1USSA

Yeast histone h1 globular domain ii, hho1p gii, solution nmr structures
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
88
structure length
88
Chain Sequence
b'KASSPSSLTYKEMILKSMPQLNDGKGSSRIVLKKYVKDTFSSKLKTSSNFDYLFNSAIKKCVENGELVQPKGPSGIIKLNKKKVKLST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HISTONE H1
publication title Two Homologous Domains of Similar Structure But Different Stability in the Yeast Linker Histone, Hho1P
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 18
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2003-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00538 Linker_histone linker histone H1 and H5 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1ussA00
2YX4A 5DCFA 2MBFA 3F8FA 4KN7X 1KQ8A 2EFNA 1S8NA 3EDPA 4HV6A 1L0OC 1Q1HA 2XAFA 5FD6A 3J81K 2QQAA 4KYWA 1RI7A 2EV0A 1ZH5A 5J6XA 1R5HA 2M45A 2GA1A 3E5XA 3F8MA 2G7UA 1G3YA 4UUVA 1R22A 2QM3A 1U5TC 3WU1B 4O3MA 1XMAA 2OZUA 4DNCA 2CSOA 1EH6A 4WK8F 1EV7A 3WTUC 5DDGA 1OMIA 1ZN2A 2PFBA 4LD5A 4S04A 1D8JA 3W6KB 2HKXA 4I02A 2Q0OA 4K2EA 4A0ZA 3HTSB 1K78B 3JTHA 1OYIA 1FZPB 3C7JA 1XN7A 2STTA 2ELHA 1W5TA 2D1HA 3HUGA 4KUMA 1XB4A 5BPDA 5F6FA 2O3FA 4ZH4F 4G6DA 3G73A 3F72A 2HKOA 3ZMUA 4L5IA 1UHWA 1B1BA 3F21A 2WTEA 3NEUA 2F5CA 2MH2A 3EQLF 3K1PA 3K69A 5DCMB 1R58A 2GAUA 2W25A 3HHHA 2LKPA 2PEXA 4IRIA 1P92A 1BJAA 4I09A 3E5UA 4L5JA 1QGPA 4L0ZB 3EETA 3I59A 1Z6RA 2A6EF 2XV4S 4RB2C 3B02A 2P5LC 1TNSA 5HDNA 4IRGA 1LB2A 2H94A 1XGNA 3TO9A 5D5UB 2XKOA 1LQ1A 1XGSA 4M72A 4A0YA 2MH9A 1YYVA 4ENMA 2K4JA 4IVNA 2CG4A 2VE8A 1IN5A 1I1SA 4HX7A 1OKRA 3RIRA 3R60A 4LLGF 3TGNA 2K4BA 2FBKA 1BI1A 2PBIA 3SQNA 4WCGA 1FBSA 3ERED 1K7AA 4MTEA 2VBZA 5FB2A 4Z2YA 3ZPLA 3HOTA 4M6XA 4P9UA 4EJTA 4WXDA 3RYPA 2XAHA 4JK1X 2KJBA 1JHFA 4F7ZA 2O6GE 3V7CA 5E8IA 1YW9A 3MFKA 3ABTA 3KZZA 1P4AA 3C18A 4N9HA 2IW5A 4U0WA 1YW8A 3KEOA 3GXOA 4EGYA 3I71A 1RUOA 3U1DA 2K7LA 5D5WB 4P55A 1V4RA 2JTVA 3ZMDA 4MEYF 2DLLA 1JE8A 3G3ZA 4KIFA 1IUYA 4UV9A 1ZG1A 4IPAA 4EJWA 2QWWA 4HQMA 1HSTA 3D5LA 3DP7A 2VT3A 3RPUA 4LLNA 1C0WA 5FGMA 3GFLA 1U5TA 1IN4A 1YQAA 3RYRA 1Z7UA 1OYWA 3V8KA 2ISZA 1ON2A 2EB7A 4EJUA 1L3LA 4OIRF 1RUNA 4G8XA 3GF2A 4LK1F 4ZYHA 4IXAA 2BGCA 5L3GA 3RJPA 3TOBA 3N4MA 2G7HA 3DFGA 2MD5A 3FF5A 3F6VA 4NB5A 3HRMA 1I1GA 2XROA 2OQGA 1FYLA 5D6FA 3KP3A 2ZBKA 4R1HA 3E6BA 1HQCA 2M8EA 4CYDA 1FY7A 4GGGA 3MZHA 1AWCA 3ML6A 4HDUA 2PQ8A 3D0SA 1IXRC 2FBIA 4FHTA 2HOEA 4ZYGA 1SD4A 3E3VA 1YIOA 2PLYA 1O7FA 2FU4A 1J59A 1HW1A 1YS6A 5DUIA 1TNTA 3GW2A 4OIQF 2FF4A 5D6EA 2ZCWA 1R7JA 2PJPA 2RKHA 2LDUA 3F22A 3BY6A 2GXGA 3NRVA 4CXFA 2B0LA 4GYIA 1R1UA 1EH7A 2C6YA 3R4KA 1IRFA 4OU0A 3O6BB 3I59B 2XAGA 2JPBA 5K5RA 3IWZA 3E6MA 3I64A 2XAJA 4L9JA 2P6TA 3SZPA 3QAHA 1XGMA 2OU2A 5CJ9A 4U7BA 1TQIA 2RNJA 5TRDA 2FBHA 3HRSA 