYC 1R5HA 3K2AA 4ZYHA 4UXNA 2XB0X 2X85A 1ZK8A 3FXLA 5AONA 1RETA 4A3DJ 4N9IA 2L9RA 4LB5A 1GVJA 2RGVA 4E7KA 1X1PA 2E7XA 2L7ZA 3JTGA 2Y9YA 4E7HA 1R1TA 2NS0A 4OAYA 3BG7A 1PJRA 5AIPA 4BE0A 5CQEA 2EPFA 3Q9SA 1X3WB 2UXNA 5KNLA 1VFCA 3CMAI 5JFRA 3CCSI 3J7AY 3CP8A 2WV0A 5FJ8J 1SEUA 1W4MA 4UVCA 4C2UA 4E7ZA 4XMYA 1BM9A 1D1CA 3P9CA 1VQMI 1B72B 1O3SA 2KL4A 3HRTA 1FOXA 1FIAA 2ID6A 3ZQHA 2R7DA 3RZDJ 2K9LA 4YFNF 1ZN2A 2HYFA 5C4JJ 2Y31A 1YRNA 2DQRA 4EEFG 2JMWA 1BI2A 2BHYA 5E17F 2F5EA 3N05A 3RJPA 2YUSA 3C7JA 1IN8A 2HOTA 2XPVA 3VSKA 2DN0A 3D1NI 3CQZJ 4ENKA 4A93J 2LTPA 3G71I 3QPLA 4BHPA 3SJMA 2P5KA 4IPAA 1G3TA 2RQPA 4QPOA 1RC9A 1HDDC 4GDFA 3W6JB 4L0YB 3KP6A 3OIQA 2A69F 4M9ZA 2VONA 1TBXA 1X3UA 4OMZA 4UUTA 3HTSB 4MLOA 1FBUA 1IDZA 5FLMJ 1OCZH 4ON0A 3GTPJ 2QYOA 4HSRA 3ZMDA 5E18F 1BJAA 2W00A 3GZNB 2R7TA 3QP6A 5E1ZB 3I56I 1G59A 2KZVA 2OV7A 1WPKA 4F92B 1SD5A 4E7JA 4KIFA 2E1MB 2YU3A 1W36D 3GCMA 4FQGA 2E19A 1SVLA 5LHHA 2M1BA 1I6HJ 4L5JA 3GW2A 3ZRGA 5F04A 1YJ9I 4D7MA 2DA3A 2DA5A 2PEXA 5CVIA 4DBQA 1BBYA 2XB5A 1B8IB 1K61A 3HHGA 2F4MB 4C3IJ 4EJUA 2LK2A 4G6TB 3ELKA 4EJVA 2ZXWH 5GTIC 4LG0A 2G9WA 2V1XA 1SD6A 1SVOA 4BJ6C 1LJ9A 3RIRA 5J8FA 3LNQA 4CYDA 5EDNA 4IZZA 1DU0A 2HOAA 3F8BA 3G1MA 1LDDA 3I59A 1XMXA 1SMYF 2IEKA 5EEAA 4UHTA 1OMIA 1D0XA 4ZH4F 3CC7I 4HPQA 3ISPA 3DBLB 3GO5A 4M6VA 2DTZA 5FKKA 1H88C 3M9AA 2GAUA 1VTNC 3DQVC 2V1UA 3OL3A 2F5FA 4A3GJ 2HNHA 2CFOA 4ZYEA 1A36A 2W57A 2YSRA 3ZMZA 2FNAA 1HKTA 1JHFA 2NVXJ 1V55H 1FNNA 1Z7UA 1V5GA 1O7FA 2OQGA 5DDGA 4HW0A 2E1OA 4U87A 2CUJA 2O5RA 1OJLA 3BR6A 4IVNA 3OYIA 1XB4A 5HNHA 4GRIA 5HNFA 3E6BA 4XIDA 3LQQA 4GFBA 3S2HJ 4A3CJ 2VN2A 3LOCA 4I0BA 4FASD 4UUSB 3KP7A 4RAZA 5E3OA 2RQQA 3TEDA 3A0HC 4JP0A 5F0FA 1FOYA 1I50J 3E5QA 3IRQA 4BBRJ 4UB6C 2QSFX 4A3EJ 3GTKJ 3T5XA 5DTDA 4DZJA 4QPQA 3KZIC 2ZJQF 3HOVJ 1EJ9A 2HQNA 1RR7A 3KPHA 1BC7C 3DTEA 2R7OA 2F4IA 1CQTA 2L01A 5L3CA 1MNEA 5KAFC 3MD2A 2BZTA 2YR2A 3BY6A 4IQ4A 1MZBA 1ZG3A 2CQKA 3K6GA 2X6XA 3CUQB 4CGZA 1X4OA 2EZLA 4OIRF 3WTXC 2CV2A 2A6HF 4RB3C 2XAHA 4LFUA 4IOAF 1L3LA 2V26A 5FLXK 1UG2A 3OIPA 1OCCH 1LFUP 1ETOA 3S1NJ 3OYCA 2ZBKA 1TLHB 1QVUA 4PGGA 1M1EB 5E8IA 1P4AA 3E97A 2IP2A 4LMYA 3VSLA 5ILSA 3H3VK 3E1SA 2YX4A 1ODDA 3PO2J 2JZYA 2L54A 1XCBA 2CWEA 5TRDA 5HS7A 1K4TA 5EJCA 5FKOA 3FIWA 2P0WA 2ZMEA 2LR8A 2HVRA 1K7AA 4RLFA 1TNTA 2A5WA 3B02A 3OYJA 1H9TA 4BXXJ 3JRDA 1MNMC 2XIGA 3OYHA 2NVYJ 4ENJA 1F43A 1ULYA 1DU6A 3PQJA 3GZ6A 2HYJA 4NBQA 2KPMA 1VF9A 3G1OA 5TGTA 5ICGA 5BOXA 4ZJZA 4ZYAA 3E6CC 3DBHB 2QBYA 5BPIA 1WGXA 2EA2A 4L9JA 4M6YA 2H8RA 3DTIA 4XRFA 2WAQA 4RAFA 5JLWA 4DYCA 1HCRA 4IX7A 2EIMH 3BLYA 4XORA 1XX5A 1DQUA 2CFXA 4AYBA 3FHNA 3TL4X 4H0EA 5BNGA 5K5OA 5B1BH 2WAQN 1UHSA 2H94A 4O3MA 2MBFA 2JVGA 2J5OA 4KN7X 5IPAA 3ZR8X 1MH4A 2DJIA 3WE2A 4AYBN 2XPWA 3L2CA 2VKDA 2ZO4A 1HA8A 5M5WJ 1JKQC 1WJFA 3CMEI 2H6BA 1S7AA 4CYCB 3H35A 2M9HA 2XROA 1T56A 3D0SA 3E6MA 2WADA 5HLIA 2W24A 3BG3A 3GWZA 1NH3A 2M0MA 3ABUA 3SFZA 4M74A 3F6VA 3SYTA 4Z6YA 3E6DA 3QPHA 1TW2A 1K78A 3W2AA 4PDKA 2H6CA 3NWSA 1EV7A 3PUFA 2CUZA 2HS5A 3ZMVA 2XUBA 1G3WA 1QBJA 1WJ5A 1V5EA 5EG0A 1RPWA 4MTDA 5ILUA 2OCEA 2ZJ2A 1BIAA 1MBKA 1ZLJA 1QZEA 4MIMA 3K1PA 2EIJH 4L9NA 3HPHA 1WH5A 1WJEA 2Q0OA 3FXMA 3M3YJ 2L9SA 3QYEA 1RNLA 1Z21A 2M34A 2XGDA 4HNVA 4U0YA 1BI0A 2K9QA 3ZMTA 4BU2A 4X0GA 5FB2A 3V7RA 2BVLA 2E2JJ 3G4SI 3F8CA 4AUXA 3GLXA 4IEJA 4I99C 1JUSA 5DD8A 2IA0A 1ZGJA 1FEXA 2V4JC 1WSUA 1XS9A 1NK2P 4B1RA 4N9HA 3S3OA 1VQ9I 1J0RA 5GAHJ 1W7PD 3HL2A 1POGA 3BPVA 4HZFA 3MAJA 1IV8A 4JX4A 4AC0A 1FMVA 4Y52J 4AWXB 3PQKA 1YE9A 2K85A 2MGQA 2DLLA 2DYRH 2LG4A 1R5ID 2ZXIA 5CVRA 4EQQA 4I7HA 3ERMA 3HHHA 3F9KA 4XONA 2P81A 2VE9A 2ZC2A 2JA8J 1Z77A 2X1DA 2DTRA 1PP7U 1W0UA 5FLXZ 3U2RA 3K70D 2V6EA 1WKMA 2M7AA 2R7FA 3G3ZA 4GO1A 4XM3A 3QPTA 4ENMA 2HPIA 3FBNB 3S32A 1VQ4I 4I2OA 1Y56A 2JSPA 3FWEA 1HW5A 1BA5A 3OYLA 2JPCA 3VYUB 1R6RA 2V6CA 2VQGA 4P55A 1QO0D 1VNDA 1Y39A 4N4NB 1BI3A 2BY2A 1WRJA 2XSJC 5IP9J 5F64A 3TDUC 3ZN0A 2LY2A 1HW2A 4IHTA 3A03A 2V9PA 1B9MA 5F0CA 1IG7A 4M3EA 2WY8Q 3OYNA 1PDNC 3HUGA 5F1JA 1ETXA 3K70C 5KCMA 4C3HJ 4YFKF 3LA7A 2HOSA 1F9NA 3SZGA 2W84A 5E79C 2GLOA 2LP0A 1J2XA 2EZHA 1WVRA 2XKPA 3DEUA 2A05A 3FISA 2VL8A 5HDNA 2HVSA 1HOMA 4ETSA 5LHGA 4I09A 1SD4A 4CO8A 3B73A 1HC8A 4QSHA 4KT5C 5GAEJ 3HOSA 4YELA 4A3FJ 4LOCA 1B8IA 1WJCA 1E0EA 1LEBA 2R5YB 3HC7A 2VQLA 2QLZA 3JRAA 2XRNA 2X1CA 5J3LA 2MC4A 3LWFA 4XKBA 3RKYA 3LMMA 1DGWY 1XTAA 2WB1A 4FT8A 2MLKA 4X1EA 1YITI 3MN2A 1PUFB 4Y33A 1UFMA 1X2NA 2P5LC 4CZCA 3NEUA 2HDCA 3A1YA 4I98B 2L9VA 3EDPA 5CLSA 3B6AA 3ECHA 1T6SA 1J09A 3R0JA 2VQHA 4M71A 1FYLA 2FEZA 4BGDA 3H9JA 2H1KA 1FY7A 3RYRA 5LD2C 4I0AA 1UHMA 2ESHA 3S2WA 3GBGA 1ZG1A 3J7YJ 1EH7A 3WGHA 4LLGF 1PP8F 4DNCA 3JRCA 1BW6A 4V2GA 3W6VA 2XV4S 4M3BA 1JTXA 1HSTA 4ZC3A 2DMPA 4CCJA 2DW4A 2A5YB 3H0GJ 2FBKA 4Q48A 3WTVC 3HOTA 2CQQA 1JT6A 3DEEA 1V54H 4RM2A 1Z7LA 1OR7A 3QOEA 1HKQA 5HDGA 1SD7A 2H27A 2G7UA 2GXBA 1TWAJ 4QLCU 2HU9A 2BGCA 5CKTA 4UUSA 3CC2I 1SFUA 2FD5A 1TWGJ 4EM1A 5H6QA 3ABMH 2KLOA 4MNUA 4DJAA 5IYCJ 2QKMB 3OS0A 2YPRA 1QRYA 1XMAA 2Y2ZA 1RRJA 3KYDB 4DIQA 2AS5F 5J1UA 1LPQA 3DV8A 3MFKA 2W4SA 1YO5C 5CVJA 1WZ2A 4OIQF 2OZ6A 3L2QA 2FE3A 2WTEA 2CW0F 4C3JJ 1IN5A 5IYBJ 2GQQA 2FU4A 1ZH5A 4OAZA 3R6SA 3HKZA 3V7CA 4MEYF 2E5NA 2KKOA 2AXTC 1I3AA 2KZGA 3ABLH 4IHVA 3TBIA 4KISA 1OCRH 3DPLC 3LFUA 5E3LA 3P5JA 2WAFA 3UNGC 3DP7A 2M7BA 3HKZN 1A5JA 1U0JA 2GIZA 4XLHA 2BW3B 2DCEA 4B8XA 3DLAA 4HF0A 3K1NA 3KP2A 1U5TB 1YYVA 2E71A 4HA8A 5J40A 3CO6C 3S3NA 1XGSA 2A6TA 3RKQA 3LAJA 3J7ZI 1IW7F 4EJWA 4CDGA 2W7NA 2ZSHB 5GTHC 4G7ZF 1IDYA 4DGWB 4J19A 1R9TJ 3BWGA 2QUFA 3PSFA 5E1WA 2XF5A 1R1VA 4UV9A 2NOJB 3H5NA 4R1HA 2G0EA 5BQTA 1VI0A 2Y9ZA 1JGGA 3LAPA 3F72A 3U1KA 3HOUJ 2V9VA 4BH9A 3HTUA 3BG9A 3C2GA 1IXSB 1XG1A 3KLOA 5TISC 3LFKA 4EM0B 1DP7P 3CC4I 3EUKL 4A6DA 4G94A 5E1XA 1SFEA 1STZA 1J9IA 1FYMA 1I6XA 4LJZF 3SEQA 1XDSA 2ZNYA 3GFMA 4XKWA 2UZKA 1ZREA 4JOMA 3CUOA 3HBLA 2LBFB 1T0FA 1DPUA 4LLLA 1D5YA 3GXOA 1Y0NA 2QF7A 3NWTA 4MO7A 3QPSA 3OL4A 3L09A 4BYYA 2CYYA 4UNOA 5CJ9A 2DU9A 3CDIA 2QGUA 3IH3A 4OU0A 1GXPA 3HOWJ 1X1BA 5CPRB 1ETWA 2JQ7A 2PJRB 3KLNA 3RPQA 1VZ0A 2EWNA 3X2QH 3HIFA 3GUDA 4RDUA 4FTHA 1R22A 1S7EA 1TP4A 1J59A 3IUOA 2JSCA 4S0HB 3IP4B 1Z6TA 4IHXA 3ZPLA 3IH4A 2OAZA 4CSWA 1X1CA 3I53A 5EF6A 1Z3YA 2FX0A 4XL9A 3OYGA 1A31A 1UELB 1TNSA 3PO3J 2D45A 3QQAA 2OTJI 5HS8A 2R5ZB 3SDBA 1DDNA 3L00A 3MWMA 3UKGA 2GXAA 3O3KA 4XSZF 3QU3A 1SC7A 2QQ8A 1B4AA 2V9KA 5DM6F 4BACA 2ZKZA 2K5CA 2ZMEC 3HYIA 1FSEA 5LRRA 1FMWA 3SFIA 2A6EF 2VXZA 3S93A 3WHBA 3IL2A 3H0DA 4RGXA 2R7VA 1AOYA 2W85A 4A5NA 3H92A 3BC8A 2VQCA 3SEZA 3I71A 4F7ZA 1MDMB 2O61A 2DT6A 3CJTB 3V7SA 1O4XA 2GM4A 3WG7H 3OMYA 1IZ1A 2DMQA 3IHUA 2E2IJ 4BHBA 2EFQA 2M0CA 2DI3A 2XPUA 3A01B 1XD7A 2R7XA 4L5IA 4KICA 4QWQA 4YIIA 4YRVA 4LK0F 3IAS2 2DFFA 3TO7A 2NS8A 3WGIA 3LSIA 4O6JA 2CRGA 4Y7NJ 1L0OC 1LVAA 2EFWA 4X6AJ 4HX4A 3KP5A 5FKNA 5TJJA 1MNDA 2E1NA 2XAUA 2PJPA 1HDPA 4U88A 1FLIA 4A3MJ 1U2WA 1YG2A 1LQ1A 3DCFA 3OSFA 2JUCA 3G2BA 2QQ9A 5KK1A 3JRGA 2MH2A 1MBJA 3IKVA 5HLTA 5FGMA 3ZMSA 3JW4A 2IVMA 3GTGJ 2DT5A 2FBIA 1RUOA 2HXIA 3RKXA 3CO7C 1HLVA 3TKYA 3BG5A 1ZR2A 3CCQI 3RI4A 3AAFA 2FOKA 1LDKB 4FE4A 1NG7A 1R7JA 4BEHB 3C2HA 3H3ZA 3QYBA 1XN7A 3IAM2 3G73A 4RBOA 1X58A 3JCUC 2LREA 5L3FA 4DZPA 4ZTJA 2EK5A 5FO5A 1LE8B 4G7OF 3KFWX 1MMAA 3BQZA 2M8EA 2W82A 3FKIJ 3QODA 4XOPA 5ICCA 3A4CA 3ZQCA 3K4NA 5DCFA 2X0LA 1GHCA 2LSOA 4B47A 2LOOA 3REOA 4BDZA 4XLNF 2ME0A 4RGSA 1FX7A 5FKMA 5HDKA 3TOBA 1YIOA 4B43A 1ETYA 1Z05A 4FX0A 1E3HA 2ELHA 1FP2A 1UB9A 4HQMA 2OC6A 5E20A 3RPUA 2GIVA 1P4WA 5J8CA 2J5PA 2VKVA 3KZZA 3IV5A 2CG4A 3OS1A 2DFEA 4G9YA 2DA7A 3LSGA 2BY3A 2VASA 3B6CA 2LF8A 5L3BA 3I4NJ 2IGOA 2JK3A 4F93B 4IOCF 5D5WB 2ISZA 3WU2C 3EETA 4A69C 3ULQB 3V8JA 2KRFA 2X6OA 4BHCA 4RB2C 5DM7F 1MMNA 4PUSA 2DDBA 4CCOA 2W48A 3PNVA 1PUFA 1TQIA 5M5YJ 1BOBA 2X9DA 2P8TA 1T98A 5J6XA 1QPMA 2QWWA 4N4OB 3JAMK 1FYKA 2RV8A 4HOBA 4BQAA 1B59A 3BPXA 3I0TA 4A0XA 2M4GA 2Z1DA 3QU6A 4QTRA 2DDAA 4PSXA 2IAIA 2R93J 4KA4A 2TDXA 3NARA 4BKXA 2P7VB 5K5RA 5M3FJ 4YIRX 2ZB9A 2KDOA 1S29A 1Y8QB 2L02A 4KMUX 4HLXA 4D9JA 1X3ZB 2GXGA 3IWFA 1EKEA 1MW7A 3TP0A 2XDVA 2OF7A 4M6XA 3AKZA 2DT7B 2OUMA 2OQRA 3U1DA 1UJ8A 2XGEA 2HTJA 3GFLA 3M8EA 1LEAA 2F6CA 4C30A 4LD5A 4HNUA 3ZGKA 5A2QZ 3OYEA 2NYXA 4DOZA 2HKOA 4HBLA 1B9NA 2JA6J 3Q3SA 3O8HA 3VOEA 3M8FA 1ZAOA 1PVEA 2VIXA 4EJTA 3L2VA 3S15J 4ESJA 2UWMA 2Y30A 4KN4X 3V4GA 5D6FA 3JRFA 2BHZA 2DQLA 1JTYA 2DODA 2K9SA 2P4WA 1XGNA 2BEOA 3M8JA 3CCJI 1D0YA 3BTIA 4D0PA 1MMDA 2P7CB 3VYSB 4PJMA 1I1SA 3ZOBA 1ON2A 4FCYA 4HV5A 2ADUA 5ILVA 2O9LA 1UCRA 1S5LC 2K9MA 3LSJA 1D3YA 1OKRA 1JKOC 1T95A 3FXUA 1SANA 2OBPA 2A68F 4II3A 3TDZC 1U3EM 1X4PA 2D5VA 3PIOF 1UAAA 2EBIA 1TTYA 2DFIA 4WX9A 4IHWA 3DU6A 3AL0B 2MG4A 3W3CA 3BR3A 2Z3YA 1D1BA 3W2WA 2KISA 2L4MA 2VPLA 1EH8A 5FKLA 4LG3A 1K6YA 1U5TA 2QEXI 1VQLI 1U8RA 5HOOA 2IT0A 2Z9OA 2IS2A 4D7NA 3I9V2 1EF4A 1XGMA 1N77A 1S9HA 2HOEA 4AVPA 3J81Z 1LVKA 3OS2A 1LUJB 4XLPF 3IRRA 4MTEA 1R71A 1VQ7I 2OZUA 2D1VA 5CVVA 3RYPA 2QM3A 2L5QA 4P1WA 1D0ZA 3H5AA 2L7FP 3HGGA 3SXYA 4F52A 1ZR4A 2UUZA 1HF0A 1N25A 2LKXA 2TCTA 2X4HA 2RNJA 1OR7C 4XOTA 2LC2A 2E1CA 2QSHX 4P9UA 1YHQI 2DA4A 2R7ZJ 1W7PB 4FX4A 1KGSA 2E35A 5JR3A 2AO9A 2NRAC 2MFZA 4AVZA 5FRMA 1ENHA 3C2BA 5ED4A 2HXOA 3FK7A 4HNTA 4A12A 4RGUA 5C4XJ 2XHKA 1FT9A 3PNTA 2IRFG 5EYRA 3CCYA 4PSWA 2XAGA 1R00A 4LITA 2KDZA 4BBSJ 2LBFA 1U8BA 1SFOJ 5LGNA 3CMYA 3JTHA 3CTAA 4HRIA 1OYWA 4BUPA 5B5EC 1R4NB 3ABKH 4BJ5C 2LMDA 3JREA 1WFXA 1USSA 2PMUA 5EZHA 4MQVA 2IA2A 1ZARA 4HG2A 3ZCOA 2EV6A 2BY1A 4GXOA 2FNPA 2K02A 2PJRA 4IRIA 3JAMZ 3CDLA 4BL0B 4G6QA 2KIFA 1Z1DA 2XGXA 2LKSA 2QVOA 2O8KA 1ORKA 3S16J 2FF4A 1RKWA 3BJAA 5D4SA 2DPUA 4DYRA 3OYAA 2DMUA 1FBSA 1D1AA 4BE1A 4I6ZA 1R4MB 3WODF 2FA5A 1APLC 3FKJA 3DKXA 2HQ5A 3I5UA 1FSHA 1IN4A 1YRNB 1KA8A 1ZRDA 2F4OB 2X6YA 3AG3H 2DA1A 4B48A 4XLCA 3JR9A 4IO9F 1GT0C 1Y8RB 1J75A 1BR1A 1HW1A 3MKYB 1P92A 3GTJJ 4CZZA 3DFGA 2CV0A 1B72A 3TP3A 5C3EJ 3CJQB 2V1NA 2LNBA 2O0YA 4XBFA 2NXNB 2FRHA 2BYVE 1MDMA 3PSIA 1F5TA 2PBIA 4HQEA 3NQOA 3K4CA 5F1RA 2D2WA 2STTA 5F0HA 4C2TA 1RI7A 3GX4X 3ZQQA 3A01A 3PM1A 3K10A 3WU0A 1T0FC 2IPQX 1V3FA 3K0LA 1LFPA 2ZFUA 4NNJA 3GLLA 5JI6A 2ECCA 4ASNA 3CP2A 5L3DA 3S14J 1AKHB 1KU3A 3CCLI 1JGSA 1SFKA 4KYWA 2E7WA 5IT9K 2JWTA 2CW7A 5DEQA 2JRTA 3OV8A 2R7UA 2DK8A 5HS9A 3T0YA 2BE5F 2A07F 1JXSA 2ELKA 2WBMA 1T2KA 1DPRA 3CZ6A 1QZYA 4BS9A 4EGYA 5D8LB 3J80K 2KMUA 2BVMA 2D1HA 2CJJA 3D5LA 4HSTA 5FROA 1ETVA 4BJTA 2RVCA 3TMOA 1P6RA 5IT3A 1IAWA 4JK1X 2ID3A 4JYKA 1Y0UA 3ML6A 4IRGA 4LIUA 4BNCA 2O3FA 3FXRA 2CS3A 2EFOA 3V8LA 1LE8A 2VBZA 4Y13A 1B1BA 3EUHA 3ONQA 1JJ8C 4S04A 1D5VA 1IF1A 5J47A 2Y69H 3MVPA 2QQAA 2HTSA 3HG9A 1V5FA 4KT6A 4IJAA 2HQAA 4BQNA 1FOKA 1OQYA 3OSGA 4OINF 3BJ6A 2M5WA 3ERED 4EGZA 2VC1A 1HQCA 2B0LA 2ICWG 2M8GX 2F2EA 3H1CA 2GOMA 5HVQC 4IQJA 1VQKI 2K86A 1K79A 2XC7A 2LDUA 2EFPA 3BZ6A 3KYCB 4ABZA 5GPCA 1USTA 4AU7A 3F3XA 3HSRA 2R7WA 4S05A 3ZQGA 1H9GA 5DS9A 3JRIA 1R23A 2V79A 2B9SA 2WA0A 4M3GA 1IV6A 4PJJA 1R58A 4FE7A 4J00A 1MSEC 1S6LA 5BS6A 4AM3A 4NDLA 3HSEA 1S7OA 3DWLE 4HAMA 4E4HA 3J7AO 1IN7A 1T08B 2IS6A 4E6KG 1G6NA 2KQRA 1YW8A 1H89C 5BPDA 4WK8F 4QIWN 3WTUC 2HQRA 2DOFA 5LLQA 3ECOA 4XLFA 3EYYA 2R7RA 1RESA 2GWRA 1UZCA 4MEXF 2RNGA 2OTLI 1IRZA 2WAEA 4V19K 5DD4A 3I4MJ 3ABTA 4RS8A 3BTJA 1UMQA 3E0JB 5FFXA 4E70A 2ZSIB 5EGOB 5B3SH 2VI6A 3KETA 2JPBA 1JKPC 3F22A 4I02A 2QA4I 3PFIA 3GF2A 1RR8C 4AIHA 3MKLA 3F6OA 2HGCA 3N4MA 3SZTA 1MBHA 1OYIA 5C44J 4EJOA 1NG6A 1W5SA 3RDIA 1BOAA 3G6EI 1ZLKA 5D5XB 3H3UA 1JHHA 3A2KA 3K4BA 4NB5A 3O6BB 5IP7J 3PUBA 2CMPA 2MH9A 3TGNA 5K1YA 3BQYA 3CUQA 1VQ5I 2OJED 2ETHA 2TRTA 3OOPA 1U9NA 2Z99A 4XR6A 5F08A 5D6EA 1SAXA 2VKEA 4OOIA 3AG4H 2CO5A 5J1RA 4P5OA 4KITB 4B44A 4CXFA 2CV1A 2F5VA 1TL8A 3LSMA 3DTKA 1GXQA 2C6YA 1IRFA 1QNTA 1ZG5A 5K5QA 4XKVA 5EEHA 2V7FA 4HYEA 1LFBA 2OD5A 4UUVA 3BZCA 2Y0SN 3E5XA 3I58A 2QKLB 1J5YA 2LY9A 3FDYA 3RQ4A 5IT9Z 3GEZA 2XKOA 3HRMA 1CGPA 3I54A 1CF7B 5LGUA 1KZHA 2CGPA 2WY7Q 3QRFF 3V8KA 1XCVA 1QQIA 2IJLA 1O3QA 5IOYA 3J80Z 4OMYA 2VODA 1ETQA 1TT0A 1IGNA 5LHIA 4XRSA 2Z33A 2IA1A 3F23A 3AG2H 2AHQA 4DYQA 1O3TA 1ACIA 5H6RA 1D8KA 4BQOA 6PAXA 1Z91A 2CSOA 1HXDA 2IW5A 4K2EA 3LQRA 4PJLA 4ZYDA 3I4PA 3PJRA 2EQRA 5K7HA 4CCLA 1XSXA 4PFOA 2Z5UA 2ZFWA 2DMTA 2DFHA 2VBWA 3DPTA 1OLTA 3ZQIA 1XGOA 1Z3XA 4L9TA 3S8PA 2A3SA 1RZ4A 4KIGA 4II2A 3EYIA 3CJRB 2GOXB 3FMSA 2KIQA 3BZKA 1IRXA 1MIJA 3BJOA 3CCUI 2PFBA 1Z67A 1OCPA 3T1BA 2VUMJ 1ONVA 1YOVB 3M1EA 5DYMA 1JT0A 3TW6A 5H20A 2PLYA 3HDDA 1JUMA 4HLYA 1WJBA 4IL6C 3A0BC 1SAUA 4NC6A 2PMZN 3HJEA 1NHAA 4LIVA 1W7PA 3RSNA 2Z2SB 3TQNA 2I5UA 3LSPA 3GZ5A 5GADJ 2EZKA 1Q1VA 1XSVA 1YW7A 4CYCA 1BR4A 3BCAA 3SQNA 2FQ4A 3QP5A 2MLGA 1YJWI 3CLOA 4HV6A 3VDXA 1Z0XA 3R4KA 2HDDA 1SFXA 4KUMA 4A3IJ 2JRMA 2NAZA 3GMEA 1TQMA 5LRSA 2W25A 2EFNA 5K7FA 1E17A 3RKWA 3NRVA 2PI0A 1S3JA 5D4RA 3S1QJ 2G7HA 2HWVA 4YG2F 2L7KA 3UR3C 1FTTA 3CJNA 2L3DA 3S3MA 2M87A 3GTLJ 3CCMI 1IO2A 2ELJA 1BIBA 3M1CA 5E8GA 1Y1VJ 2DBBA 3L7WA 3K4LA 4MHGA 4IF4A 3WU1B 1K4SA 1G4DA 5A2QK 4F55A 1P4XA 1YS6A 5CQGA 2XGCA 1KU2A 2P6SA 5HODA 2ZJRF 1XMKA 3HEFA 3IC7A 3EQLF 4HEA2 1FC3A 1O7LA 4W1UA 5DCMB 1U5TC 4O5VA 1S72I 2M45A 3C18A 1X2MA 4I76A 1Z9CA 2DOEA 1QVTA 3C3WA 2MA3A 2XRLA 4RGRA 4KIBA 3HOXJ 3GTQJ 4UVBA 1MMSA 3CESA 1ZQ3P 2MC3A 4WXDA 1D8JA 1T8IA 3FXQA 5CYVA 1QPIA 3KP3A 1AHDP 2JN6A 4CICA 4ESFA 3ZN1A 5IOZA 2PX9A 1MJBA 3KEOA 3H36A 3VEPA 1OCTC 2NNNA 3CCVI 3BDDA 4A3JJ 5ERIA 2KRCA 2PN6A 1WH7A 3RZOJ 1G3SA 2CQXA 1I3QJ 1R1UA 2LRDA 3C1DA 2DA2A 2QQBA 3HRUA 3KZYA 2F5CA 4F91B 2IS1A 4B3AA 5IYDJ 2OU2A 4CUGA 2VXDA 1MBEA 4E7SA 1TWFJ 2LLKA 3HM5A 4GYIA 2GA1A 1MJ9A 3F8NA 1P2FA 3P9KA 4NUBA 5HLGA 3M07A 4TV7A 1OFCX 1BR2A 3W2VA 1MJAA 3ZMUA 3HUGB 4RB1A 2VT3A 2K4JA 4ITVA 4R8HA 3BR0A 3Q0VA 5KHDA 2L7MP 1AKHA 3J81K 2EV5A 2WV1A 5IP6A 2MD5A 1GV2A 3K9TA 5M5XJ 1KYZA 3OOUA 3MZHA 4NC7A 1MSFC 3BR2A 4GCVA 4A3BJ 4EM2A 2FUG2 2JA7J 1J7KA 4G6DA 3K2ZA 4YFXF 3RTRA 3FZVA 3COAC 1P7IA 2LVSA 4E7LA 1XSDA 1FIPA 2VJIA 1ZKGA 4NC8A 1TC3C 3P7NA 2L0KA 2W1OA 1TZLA 1VQ8I 1LNWA 3H9QA 3Q5FA 1Z6RA 4E7IA 1S8NA 2KT0A 1IXCA 2EB7A 2L4AA 1FPQA 1FP1D 4LB6B 3ASNH 2XF7A 2ESNA 1W36C 4CCNA 1YX3A 2RKHA 1KQ0A 1NTCA 1TWHJ 2R5YA 5F27A 3ROUA 1KU9A 4JX5A 3IKTA 4FHTA 1KONA 2ECBA 3MQ0A 4DQ2A 2CH0A 3F8MA 5AIQA 3E7LA 2B7EA 4Q5SF 2ZCWA 1O3RA 1GDTA 4BAYA 2EILH 3FF5A 1ZRFA 4F3QA 1HBXG 1QU3A 3D5RC 3K69A 4L0ZB 4Y4RA 2OA4A 4AIJA 1R5GA 4YEJA 3PIPF 1AA7A 3OYBA 2LH9A 4UVAA 4NQWB 2EIKH 3VODA 1EH6A 2JA2A 2I10A 2BBYA 2IBDA 2KJCA 3F0CA 2Y48A 1IXRC 2COMA 3PFYA 3BT9A 5E3NA 4ZTFA 2O6GE 3CDHA 3K4MA 2AXLA 4ZDOA 4HX7A 4RLQA 1XDUA 3U21A 1TQPA 3GFJA 4CCKA 3M4OJ 4U0VA 1U6GA 5ICEA 4RAYA 1DGRM 4U7DA 5GPAA 3HPGA 3K7AJ 3E5UA 1R49A 1A04A 2M4KA 2RAEA 1WCMJ 4XLAA 3Q9VA 4MFDA 3VB2A 2EJRA 2E1MC 1G8XA 4LGWA 4DBRA 2CQ7A 1UHWA 3WTZA 2Q2EB 4XN3A 2FOWA 4R79A 1TT5B 4XRMA 2K3FA 3FX3A 2HEOA 3L1PA 5LFAA 3VFZA 3FM3A 2IGMA 4L9VA 3L9FA 2BXZA 4A0ZA 4A2UA 5B1AH 2HYGD 1VQOI 1A6IA 1G3YA 3H5RA 4G12A 3CLQA 5EGOA 1ZYRF 5JHFA 3OY9A 4IHSA 1I39A 3EUHC 3CCRI 2FBHA 2KJBA 2LF7A 4Q47A 3KIOA 5DUIA 3CF5F 2NOGA 5JVGF 1JKRC 1MD0A 3BTLA 2CUEA 1T33A 1WHUA 2H1LA 2HZTA 2MSYA 4G8XA 4W97A 4BDYA 3TO9A 2QCOA 2E34A 2OPTA 3K1MA 2BW3A 3WTWC 3MEXA 4Y17A 1AWCA 3L2UA 1XC5A 4M72A 3RQIA 4CA0A 3JRBA 4UY8I 1KQ8A 3KCCA 1MGTA 4H4KC 5D8KB 3F8FA 4C2MJ 2MW8A 1IUFA 2R7SA 1MMGA 1QZZA 3DKWA 3OWTA 4HDVA 2XF6A 5EEGA 2BOLA 2DAOA 4UV8A 2JA5J 1VQPI 2K7LA 1CF7A 2E60A 2WWYA 2QENA 2KP6A 3QAHA 3I64A 3G1LA 2DXIA 4M3FA 1W1WE 4RMNA 1ZRCA 2DJNA 1WQ2A 3FK6A 1JUPA 3TOAA 2ISYA 1OCOH 2M30A 3CMMA 3WG9A 5J4YA 2VKHA 1MBFA 1T39A 5B66C 2F5DA 4L5EA 2K27A 2L9NA 1LKXA 2HPMA 1OPCA 2DO7A 4ESBA 1F4KA 3LA2A 3FM5A 3HB9A 2FMYA 2EINH 4JBAA 3OYMA 1YI2I 2VJ4A 1B6AA 4GGGA 2JJ7A 3K4KA 4CH7A 1P7JA 2HKXA 3GFIA 4UB8C 1IUYA 2KIMA 4N0BA 2QSGX 5LBQA 2R3SA 2R0QC 1NK3P 1XPXA 1GLNA 3BG6A 2VT2A 4A5MA 2DMNA 2PMHA 1ZTRA 4WXHA 4CHUA 2OCCH 3E3VA 1LB2A 5D5UB 3CUQC 3DKYA 1GV5A 3KP4A 4B3XA 2K9NA 4XRSG 3BTCA 2HR3A 2XAJA 4RM3A 4WXCA 1KU7A 1WI9A 5E3MA 3HOZJ 4HF2A 1IRGA 1QA6A 5M3MJ 4P9FA 2XAFA 4HF1A 3QYFA 4BXFA 3K4JA 4M73A 4G7HF 2VBYA 2DOAA 4I01A 5LEKA 3O2PE 4ENNA 2FQ3A 2EH3A 3OYKA 4A0YA 2R5ZA 1BI1A 2WC2A 1HSJA 3BP8A 2R7QA 4WWCA 4HDUA 1BN5A 1W5CC 4A3KJ 4BY1J 1SVMA 2R4GA 5FD5A 1E3PA 1P9QC 1FZPB 4BXUA 3OYDA 1YTYA 4KMFA 2H8WA 1BW5A 2EZIA 4XN0A 3LL7A 1G2HA 2VJJA 1YFHA 1WJAA 4M9XA 3MZ8A 2E2HJ 5L3GA 3AL0C 2GZWA 3BROA 3KE2A 5CVUA 2P5VA 1ON1A 2R92J 1HKSA 5DCMA 4XK4A 3DU5A 1ERDA 1AU7A 4IHYA 3AFHA 5H2FC 2K3PA 3LSRA 2VBXA 4HX8A
chains in the Genus database with same CATH topology
5D5VB 4WCGA 5F6FA 1R36A 3LSTA 2YX7A 4EVIA 1E2XA 4P96A 2FSWA 5HLHA 4OIOF 2H09A 4OIPF 2NNYA 1YS7A 4GYGA 4LG0B 3QOPA 4Z2YA 2VOOA 4AD9A 3FHZA 3I59B 3BOQA 2RDPA 2VC0A 4KDPA 4PGHA 1U78A 4A6EA 3F21A 3WTTC 1YLFA 3M7GA 4KFCA 3DXJF 1QGPA 3ZQ7A 1I1GA 3T8RA 5LEJA 1TW3A 3FMRA 5ICFA 5FFZA 1IN6A 5JHUA 3FMQA 1PUEE 5L3EA 1H0MA 2O8XA 3IWZA 1RIOH 1DUXC 2STWA 4LLNA 2PQ8A 3SZPA 1FBQA 4U7BA 4KNYA 4JQFA 2QZ8A 3HSFA 2VOPA 4Q4ZF 3MZYA 2RN7A 3HRSA 2ZXJA 3DF8A 2RC4A 1SMTA 2DPDA 4NQWA 2HFHA 1I5ZA 2DK5A 4AIKA 3WE3A 1C0WA 1W5TA 5DUKA 3KEQA 1YW9A 3TO6A 3P9IA 2P6TA 3R61A 1I27A 4IXAA 1MKMA 4ZYGA 3LA3A 1V4RA 3JSPA 2XASA 2Q2EA 4Y15A 4MGRA 3WTSC 4L18B 1ZHFA 3W6KB 3U9GA 2ZMEB 4U0WA 2UXXA 3R0AA 4NHJA 1OYYA 1LDJA 2Y0MA 1BC8C 4LK1F 5FD6A 4XSXF 2K4BA 2PG4A 2XVCA 3GYHX 3MCZA 4ZZDA 3SHFA 2V1DA 1F1ZA 2Q8KA 2QBYB 4PZJA 2EA4A 4M9SA 1WWXA 3WGGA 1T38A 1K6OA 4PCQA 1YQAA 4RB0A 4MQ9F 2JT1A 3T8TA 5BMZA 2LKPA 2XAQA 1FWZA 1REPC 1KYWA 1RUNA 2VE8A 4ZZLA 2Y75A 3JSOA 4WF2A 3N97A 4EV0A 1Q1HA 2KIUA 4EMSA 4YIFA 2GA2A 2ZNZA 4B09A 1O57A 5JVTA 2FMLA 3R60A 2ACJA 1KQ9A 2FXAA 5KVRA 1JE8A 2JTVA 3GVAA 3ZP5A 1K78B 2O03A 2BV6A 2EV0A 5LGTA 2A61A 4IRHA 5DV5A 1ZGAA 3WTYC 1R5HA 4ZYHA 4UXNA 5AONA 4N9IA 4LB5A 1GVJA 2RGVA 2E7XA 3JTGA 1R1TA 2NS0A 5AIPA 3Q9SA 2UXNA 5JFRA 2WV0A 1W4MA 4UVCA 1BM9A 3P9CA 1O3SA 3HRTA 2R7DA 4YFNF 1ZN2A 2HYFA 2DQRA 1BI2A 5E17F 2F5EA 3RJPA 3C7JA 1IN8A 4ENKA 4BHPA 2P5KA 4IPAA 1G3TA 2RQPA 4L0YB 3W6JB 3KP6A 2A69F 4M9ZA 2VONA 1TBXA 1X3UA 4OMZA 3HTSB 1FBUA 4ON0A 2QYOA 3ZMDA 5E18F 1BJAA 3QP6A 5E1ZB 1SD5A 4KIFA 2YU3A 5LHHA 2M1BA 4L5JA 3GW2A 2PEXA 5CVIA 1BBYA 3HHGA 4EJUA 3ELKA 4EJVA 4LG0A 2G9WA 2V1XA 1SD6A 1LJ9A 3RIRA 5J8FA 4CYDA 3F8BA 1LDDA 3I59A 1SMYF 4UHTA 1OMIA 4ZH4F 3ISPA 3GO5A 3M9AA 2GAUA 1VTNC 3DQVC 2V1UA 2F5FA 4ZYEA 2W57A 2YSRA 3ZMZA 2FNAA 1HKTA 1JHFA 1FNNA 1Z7UA 1O7FA 2OQGA 5DDGA 4HW0A 4IVNA 1XB4A 3E6BA 3LQQA 2VN2A 4I0BA 3KP7A 4RAZA 3E5QA 3IRQA 3T5XA 2HQNA 1BC7C 2L01A 5L3CA 2YR2A 3BY6A 1MZBA 1ZG3A 2CQKA 3CUQB 4CGZA 4OIRF 3WTXC 2A6HF 4RB3C 2XAHA 4LFUA 1L3LA 5FLXK 2ZBKA 1TLHB 4PGGA 5E8IA 1P4AA 3E97A 2IP2A 4LMYA 5ILSA 2YX4A 1ODDA 2JZYA 2L54A 1XCBA 2CWEA 5TRDA 5HS7A 2ZMEA 1K7AA 1TNTA 3B02A 1H9TA 2XIGA 4ENJA 1ULYA 3PQJA 3GZ6A 5ICGA 5BOXA 3E6CC 2QBYA 5BPIA 2EA2A 4L9JA 4M6YA 4XRFA 2CFXA 4H0EA 5K5OA 2H94A 4O3MA 2MBFA 2J5OA 4KN7X 3WE2A 3L2CA 2ZO4A 2H6BA 1S7AA 2XROA 3D0SA 3E6MA 5HLIA 2W24A 3GWZA 3ABUA 3SFZA 4M74A 3F6VA 3E6DA 3QPHA 1TW2A 1K78A 4PDKA 2H6CA 1EV7A 3ZMVA 2HS5A 2XUBA 1G3WA 1QBJA 4MTDA 5ILUA 2ZJ2A 1BIAA 1ZLJA 4HX8A 3K1PA 4L9NA 2Q0OA 1RNLA 4U0YA 1BI0A 3ZMTA 5FB2A 3V7RA 3F8CA 3GLXA 5DD8A 2IA0A 1ZGJA 1WSUA 4N9HA 1J0RA 1W7PD 3BPVA 4HZFA 3MAJA 4AWXB 3PQKA 2DLLA 5CVRA 4EQQA 4I7HA 3HHHA 2VE9A 2DTRA 1PP7U 5FLXZ 3U2RA 1WKMA 3G3ZA 2R7FA 4GO1A 3QPTA 4ENMA 4I2OA 3FWEA 1HW5A 2JPCA 2V6CA 4P55A 1QO0D 1BI3A 1WRJA 5F64A 3TDUC 3ZN0A 1HW2A 4IHTA 1B9MA 1PDNC 3HUGA 4YFKF 3LA7A 1F9NA 2W84A 1J2XA 2XKPA 3DEUA 5HDNA 4ETSA 5LHGA 4I09A 1SD4A 4CO8A 3B73A 4KT5C 3HOSA 1LEBA 2QLZA 2XRNA 3LWFA 3RKYA 4FT8A 2MLKA 1UFMA 2P5LC 2HDCA 3NEUA 4I98B 3EDPA 5CLSA 3ECHA 1T6SA 3R0JA 4M71A 1FYLA 2FEZA 1FY7A 3RYRA 4I0AA 1UHMA 2ESHA 3S2WA 1ZG1A 1EH7A 3WGHA 4LLGF 1PP8F 4DNCA 2XV4S 1HSTA 2DW4A 2A5YB 2FBKA 4Q48A 3WTVC 3HOTA 1OR7A 1HKQA 5HDGA 1SD7A 2H27A 2G7UA 2GXBA 4QLCU 2BGCA 1SFUA 4EM1A 5H6QA 4MNUA 2YPRA 1XMAA 2AS5F 3DV8A 3MFKA 1YO5C 5CVJA 4OIQF 2OZ6A 2FE3A 2WTEA 2CW0F 1IN5A 2GQQA 2FU4A 1ZH5A 3R6SA 3V7CA 4MEYF 2KKOA 3DPLC 3DP7A 4B8XA 4HF0A 3K1NA 3KP2A 1U5TB 1YYVA 4HA8A 3CO6C 1XGSA 3LAJA 1IW7F 4EJWA 4CDGA 4G7ZF 3BWGA 2QUFA 5E1WA 1R1VA 4UV9A 4R1HA 5BQTA 3LAPA 3F72A 2V9VA 4BH9A 3HTUA 1IXSB 3KLOA 3LFKA 4EM0B 1DP7P 4A6DA 4G94A 5E1XA 1SFEA 1STZA 1J9IA 1FYMA 1I6XA 4LJZF 1XDSA 2ZNYA 3GFMA 