5A2QZ 2KIFA 1XD7A 5HDGA 5E20A 4LB6B 1DP7P 1R5GA 1YFHA 1QO0D 5ICFA 1Z05A 1GXPA 4BQAA 2E7XA 2LSOA 2HTSA 4EJOA 2FOKA 5E18F 1FYMA 4AIHA 4BNCA 3ELKA 2OA4A 4RB3C 3TO6A 1F1ZA 1BIBA 1XCVA 4QLCU 3FX3A 1WQ2A 2FQ3A 1S29A 3T8RA 1XSDA 3LA7A 1S6LA 2H27A 1KYZA 5D8KB 5H20A 2ZMEA 3R61A 3KLOA 3DKWA 1P4WA 4Q47A 2O03A 3QU6A 3KP6A 1DDNA 2P7CB 4MQ9F 5JI6A 1TLHB 3I0TA 1ULYA 3BPVA 3I5UA 1X3UA 4QWQA 2COMA 3H92A 2RV8A 4M9ZA 1ZRDA 1ZGAA 3TKYA 1JXSA 1LDJA 4M74A 5E1XA 2O8XA 3LA2A 1KQ9A 5ILUA 3P7NA 4KDPA 2FEZA 1P6RA 4JBAA 3CO7C 3WU0A 2EFOA 5JHUA 1ZGJA 4CHUA 4ZZLA 3F8BA 1O57A 3VEPA 3JAMK 4WXHA 2NS0A 1ZLJA 4YFXF 4RB0A 1BI2A 2TDXA 3JSPA 5H6QA 1T0FA 2MC3A 3U2RA 4WX9A 2J5PA 4EJVA 5H6RA 3WTWC 4U88A 2QUFA 3K0LA 2O0YA 2OD5A 2DAOA 3FM3A 2X4HA 3R6SA 3P9CA 1SMYF 1FX7A 3MZYA 5FFXA 2DQLA 4CGZA 4U0VA 5LHHA 1MZBA 2VT2A 4LFUA 5K1YA 3V7SA 2DI3A 2Z5UA 2BYVE 1HKTA 4XSZF 2HQRA 1FPQA 3V7RA 4UHTA 4GYGA 4L9TA 1R23A 1XMKA 3HTUA 2IA1A 3HSFA 2QZ8A 4OMYA 4NHJA 2OZ6A 4O5VA 2KJCA 2QYOA 2L3DA 3KLNA 2Z3YA 2XHKA 4BH9A 5AIPA 1FC3A 1B59A 2A07F 3BZ6A 1RNLA 3GEZA 1Z9CA 4G7ZF 4G7HF 3F23A 3LA3A 2R7FA 3WTZA 2XUBA 3E6CC 2KIUA 3KE2A 4IJAA 1WWXA 3ABUA 3V8JA 4P5OA 3GFIA 2QENA 2EFWA 4IHSA 3DPTA 5FFZA 1DPUA 2JPCA 4KT5C 1FBUA 5J8FA 2O61A 3H3ZA 1Z91A 2RC4A 1KU2A 2FSWA 1TW3A 4B09A 3VODA 4A2UA 2IA2A 3FZVA 5HVQC 3J81Z 2CW0F 5ED4A 2FNAA 1U6GA 1SFUA 4LJZF 4E70A 1MGTA 5D4SA 1Z1DA 4HW0A 1ZRCA 2W24A 5HOOA 1TQMA 1A04A 2V1XA 3T1BA 2IPQX 1H9TA 3ZN0A 2A61A 3R0JA 3ZMTA 3L9FA 1I27A 3PQJA 1SD7A 4RGSA 2R7DA 4Q48A 1LNWA 3F8CA 3LFKA 3VOEA 4I98B 2XAQA 1WRJA 3M8FA 4BYYA 3MWMA 4PGGA 4EM1A 5K5QA 1R1VA 2LF8A 1U8RA 3MAJA 2W85A 1O7LA 1PUEE 1T6SA 3RDIA 2H09A 3TO7A 2EFPA 2AXLA 4HF0A 2ZMEB 4Y17A 1IN6A 1LEAA 2BV6A 4I01A 3TDUC 4ASNA 3M1EA 3KETA 3COAC 4KICA 5DD4A 3KCCA 3CO6C 3FXRA 4LMYA 3L7WA 4KFCA 2A68F 3BWGA 1R1TA 3HHGA 1ZARA 4HBLA 1BM9A 4A6EA 3HYIA 4Q5SF 2XASA 2XGXA 4IHTA 2YPRA 5ERIA 4ETSA 2A6HF 4ZYDA 3WGIA 3DEUA 2GWRA 3E5QA 4KMUX 1JHHA 1XSXA 2WWYA 1JGSA 3VB2A 2F5FA 3F8NA 3O3KA 2Y0MA 2OQRA 3WTSC 1SD6A 4KA4A 2FRHA 5LEJA 2GA2A 4BHPA 4CZZA 3DV8A 2HWVA 5CVRA 1UCRA 3IWFA 2RN7A 4FX0A 5CVJA 3EYYA 2RGVA 1H0MA 1G3TA 2A3SA 3ROUA 1FP1D 1HW2A 1HKQA 5CLSA 2VBXA 4H0EA 3B73A 2EV6A 4PZJA 3HRTA 3RKXA 2Z99A 3BDDA 6PAXA 3L00A 1O3RA 3M8EA 3KFWX 1USSA 3BPXA 1SD5A 5IT9K 4I0AA 2DT5A 1DPRA 4P96A 4BHCA 1DUXC 4IF4A 2QQBA 3ISPA 2OBPA 3LQRA 3GZ6A 2YU3A 1MJAA 1KA8A 2XIGA 3J80Z 1BIAA 1MJ9A 3RTRA 2IP2A 4ENNA 4HX8A 2F5DA 1FT9A 2EK5A 4XLPF 3T8TA 5BOXA 1G3WA 2M87A 1XDUA 1VTNC 1MJBA 1FWZA 3V4GA 1QNTA 5HS9A 4HA8A 2VE9A 3CTAA 4PDKA 2IRFG 3FXUA 1HXDA 4S05A 2VXZA 1Y0UA 1SMTA 4OMZA 4OOIA 2ZXJA 4M73A 3MCZA 4XRFA 1F4KA 3FWEA 2A5YB 2MA3A 3RI4A 4OIOF 2ZNZA 2CO5A 1S7AA 1FSHA 4HQEA 4PCQA 4L9NA 3H3UA 3FHZA 3CUOA 3I58A 3GVAA 4ENJA 2PI0A 2RDPA 5D4RA 4BAYA 1G6NA 