2UZKA 1ZREA 3CUOA 1T0FA 1DPUA 4LLLA 3GXOA 3L09A 4BYYA 2CYYA 4UNOA 5CJ9A 2DU9A 4OU0A 1GXPA 3KLNA 3RPQA 2EWNA 3HIFA 3GUDA 1R22A 1J59A 2JSCA 1Z6TA 3ZPLA 2OAZA 3I53A 1TNSA 2D45A 5HS8A 1DDNA 3L00A 3MWMA 3O3KA 4XSZF 3QU3A 1B4AA 2ZKZA 3HYIA 1FSEA 5LRRA 2A6EF 2VXZA 3IL2A 1AOYA 4RGXA 2W85A 4A5NA 3H92A 2O61A 3I71A 4F7ZA 1MDMB 3V7SA 1IZ1A 3IHUA 4BHBA 2EFQA 2DI3A 1XD7A 4L5IA 4QWQA 4KICA 4YIIA 4LK0F 3TO7A 3WGIA 4O6JA 1L0OC 1LVAA 2EFWA 4HX4A 3KP5A 5TJJA 2E1NA 2PJPA 1FLIA 1U2WA 1YG2A 1LQ1A 2QQ9A 5KK1A 2MH2A 3IKVA 5FGMA 3ZMSA 3JW4A 2IVMA 2DT5A 2FBIA 1RUOA 3RKXA 3CO7C 3TKYA 3RI4A 3AAFA 2FOKA 1LDKB 1R7JA 3H3ZA 1XN7A 3G73A 5L3FA 2EK5A 5FO5A 4G7OF 3KFWX 2M8EA 5ICCA 5DCFA 2X0LA 1GHCA 2LSOA 3REOA 4XLNF 4RGSA 1FX7A 5HDKA 3TOBA 1YIOA 1Z05A 4FX0A 2ELHA 1FP2A 1UB9A 4HQMA 5E20A 3RPUA 2GIVA 1P4WA 5J8CA 2J5PA 3KZZA 2CG4A 4G9YA 2LF8A 5L3BA 2ISZA 5D5WB 3EETA 3ULQB 3V8JA 2KRFA 4BHCA 4RB2C 1TQIA 5J6XA 2P8TA 1T98A 1QPMA 2QWWA 3JAMK 1FYKA 2RV8A 4HOBA 4BQAA 1B59A 3BPXA 3I0TA 4A0XA 3QU6A 4KA4A 2TDXA 5K5RA 2P7VB 1S29A 2L02A 4KMUX 4HLXA 2GXGA 3IWFA 4M6XA 2OQRA 3U1DA 3M8EA 2HTJA 3GFLA 1LEAA 4LD5A 5A2QZ 2NYXA 2HKOA 4HBLA 1B9NA 3VOEA 3M8FA 1ZAOA 4EJTA 4ESJA 2UWMA 4KN4X 3V4GA 5D6FA 2DQLA 2P4WA 1XGNA 2BEOA 4D0PA 2P7CB 1I1SA 1ON2A 4HV5A 2ADUA 5ILVA 1UCRA 1D3YA 1OKRA 3FXUA 2OBPA 2A68F 3TDZC 1U3EM 1TTYA 2DFIA 4WX9A 2Z3YA 2L4MA 1EH8A 1U5TA 1U8RA 5HOOA 2IT0A 2Z9OA 1XGMA 2HOEA 4AVPA 3J81Z 3IRRA 4XLPF 4MTEA 2OZUA 2D1VA 5CVVA 3RYPA 2QM3A 3SXYA 2X4HA 2RNJA 2E1CA 4P9UA 1W7PB 4FX4A 1KGSA 5JR3A 2NRAC 5ED4A 4A12A 4RGUA 2XHKA 1FT9A 2IRFG 2XAGA 1R00A 5LGNA 3JTHA 3CTAA 1OYWA 1USSA 2PMUA 4MQVA 2IA2A 1ZARA 2EV6A 4GXOA 2FNPA 2K02A 4IRIA 3JAMZ 4G6QA 2KIFA 1Z1DA 2XGXA 2QVOA 2FF4A 3BJAA 5D4SA 2DPUA 1FBSA 3WODF 2FA5A 1FSHA 3I5UA 1IN4A 1ZRDA 1KA8A 1J75A 1HW1A 1P92A 4CZZA 3DFGA 2LNBA 2O0YA 4XBFA 2FRHA 2BYVE 1MDMA 1F5TA 2PBIA 4HQEA 3NQOA 5F1RA 2D2WA 2STTA 1RI7A 3GX4X 3WU0A 2IPQX 1V3FA 3K0LA 5JI6A 4ASNA 5L3DA 1KU3A 1JGSA 4KYWA 2E7WA 5IT9K 5DEQA 2JRTA 3OV8A 1JXSA 2DK8A 5HS9A 3T0YA 2BE5F 2A07F 1T2KA 1DPRA 1QZYA 4EGYA 5D8LB 3J80K 2D1HA 3D5LA 2RVCA 1P6RA 5IT3A 1IAWA 4JK1X 1Y0UA 3ML6A 4IRGA 4BNCA 2O3FA 3FXRA 2EFOA 3V8LA 2VBZA 4Y13A 1B1BA 3EUHA 4S04A 1D5VA 1IF1A 2QQAA 2HTSA 4IJAA 1FOKA 4OINF 3BJ6A 2M5WA 3ERED 4EGZA 2VC1A 1HQCA 2B0LA 2F2EA 5HVQC 2K86A 1K79A 2LDUA 2EFPA 3BZ6A 1USTA 3F3XA 3HSRA 4S05A 1H9GA 1R23A 2V79A 1R58A 1S6LA 5BS6A 3HSEA 1S7OA 4HAMA 3J7AO 1IN7A 1G6NA 1YW8A 5BPDA 4WK8F 3WTUC 2HQRA 5LLQA 3ECOA 3EYYA 4MEXF 2GWRA 5DD4A 3ABTA 4RS8A 4E70A 5FFXA 3KETA 2JPBA 3F22A 4I02A 3PFIA 3GF2A 4AIHA 3N4MA 3F6OA 2HGCA 3SZTA 1OYIA 4EJOA 1W5SA 3RDIA 1BOAA 1ZLKA 5D5XB 3H3UA 1JHHA 4NB5A 3O6BB 2MH9A 3TGNA 5K1YA 3CUQA 2ETHA 3OOPA 2Z99A 1SAXA 5D6EA 4OOIA 2CO5A 4P5OA 4CXFA 1GXQA 2C6YA 1IRFA 1QNTA 1ZG5A 5K5QA 5EEHA 4HYEA 2OD5A 4UUVA 3E5XA 3I58A 1J5YA 5IT9Z 3GEZA 2XKOA 3HRMA 1CGPA 3I54A 1CF7B 5LGUA 2CGPA 3QRFF 3V8KA 1XCVA 1QQIA 2IJLA 1O3QA 4OMYA 3J80Z 2VODA 5LHIA 2Z33A 2IA1A 3F23A 1O3TA 5H6RA 1D8KA 6PAXA 1Z91A 2CSOA 1HXDA 2IW5A 4K2EA 3LQRA 4ZYDA 3I4PA 1XSXA 2Z5UA 2ZFWA 2VBWA 3DPTA 1XGOA 4L9TA 2A3SA 1RZ4A 4KIGA 3EYIA 3FMSA 3BJOA 2PFBA 3T1BA 1ONVA 3M1EA 5DYMA 5H20A 2PLYA 4HLYA 1NHAA 1W7PA 3TQNA 3GZ5A 1XSVA 1YW7A 3SQNA 3QP5A 2MLGA 3CLOA 4HV6A 3R4KA 1SFXA 4KUMA 2NAZA 1TQMA 5LRSA 2W25A 2EFNA 1E17A 3RKWA 3NRVA 2PI0A 1S3JA 5D4RA 2G7HA 2HWVA 4YG2F 3CJNA 2L3DA 2M87A 1BIBA 5E8GA 2DBBA 3L7WA 4MHGA 3WU1B 4IF4A 1G4DA 5A2QK 1P4XA 1YS6A 1KU2A 2P6SA 1XMKA 3IC7A 3EQLF 1FC3A 1O7LA 5DCMB 1U5TC 4O5VA 2M45A 3C18A 1Z9CA 3C3WA 2MA3A 4RGRA 4KIBA 4UVBA 2MC3A 4WXDA 1D8JA 3FXQA 5CYVA 3KP3A 4CICA 4ESFA 3ZN1A 1MJBA 3KEOA 3VEPA 2NNNA 3BDDA 5ERIA 2PN6A 1G3SA 1R1UA 3C1DA 2QQBA 3HRUA 3KZYA 2F5CA 2OU2A 4GYIA 2GA1A 1MJ9A 3F8NA 1P2FA 3P9KA 5HLGA 4TV7A 1MJAA 3ZMUA 4RB1A 2VT3A 2K4JA 4R8HA 3J81K 2EV5A 2MD5A 3K9TA 1KYZA 3MZHA 4GCVA 4EM2A 1J7KA 4G6DA 3K2ZA 4YFXF 3RTRA 3FZVA 3COAC 1XSDA 3P7NA 1LNWA 3Q5FA 1Z6RA 1S8NA 1IXCA 2EB7A 2L4AA 1FPQA 1FP1D 4LB6B 2ESNA 2RKHA 1KQ0A 3ROUA 1KU9A 3IKTA 4FHTA 3MQ0A 4DQ2A 3F8MA 5AIQA 4Q5SF 2ZCWA 1O3RA 4BAYA 3FF5A 1ZRFA 1HBXG 3K69A 4L0ZB 2OA4A 4AIJA 1R5GA 4UVAA 3VODA 1EH6A 2BBYA 2KJCA 2Y48A 1IXRC 2COMA 2O6GE 3CDHA 2AXLA 4HX7A 1XDUA 1TQPA 3GFJA 4U0VA 1U6GA 5ICEA 4RAYA 4U7DA 3E5UA 1A04A 3Q9VA 3VB2A 2EJRA 4LGWA 3WTZA 1UHWA 4R79A 3FX3A 2HEOA 3VFZA 3FM3A 4L9VA 3L9FA 4A0ZA 4A2UA 2HYGD 1G3YA 1ZYRF 4IHSA 2FBHA 2KJBA 2LF7A 4Q47A 5DUIA 1MD0A 2HZTA 4G8XA 3TO9A 3K1MA 3WTWC 3MEXA 4Y17A 1AWCA 4M72A 1KQ8A 3KCCA 1MGTA 5D8KB 3F8FA 1QZZA 3DKWA 4HDVA 5EEGA 2DAOA 4UV8A 2K7LA 1CF7A 2WWYA 2QENA 3QAHA 3I64A 1ZRCA 1WQ2A 3TOAA 2ISYA 2M30A 3WG9A 1T39A 2F5DA 2K27A 1OPCA 2DO7A 4ESBA 1F4KA 3LA2A 3FM5A 4JBAA 2FMYA 1B6AA 4GGGA 2HKXA 3GFIA 1IUYA 2KIMA 4N0BA 5LBQA 2R3SA 2VT2A 4A5MA 2PMHA 4WXHA 4CHUA 3E3VA 1LB2A 5D5UB 3CUQC 3KP4A 2HR3A 2XAJA 4WXCA 1KU7A 1WI9A 1IRGA 4HF2A 4P9FA 2XAFA 4HF1A 4M73A 4G7HF 2VBYA 4I01A 5LEKA 3O2PE 4ENNA 2FQ3A 4A0YA 1BI1A 2WC2A 1HSJA 3BP8A 4WWCA 4HDUA 1BN5A 5FD5A 1FZPB 4BXUA 1YTYA 4KMFA 1YFHA 4M9XA 5L3GA 2GZWA 3BROA 3KE2A 5CVUA 2P5VA 1ON1A 1HKSA 5DCMA 2VBXA 4U88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D5V B;  4WCG A;  5F6F A;  1R36 A;  3LST A;  2YX7 A;  4EVI A;  1E2X A;  4P96 A;  2FSW A;  5HLH A;  4OIO F;  2H09 A;  4OIP F;  2NNY A;  1YS7 A;  4GYG A;  4LG0 B;  3QOP A;  4Z2Y A;  2VOO A;  4AD9 A;  3FHZ A;  3I59 B;  3BOQ A;  2RDP A;  2VC0 A;  4KDP A;  4PGH A;  1U78 A;  4A6E A;  3F21 A;  3WTT C;  1YLF A;  3M7G A;  4KFC A;  3DXJ F;  1QGP A;  3ZQ7 A;  1I1G A;  3T8R A;  5LEJ A;  1TW3 A;  3FMR A;  5ICF A;  5FFZ A;  1IN6 A;  5JHU A;  3FMQ A;  1PUE E;  5L3E A;  1H0M A;  2O8X A;  3IWZ A;  1RIO H;  1DUX C;  2STW A;  4LLN A;  2PQ8 A;  3SZP A;  1FBQ A;  4U7B A;  4KNY A;  4JQF A;  2QZ8 A;  3HSF A;  2VOP A;  4Q4Z F;  3MZY A;  2RN7 A;  3HRS A;  2ZXJ A;  3DF8 A;  2RC4 A;  1SMT A;  2DPD A;  4NQW A;  2HFH A;  1I5Z A;  2DK5 A;  4AIK A;  3WE3 A;  1C0W A;  1W5T A;  5DUK A;  3KEQ A;  1YW9 A;  3TO6 A;  3P9I A;  2P6T A;  3R61 A;  1I27 A;  4IXA A;  1MKM A;  4ZYG A;  3LA3 A;  1V4R A;  3JSP A;  2XAS A;  2Q2E A;  4Y15 A;  4MGR A;  3WTS C;  4L18 B;  1ZHF A;  3W6K B;  3U9G A;  2ZME B;  4U0W A;  2UXX A;  3R0A A;  4NHJ A;  1OYY A;  1LDJ A;  2Y0M A;  1BC8 C;  4LK1 F;  5FD6 A;  4XSX F;  2K4B A;  2PG4 A;  2XVC A;  3GYH X;  3MCZ A;  4ZZD A;  3SHF A;  2V1D A;  1F1Z A;  2Q8K A;  2QBY B;  4PZJ A;  2EA4 A;  4M9S A;  1WWX A;  3WGG A;  1T38 A;  1K6O A;  4PCQ A;  1YQA A;  4RB0 A;  4MQ9 F;  2JT1 A;  3T8T A;  5BMZ A;  2LKP A;  2XAQ A;  1FWZ A;  1REP C;  1KYW A;  1RUN A;  2VE8 A;  4ZZL A;  2Y75 A;  3JSO A;  4WF2 A;  3N97 A;  4EV0 A;  1Q1H A;  2KIU A;  4EMS A;  4YIF A;  2GA2 A;  2ZNZ A;  4B09 A;  1O57 A;  5JVT A;  2FML A;  3R60 A;  2ACJ A;  1KQ9 A;  2FXA A;  5KVR A;  1JE8 A;  2JTV A;  3GVA A;  3ZP5 A;  1K78 B;  2O03 A;  2BV6 A;  2EV0 A;  5LGT A;  2A61 A;  4IRH A;  5DV5 A;  1ZGA A;  3WTY C;  1R5H A;  4ZYH A;  4UXN A;  5AON A;  4N9I A;  4LB5 A;  1GVJ A;  2RGV A;  2E7X A;  3JTG A;  1R1T A;  2NS0 A;  5AIP A;  3Q9S A;  2UXN A;  5JFR A;  2WV0 A;  1W4M A;  4UVC A;  1BM9 A;  3P9C A;  1O3S A;  3HRT A;  2R7D A;  4YFN F;  1ZN2 A;  2HYF A;  2DQR A;  1BI2 A;  5E17 F;  2F5E A;  3RJP A;  3C7J A;  1IN8 A;  4ENK A;  4BHP A;  2P5K A;  4IPA A;  1G3T A;  2RQP A;  4L0Y B;  3W6J B;  3KP6 A;  2A69 F;  4M9Z A;  2VON A;  1TBX A;  1X3U A;  4OMZ A;  3HTS B;  1FBU A;  4ON0 A;  2QYO A;  3ZMD A;  5E18 F;  1BJA A;  3QP6 A;  5E1Z B;  1SD5 A;  4KIF A;  2YU3 A;  5LHH A;  2M1B A;  4L5J A;  3GW2 A;  2PEX A;  5CVI A;  1BBY A;  3HHG A;  4EJU A;  3ELK A;  4EJV A;  4LG0 A;  2G9W A;  2V1X A;  1SD6 A;  1LJ9 A;  3RIR A;  5J8F A;  4CYD A;  3F8B A;  1LDD A;  3I59 A;  1SMY F;  4UHT A;  1OMI A;  4ZH4 F;  3ISP A;  3GO5 A;  3M9A A;  2GAU A;  1VTN C;  3DQV C;  2V1U A;  2F5F A;  4ZYE A;  2W57 A;  2YSR A;  3ZMZ A;  2FNA A;  1HKT A;  1JHF A;  1FNN A;  1Z7U A;  1O7F A;  2OQG A;  5DDG A;  4HW0 A;  4IVN A;  1XB4 A;  3E6B A;  3LQQ A;  2VN2 A;  4I0B A;  3KP7 A;  4RAZ A;  3E5Q A;  3IRQ A;  3T5X A;  2HQN A;  1BC7 C;  2L01 A;  5L3C A;  2YR2 A;  3BY6 A;  1MZB A;  1ZG3 A;  2CQK A;  3CUQ B;  4CGZ A;  4OIR F;  3WTX C;  2A6H F;  4RB3 C;  2XAH A;  4LFU A;  1L3L A;  5FLX K;  2ZBK A;  1TLH B;  4PGG A;  5E8I A;  1P4A A;  3E97 A;  2IP2 A;  4LMY A;  5ILS A;  2YX4 A;  1ODD A;  2JZY A;  2L54 A;  1XCB A;  2CWE A;  5TRD A;  5HS7 A;  2ZME A;  1K7A A;  1TNT A;  3B02 A;  1H9T A;  2XIG A;  4ENJ A;  1ULY A;  3PQJ A;  3GZ6 A;  5ICG A;  5BOX A;  3E6C C;  2QBY A;  5BPI A;  2EA2 A;  4L9J A;  4M6Y A;  4XRF A;  2CFX A;  4H0E A;  5K5O A;  2H94 A;  4O3M A;  2MBF A;  2J5O A;  4KN7 X;  3WE2 A;  3L2C A;  2ZO4 A;  2H6B A;  1S7A A;  2XRO A;  3D0S A;  3E6M A;  5HLI A;  2W24 A;  3GWZ A;  3ABU A;  3SFZ A;  4M74 A;  3F6V A;  3E6D A;  3QPH A;  1TW2 A;  1K78 A;  4PDK A;  2H6C A;  1EV7 A;  3ZMV A;  2HS5 A;  2XUB A;  1G3W A;  1QBJ A;  4MTD A;  5ILU A;  2ZJ2 A;  1BIA A;  1ZLJ A;  4HX8 A;  3K1P A;  4L9N A;  2Q0O A;  1RNL A;  4U0Y A;  1BI0 A;  3ZMT A;  5FB2 A;  3V7R A;  3F8C A;  3GLX A;  5DD8 A;  2IA0 A;  1ZGJ A;  1WSU A;  4N9H A;  1J0R A;  1W7P D;  3BPV A;  4HZF A;  3MAJ A;  4AWX B;  3PQK A;  2DLL A;  5CVR A;  4EQQ A;  4I7H A;  3HHH A;  2VE9 A;  2DTR A;  1PP7 U;  5FLX Z;  3U2R A;  1WKM A;  3G3Z A;  2R7F A;  4GO1 A;  3QPT A;  4ENM A;  4I2O A;  3FWE A;  1HW5 A;  2JPC A;  2V6C A;  4P55 A;  1QO0 D;  1BI3 A;  1WRJ A;  5F64 A;  3TDU C;  3ZN0 A;  1HW2 A;  4IHT A;  1B9M A;  1PDN C;  3HUG A;  4YFK F;  3LA7 A;  1F9N A;  2W84 A;  1J2X A;  2XKP A;  3DEU A;  5HDN A;  4ETS A;  5LHG A;  4I09 A;  1SD4 A;  4CO8 A;  3B73 A;  4KT5 C;  3HOS A;  1LEB A;  2QLZ A;  2XRN A;  3LWF A;  3RKY A;  4FT8 A;  2MLK A;  1UFM A;  2P5L C;  2HDC A;  3NEU A;  4I98 B;  3EDP A;  5CLS A;  3ECH A;  1T6S A;  3R0J A;  4M71 A;  1FYL A;  2FEZ A;  1FY7 A;  3RYR A;  4I0A A;  1UHM A;  2ESH A;  3S2W A;  1ZG1 A;  1EH7 A;  3WGH A;  4LLG F;  1PP8 F;  4DNC A;  2XV4 S;  1HST A;  2DW4 A;  2A5Y B;  2FBK A;  4Q48 A;  3WTV C;  3HOT A;  1OR7 A;  1HKQ A;  5HDG A;  1SD7 A;  2H27 A;  2G7U A;  2GXB A;  4QLC U;  2BGC A;  1SFU A;  4EM1 A;  5H6Q A;  4MNU A;  2YPR A;  1XMA A;  2AS5 F;  3DV8 A;  3MFK A;  1YO5 C;  5CVJ A;  4OIQ F;  2OZ6 A;  2FE3 A;  2WTE A;  2CW0 F;  1IN5 A;  2GQQ A;  2FU4 A;  1ZH5 A;  3R6S A;  3V7C A;  4MEY F;  2KKO A;  3DPL C;  3DP7 A;  4B8X A;  4HF0 A;  3K1N A;  3KP2 A;  1U5T B;  1YYV A;  4HA8 A;  3CO6 C;  1XGS A;  3LAJ A;  1IW7 F;  4EJW A;  4CDG A;  4G7Z F;  3BWG A;  2QUF A;  5E1W A;  1R1V A;  4UV9 A;  4R1H A;  5BQT A;  3LAP A;  3F72 A;  2V9V A;  4BH9 A;  3HTU A;  1IXS B;  3KLO A;  3LFK A;  4EM0 B;  1DP7 P;  4A6D A;  4G94 A;  5E1X A;  1SFE A;  1STZ A;  1J9I A;  1FYM A;  1I6X A;  4LJZ F;  1XDS A;  2ZNY A;  3GFM A;  2UZK A;  1ZRE A;  3CUO A;  1T0F A;  1DPU A;  4LLL A;  3GXO A;  3L09 A;  4BYY A;  2CYY A;  4UNO A;  5CJ9 A;  2DU9 A;  4OU0 A;  1GXP A;  3KLN A;  3RPQ A;  2EWN A;  3HIF A;  3GUD A;  1R22 A;  1J59 A;  2JSC A;  1Z6T A;  3ZPL A;  2OAZ A;  3I53 A;  1TNS A;  2D45 A;  5HS8 A;  1DDN A;  3L00 A;  3MWM A;  3O3K A;  4XSZ F;  3QU3 A;  1B4A A;  2ZKZ A;  3HYI A;  1FSE A;  5LRR A;  2A6E F;  2VXZ A;  3IL2 A;  1AOY A;  4RGX A;  2W85 A;  4A5N A;  3H92 A;  2O61 A;  3I71 A;  4F7Z A;  1MDM B;  3V7S A;  1IZ1 A;  3IHU A;  4BHB A;  2EFQ A;  2DI3 A;  1XD7 A;  4L5I A;  4QWQ A;  4KIC A;  4YII A;  4LK0 F;  3TO7 A;  3WGI A;  4O6J A;  1L0O C;  1LVA A;  2EFW A;  4HX4 A;  3KP5 A;  5TJJ A;  2E1N A;  2PJP A;  1FLI A;  1U2W A;  1YG2 A;  1LQ1 A;  2QQ9 A;  5KK1 A;  2MH2 A;  3IKV A;  5FGM A;  3ZMS A;  3JW4 A;  2IVM A;  2DT5 A;  2FBI A;  1RUO A;  3RKX A;  3CO7 C;  3TKY A;  3RI4 A;  3AAF A;  2FOK A;  1LDK B;  1R7J A;  3H3Z A;  1XN7 A;  3G73 A;  5L3F A;  2EK5 A;  5FO5 A;  4G7O F;  3KFW X;  2M8E A;  5ICC A;  5DCF A;  2X0L A;  1GHC A;  2LSO A;  3REO A;  4XLN F;  4RGS A;  1FX7 A;  5HDK A;  3TOB A;  1YIO A;  1Z05 A;  4FX0 A;  2ELH A;  1FP2 A;  1UB9 A;  4HQM A;  5E20 A;  3RPU A;  2GIV A;  1P4W A;  5J8C A;  2J5P A;  3KZZ A;  2CG4 A;  4G9Y A;  2LF8 A;  5L3B A;  2ISZ A;  5D5W B;  3EET A;  3ULQ B;  3V8J A;  2KRF A;  4BHC A;  4RB2 C;  1TQI A;  5J6X A;  2P8T A;  1T98 A;  1QPM A;  2QWW A;  3JAM K;  1FYK A;  2RV8 A;  4HOB A;  4BQA A;  1B59 A;  3BPX A;  3I0T A;  4A0X A;  3QU6 A;  4KA4 A;  2TDX A;  5K5R A;  2P7V B;  1S29 A;  2L02 A;  4KMU X;  4HLX A;  2GXG A;  3IWF A;  4M6X A;  2OQR A;  3U1D A;  3M8E A;  2HTJ A;  3GFL A;  1LEA A;  4LD5 A;  5A2Q Z;  2NYX A;  2HKO A;  4HBL A;  1B9N A;  3VOE A;  3M8F A;  1ZAO A;  4EJT A;  4ESJ A;  2UWM A;  4KN4 X;  3V4G A;  5D6F A;  2DQL A;  2P4W A;  1XGN A;  2BEO A;  4D0P A;  2P7C B;  1I1S A;  1ON2 A;  4HV5 A;  2ADU A;  5ILV A;  1UCR A;  1D3Y A;  1OKR A;  3FXU A;  2OBP A;  2A68 F;  3TDZ C;  1U3E M;  1TTY A;  2DFI A;  4WX9 A;  2Z3Y A;  2L4M A;  1EH8 A;  1U5T A;  1U8R A;  5HOO A;  2IT0 A;  2Z9O A;  1XGM A;  2HOE A;  4AVP A;  3J81 Z;  3IRR A;  4XLP F;  4MTE A;  2OZU A;  2D1V A;  5CVV A;  3RYP A;  2QM3 A;  3SXY A;  2X4H A;  2RNJ A;  2E1C A;  4P9U A;  1W7P B;  4FX4 A;  1KGS A;  5JR3 A;  2NRA C;  5ED4 A;  4A12 A;  4RGU A;  2XHK A;  1FT9 A;  2IRF G;  2XAG A;  1R00 A;  5LGN A;  3JTH A;  3CTA A;  1OYW A;  1USS A;  2PMU A;  4MQV A;  2IA2 A;  1ZAR A;  2EV6 A;  4GXO A;  2FNP A;  2K02 A;  4IRI A;  3JAM Z;  4G6Q A;  2KIF A;  1Z1D A;  2XGX A;  2QVO A;  2FF4 A;  3BJA A;  5D4S A;  2DPU A;  1FBS A;  3WOD F;  2FA5 A;  1FSH A;  3I5U A;  1IN4 A;  1ZRD A;  1KA8 A;  1J75 A;  1HW1 A;  1P92 A;  4CZZ A;  3DFG A;  2LNB A;  2O0Y A;  4XBF A;  2FRH A;  2BYV E;  1MDM A;  1F5T A;  2PBI A;  4HQE A;  3NQO A;  5F1R A;  2D2W A;  2STT A;  1RI7 A;  3GX4 X;  3WU0 A;  2IPQ X;  1V3F A;  3K0L A;  5JI6 A;  4ASN A;  5L3D A;  1KU3 A;  1JGS A;  4KYW A;  2E7W A;  5IT9 K;  5DEQ A;  2JRT A;  3OV8 A;  1JXS A;  2DK8 A;  5HS9 A;  3T0Y A;  2BE5 F;  2A07 F;  1T2K A;  1DPR A;  1QZY A;  4EGY A;  5D8L B;  3J80 K;  2D1H A;  3D5L A;  2RVC A;  1P6R A;  5IT3 A;  1IAW A;  4JK1 X;  1Y0U A;  3ML6 A;  4IRG A;  4BNC A;  2O3F A;  3FXR A;  2EFO A;  3V8L A;  2VBZ A;  4Y13 A;  1B1B A;  3EUH A;  4S04 A;  1D5V A;  1IF1 A;  2QQA A;  2HTS A;  4IJA A;  1FOK A;  4OIN F;  3BJ6 A;  2M5W A;  3ERE D;  4EGZ A;  2VC1 A;  1HQC A;  2B0L A;  2F2E A;  5HVQ C;  2K86 A;  1K79 A;  2LDU A;  2EFP A;  3BZ6 A;  1UST A;  3F3X A;  3HSR A;  4S05 A;  1H9G A;  1R23 A;  2V79 A;  1R58 A;  1S6L A;  5BS6 A;  3HSE A;  1S7O A;  4HAM A;  3J7A O;  1IN7 A;  1G6N A;  1YW8 A;  5BPD A;  4WK8 F;  3WTU C;  2HQR A;  5LLQ A;  3ECO A;  3EYY A;  4MEX F;  2GWR A;  5DD4 A;  3ABT A;  4RS8 A;  4E70 A;  5FFX A;  3KET A;  2JPB A;  3F22 A;  4I02 A;  3PFI A;  3GF2 A;  4AIH A;  3N4M A;  3F6O A;  2HGC A;  3SZT A;  1OYI A;  4EJO A;  1W5S A;  3RDI A;  1BOA A;  1ZLK A;  5D5X B;  3H3U A;  1JHH A;  4NB5 A;  3O6B B;  2MH9 A;  3TGN A;  5K1Y A;  3CUQ A;  2ETH A;  3OOP A;  2Z99 A;  1SAX A;  5D6E A;  4OOI A;  2CO5 A;  4P5O A;  4CXF A;  1GXQ A;  2C6Y A;  1IRF A;  1QNT A;  1ZG5 A;  5K5Q A;  5EEH A;  4HYE A;  2OD5 A;  4UUV A;  3E5X A;  3I58 A;  1J5Y A;  5IT9 Z;  3GEZ A;  2XKO A;  3HRM A;  1CGP A;  3I54 A;  1CF7 B;  5LGU A;  2CGP A;  3QRF F;  3V8K A;  1XCV A;  1QQI A;  2IJL A;  1O3Q A;  4OMY A;  3J80 Z;  2VOD A;  5LHI A;  2Z33 A;  2IA1 A;  3F23 A;  1O3T A;  5H6R A;  1D8K A;  6PAX A;  1Z91 A;  2CSO A;  1HXD A;  2IW5 A;  4K2E A;  3LQR A;  4ZYD A;  3I4P A;  1XSX A;  2Z5U A;  2ZFW A;  2VBW A;  3DPT A;  1XGO A;  4L9T A;  2A3S A;  1RZ4 A;  4KIG A;  3EYI A;  3FMS A;  3BJO A;  2PFB A;  3T1B A;  1ONV A;  3M1E A;  5DYM A;  5H20 A;  2PLY A;  4HLY A;  1NHA A;  1W7P A;  3TQN A;  3GZ5 A;  1XSV A;  1YW7 A;  3SQN A;  3QP5 A;  2MLG A;  3CLO A;  4HV6 A;  3R4K A;  1SFX A;  4KUM A;  2NAZ A;  1TQM A;  5LRS A;  2W25 A;  2EFN A;  1E17 A;  3RKW A;  3NRV A;  2PI0 A;  1S3J A;  5D4R A;  2G7H A;  2HWV A;  4YG2 F;  3CJN A;  2L3D A;  2M87 A;  1BIB A;  5E8G A;  2DBB A;  3L7W A;  4MHG A;  3WU1 B;  4IF4 A;  1G4D A;  5A2Q K;  1P4X A;  1YS6 A;  1KU2 A;  2P6S A;  1XMK A;  3IC7 A;  3EQL F;  1FC3 A;  1O7L A;  5DCM B;  1U5T C;  4O5V A;  2M45 A;  3C18 A;  1Z9C A;  3C3W A;  2MA3 A;  4RGR A;  4KIB A;  4UVB A;  2MC3 A;  4WXD A;  1D8J A;  3FXQ A;  5CYV A;  3KP3 A;  4CIC A;  4ESF A;  3ZN1 A;  1MJB A;  3KEO A;  3VEP A;  2NNN A;  3BDD A;  5ERI A;  2PN6 A;  1G3S A;  1R1U A;  3C1D A;  2QQB A;  3HRU A;  3KZY A;  2F5C A;  2OU2 A;  4GYI A;  2GA1 A;  1MJ9 A;  3F8N A;  1P2F A;  3P9K A;  5HLG A;  4TV7 A;  1MJA A;  3ZMU A;  4RB1 A;  2VT3 A;  2K4J A;  4R8H A;  3J81 K;  2EV5 A;  2MD5 A;  3K9T A;  1KYZ A;  3MZH A;  4GCV A;  4EM2 A;  1J7K A;  4G6D A;  3K2Z A;  4YFX F;  3RTR A;  3FZV A;  3COA C;  1XSD A;  3P7N A;  1LNW A;  3Q5F A;  1Z6R A;  1S8N A;  1IXC A;  2EB7 A;  2L4A A;  1FPQ A;  1FP1 D;  4LB6 B;  2ESN A;  2RKH A;  1KQ0 A;  3ROU A;  1KU9 A;  3IKT A;  4FHT A;  3MQ0 A;  4DQ2 A;  3F8M A;  5AIQ A;  4Q5S F;  2ZCW A;  1O3R A;  4BAY A;  3FF5 A;  1ZRF A;  1HBX G;  3K69 A;  4L0Z B;  2OA4 A;  4AIJ A;  1R5G A;  4UVA A;  3VOD A;  1EH6 A;  2BBY A;  2KJC A;  2Y48 A;  1IXR C;  2COM A;  2O6G E;  3CDH A;  2AXL A;  4HX7 A;  1XDU A;  1TQP A;  3GFJ A;  4U0V A;  1U6G A;  5ICE A;  4RAY A;  4U7D A;  3E5U A;  1A04 A;  3Q9V A;  3VB2 A;  2EJR A;  4LGW A;  3WTZ A;  1UHW A;  4R79 A;  3FX3 A;  2HEO A;  3VFZ A;  3FM3 A;  4L9V A;  3L9F A;  4A0Z A;  4A2U A;  2HYG D;  1G3Y A;  1ZYR F;  4IHS A;  2FBH A;  2KJB A;  2LF7 A;  4Q47 A;  5DUI A;  1MD0 A;  2HZT A;  4G8X A;  3TO9 A;  3K1M A;  3WTW C;  3MEX A;  4Y17 A;  1AWC A;  4M72 A;  1KQ8 A;  3KCC A;  1MGT A;  5D8K B;  3F8F A;  1QZZ A;  3DKW A;  4HDV A;  5EEG A;  2DAO A;  4UV8 A;  2K7L A;  1CF7 A;  2WWY A;  2QEN A;  3QAH A;  3I64 A;  1ZRC A;  1WQ2 A;  3TOA A;  2ISY A;  2M30 A;  3WG9 A;  1T39 A;  2F5D A;  2K27 A;  1OPC A;  2DO7 A;  4ESB A;  1F4K A;  3LA2 A;  3FM5 A;  4JBA A;  2FMY A;  1B6A A;  4GGG A;  2HKX A;  3GFI A;  1IUY A;  2KIM A;  4N0B A;  5LBQ A;  2R3S A;  2VT2 A;  4A5M A;  2PMH A;  4WXH A;  4CHU A;  3E3V A;  1LB2 A;  5D5U B;  3CUQ C;  3KP4 A;  2HR3 A;  2XAJ A;  4WXC A;  1KU7 A;  1WI9 A;  1IRG A;  4HF2 A;  4P9F A;  2XAF A;  4HF1 A;  4M73 A;  4G7H F;  2VBY A;  4I01 A;  5LEK A;  3O2P E;  4ENN A;  2FQ3 A;  4A0Y A;  1BI1 A;  2WC2 A;  1HSJ A;  3BP8 A;  4WWC A;  4HDU A;  1BN5 A;  5FD5 A;  1FZP B;  4BXU A;  1YTY A;  4KMF A;  1YFH A;  4M9X A;  5L3G A;  2GZW A;  3BRO A;  3KE2 A;  5CVU A;  2P5V A;  1ON1 A;  1HKS A;  5DCM A;  2VBX A;  4U88 A; 
#chains in the Genus database with same CATH topology
 2X48 A;  5D5V B;  1Y6I A;  4WCG A;  3BR5 A;  5F6F A;  1R36 A;  2CUF A;  3LST A;  3LSK A;  2YX7 A;  5EZG A;  3D5S C;  2MAB A;  3DBR B;  4EVI A;  1E2X A;  1FJL A;  3AG1 H;  5KAI C;  4P96 A;  3VYR B;  3BR1 A;  2X51 A;  2FSW A;  5HLH A;  2KRH A;  4OIO F;  2H09 A;  3H9G A;  4XKC A;  3S17 J;  4OIP F;  2NNY A;  1YS7 A;  1U9O A;  4GYG A;  3L2W A;  4LG0 B;  3QOP A;  4JX6 A;  4Z2Y A;  4XIC A;  4BEH A;  4OWR B;  3FXK A;  4D5F A;  2BXY A;  4DW6 A;  3O8G A;  2LY1 A;  1VQN I;  3VPR A;  2VOO A;  5GP9 A;  4AD9 A;  3FHZ A;  3I59 B;  3BOQ A;  2RDP A;  2KFD A;  2CU7 A;  2AQE A;  2VC0 A;  1RKT A;  1N78 A;  4KDP A;  2N8G A;  1FOW A;  3PL8 A;  1A35 A;  4PGH A;  2LYC A;  2IXS A;  1U78 A;  1JI8 A;  2M2E A;  3EUA A;  4A6E A;  3ZQF A;  3ZQL A;  1ZEL A;  4XQF A;  3F21 A;  3WTT C;  1YLF A;  4IKF A;  3M7G A;  1H8A C;  4KFC A;  2VJ5 A;  2YS9 A;  2XSD C;  3KEY A;  1A6Q A;  3DXJ F;  3RCO A;  1MH3 A;  1QGP A;  3ZQ7 A;  2Q1Z B;  1I1G A;  4PJ0 C;  2HVQ A;  3T8R A;  5LEJ A;  1GVD A;  1TW3 A;  2ZXH A;  3FMR A;  5ICF A;  3OR1 C;  5FFZ A;  4ZDL A;  1W0T A;  1IN6 A;  1GUU A;  1QHG A;  5JHU A;  3FMQ A;  1PUE E;  3CF2 A;  3IH2 A;  2Z16 A;  2L2O A;  5L3E A;  2RRE A;  1H0M A;  2O8X A;  1WI3 A;  3IWZ A;  3S1R J;  1RIO H;  1DUX C;  4PFP A;  1JJ6 C;  2STW A;  2F48 A;  4LLN A;  4PJN A;  1N75 A;  1IJW C;  2PQ8 A;  3SZP A;  2M3A A;  2WB1 N;  1FBQ A;  4RAG A;  4U7B A;  4KNY A;  4JQF A;  3WHC A;  3FXO A;  2QZ8 A;  1IC8 A;  3HSF A;  3CCE I;  2VOP A;  2CQN A;  4MFE A;  3MZY A;  4Q4Z F;  2RN7 A;  4AID A;  3HRS A;  1WJD A;  1UG0 A;  4C9Y A;  3ASO H;  4BY7 J;  2ZXJ A;  3DF8 A;  3Q0U A;  5FLV