2HR3A 2DFIA 2PMHA 2V6CA 4FX4A 3WTVC 2D2WA 1QZYA 3RKWA 4A0XA 1RZ4A 4BXUA 1J2XA 2CFXA 4GO1A 4A5MA 1KYWA 3PQKA 5LRSA 2VODA 3ZMVA 3W6JB 1U2WA 1B4AA 2NNNA 3Q9VA 4R79A 4LG0A 1W7PA 2X0LA 3ZMZA 3Q9SA 4LB5A 5KK1A 2KIMA 4RB1A 3MQ0A 1FLIA 2WC2A 3FMRA 2FNPA 1BBYA 3FXQA 4N9IA 4HX4A 5KVRA 2DO7A 1J5YA 1IXSB 1IAWA 4PGHA 5CVVA 4U7DA 3IRQA 3K1NA 4KMFA 3M7GA 1TW2A 4EMSA 4R8HA 5CVUA 3P9KA 1OYYA 2HTJA 2PN6A 1CGPA 4AIKA 1O3TA 2QBYA 3LWFA 1MD0A 2M30A 3IL2A 4L0YB 2W84A 1ZLKA 4G94A 2VOOA 2GXBA 2UXNA 3GWZA 4ESFA 5F64A 3WGHA 2H6CA 4IRHA 5CVIA 2BE5F 2RVCA 2ISYA 4LLLA 1UB9A 1P4XA 1WI9A 3ZMSA 4Y13A 2JZYA 4DQ2A 2FE3A 4YFKF 3GFJA 1HSJA 1J7KA 2L02A 1QPMA 2EJRA 3WG9A 4MQVA 2UZKA 1SFEA 2HDCA 3I4PA 1O3QA 1CF7A 5E17F 2QQ9A 2OAZA 5LHIA 2E1NA 3CUQC 1D5VA 1LDKB 1U5TB 4CICA 2KKOA 1FBQA 2ETHA 3IKTA 4HF2A 3L09A 1S7OA 4L18B 2DPUA 4O6JA 5HDKA 3HRUA 3GFMA 2EV5A 3I53A 4HAMA 4KNYA 5HLGA 5LGUA 5ILSA 1KGSA 4YFNF 2LF7A 3QPHA 5FLXZ 5CYVA 5HS8A 3FM5A 3P9IA 3IC7A 4ZYEA 3LAPA 3QP6A 3SZTA 1BC8C 1ZG3A 5E1WA 4M6YA 5HLIA 5DD8A 4NQWA 1QBJA 2VN2A 1KQ0A 3OOPA 3C1DA 1ON1A 2EWNA 2P5KA 2VC1A 2QVOA 4A5NA 3K1MA 3SFZA 2DBBA 4RGXA 4AIJA 1T2KA 1NHAA 1YTYA 4M9SA 1ZYRF 1D3YA 5BMZA 1LDDA 3LQQA 1YG2A 2P5VA 1I6XA 4ENKA 1K6OA 2ZKZA 3GLXA 2V79A 3JAMZ 1HKSA 5AIQA 3KZYA 4CDGA 2BBYA 5TJJA 5L3BA 1PP8F 4XBFA 3QU3A 1BOAA 2IVMA 2PG4A 4G6QA 2P7VB 4MNUA 1IN8A 3IKVA 2GQQA 5AONA 2NYXA 2HYGD 4I7HA 3R0AA 1XDSA 2PMUA 3TQNA 1HBXG 1O3SA 2ZFWA 5BS6A 1IRGA 4ON0A 2IJLA 3SHFA 4ESJA 1B9NA 2DU9A 3WGGA 4UVBA 2IT0A 2D45A 1UFMA 3S2WA 2K02A 4RGRA 4YIFA 1KU3A 3WE3A 3JSOA 1RIOH 4LG0B 2M1BA 1W7PB 5LRRA 4AWXB 2LNBA 2JRTA 2V9VA 4GXOA 2XVCA 1HW5A 2MLKA 3K9TA 4EVIA 4MEXF 4XLNF 2FMLA 1MKMA 4JQFA 2XKPA 3TOAA 1OR7A 4GCVA 1B6AA 2NAZA 4AD9A 1F9NA 5LGTA 2P6SA 2K86A 3WODF 1SFXA 2L4AA 1P2FA 2FMYA 2V1DA 2BEOA 3GO5A 2UWMA 1TBXA 5J8CA 3E6DA 3KP2A 1G4DA 4HDVA 4P9FA 3BJAA 4HLXA 2DQRA 1PDNC 5LBQA 1XGOA 2QBYB 3AAFA 4EM2A 1SAXA 2VBWA 4MGRA 2KRFA 2DTRA 3K2ZA 3REOA 4EV0A 4WF2A 2CQKA 4YG2F 1J9IA 1BN5A 1AOYA 3DQVC 1IW7F 3V8LA 2YR2A 1IN7A 3KP7A 2F5EA 2FA5A 4KN4X 3HIFA 3GYHX 5FD5A 4EQQA 3MEXA 3CUQA 2QLZA 1T38A 5HLHA 3DPLC 2ADUA 1CF7B 1USTA 2L01A 1OPCA 3O2PE 2ZJ2A 1Z6TA 5D5XB 3J80K 1J75A 3WTYC 2NNYA 3JTGA 5BQTA 4A12A 2FXAA 2VOPA 4Y15A 4HV5A 3WE2A 1GVJA 1F5TA 4EM0B 4UV8A 5ICEA 1YLFA 3Q5FA 5EEGA 3N97A 2ZNYA 2VC0A 2YSRA 2HGCA 1YS7A 3QRFF 1K79A 2HS5A 1J0RA 1D8KA 2EA2A 1ZG5A 1MDMA 4MTDA 4MHGA 1FNNA 1BI0A 1ZAOA 5JR3A 5ILVA 1LJ9A 4EGZA 5DV5A 4KIBA 3ZP5A 3IHUA 2Z33A 2A69F 1FOKA 1V3FA 5L3CA 3BP8A 2RQPA 4M9XA 1EH8A 3WTXC 4L9VA 2MLGA 2L4MA 5JFRA 4B8XA 2DPDA 3T0YA 2IA0A 1UHMA 4RAYA 3GX4X 3ZQ7A 2GZWA 3E97A 1IXCA 4UVAA 2Y75A 4HYEA 2CWEA 3DXJF 2ZO4A 1W5SA 3SXYA 2XRNA 5D5VB 1U78A 5DYMA 3NQOA 5LHGA 4OINF 5FO5A 4WXCA 1R36A 4KIGA 1XSVA 3CDHA 3BROA 5JVTA 1KU9A 5A2QK 4HF1A 1ODDA 3LSTA 3L2CA 4OIPF 2K27A 1T39A 3ZN1A 5IT9Z 1H9GA 3OV8A 3CJNA 1QZZA 5HS7A 3WTTC 4UNOA 2DW4A 3I54A 3C3WA 1ZRFA 3BJ6A 4ESBA 5ICCA 5E8GA 3F6OA 3RKYA 3PFIA 3FMQA 2L54A 3KEQA 2M5WA 4LK0F 1WKMA 5L3EA 1S3JA 4RS8A 2JT1A 4HOBA 1K78A 1BI3A 5F1RA 5E1ZB 3ULQB 2Z9OA 4BHBA 3RPQA 3QPTA 2STWA 4HLYA 1STZA 3HSEA 5D8LB 4D0PA 1PP7U 2HZTA 2F2EA 2R3SA 4RAZA 1KU7A 5L3DA 5DUKA 1FP2A 2J5OA 2DK8A 1QQIA 5IT3A 2P4WA 2V1UA 2HFHA 2WV0A 1GXQA 5LGNA 4FT8A 4UXNA 2HEOA 5K5OA 1ZREA 5DCMA 3QP5A 1LEBA 1TTYA 3U9GA 2Q2EA 3JW4A 4RGUA 4TV7A 2HQNA 2W57A 1W4MA 2HYFA 1T98A 1IZ1A 3QOPA 5L3FA 4AVPA 3F3XA 3GUDA 3TDZC 4WWCA 1ONVA 1BC7C 2EA4A 3IRRA 3BJOA 4UVCA 5ICGA 3M9AA 3CUQB 4ZZDA 5DEQA 2H6BA 2E1CA 1I5ZA 1YO5C 2D1VA 4G9YA 4YIIA 2CYYA 2JSCA 2AS5F 2EFQA 3BOQA 3CLOA 1REPC 5LLQA 2NRAC 5FLXK 4N0BA 2Q8KA 3ECHA 5LEKA 3KP5A 3GZ5A 2UXXA 5BPIA 3VFZA 4I0BA 2GIVA 2ESHA 3FMSA 2VONA 2P8TA 1U3EM 1W7PD 2G9WA 1GHCA 1MDMB 1FSEA 2E7WA 4CO8A 2YX7A 2CGPA 1XCBA 3LAJA 5EEHA 1G3SA 4XSXF 3EUHA 4HZFA 3J7AO 1LVAA 1R00A 1WSUA 1TQPA 3DF8A 3KP4A 2ACJA 4LGWA 3HSRA 4M71A 4U0YA 4G7OF 1E17A 1YW7A 3ECOA 4A6DA 2DK5A 4Q4ZF 1B9MA 2ESNA 1ZHFA 4I2OA 1FYKA 2VBYA 1E2XA 3EYIA 3HOSA 1IF1A 2Y48A 3T5XA
chains in the Genus database with same CATH superfamily
2YX4A 3HPHA 4J01A 5DCFA 2MBFA 1RESA 3A02A 4BQQA 3F8FA 5DM7F 2XRLA 3IH2A 4KN7X 2KLOA 1KQ8A 2EFNA 1P7JA 1S8NA 3EDPA 2BVLA 4HV6A 4E7SA 1L0OC 1Q1HA 1ZTRA 2XAFA 3DKYA 5FD6A 3J81K 3ASOH 2QQAA 4KYWA 1RI7A 2EV0A 1ZH5A 2HI3A 5J6XA 1R5HA 3LNQA 2M45A 3AL0C 2GA1A 3E5XA 5FLMJ 2M7BA 3DTKA 3VSLA 3F8MA 2G7UA 1G3YA 2CJJA 5KHDA 4PJJA 5IP7J 2HOTA 1WH7A 4UUVA 1UMQA 1ETVA 1N75A 3JRCA 4E7LA 1R22A 3FBNB 2QM3A 3ZQGA 2JQ7A 1U5TC 4M6VA 3WU1B 4O3MA 1XMAA 4IHYA 2FD5A 2OZUA 2Y0SA 1Y8RB 2CSOA 4DNCA 1EH6A 4WK8F 1EV7A 3OR2C 3WTUC 3EUAA 5DDGA 1OMIA 2MG4A 1ZN2A 2PFBA 3G1OA 4CH7A 1FIPA 1GT0C 1NK3P 4LD5A 3JRFA 4S04A 1D8JA 3RSNA 3W6KB 3BTIA 4JOMA 3JRGA 2HKXA 4I02A 2Q0OA 2GBYA 2R4GA 4A3JJ 3LSJA 4K2EA 4A0ZA 3WHCA 4XOPA 3HTSB 4XM3A 2DA3A 1K78B 5EDNA 3JTHA 3S3NA 1OYIA 1FZPB 2L7KA 2OCCH 3C7JA 3TMOA 1XN7A 3VSKA 2BOLA 2STTA 2CW7A 3LSKA 2DFHA 1B8IA 2ELHA 1D1CA 1W5TA 2D1HA 3HUGA 1Y6IA 4KUMA 2B9SA 4GDFA 1XB4A 3QYEA 5BPDA 2Y9ZA 3QODA 5F6FA 2ZJPF 3Q3SA 1SFOJ 3B6CA 2O3FA 2E19A 4ZH4F 5M5WJ 3ZXSA 4G6DA 3G73A 1XS9A 3HG9A 2XGDA 5J40A 3F72A 3OYJA 3DBLB 2HKOA 3IAS2 3ZMUA 4L5IA 3G71I 1UHWA 2JA7J 2LTPA 3QQAA 1B1BA 3F21A 1VFCA 4F93B 4BE2A 4A3CJ 4IQJA 2WTEA 3NEUA 2F5CA 4M3FA 3AG1H 2MH2A 3EQLF 3FXKA 3K1PA 4AIDA 2CFOA 3K69A 2M2EA 1VQ5I 5DCMB 1R58A 2GAUA 2W25A 2Q2EB 3LSMA 3S1NJ 2NOJB 3FIWA 3QPLA 3HHHA 3G1MA 2LKPA 2PEXA 4IRIA 1P92A 5CQGA 1BJAA 4I09A 2BHYA 2YUSA 3E5UA 4L5JA 1QGPA 4L0ZB 3EETA 3I59A 1Z6RA 1T33A 2A6EF 3BTLA 2XV4S 4RB2C 3VYTB 3B02A 1Z21A 2P5LC 5DTDA 4F91B 1TNSA 5HDNA 4IRGA 