A;  3NAU A;  2RC4 A;  1SMT A;  1QHH D;  4ZDP A;  4BE2 A;  2DPD A;  4NQW A;  2HFH A;  1I5Z A;  3QWL A;  2JVH A;  2VB6 A;  3LSH A;  2DK5 A;  4AIK A;  3GTO J;  3WE3 A;  1ITY A;  1EA3 A;  1F36 A;  3RPU D;  3HGY A;  4Y3O A;  2VPR A;  1C0W A;  1W5T A;  4A3L J;  5DUK A;  2KHM A;  2E5Z A;  3DLL F;  2GBY A;  1X1D A;  3KEQ A;  2VLA A;  1YW9 A;  3TO6 A;  3P9I A;  3BCB A;  3KYL A;  2I8D A;  2JUG A;  2P6T A;  3R61 A;  4XLE A;  1I27 A;  2HZD A;  4IXA A;  1MKM A;  2UV1 A;  2NVQ J;  4ZYG A;  3LA3 A;  2LD5 A;  2NVU B;  2IS4 A;  4XNF A;  1V4R A;  3JSP A;  2XAS A;  2Y0S A;  1FTZ A;  2MYS A;  2Q2E A;  4MGR A;  4Y15 A;  3MMY B;  4CCM A;  2NS7 A;  3WTS C;  3I55 I;  2YU9 J;  2X6W A;  3MKW B;  4L18 B;  3HOY J;  1ZHF A;  3W6K B;  3U9G A;  1VQ6 I;  2IGN A;  5FRN A;  4EAT A;  2ZME B;  4U0W A;  2UXX A;  3R0A A;  1YIJ I;  4NHJ A;  4PK4 A;  3ZXS A;  1OYY A;  2AQF A;  1K83 J;  1ETK A;  2IGK A;  1LDJ A;  2Y0M A;  2BY0 A;  1BC8 C;  4LK1 F;  5FD6 A;  4XSX F;  3HXL A;  2HI3 A;  2K4B A;  3DEW A;  3OIO A;  2PG4 A;  1YJN I;  2LFB A;  2XVC A;  4D5C A;  3GYH X;  5J4V A;  1BJZ A;  3DPU A;  3S1M J;  3MCZ A;  4ZZD A;  3SHF A;  1DP3 A;  2V1D A;  4D1Q A;  1F1Z A;  2DYS H;  2Q8K A;  5GAG J;  3CD6 I;  3FXJ A;  2QBY B;  3VYT B;  4PZJ A;  2DA6 A;  1Y1W J;  2EA4 A;  4BQQ A;  3JRH A;  4M9S A;  1WWX A;  3WGG A;  1T38 A;  3VWB A;  1K6O A;  4PCQ A;  3L2R A;  3TW7 A;  1YQA A;  1X19 A;  4RB0 A;  5K7Z A;  4MQ9 F;  2JT1 A;  4RA2 A;  3T8T A;  1BL0 A;  3OYF A;  2HDW A;  5BMZ A;  3PNY A;  2LKP A;  2XAQ A;  1FWZ A;  3KX2 A;  1REP C;  3OR2 C;  1KYW A;  5IY5 H;  2E36 A;  1RUN A;  1X1A A;  3EPZ A;  5J1Y A;  2VE8 A;  2FJ1 A;  4ZZL A;  2Y75 A;  1E3O C;  3JSO A;  4WF2 A;  3N97 A;  4EV0 A;  1Q1H A;  2KIU A;  2O7O A;  1MBG A;  3V42 A;  2B63 J;  2PMZ A;  2ME6 A;  1YX5 A;  4EMS A;  4YIF A;  2GA2 A;  4V2F A;  2ZNZ A;  3I3L A;  4B09 A;  1O57 A;  2X1E A;  3FBI B;  2NVT J;  3Q0W A;  4ANJ A;  5JVT A;  2FML A;  1TWC J;  3R60 A;  4FIS A;  2ACJ A;  1OIS A;  1KQ9 A;  3HZJ A;  2MD0 A;  2FXA A;  5KVR A;  1JE8 A;  2COB A;  2JTV A;  4FET A;  3MKZ A;  2CW8 A;  3GVA A;  9ANT A;  3ZP5 A;  1ZGW A;  2ZJP F;  1K78 B;  3ESW B;  2O03 A;  4J01 A;  4M3D A;  2BV6 A;  2EV0 A;  2K40 A;  3SDG A;  3S2D J;  5LGT A;  2A61 A;  4IRH A;  5DV5 A;  5EG0 B;  4KJZ A;  3A02 A;  3GTM J;  1ZGA A;  5JLX A;  1PYV A;  4B4C A;  3WTY C;  1R5H A;  3K2A A;  4ZYH A;  4UXN A;  2XB0 X;  2X85 A;  1ZK8 A;  3FXL A;  5AON A;  1RET A;  4A3D J;  4N9I A;  2L9R A;  4LB5 A;  1GVJ A;  2RGV A;  4E7K A;  1X1P A;  2E7X A;  2L7Z A;  3JTG A;  2Y9Y A;  4E7H A;  1R1T A;  2NS0 A;  4OAY A;  3BG7 A;  1PJR A;  5AIP A;  4BE0 A;  5CQE A;  2EPF A;  3Q9S A;  1X3W B;  2UXN A;  5KNL A;  1VFC A;  3CMA I;  5JFR A;  3CCS I;  3J7A Y;  3CP8 A;  2WV0 A;  5FJ8 J;  1SEU A;  1W4M A;  4UVC A;  4C2U A;  4E7Z A;  4XMY A;  1BM9 A;  1D1C A;  3P9C A;  1VQM I;  1B72 B;  1O3S A;  2KL4 A;  3HRT A;  1FOX A;  1FIA A;  2ID6 A;  3ZQH A;  2R7D A;  3RZD J;  2K9L A;  4YFN F;  1ZN2 A;  2HYF A;  5C4J J;  2Y31 A;  1YRN A;  2DQR A;  4EEF G;  2JMW A;  1BI2 A;  2BHY A;  5E17 F;  2F5E A;  3N05 A;  3RJP A;  2YUS A;  3C7J A;  1IN8 A;  2HOT A;  2XPV A;  3VSK A;  2DN0 A;  3D1N I;  3CQZ J;  4ENK A;  4A93 J;  2LTP A;  3G71 I;  3QPL A;  4BHP A;  3SJM A;  2P5K A;  4IPA A;  1G3T A;  2RQP A;  4QPO A;  1RC9 A;  1HDD C;  4GDF A;  3W6J B;  4L0Y B;  3KP6 A;  3OIQ A;  2A69 F;  4M9Z A;  2VON A;  1TBX A;  1X3U A;  4OMZ A;  4UUT A;  3HTS B;  4MLO A;  1FBU A;  1IDZ A;  5FLM J;  1OCZ H;  4ON0 A;  3GTP J;  2QYO A;  4HSR A;  3ZMD A;  5E18 F;  1BJA A;  2W00 A;  3GZN B;  2R7T A;  3QP6 A;  5E1Z B;  3I56 I;  1G59 A;  2KZV A;  2OV7 A;  1WPK A;  4F92 B;  1SD5 A;  4E7J A;  4KIF A;  2E1M B;  2YU3 A;  1W36 D;  3GCM A;  4FQG A;  2E19 A;  1SVL A;  5LHH A;  2M1B A;  1I6H J;  4L5J A;  3GW2 A;  3ZRG A;  5F04 A;  1YJ9 I;  4D7M A;  2DA3 A;  2DA5 A;  2PEX A;  5CVI A;  4DBQ A;  1BBY A;  2XB5 A;  1B8I B;  1K61 A;  3HHG A;  2F4M B;  4C3I J;  4EJU A;  2LK2 A;  4G6T B;  3ELK A;  4EJV A;  2ZXW H;  5GTI C;  4LG0 A;  2G9W A;  2V1X A;  1SD6 A;  1SVO A;  4BJ6 C;  1LJ9 A;  3RIR A;  5J8F A;  3LNQ A;  4CYD A;  5EDN A;  4IZZ A;  1DU0 A;  2HOA A;  3F8B A;  3G1M A;  1LDD A;  3I59 A;  1XMX A;  1SMY F;  2IEK A;  5EEA A;  4UHT A;  1OMI A;  1D0X A;  4ZH4 F;  3CC7 I;  4HPQ A;  3ISP A;  3DBL B;  3GO5 A;  4M6V A;  2DTZ A;  5FKK A;  1H88 C;  3M9A A;  2GAU A;  1VTN C;  3DQV C;  2V1U A;  3OL3 A;  2F5F A;  4A3G J;  2HNH A;  2CFO A;  4ZYE A;  1A36 A;  2W57 A;  2YSR A;  3ZMZ A;  2FNA A;  1HKT A;  1JHF A;  2NVX J;  1V55 H;  1FNN A;  1Z7U A;  1V5G A;  1O7F A;  2OQG A;  5DDG A;  4HW0 A;  2E1O A;  4U87 A;  2CUJ A;  2O5R A;  1OJL A;  3BR6 A;  4IVN A;  3OYI A;  1XB4 A;  5HNH A;  4GRI A;  5HNF A;  3E6B A;  4XID A;  3LQQ A;  4GFB A;  3S2H J;  4A3C J;  2VN2 A;  3LOC A;  4I0B A;  4FAS D;  4UUS B;  3KP7 A;  4RAZ A;  5E3O A;  2RQQ A;  3TED A;  3A0H C;  4JP0 A;  5F0F A;  1FOY A;  1I50 J;  3E5Q A;  3IRQ A;  4BBR J;  4UB6 C;  2QSF X;  4A3E J;  3GTK J;  3T5X A;  5DTD A;  4DZJ A;  4QPQ A;  3KZI C;  2ZJQ F;  3HOV J;  1EJ9 A;  2HQN A;  1RR7 A;  3KPH A;  1BC7 C;  3DTE A;  2R7O A;  2F4I A;  1CQT A;  2L01 A;  5L3C A;  1MNE A;  5KAF C;  3MD2 A;  2BZT A;  2YR2 A;  3BY6 A;  4IQ4 A;  1MZB A;  1ZG3 A;  2CQK A;  3K6G A;  2X6X A;  3CUQ B;  4CGZ A;  1X4O A;  2EZL A;  4OIR F;  3WTX C;  2CV2 A;  2A6H F;  4RB3 C;  2XAH A;  4LFU A;  4IOA F;  1L3L A;  2V26 A;  5FLX K;  1UG2 A;  3OIP A;  1OCC H;  1LFU P;  1ETO A;  3S1N J;  3OYC A;  2ZBK A;  1TLH B;  1QVU A;  4PGG A;  1M1E B;  5E8I A;  1P4A A;  3E97 A;  2IP2 A;  4LMY A;  3VSL A;  5ILS A;  3H3V K;  3E1S A;  2YX4 A;  1ODD A;  3PO2 J;  2JZY A;  2L54 A;  1XCB A;  2CWE A;  5TRD A;  5HS7 A;  1K4T A;  5EJC A;  5FKO A;  3FIW A;  2P0W A;  2ZME A;  2LR8 A;  2HVR A;  1K7A A;  4RLF A;  1TNT A;  2A5W A;  3B02 A;  3OYJ A;  1H9T A;  4BXX J;  3JRD A;  1MNM C;  2XIG A;  3OYH A;  2NVY J;  4ENJ A;  1F43 A;  1ULY A;  1DU6 A;  3PQJ A;  3GZ6 A;  2HYJ A;  4NBQ A;  2KPM A;  1VF9 A;  3G1O A;  5TGT A;  5ICG A;  5BOX A;  4ZJZ A;  4ZYA A;  3E6C C;  3DBH B;  2QBY A;  5BPI A;  1WGX A;  2EA2 A;  4L9J A;  4M6Y A;  2H8R A;  3DTI A;  4XRF A;  2WAQ A;  4RAF A;  5JLW A;  4DYC A;  1HCR A;  4IX7 A;  2EIM H;  3BLY A;  4XOR A;  1XX5 A;  1DQU A;  2CFX A;  4AYB A;  3FHN A;  3TL4 X;  4H0E A;  5BNG A;  5K5O A;  5B1B H;  2WAQ N;  1UHS A;  2H94 A;  4O3M A;  2MBF A;  2JVG A;  2J5O A;  4KN7 X;  5IPA A;  3ZR8 X;  1MH4 A;  2DJI A;  3WE2 A;  4AYB N;  2XPW A;  3L2C A;  2VKD A;  2ZO4 A;  1HA8 A;  5M5W J;  1JKQ C;  1WJF A;  3CME I;  2H6B A;  1S7A A;  4CYC B;  3H35 A;  2M9H A;  2XRO A;  1T56 A;  3D0S A;  3E6M A;  2WAD A;  5HLI A;  2W24 A;  3BG3 A;  3GWZ A;  1NH3 A;  2M0M A;  3ABU A;  3SFZ A;  4M74 A;  3F6V A;  3SYT A;  4Z6Y A;  3E6D A;  3QPH A;  1TW2 A;  1K78 A;  3W2A A;  4PDK A;  2H6C A;  3NWS A;  1EV7 A;  3PUF A;  2CUZ A;  2HS5 A;  3ZMV A;  2XUB A;  1G3W A;  1QBJ A;  1WJ5 A;  1V5E A;  5EG0 A;  1RPW A;  4MTD A;  5ILU A;  2OCE A;  2ZJ2 A;  1BIA A;  1MBK A;  1ZLJ A;  1QZE A;  4MIM A;  3K1P A;  2EIJ H;  4L9N A;  3HPH A;  1WH5 A;  1WJE A;  2Q0O A;  3FXM A;  3M3Y J;  2L9S A;  3QYE A;  1RNL A;  1Z21 A;  2M34 A;  2XGD A;  4HNV A;  4U0Y A;  1BI0 A;  2K9Q A;  3ZMT A;  4BU2 A;  4X0G A;  5FB2 A;  3V7R A;  2BVL A;  2E2J J;  3G4S I;  3F8C A;  4AUX A;  3GLX A;  4IEJ A;  4I99 C;  1JUS A;  5DD8 A;  2IA0 A;  1ZGJ A;  1FEX A;  2V4J C;  1WSU A;  1XS9 A;  1NK2 P;  4B1R A;  4N9H A;  3S3O A;  1VQ9 I;  1J0R A;  5GAH J;  1W7P D;  3HL2 A;  1POG A;  3BPV A;  4HZF A;  3MAJ A;  1IV8 A;  4JX4 A;  4AC0 A;  1FMV A;  4Y52 J;  4AWX B;  3PQK A;  1YE9 A;  2K85 A;  2MGQ A;  2DLL A;  2DYR H;  2LG4 A;  1R5I D;  2ZXI A;  5CVR A;  4EQQ A;  4I7H A;  3ERM A;  3HHH A;  3F9K A;  4XON A;  2P81 A;  2VE9 A;  2ZC2 A;  2JA8 J;  1Z77 A;  2X1D A;  2DTR A;  1PP7 U;  1W0U A;  5FLX Z;  3U2R A;  3K70 D;  2V6E A;  1WKM A;  2M7A A;  2R7F A;  3G3Z A;  4GO1 A;  4XM3 A;  3QPT A;  4ENM A;  2HPI A;  3FBN B;  3S32 A;  1VQ4 I;  4I2O A;  1Y56 A;  2JSP A;  3FWE A;  1HW5 A;  1BA5 A;  3OYL A;  2JPC A;  3VYU B;  1R6R A;  2V6C A;  2VQG A;  4P55 A;  1QO0 D;  1VND A;  1Y39 A;  4N4N B;  1BI3 A;  2BY2 A;  1WRJ A;  2XSJ C;  5IP9 J;  5F64 A;  3TDU C;  3ZN0 A;  2LY2 A;  1HW2 A;  4IHT A;  3A03 A;  2V9P A;  1B9M A;  5F0C A;  1IG7 A;  4M3E A;  2WY8 Q;  3OYN A;  1PDN C;  3HUG A;  5F1J A;  1ETX A;  3K70 C;  5KCM A;  4C3H J;  4YFK F;  3LA7 A;  2HOS A;  1F9N A;  3SZG A;  2W84 A;  5E79 C;  2GLO A;  2LP0 A;  1J2X A;  2EZH A;  1WVR A;  2XKP A;  3DEU A;  2A05 A;  3FIS A;  2VL8 A;  5HDN A;  2HVS A;  1HOM A;  4ETS A;  5LHG A;  4I09 A;  1SD4 A;  4CO8 A;  3B73 A;  1HC8 A;  4QSH A;  4KT5 C;  5GAE J;  3HOS A;  4YEL A;  4A3F J;  4LOC A;  1B8I A;  1WJC A;  1E0E A;  1LEB A;  2R5Y B;  3HC7 A;  2VQL A;  2QLZ A;  3JRA A;  2XRN A;  2X1C A;  5J3L A;  2MC4 A;  3LWF A;  4XKB A;  3RKY A;  3LMM A;  1DGW Y;  1XTA A;  2WB1 A;  4FT8 A;  2MLK A;  4X1E A;  1YIT I;  3MN2 A;  1PUF B;  4Y33 A;  1UFM A;  1X2N A;  2P5L C;  4CZC A;  3NEU A;  2HDC A;  3A1Y A;  4I98 B;  2L9V A;  3EDP A;  5CLS A;  3B6A A;  3ECH A;  1T6S A;  1J09 A;  3R0J A;  2VQH A;  4M71 A;  1FYL A;  2FEZ A;  4BGD A;  3H9J A;  2H1K A;  1FY7 A;  3RYR A;  5LD2 C;  4I0A A;  1UHM A;  2ESH A;  3S2W A;  3GBG A;  1ZG1 A;  3J7Y J;  1EH7 A;  3WGH A;  4LLG F;  1PP8 F;  4DNC A;  3JRC A;  1BW6 A;  4V2G A;  3W6V A;  2XV4 S;  4M3B A;  1JTX A;  1HST A;  4ZC3 A;  2DMP A;  4CCJ A;  2DW4 A;  2A5Y B;  3H0G J;  2FBK A;  4Q48 A;  3WTV C;  3HOT A;  2CQQ A;  1JT6 A;  3DEE A;  1V54 H;  4RM2 A;  1Z7L A;  1OR7 A;  3QOE A;  1HKQ A;  5HDG A;  1SD7 A;  2H27 A;  2G7U A;  2GXB A;  1TWA J;  4QLC U;  2HU9 A;  2BGC A;  5CKT A;  4UUS A;  3CC2 I;  1SFU A;  2FD5 A;  1TWG J;  4EM1 A;  5H6Q A;  3ABM H;  2KLO A;  4MNU A;  4DJA A;  5IYC J;  2QKM B;  3OS0 A;  2YPR A;  1QRY A;  1XMA A;  2Y2Z A;  1RRJ A;  3KYD B;  4DIQ A;  2AS5 F;  5J1U A;  1LPQ A;  3DV8 A;  3MFK A;  2W4S A;  1YO5 C;  5CVJ A;  1WZ2 A;  4OIQ F;  2OZ6 A;  3L2Q A;  2FE3 A;  2WTE A;  2CW0 F;  4C3J J;  1IN5 A;  5IYB J;  2GQQ A;  2FU4 A;  1ZH5 A;  4OAZ A;  3R6S A;  3HKZ A;  3V7C A;  4MEY F;  2E5N A;  2KKO A;  2AXT C;  1I3A A;  2KZG A;  3ABL H;  4IHV A;  3TBI A;  4KIS A;  1OCR H;  3DPL C;  3LFU A;  5E3L A;  3P5J A;  2WAF A;  3UNG C;  3DP7 A;  2M7B A;  3HKZ N;  1A5J A;  1U0J A;  2GIZ A;  4XLH A;  2BW3 B;  2DCE A;  4B8X A;  3DLA A;  4HF0 A;  3K1N A;  3KP2 A;  1U5T B;  1YYV A;  2E71 A;  4HA8 A;  5J40 A;  3CO6 C;  3S3N A;  1XGS A;  2A6T A;  3RKQ A;  3LAJ A;  3J7Z I;  1IW7 F;  4EJW A;  4CDG A;  2W7N A;  2ZSH B;  5GTH C;  4G7Z F;  1IDY A;  4DGW B;  4J19 A;  1R9T J;  3BWG A;  2QUF A;  3PSF A;  5E1W A;  2XF5 A;  1R1V A;  4UV9 A;  2NOJ B;  3H5N A;  4R1H A;  2G0E A;  5BQT A;  1VI0 A;  2Y9Z A;  1JGG A;  3LAP A;  3F72 A;  3U1K A;  3HOU J;  2V9V A;  4BH9 A;  3HTU A;  3BG9 A;  3C2G A;  1IXS B;  1XG1 A;  3KLO A;  5TIS C;  3LFK A;  4EM0 B;  1DP7 P;  3CC4 I;  3EUK L;  4A6D A;  4G94 A;  5E1X A;  1SFE A;  1STZ A;  1J9I A;  1FYM A;  1I6X A;  4LJZ F;  3SEQ A;  1XDS A;  2ZNY A;  3GFM A;  4XKW A;  2UZK A;  1ZRE A;  4JOM A;  3CUO A;  3HBL A;  2LBF B;  1T0F A;  1DPU A;  4LLL A;  1D5Y A;  3GXO A;  1Y0N A;  2QF7 A;  3NWT A;  4MO7 A;  3QPS A;  3OL4 A;  3L09 A;  4BYY A;  2CYY A;  4UNO A;  5CJ9 A;  2DU9 A;  3CDI A;  2QGU A;  3IH3 A;  4OU0 A;  1GXP A;  3HOW J;  1X1B A;  5CPR B;  1ETW A;  2JQ7 A;  2PJR B;  3KLN A;  3RPQ A;  1VZ0 A;  2EWN A;  3X2Q H;  3HIF A;  3GUD A;  4RDU A;  4FTH A;  1R22 A;  1S7E A;  1TP4 A;  1J59 A;  3IUO A;  2JSC A;  4S0H B;  3IP4 B;  1Z6T A;  4IHX A;  3ZPL A;  3IH4 A;  2OAZ A;  4CSW A;  1X1C A;  3I53 A;  5EF6 A;  1Z3Y A;  2FX0 A;  4XL9 A;  3OYG A;  1A31 A;  1UEL B;  1TNS A;  3PO3 J;  2D45 A;  3QQA A;  2OTJ I;  5HS8 A;  2R5Z B;  3SDB A;  1DDN A;  3L00 A;  3MWM A;  3UKG A;  2GXA A;  3O3K A;  4XSZ F;  3QU3 A;  1SC7 A;  2QQ8 A;  1B4A A;  2V9K A;  5DM6 F;  4BAC A;  2ZKZ A;  2K5C A;  2ZME C;  3HYI A;  1FSE A;  5LRR A;  1FMW A;  3SFI A;  2A6E F;  2VXZ A;  3S93 A;  3WHB A;  3IL2 A;  3H0D A;  4RGX A;  2R7V A;  1AOY A;  2W85 A;  4A5N A;  3H92 A;  3BC8 A;  2VQC A;  3SEZ A;  3I71 A;  4F7Z A;  1MDM B;  2O61 A;  2DT6 A;  3CJT B;  3V7S A;  1O4X A;  2GM4 A;  3WG7 H;  3OMY A;  1IZ1 A;  2DMQ A;  3IHU A;  2E2I J;  4BHB A;  2EFQ A;  2M0C A;  2DI3 A;  2XPU A;  3A01 B;  1XD7 A;  2R7X A;  4L5I A;  4KIC A;  4QWQ A;  4YII A;  4YRV A;  4LK0 F;  3IAS 2;  2DFF A;  3TO7 A;  2NS8 A;  3WGI A;  3LSI A;  4O6J A;  2CRG A;  4Y7N J;  1L0O C;  1LVA A;  2EFW A;  4X6A J;  4HX4 A;  3KP5 A;  5FKN A;  5TJJ A;  1MND A;  2E1N A;  2XAU A;  2PJP A;  1HDP A;  4U88 A;  1FLI A;  4A3M J;  1U2W A;  1YG2 A;  1LQ1 A;  3DCF A;  3OSF A;  2JUC A;  3G2B A;  2QQ9 A;  5KK1 A;  3JRG A;  2MH2 A;  1MBJ A;  3IKV A;  5HLT A;  5FGM A;  3ZMS A;  3JW4 A;  2IVM A;  3GTG J;  2DT5 A;  2FBI A;  1RUO A;  2HXI A;  3RKX A;  3CO7 C;  1HLV A;  3TKY A;  3BG5 A;  1ZR2 A;  3CCQ I;  3RI4 A;  3AAF A;  2FOK A;  1LDK B;  4FE4 A;  1NG7 A;  1R7J A;  4BEH B;  3C2H A;  3H3Z A;  3QYB A;  1XN7 A;  3IAM 2;  3G73 A;  4RBO A;  1X58 A;  3JCU C;  2LRE A;  5L3F A;  4DZP A;  4ZTJ A;  2EK5 A;  5FO5 A;  1LE8 B;  4G7O F;  3KFW X;  1MMA A;  3BQZ A;  2M8E A;  2W82 A;  3FKI J;  3QOD A;  4XOP A;  5ICC A;  3A4C A;  3ZQC A;  3K4N A;  5DCF A;  2X0L A;  1GHC A;  2LSO A;  4B47 A;  2LOO A;  3REO A;  4BDZ A;  4XLN F;  2ME0 A;  4RGS A;  1FX7 A;  5FKM A;  5HDK A;  3TOB A;  1YIO A;  4B43 A;  1ETY A;  1Z05 A;  4FX0 A;  1E3H A;  2ELH A;  1FP2 A;  1UB9 A;  4HQM A;  2OC6 A;  5E20 A;  3RPU A;  2GIV A;  1P4W A;  5J8C A;  2J5P A;  2VKV A;  3KZZ A;  3IV5 A;  2CG4 A;  3OS1 A;  2DFE A;  4G9Y A;  2DA7 A;  3LSG A;  2BY3 A;  2VAS A;  3B6C A;  2LF8 A;  5L3B A;  3I4N J;  2IGO A;  2JK3 A;  4F93 B;  4IOC F;  5D5W B;  2ISZ A;  3WU2 C;  3EET A;  4A69 C;  3ULQ B;  3V8J A;  2KRF A;  2X6O A;  4BHC A;  4RB2 C;  5DM7 F;  1MMN A;  4PUS A;  2DDB A;  4CCO A;  2W48 A;  3PNV A;  1PUF A;  1TQI A;  5M5Y J;  1BOB A;  2X9D A;  2P8T A;  1T98 A;  5J6X A;  1QPM A;  2QWW A;  4N4O B;  3JAM K;  1FYK A;  2RV8 A;  4HOB A;  4BQA A;  1B59 A;  3BPX A;  3I0T A;  4A0X A;  2M4G A;  2Z1D A;  3QU6 A;  4QTR A;  2DDA A;  4PSX A;  2IAI A;  2R93 J;  4KA4 A;  2TDX A;  3NAR A;  4BKX A;  2P7V B;  5K5R A;  5M3F J;  4YIR X;  2ZB9 A;  2KDO A;  1S29 A;  1Y8Q B;  2L02 A;  4KMU X;  4HLX A;  4D9J A;  1X3Z B;  2GXG A;  3IWF A;  1EKE A;  1MW7 A;  3TP0 A;  2XDV A;  2OF7 A;  4M6X A;  3AKZ A;  2DT7 B;  2OUM A;  2OQR A;  3U1D A;  1UJ8 A;  2XGE A;  2HTJ A;  3GFL A;  3M8E A;  1LEA A;  2F6C A;  4C30 A;  4LD5 A;  4HNU A;  3ZGK A;  5A2Q Z;  3OYE A;  2NYX A;  4DOZ A;  2HKO A;  4HBL A;  1B9N A;  2JA6 J;  3Q3S A;  3O8H A;  3VOE A;  3M8F A;  1ZAO A;  1PVE A;  2VIX A;  4EJT A;  3L2V A;  3S15 J;  4ESJ A;  2UWM A;  2Y30 A;  4KN4 X;  3V4G A;  5D6F A;  3JRF A;  2BHZ A;  2DQL A;  1JTY A;  2DOD A;  2K9S A;  2P4W A;  1XGN A;  2BEO A;  3M8J A;  3CCJ I;  1D0Y A;  3BTI A;  4D0P A;  1MMD A;  2P7C B;  3VYS B;  4PJM A;  1I1S A;  3ZOB A;  1ON2 A;  4FCY A;  4HV5 A;  2ADU A;  5ILV A;  2O9L A;  1UCR A;  1S5L C;  2K9M A;  3LSJ A;  1D3Y A;  1OKR A;  1JKO C;  1T95 A;  3FXU A;  1SAN A;  2OBP A;  2A68 F;  4II3 A;  3TDZ C;  1U3E M;  1X4P A;  2D5V A;  3PIO F;  1UAA A;  2EBI A;  1TTY A;  2DFI A;  4WX9 A;  4IHW A;  3DU6 A;  3AL0 B;  2MG4 A;  3W3C A;  3BR3 A;  2Z3Y A;  1D1B A;  3W2W A;  2KIS A;  2L4M A;  2VPL A;  1EH8 A;  5FKL A;  4LG3 A;  1K6Y A;  1U5T A;  2QEX I;  1VQL I;  1U8R A;  5HOO A;  2IT0 A;  2Z9O A;  2IS2 A;  4D7N A;  3I9V 2;  1EF4 A;  1XGM A;  1N77 A;  1S9H A;  2HOE A;  4AVP A;  3J81 Z;  1LVK A;  3OS2 A;  1LUJ B;  4XLP F;  3IRR A;  4MTE A;  1R71 A;  1VQ7 I;  2OZU A;  2D1V A;  5CVV A;  3RYP A;  2QM3 A;  2L5Q A;  4P1W A;  1D0Z A;  3H5A A;  2L7F P;  3HGG A;  3SXY A;  4F52 A;  1ZR4 A;  2UUZ A;  1HF0 A;  1N25 A;  2LKX A;  2TCT A;  2X4H A;  2RNJ A;  1OR7 C;  4XOT A;  2LC2 A;  2E1C A;  2QSH X;  4P9U A;  1YHQ I;  2DA4 A;  2R7Z J;  1W7P B;  4FX4 A;  1KGS A;  2E35 A;  5JR3 A;  2AO9 A;  2NRA C;  2MFZ A;  4AVZ A;  5FRM A;  1ENH A;  3C2B A;  5ED4 A;  2HXO A;  3FK7 A;  4HNT A;  4A12 A;  4RGU A;  5C4X J;  2XHK A;  1FT9 A;  3PNT A;  2IRF G;  5EYR A;  3CCY A;  4PSW A;  2XAG A;  1R00 A;  4LIT A;  2KDZ A;  4BBS J;  2LBF A;  1U8B A;  1SFO J;  5LGN A;  3CMY A;  3JTH A;  3CTA A;  4HRI A;  1OYW A;  4BUP A;  5B5E C;  1R4N B;  3ABK H;  4BJ5 C;  2LMD A;  3JRE A;  1WFX A;  1USS A;  2PMU A;  5EZH A;  4MQV A;  2IA2 A;  1ZAR A;  4HG2 A;  3ZCO A;  2EV6 A;  2BY1 A;  4GXO A;  2FNP A;  2K02 A;  2PJR A;  4IRI A;  3JAM Z;  3CDL A;  4BL0 B;  4G6Q A;  2KIF A;  1Z1D A;  2XGX A;  2LKS A;  2QVO A;  2O8K A;  1ORK A;  3S16 J;  2FF4 A;  1RKW A;  3BJA A;  5D4S A;  2DPU A;  4DYR A;  3OYA A;  2DMU A;  1FBS A;  1D1A A;  4BE1 A;  4I6Z A;  1R4M B;  3WOD F;  2FA5 A;  1APL C;  3FKJ A;  3DKX A;  2HQ5 A;  3I5U A;  1FSH A;  1IN4 A;  1YRN B;  1KA8 A;  1ZRD A;  2F4O B;  2X6Y A;  3AG3 H;  2DA1 A;  4B48 A;  4XLC A;  3JR9 A;  4IO9 F;  1GT0 C;  1Y8R B;  1J75 A;  1BR1 A;  1HW1 A;  3MKY B;  1P92 A;  3GTJ J;  4CZZ A;  3DFG A;  2CV0 A;  1B72 A;  3TP3 A;  5C3E J;  3CJQ B;  2V1N A;  2LNB A;  2O0Y A;  4XBF A;  2NXN B;  2FRH A;  2BYV E;  1MDM A;  3PSI A;  1F5T A;  2PBI A;  4HQE A;  3NQO A;  3K4C A;  5F1R A;  2D2W A;  2STT A;  5F0H A;  4C2T A;  1RI7 A;  3GX4 X;  3ZQQ A;  3A01 A;  3PM1 A;  3K10 A;  3WU0 A;  1T0F C;  2IPQ X;  1V3F A;  3K0L A;  1LFP A;  2ZFU A;  4NNJ A;  3GLL A;  5JI6 A;  2ECC A;  4ASN A;  3CP2 A;  5L3D A;  3S14 J;  1AKH B;  1KU3 A;  3CCL I;  1JGS A;  1SFK A;  4KYW A;  2E7W A;  5IT9 K;  2JWT A;  2CW7 A;  5DEQ A;  2JRT A;  3OV8 A;  2R7U A;  2DK8 A;  5HS9 A;  3T0Y A;  2BE5 F;  2A07 F;  1JXS A;  2ELK A;  2WBM A;  1T2K A;  1DPR A;  3CZ6 A;  1QZY A;  4BS9 A;  4EGY A;  5D8L B;  3J80 K;  2KMU A;  2BVM A;  2D1H A;  2CJJ A;  3D5L A;  4HST A;  5FRO A;  1ETV A;  4BJT A;  2RVC A;  3TMO A;  1P6R A;  5IT3 A;  1IAW A;  4JK1 X;  2ID3 A;  4JYK A;  1Y0U A;  3ML6 A;  4IRG A;  4LIU A;  4BNC A;  2O3F A;  3FXR A;  2CS3 A;  2EFO A;  3V8L A;  1LE8 A;  2VBZ A;  4Y13 A;  1B1B A;  3EUH A;  3ONQ A;  1JJ8 C;  4S04 A;  1D5V A;  1IF1 A;  5J47 A;  2Y69 H;  3MVP A;  2QQA A;  2HTS A;  3HG9 A;  1V5F A;  4KT6 A;  4IJA A;  2HQA A;  4BQN A;  1FOK A;  1OQY A;  3OSG A;  4OIN F;  3BJ6 A;  2M5W A;  3ERE D;  4EGZ A;  2VC1 A;  1HQC A;  2B0L A;  2ICW G;  2M8G X;  2F2E A;  3H1C A;  2GOM A;  5HVQ C;  4IQJ A;  1VQK I;  2K86 A;  1K79 A;  2XC7 A;  2LDU A;  2EFP A;  3BZ6 A;  3KYC B;  4ABZ A;  5GPC A;  1UST A;  4AU7 A;  3F3X A;  3HSR A;  2R7W A;  4S05 A;  3ZQG A;  1H9G A;  5DS9 A;  3JRI A;  1R23 A;  2V79 A;  2B9S A;  2WA0 A;  4M3G A;  1IV6 A;  4PJJ A;  1R58 A;  4FE7 A;  4J00 A;  1MSE C;  1S6L A;  5BS6 A;  4AM3 A;  4NDL A;  3HSE A;  1S7O A;  3DWL E;  4HAM A;  4E4H A;  3J7A O;  1IN7 A;  1T08 B;  2IS6 A;  4E6K G;  1G6N A;  2KQR A;  1YW8 A;  1H89 C;  5BPD A;  4WK8 F;  4QIW N;  3WTU C;  2HQR A;  2DOF A;  5LLQ A;  3ECO A;  4XLF A;  3EYY A;  2R7R A;  1RES A;  2GWR A;  1UZC A;  4MEX F;  2RNG A;  2OTL I;  1IRZ A;  2WAE A;  4V19 K;  5DD4 A;  3I4M J;  3ABT A;  4RS8 A;  3BTJ A;  1UMQ A;  3E0J B;  5FFX A;  4E70 A;  2ZSI B;  5EGO B;  5B3S H;  2VI6 A;  3KET A;  2JPB A;  1JKP C;  3F22 A;  4I02 A;  2QA4 I;  3PFI A;  3GF2 A;  1RR8 C;  4AIH A;  3MKL A;  3F6O A;  2HGC A;  3N4M A;  3SZT A;  1MBH A;  1OYI A;  5C44 J;  4EJO A;  1NG6 A;  1W5S A;  3RDI A;  1BOA A;  3G6E I;  1ZLK A;  5D5X B;  3H3U A;  1JHH A;  3A2K A;  3K4B A;  4NB5 A;  3O6B B;  5IP7 J;  3PUB A;  2CMP A;  2MH9 A;  3TGN A;  5K1Y A;  3BQY A;  3CUQ A;  1VQ5 I;  2OJE D;  2ETH A;  2TRT A;  3OOP A;  1U9N A;  2Z99 A;  4XR6 A;  5F08 A;  5D6E A;  1SAX A;  2VKE A;  4OOI A;  3AG4 H;  2CO5 A;  5J1R A;  4P5O A;  4KIT B;  4B44 A;  4CXF A;  2CV1 A;  2F5V A;  1TL8 A;  3LSM A;  3DTK A;  1GXQ A;  2C6Y A;  1IRF A;  1QNT A;  1ZG5 A;  5K5Q A;  4XKV A;  5EEH A;  2V7F A;  4HYE A;  1LFB A;  2OD5 A;  4UUV A;  3BZC A;  2Y0S N;  3E5X A;  3I58 A;  2QKL B;  1J5Y A;  2LY9 A;  3FDY A;  3RQ4 A;  5IT9 Z;  3GEZ A;  2XKO A;  3HRM A;  1CGP A;  3I54 A;  1CF7 B;  5LGU