1LB2A 1W36D 2V26A 1D5YA 5B1BH 4P1WA 4M3EA 1ETQA 3BG5A 1R49A 2H94A 4CUGA 1XGNA 3HB9A 5GTHC 1IUFA 2HVQA 3TO9A 3ESWB 5D5UB 5E3LA 1LPQA 2XKOA 3LOCA 1BW6A 4BQNA 1LQ1A 2KZVA 1XGSA 3PO2J 4A93J 4M72A 4A0YA 2MH9A 1YYVA 4ENMA 2GM4A 3DCFA 2K9QA 2K4JA 4IVNA 5TISC 3BG7A 2CG4A 2VE8A 1JTXA 1Y56A 1IN5A 2VI6A 1I1SA 1SVMA 4HX7A 2KIQA 3J7YJ 1OKRA 3RIRA 3R60A 2KHMA 3SFIA 2LOOA 4LLGF 3TGNA 4QSHA 2K4BA 2VPRA 4DZJA 2FBKA 2M0MA 3AG2H 4C2MJ 2WY8Q 2R5ZB 1BI1A 3I56I 3S3MA 2PBIA 3SQNA 2GXAA 3CESA 5J4VA 5GPAA 4WCGA 1FBSA 4AYBN 3ERED 1K7AA 1DP3A 4MTEA 3GMEA 5JHFA 2VBZA 5FB2A 4Z2YA 2W82A 3A0BC 3ZPLA 2HOAA 2RAEA 3HOTA 4M6XA 4XLHA 4P9UA 4EJTA 2NVXJ 1SAUA 2PMZN 4WXDA 2XAHA 3RYPA 4ZDOA 4BACA 1I3AA 4JK1X 2KJBA 2K3PA 2A5WA 2VKEA 1JHFA 3GTKJ 4IEJA 4F7ZA 1MSFC 2O6GE 4N4OB 3V7CA 1UELB 5E8IA 3S2HJ 1YW9A 3MFKA 3ABTA 4CYCB 3KZZA 4Y33A 1P4AA 3C18A 4N9HA 2E2IJ 3H0GJ 4BEHB 2HVSA 3OYHA 2LBFA 2IW5A 2YU9J 2ZMEC 4U0WA 1YW8A 4PJNA 3KEOA 4Y52J 1MNDA 4PFPA 4ITVA 2D5VA 3C2HA 4HNTA 2DMTA 3GXOA 2ZXWH 4XLFA 1KONA 4EGYA 3S2DJ 2DOAA 3I55I 3I71A 1RUOA 3U1DA 2B7EA 4RBOA 2KMUA 4PSWA 2K7LA 5D5WB 1ZELA 4XLEA 1V5EA 1VQMI 4P55A 1V4RA 2JTVA 2AHQA 1W5CC 3ZMDA 1I50J 4MEYF 2DLLA 5J4YA 1JE8A 1UZCA 3G3ZA 1HCRA 5KAFC 3PFYA 3HM5A 4KIFA 3W2AA 1IUYA 4UV9A 4CZCA 4IPAA 4EJWA 1ZG1A 3H9QA 2QWWA 4HQMA 4GFBA 1HSTA 2FUG2 3CMAI 1HDDC 4X0GA 3D5LA 3DP7A 2VT3A 3RPUA 3K4KA 4HSTA 4XN0A 3JRIA 4LLNA 1C0WA 5FGMA 3GFLA 1U5TA 1IN4A 1YQAA 2R7XA 4XR6A 3RYRA 3ZQCA 1Z7UA 2Z2SB 1OYWA 1QZEA 3V8KA 2JSPA 2ISZA 1ON2A 1GV2A 1X1DA 2XAUA 2EB7A 4EJUA 3I4NJ 1GV5A 1L3LA 2LR8A 4OIRF 1RUNA 4DW6A 5F1JA 1WHUA 4NC8A 5B1AH 2R92J 4G8XA 3GF2A 3BZCA 3IH3A 4LK1F 4ZYHA 2FQ4A 3JCUC 3LSIA 2BGCA 1T0FC 4IXAA 5L3GA 3RJPA 2BY0A 2BW3A 5FKLA 2HXIA 4FE4A 3TOBA 3H5RA 3N4MA 1Y1WJ 2DYSH 2G7HA 3H36A 4AYBA 3DFGA 5FLVA 5J47A 2MD5A 4IHWA 3FF5A 3F6VA 5IYBJ 2DMUA 4NB5A 3HRMA 3D5SC 1I1GA 2XROA 2OQGA 1FYLA 5D6FA 3KP3A 2WA0A 1Z0XA 2ZBKA 4R1HA 3E6BA 3RZOJ 1EJ9A 1HQCA 2M8EA 1YJ9I 5CKTA 4A3BJ 2ZSIB 3BQZA 1W0UA 4CYDA 1G59A 1FY7A 1D1AA 4GGGA 3MZHA 1JUMA 1O4XA 1AWCA 3HKZN 3ML6A 9ANTA 2RQQA 3NAUA 4V19K 4HDUA 2DA5A 2PQ8A 3D0SA 4M3DA 4E6KG 3OYMA 4XONA 1IXRC 1SFKA 2FBIA 4FHTA 4C2TA 2CW8A 2HOEA 4ZYGA 1B8IB 1SD4A 3E3VA 2OCEA 5GPCA 3I4MJ 4A3MJ 3HUGB 1YIOA 3RQIA 2PLYA 3L2VA 5EEAA 1O7FA 2FU4A 1J59A 1HW1A 1YS6A 5DUIA 1ERDA 1TNTA 3GW2A 4OIQF 2FF4A 5D6EA 3PNYA 2ZCWA 4XKBA 4BXXJ 1R7JA 3OIQA 2PJPA 3CD6I 3CZ6A 3AKZA 2RKHA 1X1CA 2LDUA 4II2A 3OSGA 3FXJA 2COBA 3OYEA 3TBIA 3F22A 2LY2A 2H8RA 3K6GA 3BY6A 2GXGA 3NRVA 4CXFA 3M8JA 2B0LA 2GOMA 3OYIA 1TWCJ 5E79C 2X9DA 2MW8A 2BZTA 1R1UA 4GYIA 3HOUJ 1UAAA 1EH7A 2C6YA 4RA2A 3R4KA 1V5FA 1IRFA 3S1MJ 4OU0A 3O6BB 3I59B 2H8WA 2DOEA 1G8XA 3MZ8A 2XAGA 3OYAA 2ZC2A 3CDLA 1S9HA 2JJ7A 2JPBA 4EEFG 4MO7A 3CMEI 3E0JB 5K5RA 3IWZA 1OCCH 3E6MA 4E7ZA 