A;  1KZH A;  2CGP A;  2WY7 Q;  3QRF F;  3V8K A;  1XCV A;  1QQI A;  2IJL A;  1O3Q A;  5IOY A;  3J80 Z;  4OMY A;  2VOD A;  1ETQ A;  1TT0 A;  1IGN A;  5LHI A;  4XRS A;  2Z33 A;  2IA1 A;  3F23 A;  3AG2 H;  2AHQ A;  4DYQ A;  1O3T A;  1ACI A;  5H6R A;  1D8K A;  4BQO A;  6PAX A;  1Z91 A;  2CSO A;  1HXD A;  2IW5 A;  4K2E A;  3LQR A;  4PJL A;  4ZYD A;  3I4P A;  3PJR A;  2EQR A;  5K7H A;  4CCL A;  1XSX A;  4PFO A;  2Z5U A;  2ZFW A;  2DMT A;  2DFH A;  2VBW A;  3DPT A;  1OLT A;  3ZQI A;  1XGO A;  1Z3X A;  4L9T A;  3S8P A;  2A3S A;  1RZ4 A;  4KIG A;  4II2 A;  3EYI A;  3CJR B;  2GOX B;  3FMS A;  2KIQ A;  3BZK A;  1IRX A;  1MIJ A;  3BJO A;  3CCU I;  2PFB A;  1Z67 A;  1OCP A;  3T1B A;  2VUM J;  1ONV A;  1YOV B;  3M1E A;  5DYM A;  1JT0 A;  3TW6 A;  5H20 A;  2PLY A;  3HDD A;  1JUM A;  4HLY A;  1WJB A;  4IL6 C;  3A0B C;  1SAU A;  4NC6 A;  2PMZ N;  3HJE A;  1NHA A;  4LIV A;  1W7P A;  3RSN A;  2Z2S B;  3TQN A;  2I5U A;  3LSP A;  3GZ5 A;  5GAD J;  2EZK A;  1Q1V A;  1XSV A;  1YW7 A;  4CYC A;  1BR4 A;  3BCA A;  3SQN A;  2FQ4 A;  3QP5 A;  2MLG A;  1YJW I;  3CLO A;  4HV6 A;  3VDX A;  1Z0X A;  3R4K A;  2HDD A;  1SFX A;  4KUM A;  4A3I J;  2JRM A;  2NAZ A;  3GME A;  1TQM A;  5LRS A;  2W25 A;  2EFN A;  5K7F A;  1E17 A;  3RKW A;  3NRV A;  2PI0 A;  1S3J A;  5D4R A;  3S1Q J;  2G7H A;  2HWV A;  4YG2 F;  2L7K A;  3UR3 C;  1FTT A;  3CJN A;  2L3D A;  3S3M A;  2M87 A;  3GTL J;  3CCM I;  1IO2 A;  2ELJ A;  1BIB A;  3M1C A;  5E8G A;  1Y1V J;  2DBB A;  3L7W A;  3K4L A;  4MHG A;  4IF4 A;  3WU1 B;  1K4S A;  1G4D A;  5A2Q K;  4F55 A;  1P4X A;  1YS6 A;  5CQG A;  2XGC A;  1KU2 A;  2P6S A;  5HOD A;  2ZJR F;  1XMK A;  3HEF A;  3IC7 A;  3EQL F;  4HEA 2;  1FC3 A;  1O7L A;  4W1U A;  5DCM B;  1U5T C;  4O5V A;  1S72 I;  2M45 A;  3C18 A;  1X2M A;  4I76 A;  1Z9C A;  2DOE A;  1QVT A;  3C3W A;  2MA3 A;  2XRL A;  4RGR A;  4KIB A;  3HOX J;  3GTQ J;  4UVB A;  1MMS A;  3CES A;  1ZQ3 P;  2MC3 A;  4WXD A;  1D8J A;  1T8I A;  3FXQ A;  5CYV A;  1QPI A;  3KP3 A;  1AHD P;  2JN6 A;  4CIC A;  4ESF A;  3ZN1 A;  5IOZ A;  2PX9 A;  1MJB A;  3KEO A;  3H36 A;  3VEP A;  1OCT C;  2NNN A;  3CCV I;  3BDD A;  4A3J J;  5ERI A;  2KRC A;  2PN6 A;  1WH7 A;  3RZO J;  1G3S A;  2CQX A;  1I3Q J;  1R1U A;  2LRD A;  3C1D A;  2DA2 A;  2QQB A;  3HRU A;  3KZY A;  2F5C A;  4F91 B;  2IS1 A;  4B3A A;  5IYD J;  2OU2 A;  4CUG A;  2VXD A;  1MBE A;  4E7S A;  1TWF J;  2LLK A;  3HM5 A;  4GYI A;  2GA1 A;  1MJ9 A;  3F8N A;  1P2F A;  3P9K A;  4NUB A;  5HLG A;  3M07 A;  4TV7 A;  1OFC X;  1BR2 A;  3W2V A;  1MJA A;  3ZMU A;  3HUG B;  4RB1 A;  2VT3 A;  2K4J A;  4ITV A;  4R8H A;  3BR0 A;  3Q0V A;  5KHD A;  2L7M P;  1AKH A;  3J81 K;  2EV5 A;  2WV1 A;  5IP6 A;  2MD5 A;  1GV2 A;  3K9T A;  5M5X J;  1KYZ A;  3OOU A;  3MZH A;  4NC7 A;  1MSF C;  3BR2 A;  4GCV A;  4A3B J;  4EM2 A;  2FUG 2;  2JA7 J;  1J7K A;  4G6D A;  3K2Z A;  4YFX F;  3RTR A;  3FZV A;  3COA C;  1P7I A;  2LVS A;  4E7L A;  1XSD A;  1FIP A;  2VJI A;  1ZKG A;  4NC8 A;  1TC3 C;  3P7N A;  2L0K A;  2W1O A;  1TZL A;  1VQ8 I;  1LNW A;  3H9Q A;  3Q5F A;  1Z6R A;  4E7I A;  1S8N A;  2KT0 A;  1IXC A;  2EB7 A;  2L4A A;  1FPQ A;  1FP1 D;  4LB6 B;  3ASN H;  2XF7 A;  2ESN A;  1W36 C;  4CCN A;  1YX3 A;  2RKH A;  1KQ0 A;  1NTC A;  1TWH J;  2R5Y A;  5F27 A;  3ROU A;  1KU9 A;  4JX5 A;  3IKT A;  4FHT A;  1KON A;  2ECB A;  3MQ0 A;  4DQ2 A;  2CH0 A;  3F8M A;  5AIQ A;  3E7L A;  2B7E A;  4Q5S F;  2ZCW A;  1O3R A;  1GDT A;  4BAY A;  2EIL H;  3FF5 A;  1ZRF A;  4F3Q A;  1HBX G;  1QU3 A;  3D5R C;  3K69 A;  4L0Z B;  4Y4R A;  2OA4 A;  4AIJ A;  1R5G A;  4YEJ A;  3PIP F;  1AA7 A;  3OYB A;  2LH9 A;  4UVA A;  4NQW B;  2EIK H;  3VOD A;  1EH6 A;  2JA2 A;  2I10 A;  2BBY A;  2IBD A;  2KJC A;  3F0C A;  2Y48 A;  1IXR C;  2COM A;  3PFY A;  3BT9 A;  5E3N A;  4ZTF A;  2O6G E;  3CDH A;  3K4M A;  2AXL A;  4ZDO A;  4HX7 A;  4RLQ A;  1XDU A;  3U21 A;  1TQP A;  3GFJ A;  4CCK A;  3M4O J;  4U0V A;  1U6G A;  5ICE A;  4RAY A;  1DGR M;  4U7D A;  5GPA A;  3HPG A;  3K7A J;  3E5U A;  1R49 A;  1A04 A;  2M4K A;  2RAE A;  1WCM J;  4XLA A;  3Q9V A;  4MFD A;  3VB2 A;  2EJR A;  2E1M C;  1G8X A;  4LGW A;  4DBR A;  2CQ7 A;  1UHW A;  3WTZ A;  2Q2E B;  4XN3 A;  2FOW A;  4R79 A;  1TT5 B;  4XRM A;  2K3F A;  3FX3 A;  2HEO A;  3L1P A;  5LFA A;  3VFZ A;  3FM3 A;  2IGM A;  4L9V A;  3L9F A;  2BXZ A;  4A0Z A;  4A2U A;  5B1A H;  2HYG D;  1VQO I;  1A6I A;  1G3Y A;  3H5R A;  4G12 A;  3CLQ A;  5EGO A;  1ZYR F;  5JHF A;  3OY9 A;  4IHS A;  1I39 A;  3EUH C;  3CCR I;  2FBH A;  2KJB A;  2LF7 A;  4Q47 A;  3KIO A;  5DUI A;  3CF5 F;  2NOG A;  5JVG F;  1JKR C;  1MD0 A;  3BTL A;  2CUE A;  1T33 A;  1WHU A;  2H1L A;  2HZT A;  2MSY A;  4G8X A;  4W97 A;  4BDY A;  3TO9 A;  2QCO A;  2E34 A;  2OPT A;  3K1M A;  2BW3 A;  3WTW C;  3MEX A;  4Y17 A;  1AWC A;  3L2U A;  1XC5 A;  4M72 A;  3RQI A;  4CA0 A;  3JRB A;  4UY8 I;  1KQ8 A;  3KCC A;  1MGT A;  4H4K C;  5D8K B;  3F8F A;  4C2M J;  2MW8 A;  1IUF A;  2R7S A;  1MMG A;  1QZZ A;  3DKW A;  3OWT A;  4HDV A;  2XF6 A;  5EEG A;  2BOL A;  2DAO A;  4UV8 A;  2JA5 J;  1VQP I;  2K7L A;  1CF7 A;  2E60 A;  2WWY A;  2QEN A;  2KP6 A;  3QAH A;  3I64 A;  3G1L A;  2DXI A;  4M3F A;  1W1W E;  4RMN A;  1ZRC A;  2DJN A;  1WQ2 A;  3FK6 A;  1JUP A;  3TOA A;  2ISY A;  1OCO H;  2M30 A;  3CMM A;  3WG9 A;  5J4Y A;  2VKH A;  1MBF A;  1T39 A;  5B66 C;  2F5D A;  4L5E A;  2K27 A;  2L9N A;  1LKX A;  2HPM A;  1OPC A;  2DO7 A;  4ESB A;  1F4K A;  3LA2 A;  3FM5 A;  3HB9 A;  2FMY A;  2EIN H;  4JBA A;  3OYM A;  1YI2 I;  2VJ4 A;  1B6A A;  4GGG A;  2JJ7 A;  3K4K A;  4CH7 A;  1P7J A;  2HKX A;  3GFI A;  4UB8 C;  1IUY A;  2KIM A;  4N0B A;  2QSG X;  5LBQ A;  2R3S A;  2R0Q C;  1NK3 P;  1XPX A;  1GLN A;  3BG6 A;  2VT2 A;  4A5M A;  2DMN A;  2PMH A;  1ZTR A;  4WXH A;  4CHU A;  2OCC H;  3E3V A;  1LB2 A;  5D5U B;  3CUQ C;  3DKY A;  1GV5 A;  3KP4 A;  4B3X A;  2K9N A;  4XRS G;  3BTC A;  2HR3 A;  2XAJ A;  4RM3 A;  4WXC A;  1KU7 A;  1WI9 A;  5E3M A;  3HOZ J;  4HF2 A;  1IRG A;  1QA6 A;  5M3M J;  4P9F A;  2XAF A;  4HF1 A;  3QYF A;  4BXF A;  3K4J A;  4M73 A;  4G7H F;  2VBY A;  2DOA A;  4I01 A;  5LEK A;  3O2P E;  4ENN A;  2FQ3 A;  2EH3 A;  3OYK A;  4A0Y A;  2R5Z A;  1BI1 A;  2WC2 A;  1HSJ A;  3BP8 A;  2R7Q A;  4WWC A;  4HDU A;  1BN5 A;  1W5C C;  4A3K J;  4BY1 J;  1SVM A;  2R4G A;  5FD5 A;  1E3P A;  1P9Q C;  1FZP B;  4BXU A;  3OYD A;  1YTY A;  4KMF A;  2H8W A;  1BW5 A;  2EZI A;  4XN0 A;  3LL7 A;  1G2H A;  2VJJ A;  1YFH A;  1WJA A;  4M9X A;  3MZ8 A;  2E2H J;  5L3G A;  3AL0 C;  2GZW A;  3BRO A;  3KE2 A;  5CVU A;  2P5V A;  1ON1 A;  2R92 J;  1HKS A;  5DCM A;  4XK4 A;  3DU5 A;  1ERD A;  1AU7 A;  4IHY A;  3AFH A;  5H2F C;  2K3P A;  3LSR A;  2VBX A;  4HX8 A; 
#chains in the Genus database with same CATH homology
 5D5V B;  4WCG A;  5F6F A;  1R36 A;  3LST A;  2YX7 A;  4EVI A;  1E2X A;  4P96 A;  2FSW A;  5HLH A;  4OIO F;  2H09 A;  4OIP F;  2NNY A;  1YS7 A;  4GYG A;  4LG0 B;  3QOP A;  4Z2Y A;  2VOO A;  4AD9 A;  3FHZ A;  3I59 B;  3BOQ A;  2RDP A;  2VC0 A;  4KDP A;  4PGH A;  1U78 A;  4A6E A;  3F21 A;  3WTT C;  1YLF A;  3M7G A;  4KFC A;  3DXJ F;  1QGP A;  3ZQ7 A;  1I1G A;  3T8R A;  5LEJ A;  1TW3 A;  3FMR A;  5ICF A;  5FFZ A;  1IN6 A;  5JHU A;  3FMQ A;  1PUE E;  5L3E A;  1H0M A;  2O8X A;  3IWZ A;  1RIO H;  1DUX C;  2STW A;  4LLN A;  2PQ8 A;  3SZP A;  1FBQ A;  4U7B A;  4KNY A;  4JQF A;  2QZ8 A;  3HSF A;  2VOP A;  4Q4Z F;  3MZY A;  2RN7 A;  3HRS A;  2ZXJ A;  3DF8 A;  2RC4 A;  1SMT A;  2DPD A;  4NQW A;  2HFH A;  1I5Z A;  2DK5 A;  4AIK A;  3WE3 A;  1C0W A;  1W5T A;  5DUK A;  3KEQ A;  1YW9 A;  3TO6 A;  3P9I A;  2P6T A;  3R61 A;  1I27 A;  4IXA A;  1MKM A;  4ZYG A;  3LA3 A;  1V4R A;  3JSP A;  2XAS A;  2Q2E A;  4Y15 A;  4MGR A;  3WTS C;  4L18 B;  1ZHF A;  3W6K B;  3U9G A;  2ZME B;  4U0W A;  2UXX A;  3R0A A;  4NHJ A;  1OYY A;  1LDJ A;  2Y0M A;  1BC8 C;  4LK1 F;  5FD6 A;  4XSX F;  2K4B A;  2PG4 A;  2XVC A;  3GYH X;  3MCZ A;  4ZZD A;  3SHF A;  2V1D A;  1F1Z A;  2Q8K A;  2QBY B;  4PZJ A;  2EA4 A;  4M9S A;  1WWX A;  3WGG A;  1T38 A;  1K6O A;  4PCQ A;  1YQA A;  4RB0 A;  4MQ9 F;  2JT1 A;  3T8T A;  5BMZ A;  2LKP A;  2XAQ A;  1FWZ A;  1REP C;  1KYW A;  1RUN A;  2VE8 A;  4ZZL A;  2Y75 A;  3JSO A;  4WF2 A;  3N97 A;  4EV0 A;  1Q1H A;  2KIU A;  4EMS A;  4YIF A;  2GA2 A;  2ZNZ A;  4B09 A;  1O57 A;  5JVT A;  2FML A;  3R60 A;  2ACJ A;  1KQ9 A;  2FXA A;  5KVR A;  1JE8 A;  2JTV A;  3GVA A;  3ZP5 A;  1K78 B;  2O03 A;  2BV6 A;  2EV0 A;  5LGT A;  2A61 A;  4IRH A;  5DV5 A;  1ZGA A;  3WTY C;  1R5H A;  4ZYH A;  4UXN A;  5AON A;  4N9I A;  4LB5 A;  1GVJ A;  2RGV A;  2E7X A;  3JTG A;  1R1T A;  2NS0 A;  5AIP A;  3Q9S A;  2UXN A;  5JFR A;  2WV0 A;  1W4M A;  4UVC A;  1BM9 A;  3P9C A;  1O3S A;  3HRT A;  2R7D A;  4YFN F;  1ZN2 A;  2HYF A;  2DQR A;  1BI2 A;  5E17 F;  2F5E A;  3RJP A;  3C7J A;  1IN8 A;  4ENK A;  4BHP A;  2P5K A;  4IPA A;  1G3T A;  2RQP A;  4L0Y B;  3W6J B;  3KP6 A;  2A69 F;  4M9Z A;  2VON A;  1TBX A;  1X3U A;  4OMZ A;  3HTS B;  1FBU A;  4ON0 A;  2QYO A;  3ZMD A;  5E18 F;  1BJA A;  3QP6 A;  5E1Z B;  1SD5 A;  4KIF A;  2YU3 A;  5LHH A;  2M1B A;  4L5J A;  3GW2 A;  2PEX A;  5CVI A;  1BBY A;  3HHG A;  4EJU A;  3ELK A;  4EJV A;  4LG0 A;  2G9W A;  2V1X A;  1SD6 A;  1LJ9 A;  3RIR A;  5J8F A;  4CYD A;  3F8B A;  1LDD A;  3I59 A;  1SMY F;  4UHT A;  1OMI A;  4ZH4 F;  3ISP A;  3GO5 A;  3M9A A;  2GAU A;  1VTN C;  3DQV C;  2V1U A;  2F5F A;  4ZYE A;  2W57 A;  2YSR A;  3ZMZ A;  2FNA A;  1HKT A;  1JHF A;  1FNN A;  1Z7U A;  1O7F A;  2OQG A;  5DDG A;  4HW0 A;  4IVN A;  1XB4 A;  3E6B A;  3LQQ A;  2VN2 A;  4I0B A;  3KP7 A;  4RAZ A;  3E5Q A;  3IRQ A;  3T5X A;  2HQN A;  1BC7 C;  2L01 A;  5L3C A;  2YR2 A;  3BY6 A;  1MZB A;  1ZG3 A;  2CQK A;  3CUQ B;  4CGZ A;  4OIR F;  3WTX C;  2A6H F;  4RB3 C;  2XAH A;  4LFU A;  1L3L A;  5FLX K;  2ZBK A;  1TLH B;  4PGG A;  5E8I A;  1P4A A;  3E97 A;  2IP2 A;  4LMY A;  5ILS A;  2YX4 A;  1ODD A;  2JZY A;  2L54 A;  1XCB A;  2CWE A;  5TRD A;  5HS7 A;  2ZME A;  1K7A A;  