4RDUA 2IGKA 3I64A 3UR3C 2XAJA 3K4MA 4LIUA 4L9JA 2P6TA 3BCAA 3SZPA 3QAHA 1XGMA 1ETOA 2OU2A 5CJ9A 2Y31A 2QCOA 4D5FA 4U7BA 1TQIA 2RNJA 3OR1C 3Q0UA 5TRDA 2E1OA 3W2VA 2FBHA 3HRSA 5A2QZ 2VPLA 3BR5A 1A6IA 2KIFA 1XD7A 2G0EA 5E20A 5HDGA 4LB6B 1DP7P 1R5GA 2L7MP 1QO0D 1YFHA 5ICFA 3HOVJ 1Z05A 3L2RA 1GXPA 2VIXA 2DT6A 4BQAA 2E7XA 1SC7A 2LSOA 2HTSA 2M34A 4I99C 4EJOA 2FOKA 4AVZA 5E18F 3AG4H 4FQGA 1FYMA 2F4IA 3M4OJ 4AIHA 4BNCA 3DBRB 1OR7C 2CV0A 2XPUA 3ELKA 2OA4A 4FTHA 1MMSA 4RB3C 3TO6A 1F1ZA 1BIBA 1XCVA 2JWTA 1D1BA 4QLCU 3FX3A 4BY7J 2X1DA 1WQ2A 3DU5A 2FQ3A 1S29A 3BLYA 3T8RA 1XSDA 3LA7A 1LFPA 1FMWA 1S6LA 1B72A 2H27A 1VQ6I 1KYZA 2K9LA 5F08A 5D8KB 4CCJA 4IHVA 5H20A 4KISA 2EZKA 3K4CA 3DTEA 2ZMEA 3R61A 2VB6A 3KLOA 3DKWA 1P4WA 4Q47A 2O03A 3QU6A 2FJ1A 4F92B 3KP6A 1DDNA 2P7CB 3ONQA 4MQ9F 2NVUB 1TLHB 5JI6A 5IYCJ 1YI2I 4Z6YA 3I0TA 3GTOJ 2LBFB 3WU2C 3S1RJ 2BVMA 1ULYA 2K9SA 1FEXA 1X3ZB 2KPMA 2Y0SN 4DZPA 2OTJI 2R0QC 2HXOA 1JUSA 3BPVA 3I5UA 1SVLA 1X3UA 3CMYA 4QWQA 1NG7A 2COMA 3H92A 2LRDA 3CCLI 1QVUA 2RV8A 1XC5A 1U9NA 4M9ZA 1ZRDA 5EJCA 4A3LJ 4DBQA 3K70C 3TP3A 1ZGAA 3TKYA 4NNJA 1JXSA 1LDJA 4M74A 5E1XA 2O8XA 3LA2A 1MBHA 4OWRB 1KQ9A 5FKOA 3W6VA 5ILUA 2XPVA 3P7NA 4KDPA 2FEZA 4XOTA 3AL0B 2AQFA 1P6RA 2XGCA 3OY9A 4JBAA 2VJJA 3CO7C 3WU0A 1MMGA 2EFOA 2L7ZA 5JHUA 1ITYA 1ZGJA 4XN3A 2QSFX 4CHUA 2R7ZJ 4ZZLA 2VASA 3F8BA 1O57A 3H9JA 3SEQA 3VEPA 3JAMK 4WXHA 2NS0A 1ZLJA 2KQRA 5J1YA 5IOZA 4YFXF 3MKLA 1YX5A 2CRGA 4RB0A 1BI2A 2TDXA 4LG3A 3MKYB 3FXLA 3JSPA 5H6QA 1T0FA 2MC3A 3U2RA 4ABZA 1BW5A 4WX9A 3S16J 2OC6A 2LK2A 2J5PA 4JP0A 2R7VA 4EJVA 1K83J 2JA5J 5H6RA 4HNVA 3WTWC 4U88A 4IOAF 3AFHA 4XQFA 1NG6A 2QUFA 3K0LA 2O0YA 2OD5A 3VYUB 4XL9A 2DAOA 3KYLA 2DJNA 3FM3A 2DXIA 2X4HA 3OYKA 3R6SA 1D0ZA 2BW3B 4F52A 1RR8C 3A01A 1WJEA 3P9CA 2DFEA 1ETXA 1SMYF 5FROA 2XC7A 1D0XA 1FX7A 2L9NA 3CC7I 1TP4A 3MZYA 5FFXA 2DQLA 3CCJI 4CGZA 3WG7H 4U0VA 5GP9A 5LHHA 1MZBA 2VT2A 4B3AA 2X85A 3IP4B 4LFUA 1IC8A 4LIVA 5IPAA 2MFZA 2PJRA 1ZKGA 5K1YA 3K7AJ 3J7AY 3V7SA 4E7KA 2DI3A 2Z5UA 3A1YA 2BYVE 1N77A 1HKTA 5HNHA 2M7AA 4XSZF 2HQRA 1FPQA 3V7RA 2VL8A 3G4SI 2OF7A 3OYBA 2Z1DA 4UHTA 4GYGA 3S14J 4L9TA 1R23A 2TRTA 4RLQA 3M1CA 1XMKA 3GTQJ 3VPRA 4UB8C 5EF6A 3HTUA 4ZC3A 2IA1A 3HSFA 2L7FP 3H35A 2I8DA 3PUBA 2DYRH 2QZ8A 1XX5A 3HGGA 4OMYA 1EKEA 1LFBA 3I3LA 5JLXA 4NHJA 2IS1A 2O5RA 2OZ6A 2HYJA 4O5VA 2KJCA 3BT9A 2QYOA 2L3DA 3KLNA 1YE9A 1PVEA 2E1MC 1K6YA 2R7QA 2Z3YA 2XHKA 1Z7LA 4EATA 1IRZA 4BH9A 1ETKA 5AIPA 3PIPF 2NVQJ 2X1EA 2WY7Q 1FC3A 1B59A 5F04A 3BZ6A 1RNLA 3GEZA 1Z9CA 2A07F 2JA6J 4G7ZF 2NXNB 3F23A 4G7HF 3VWBA 2CUZA 3LA3A 2R7FA 2OJED 3WTZA 1N78A 2XUBA 3E6CC 2KIUA 3KE2A 5C44J 2XF5A 3E7LA 2CMPA 4IJAA 1WWXA 2HU9A 3ABUA 3V8JA 4P5OA 3GZNB 5BNGA 3DEEA 3ZQQA 3GFIA 3DWLE 5E3MA 1Y0NA 5B66C 1YJNI 2QENA 2EFWA 4IHSA 3DPTA 5FFZA 1DPUA 2JPCA 3BQYA 4KT5C 1FBUA 5J8FA 4D7MA 2O61A 3H3ZA 1Z91A 2V9KA 1TL8A 2RC4A 4B43A 1JGGA 1KU2A 2FSWA 1TW3A 2CH0A 4B09A 3VODA 4A2UA 2IA2A 1UG0A 2DMNA 4AU7A 3FZVA 5HVQC 3OYFA 4LOCA 4RAGA 3J81Z 2CW0F 5ED4A 3HOYJ 2FNAA 1VQKI 2M3AA 1U6GA 2AO9A 2XSJC 3LSRA 2JUGA 1SFUA 4LJZF 4RLFA 4E70A 3JRBA 2XF6A 1JKPC 4XLAA 1MGTA 2KISA 3Q0VA 1MBGA 4CCMA 3SJMA 5D4SA 1Z1DA 4HW0A 1ZRCA 4U87A 2W24A 5HOOA 1TQMA 1A04A 1WJFA 2L0KA 2V1XA 3T1BA 2K9MA 4IZZA 2DA7A 2IPQX 4BJTA 3OIPA 3GTPJ 1MBEA 5KCMA 1H9TA 3ZN0A 2A61A 2R7TA 3R0JA 3ZMTA 3L9FA 4C9YA 3BTJA 4B1RA 2DDBA 4DGWB 1I27A 3SDBA 3GTJJ 2OUMA 3CCRI 1VF9A 5FRNA 3PQJA 1SD7A 2HNHA 4RGSA 3CCQI 4PK4A 1WJAA 2R7DA 4Q48A 1LNWA 2MC4A 2JK3A 3F8CA 3LFKA 5EG0A 3VOEA 1GLNA 3ZGKA 4I98B 5JVGF 2XAQA 2MYSA 1MNMC 2W4SA 3W2WA 3IH4A 1WRJA 3M8FA 1DU0A 4BYYA 5LD2C 1JT0A 1HDPA 3U21A 4BE0A 2BXYA 5M5XJ 4IX7A 3MWMA 4PGGA 4EM1A 5K5QA 1R1VA 4V2FA 2LF8A 1IDYA 1U8RA 2W48A 3KEYA 2X6WA 3MAJA 2JRMA 2W85A 1O7LA 1PUEE 1T6SA 2KP6A 2L5QA 3RDIA 2H09A 3TO7A 1RRJA 2EFPA 2AXLA 4HF0A 2ZMEB 1OCZH 4Y17A 3DEWA 1IN6A 1JTYA 2KT0A 1RPWA 2UUZA 1LEAA 2BV6A 4I01A 3TDUC 1X1AA 4QTRA 4ASNA 3H9GA 1X2NA 3M1EA 1FOYA 1WJ5A 1X4PA 2DCEA 3KETA 4XICA 3COAC 3CJRB 4KICA 2X6YA 5DD4A 3KCCA 3CO6C 3FXRA 4LMYA 3L7WA 4KFCA 2A68F 2IS2A 3BR1A 1HF0A 3BWGA 2DT7B 2ME0A 1R1TA 2IGOA 3PL8A 4Y3OA 1HLVA 3HHGA 1ZARA 1TWAJ 2DA1A 1UHSA 1WZ2A 4HBLA 3N05A 1R6RA 2EIJH 3PSFA 1BM9A 4C3JJ 4A6EA 1TT0A 3NWTA 3S17J 4A3FJ 3HYIA 4ZTFA 1GDTA 4Q5SF 1AKHA 3L2WA 2XASA 3LFUA 2XGXA 4IHTA 2YPRA 5ERIA 3TL4X 1WVRA 5IP9J 4ETSA 3Q0WA 2A6HF 4ZYDA 3WGIA 1LKXA 2IBDA 3DEUA 2GWRA 4ANJA 3E5QA 4KMUX 4MFEA 1JHHA 1R4MB 1XSXA 4GRIA 2WWYA 4UY8I 1JGSA 3VB2A 2F5FA 1QRYA 1I3QJ 3F8NA 3O3KA 2Y0MA 2OQRA 3WTSC 1SD6A 3FKJA 3KX2A 4OAYA 4KA4A 2CU7A 2FRHA 2IGMA 5LEJA 2CQXA 2GA2A 1JUPA 4BHPA 4CZZA 3DV8A 1BR4A 2JA2A 4E4HA 1IO2A 2HWVA 1DU6A 1Z3YA 5CVRA 1UCRA 3IWFA 2LG4A 3H0DA 2RN7A 4FX0A 3VDXA 5CVJA 4HRIA 3EYYA 4BL0B 2VJ4A 2E36A 4YIRX 2BHZA 1TWFJ 2RGVA 4UUTA 1G3TA 1H0MA 3ZQHA 5E3OA 2R93J 3DU6A 1TC3C 2FOWA 1PJRA 2VKVA 3A01B 2A3SA 3K4NA 3ROUA 4QPQA 1FP1D 3BTCA 2R7UA 5H2FC 1HW2A 1HKQA 1EF4A 5CLSA 2VBXA 4HPQA 2RNGA 4H0EA 4FETA 1PUFA 3B73A 2EV6A 4PZJA 3HRTA 2QGUA 3PM1A 3RKXA 1YHQI 2Z99A 3OWTA 4BJ6C 2R5YA 4ZTJA 1QA6A 3PJRA 3BDDA 6PAXA 3L00A 3HC7A 3HGYA 3M8EA 1O3RA 4BE1A 3BR0A 2PJRB 3QPSA 2JVGA 4XIDA 3KFWX 2ZSHB 1USSA 1X4OA 2JUCA 3BPXA 2CUFA 1SD5A 5IT9K 3TW6A 4I0AA 2DT5A 2QEXI 2F6CA 1DPRA 4P96A 5B3SH 4BHCA 3HXLA 1DUXC 2QSGX 2LH9A 4V2GA 3H3VK 4IF4A 5FKMA 2QQBA 3M07A 3ISPA 2OBPA 3LQRA 3GZ6A 1BJZA 2YU3A 1U8BA 5FJ8J 1MJAA 1KA8A 2XIGA 3J80Z 1BIAA 1MJ9A 3ABKH 3RTRA 3K4LA 3V42A 1IG7A 2VKDA 2IP2A 5IY5H 4ENNA 1QPIA 4HX8A 1F36A 1KZHA 2LP0A 2F5DA 3BR6A 1FT9A 2EK5A 3P5JA 3LMMA 3LSHA 4XLPF 3OYDA 1YJWI 4LITA 3T8TA 5BOXA 1G3WA 5GTIC 