1TNT A;  3B02 A;  1H9T A;  2XIG A;  4ENJ A;  1ULY A;  3PQJ A;  3GZ6 A;  5ICG A;  5BOX A;  3E6C C;  2QBY A;  5BPI A;  2EA2 A;  4L9J A;  4M6Y A;  4XRF A;  2CFX A;  4H0E A;  5K5O A;  2H94 A;  4O3M A;  2MBF A;  2J5O A;  4KN7 X;  3WE2 A;  3L2C A;  2ZO4 A;  2H6B A;  1S7A A;  2XRO A;  3D0S A;  3E6M A;  5HLI A;  2W24 A;  3GWZ A;  3ABU A;  3SFZ A;  4M74 A;  3F6V A;  3E6D A;  3QPH A;  1TW2 A;  1K78 A;  4PDK A;  2H6C A;  1EV7 A;  3ZMV A;  2HS5 A;  2XUB A;  1G3W A;  1QBJ A;  4MTD A;  5ILU A;  2ZJ2 A;  1BIA A;  1ZLJ A;  4HX8 A;  3K1P A;  4L9N A;  2Q0O A;  1RNL A;  4U0Y A;  1BI0 A;  3ZMT A;  5FB2 A;  3V7R A;  3F8C A;  3GLX A;  5DD8 A;  2IA0 A;  1ZGJ A;  1WSU A;  4N9H A;  1J0R A;  1W7P D;  3BPV A;  4HZF A;  3MAJ A;  4AWX B;  3PQK A;  2DLL A;  5CVR A;  4EQQ A;  4I7H A;  3HHH A;  2VE9 A;  2DTR A;  1PP7 U;  5FLX Z;  3U2R A;  1WKM A;  3G3Z A;  2R7F A;  4GO1 A;  3QPT A;  4ENM A;  4I2O A;  3FWE A;  1HW5 A;  2JPC A;  2V6C A;  4P55 A;  1QO0 D;  1BI3 A;  1WRJ A;  5F64 A;  3TDU C;  3ZN0 A;  1HW2 A;  4IHT A;  1B9M A;  1PDN C;  3HUG A;  4YFK F;  3LA7 A;  1F9N A;  2W84 A;  1J2X A;  2XKP A;  3DEU A;  5HDN A;  4ETS A;  5LHG A;  4I09 A;  1SD4 A;  4CO8 A;  3B73 A;  4KT5 C;  3HOS A;  1LEB A;  2QLZ A;  2XRN A;  3LWF A;  3RKY A;  4FT8 A;  2MLK A;  1UFM A;  2P5L C;  2HDC A;  3NEU A;  4I98 B;  3EDP A;  5CLS A;  3ECH A;  1T6S A;  3R0J A;  4M71 A;  1FYL A;  2FEZ A;  1FY7 A;  3RYR A;  4I0A A;  1UHM A;  2ESH A;  3S2W A;  1ZG1 A;  1EH7 A;  3WGH A;  4LLG F;  1PP8 F;  4DNC A;  2XV4 S;  1HST A;  2DW4 A;  2A5Y B;  2FBK A;  4Q48 A;  3WTV C;  3HOT A;  1OR7 A;  1HKQ A;  5HDG A;  1SD7 A;  2H27 A;  2G7U A;  2GXB A;  4QLC U;  2BGC A;  1SFU A;  4EM1 A;  5H6Q A;  4MNU A;  2YPR A;  1XMA A;  2AS5 F;  3DV8 A;  3MFK A;  1YO5 C;  5CVJ A;  4OIQ F;  2OZ6 A;  2FE3 A;  2WTE A;  2CW0 F;  1IN5 A;  2GQQ A;  2FU4 A;  1ZH5 A;  3R6S A;  3V7C A;  4MEY F;  2KKO A;  3DPL C;  3DP7 A;  4B8X A;  4HF0 A;  3K1N A;  3KP2 A;  1U5T B;  1YYV A;  4HA8 A;  3CO6 C;  1XGS A;  3LAJ A;  1IW7 F;  4EJW A;  4CDG A;  4G7Z F;  3BWG A;  2QUF A;  5E1W A;  1R1V A;  4UV9 A;  4R1H A;  5BQT A;  3LAP A;  3F72 A;  2V9V A;  4BH9 A;  3HTU A;  1IXS B;  3KLO A;  3LFK A;  4EM0 B;  1DP7 P;  4A6D A;  4G94 A;  5E1X A;  1SFE A;  1STZ A;  1J9I A;  1FYM A;  1I6X A;  4LJZ F;  1XDS A;  2ZNY A;  3GFM A;  2UZK A;  1ZRE A;  3CUO A;  1T0F A;  1DPU A;  4LLL A;  3GXO A;  3L09 A;  4BYY A;  2CYY A;  4UNO A;  5CJ9 A;  2DU9 A;  4OU0 A;  1GXP A;  3KLN A;  3RPQ A;  2EWN A;  3HIF A;  3GUD A;  1R22 A;  1J59 A;  2JSC A;  1Z6T A;  3ZPL A;  2OAZ A;  3I53 A;  1TNS A;  2D45 A;  5HS8 A;  1DDN A;  3L00 A;  3MWM A;  3O3K A;  4XSZ F;  3QU3 A;  1B4A A;  2ZKZ A;  3HYI A;  1FSE A;  5LRR A;  2A6E F;  2VXZ A;  3IL2 A;  1AOY A;  4RGX A;  2W85 A;  4A5N A;  3H92 A;  2O61 A;  3I71 A;  4F7Z A;  1MDM B;  3V7S A;  1IZ1 A;  3IHU A;  4BHB A;  2EFQ A;  2DI3 A;  1XD7 A;  4L5I A;  4QWQ A;  4KIC A;  4YII A;  4LK0 F;  3TO7 A;  3WGI A;  4O6J A;  1L0O C;  1LVA A;  2EFW A;  4HX4 A;  3KP5 A;  5TJJ A;  2E1N A;  2PJP A;  1FLI A;  1U2W A;  1YG2 A;  1LQ1 A;  2QQ9 A;  5KK1 A;  2MH2 A;  3IKV A;  5FGM A;  3ZMS A;  3JW4 A;  2IVM A;  2DT5 A;  2FBI A;  1RUO A;  3RKX A;  3CO7 C;  3TKY A;  3RI4 A;  3AAF A;  2FOK A;  1LDK B;  1R7J A;  3H3Z A;  1XN7 A;  3G73 A;  5L3F A;  2EK5 A;  5FO5 A;  4G7O F;  3KFW X;  2M8E A;  5ICC A;  5DCF A;  2X0L A;  1GHC A;  2LSO A;  3REO A;  4XLN F;  4RGS A;  1FX7 A;  5HDK A;  3TOB A;  1YIO A;  1Z05 A;  4FX0 A;  2ELH A;  1FP2 A;  1UB9 A;  4HQM A;  5E20 A;  3RPU A;  2GIV A;  1P4W A;  5J8C A;  2J5P A;  3KZZ A;  2CG4 A;  4G9Y A;  2LF8 A;  5L3B A;  2ISZ A;  5D5W B;  3EET A;  3ULQ B;  3V8J A;  2KRF A;  4BHC A;  4RB2 C;  1TQI A;  5J6X A;  2P8T A;  1T98 A;  1QPM A;  2QWW A;  3JAM K;  1FYK A;  2RV8 A;  4HOB A;  4BQA A;  1B59 A;  3BPX A;  3I0T A;  4A0X A;  3QU6 A;  4KA4 A;  2TDX A;  5K5R A;  2P7V B;  1S29 A;  2L02 A;  4KMU X;  4HLX A;  2GXG A;  3IWF A;  4M6X A;  2OQR A;  3U1D A;  3M8E A;  2HTJ A;  3GFL A;  1LEA A;  4LD5 A;  5A2Q Z;  2NYX A;  2HKO A;  4HBL A;  1B9N A;  3VOE A;  3M8F A;  1ZAO A;  4EJT A;  4ESJ A;  2UWM A;  4KN4 X;  3V4G A;  5D6F A;  2DQL A;  2P4W A;  1XGN A;  2BEO A;  4D0P A;  2P7C B;  1I1S A;  1ON2 A;  4HV5 A;  2ADU A;  5ILV A;  1UCR A;  1D3Y A;  1OKR A;  3FXU A;  2OBP A;  2A68 F;  3TDZ C;  1U3E M;  1TTY A;  2DFI A;  4WX9 A;  2Z3Y A;  2L4M A;  1EH8 A;  1U5T A;  1U8R A;  5HOO A;  2IT0 A;  2Z9O A;  1XGM A;  2HOE A;  4AVP A;  3J81 Z;  3IRR A;  4XLP F;  4MTE A;  2OZU A;  2D1V A;  5CVV A;  3RYP A;  2QM3 A;  3SXY A;  2X4H A;  2RNJ A;  2E1C A;  4P9U A;  1W7P B;  4FX4 A;  1KGS A;  5JR3 A;  2NRA C;  5ED4 A;  4A12 A;  4RGU A;  2XHK A;  1FT9 A;  2IRF G;  2XAG A;  1R00 A;  5LGN A;  3JTH A;  3CTA A;  1OYW A;  1USS A;  2PMU A;  4MQV A;  2IA2 A;  1ZAR A;  2EV6 A;  4GXO A;  2FNP A;  2K02 A;  4IRI A;  3JAM Z;  4G6Q A;  2KIF A;  1Z1D A;  2XGX A;  2QVO A;  2FF4 A;  3BJA A;  5D4S A;  2DPU A;  1FBS A;  3WOD F;  2FA5 A;  1FSH A;  3I5U A;  1IN4 A;  1ZRD A;  1KA8 A;  1J75 A;  1HW1 A;  1P92 A;  4CZZ A;  3DFG A;  2LNB A;  2O0Y A;  4XBF A;  2FRH A;  2BYV E;  1MDM A;  1F5T A;  2PBI A;  4HQE A;  3NQO A;  5F1R A;  2D2W A;  2STT A;  1RI7 A;  3GX4 X;  3WU0 A;  2IPQ X;  1V3F A;  3K0L A;  5JI6 A;  4ASN A;  5L3D A;  1KU3 A;  1JGS A;  4KYW A;  2E7W A;  5IT9 K;  5DEQ A;  2JRT A;  3OV8 A;  1JXS A;  2DK8 A;  5HS9 A;  3T0Y A;  2BE5 F;  2A07 F;  1T2K A;  1DPR A;  1QZY A;  4EGY A;  5D8L B;  3J80 K;  2D1H A;  3D5L A;  2RVC A;  1P6R A;  5IT3 A;  1IAW A;  4JK1 X;  1Y0U A;  3ML6 A;  4IRG A;  4BNC A;  2O3F A;  3FXR A;  2EFO A;  3V8L A;  2VBZ A;  4Y13 A;  1B1B A;  3EUH A;  4S04 A;  1D5V A;  1IF1 A;  2QQA A;  2HTS A;  4IJA A;  1FOK A;  4OIN F;  3BJ6 A;  2M5W A;  3ERE D;  4EGZ A;  2VC1 A;  1HQC A;  2B0L A;  2F2E A;  5HVQ C;  2K86 A;  1K79 A;  2LDU A;  2EFP A;  3BZ6 A;  1UST A;  3F3X A;  3HSR A;  4S05 A;  1H9G A;  1R23 A;  2V79 A;  1R58 A;  1S6L A;  5BS6 A;  3HSE A;  1S7O A;  4HAM A;  3J7A O;  1IN7 A;  1G6N A;  1YW8 A;  5BPD A;  4WK8 F;  3WTU C;  2HQR A;  5LLQ A;  3ECO A;  3EYY A;  4MEX F;  2GWR A;  5DD4 A;  3ABT A;  4RS8 A;  4E70 A;  5FFX A;  3KET A;  2JPB A;  3F22 A;  4I02 A;  3PFI A;  3GF2 A;  4AIH A;  3N4M A;  3F6O A;  2HGC A;  3SZT A;  1OYI A;  4EJO A;  1W5S A;  3RDI A;  1BOA A;  1ZLK A;  5D5X B;  3H3U A;  1JHH A;  4NB5 A;  3O6B B;  2MH9 A;  3TGN A;  5K1Y A;  3CUQ A;  2ETH A;  3OOP A;  2Z99 A;  1SAX A;  5D6E A;  4OOI A;  2CO5 A;  4P5O A;  4CXF A;  1GXQ A;  2C6Y A;  1IRF A;  1QNT A;  1ZG5 A;  5K5Q A;  5EEH A;  4HYE A;  2OD5 A;  4UUV A;  3E5X A;  3I58 A;  1J5Y A;  5IT9 Z;  3GEZ A;  2XKO A;  3HRM A;  1CGP A;  3I54 A;  1CF7 B;  5LGU A;  2CGP A;  3QRF F;  3V8K A;  1XCV A;  1QQI A;  2IJL A;  1O3Q A;  4OMY A;  3J80 Z;  2VOD A;  5LHI A;  2Z33 A;  2IA1 A;  3F23 A;  1O3T A;  5H6R A;  1D8K A;  6PAX A;  1Z91 A;  2CSO A;  1HXD A;  2IW5 A;  4K2E A;  3LQR A;  4ZYD A;  3I4P A;  1XSX A;  2Z5U A;  2ZFW A;  2VBW A;  3DPT A;  1XGO A;  4L9T A;  2A3S A;  1RZ4 A;  4KIG A;  3EYI A;  3FMS A;  3BJO A;  2PFB A;  3T1B A;  1ONV A;  3M1E A;  5DYM A;  5H20 A;  2PLY A;  4HLY A;  1NHA A;  1W7P A;  3TQN A;  3GZ5 A;  1XSV A;  1YW7 A;  3SQN A;  3QP5 A;  2MLG A;  3CLO A;  4HV6 A;  3R4K A;  1SFX A;  4KUM A;  2NAZ A;  1TQM A;  5LRS A;  2W25 A;  2EFN A;  1E17 A;  3RKW A;  3NRV A;  2PI0 A;  1S3J A;  5D4R A;  2G7H A;  2HWV A;  4YG2 F;  3CJN A;  2L3D A;  2M87 A;  1BIB A;  5E8G A;  2DBB A;  3L7W A;  4MHG A;  3WU1 B;  4IF4 A;  1G4D A;  5A2Q K;  1P4X A;  1YS6 A;  1KU2 A;  2P6S A;  1XMK A;  3IC7 A;  3EQL F;  1FC3 A;  1O7L A;  5DCM B;  1U5T C;  4O5V A;  2M45 A;  3C18 A;  1Z9C A;  3C3W A;  2MA3 A;  4RGR A;  4KIB A;  4UVB A;  2MC3 A;  4WXD A;  1D8J A;  3FXQ A;  5CYV A;  3KP3 A;  4CIC A;  4ESF A;  3ZN1 A;  1MJB A;  3KEO A;  3VEP A;  2NNN A;  3BDD A;  5ERI A;  2PN6 A;  1G3S A;  1R1U A;  3C1D A;  2QQB A;  3HRU A;  3KZY A;  2F5C A;  2OU2 A;  4GYI A;  2GA1 A;  1MJ9 A;  3F8N A;  1P2F A;  3P9K A;  5HLG A;  4TV7 A;  1MJA A;  3ZMU A;  4RB1 A;  2VT3 A;  2K4J A;  4R8H A;  3J81 K;  2EV5 A;  2MD5 A;  3K9T A;  1KYZ A;  3MZH A;  4GCV A;  4EM2 A;  1J7K A;  4G6D A;  3K2Z A;  4YFX F;  3RTR A;  3FZV A;  3COA C;  1XSD A;  3P7N A;  1LNW A;  3Q5F A;  1Z6R A;  1S8N A;  1IXC A;  2EB7 A;  2L4A A;  1FPQ A;  1FP1 D;  4LB6 B;  2ESN A;  2RKH A;  1KQ0 A;  3ROU A;  1KU9 A;  3IKT A;  4FHT A;  3MQ0 A;  4DQ2 A;  3F8M A;  5AIQ A;  4Q5S F;  2ZCW A;  1O3R A;  4BAY A;  3FF5 A;  1ZRF A;  1HBX G;  3K69 A;  4L0Z B;  2OA4 A;  4AIJ A;  1R5G A;  4UVA A;  3VOD A;  1EH6 A;  2BBY A;  2KJC A;  2Y48 A;  1IXR C;  2COM A;  2O6G E;  3CDH A;  2AXL A;  4HX7 A;  1XDU A;  1TQP A;  3GFJ A;  4U0V A;  1U6G A;  5ICE A;  4RAY A;  4U7D A;  3E5U A;  1A04 A;  3Q9V A;  3VB2 A;  2EJR A;  4LGW A;  3WTZ A;  1UHW A;  4R79 A;  3FX3 A;  2HEO A;  3VFZ A;  3FM3 A;  4L9V A;  3L9F A;  4A0Z A;  4A2U A;  2HYG D;  1G3Y A;  1ZYR F;  4IHS A;  2FBH A;  2KJB A;  2LF7 A;  4Q47 A;  5DUI A;  1MD0 A;  2HZT A;  4G8X A;  3TO9 A;  3K1M A;  3WTW C;  3MEX A;  4Y17 A;  1AWC A;  4M72 A;  1KQ8 A;  3KCC A;  1MGT A;  5D8K B;  3F8F A;  1QZZ A;  3DKW A;  4HDV A;  5EEG A;  2DAO A;  4UV8 A;  2K7L A;  1CF7 A;  2WWY A;  2QEN A;  3QAH A;  3I64 A;  1ZRC A;  1WQ2 A;  3TOA A;  2ISY A;  2M30 A;  3WG9 A;  1T39 A;  2F5D A;  2K27 A;  1OPC A;  2DO7 A;  4ESB A;  1F4K A;  3LA2 A;  3FM5 A;  4JBA A;  2FMY A;  1B6A A;  4GGG A;  2HKX A;  3GFI A;  1IUY A;  2KIM A;  4N0B A;  5LBQ A;  2R3S A;  2VT2 A;  4A5M A;  2PMH A;  4WXH A;  4CHU A;  3E3V A;  1LB2 A;  5D5U B;  3CUQ C;  3KP4 A;  2HR3 A;  2XAJ A;  4WXC A;  1KU7 A;  1WI9 A;  1IRG A;  4HF2 A;  4P9F A;  2XAF A;  4HF1 A;  4M73 A;  4G7H F;  2VBY A;  4I01 A;  5LEK A;  3O2P E;  4ENN A;  2FQ3 A;  4A0Y A;  1BI1 A;  2WC2 A;  1HSJ A;  3BP8 A;  4WWC A;  4HDU A;  1BN5 A;  5FD5 A;  1FZP B;  4BXU A;  1YTY A;  4KMF A;  1YFH A;  4M9X A;  5L3G A;  2GZW A;  3BRO A;  3KE2 A;  5CVU A;  2P5V A;  1ON1 A;  1HKS A;  5DCM A;  2VBX A;  4U88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...