1I39A 3OS1A 1H88C 3BZKA 2M87A 1XDUA 2EZIA 2ZXIA 1OCRH 1VTNC 1MJBA 1FWZA 3UKGA 1UG2A 5C4XJ 3DLAA 2Y9YA 3V4GA 1QNTA 5HS9A 2DA6A 2A6TA 3QWLA 2KDZA 1JKRC 4HA8A 2VE9A 1JJ8C 1RC9A 2KZGA 3CTAA 4DYCA 4AUXA 4PDKA 1T8IA 2E2JJ 2DFFA 2IRFG 1LVKA 1V55H 2CUEA 3DKXA 1G2HA 3CP2A 3FXUA 1HXDA 4S05A 2VUMJ 2VXZA 1Y0UA 3HBLA 1SMTA 4OMZA 2VXDA 2E5ZA 3BG6A 3MKWB 4OOIA 2ZXJA 4M73A 3M3YJ 4Y4RA 3MCZA 1APLC 2MGQA 3CJTB 2X6XA 4XRFA 5F0CA 1F4KA 1UJ8A 2UV1A 3FWEA 5FRMA 2A5YB 2MA3A 3JREA 3RI4A 4JYKA 4OIOF 2HQAA 2ZNZA 2CO5A 1S7AA 1FSHA 3C2GA 4D9JA 4HQEA 3A4CA 4PCQA 3L2UA 2ZB9A 4L9NA 3H3UA 1WCMJ 3FHZA 3CUOA 3I58A 2NVYJ 2AXTC 3RPUD 4BJ5C 3GVAA 3CCUI 3HOZJ 4KT6A 4ENJA 2PI0A 2RDPA 1LFUP 5D4RA 4BAYA 3LL7A 4G6TB 1G6NA 2JN6A 2HR3A 4B44A 2DFIA 4RM2A 2P81A 2PMHA 2IGNA 2V6CA 3H5NA 5DM6F 1W36C 4G12A 3ABMH 4FX4A 4BBSJ 3WTVC 4IQ4A 2D2WA 3VYSB 1TZLA 4XRSG 1JKOC 1QZYA 2KRCA 3BG3A 1RZ4A 3RKWA 4A0XA 4BXUA 3GTMJ 5EG0B 1F43A 4UUSA 1J2XA 1OCTC 3HDDA 1E3HA 2HQ5A 2VKHA 2CFXA 4GO1A 1MNEA 2V1NA 4A5MA 1KYWA 3PQKA 1U9OA 5LRSA 2P0WA 3OYNA 1DGRM 3ZMVA 2VODA 1VQ9I 1ZR4A 2BY1A 3FXOA 3W6JB 5K7FA 1U2WA 2XF7A 4HSRA 1B4AA 1MBKA 2NNNA 1A31A 3Q9VA 1P9QC 1NK2P 4QPOA 4R79A 4LG0A 4NC7A 1W7PA 1GVDA 4DYQA 2X0LA 3ZMZA 3Q9SA 4LB5A 5KK1A 2KIMA 2JA8J 2X48A 1K4SA 4RB1A 2DA2A 3MQ0A 2M0CA 3OSFA 1FLIA 2WC2A 2W00A 4BY1J 4XKVA 1VZ0A 1HOMA 3AG3H 3FMRA 1WJCA 3K2AA 1XTAA 2FNPA 1BBYA 2DMPA 4D1QA 3FXQA 4N9IA 4XKWA 4HX4A 5KVRA 2DO7A 1J5YA 2EILH 1IXSB 2ZXHA 1YITI 3FKIJ 1IAWA 4ZDLA 1X2MA 4PGHA 3LSGA 5CVVA 5F0FA 4U7DA 3IRQA 1A36A 3K1NA 4KMFA 4J00A 3M7GA 1TW2A 2QQ8A 4EMSA 3RCOA 2ME6A 2DODA 3ASNH 4R8HA 5CVUA 1ZR2A 2NVTJ 1AKHB 3S32A 2V9PA 3P9KA 1DGWY 1D0YA 2X51A 1OYYA 3KIOA 1WFXA 2HTJA 2PN6A 1CGPA 4AIKA 1MBJA 1FTTA 2H1KA 2QF7A 5J3LA 1O3TA 3HZJA 2QBYA 4MIMA 3LWFA 1MD0A 1ZGWA 2CUJA 2M30A 4BKXA 3IL2A 3CLQA 1QHGA 4L0YB 2W84A 3X2QH 2EQRA 1ZLKA 1WGXA 5FKNA 2XPWA 2I5UA 2K9NA 3PNTA 4G94A 2ECBA 2HPIA 4C3HJ 2VOOA 5EGOA 2GXBA 5EZGA 2UXNA 3GWZA 2DTZA 4ESFA 4XK4A 5F64A 2OTLI 3S8PA 2H6CA 3FBIB 4IRHA 3K4BA 4MLOA 2BE5F 2RVCA 2ISYA 5CVIA 3WGHA 1NH3A 4XMYA 4NDLA 4IKFA 4LLLA 1UB9A 2I10A 1P4XA 1WI9A 3ZMSA 4ZDPA 4Y13A 2JZYA 4DQ2A 2FE3A 5F27A 4YFKF 1X3WB 3S93A 3A0HC 3A03A 3GFJA 2X6OA 2R5ZA 2EZHA 1HSJA 1J7KA 2QSHX 2L02A 1QPMA 5M5YJ 2EJRA 3WG9A 4MQVA 3IAM2 2E5NA 4UB6C 2UZKA 1MW7A 1SFEA 1PUFB 2HDCA 2WAQA 3I4PA 1Y1VJ 1O3QA 3PIOF 1CF7A 5E17F 4F3QA 2QQ9A 2R5YB 2CQQA 2OAZA 4DYRA 5LHIA 2E1NA 3CUQC 1D5VA 2HDWA 5EYRA 1LDKB 3GTLJ 1U5TB 4CICA 4DIQA 2L9RA 2ID6A 2KKOA 3ZCOA 2O7OA 1FBQA 2ETHA 2QKMB 4CA0A 3IKTA 4HF2A 3L09A 1S7OA 2HDDA 4L18B 1AU7A 1I6HJ 3RKQA 2DPUA 2GLOA 4O6JA 5HDKA 2ZFUA 3HRUA 3BCBA 2LYCA 2E1MB 3GFMA 2EV5A 2QKLB 3I53A 4HAMA 4F55A 5HLGA 4KNYA 1ETYA 2A05A 5LGUA 1FOXA 5ILSA 1KGSA 4YFNF 4A3GJ 2LF7A 3QPHA 5FLXZ 2K5CA 5CYVA 5HS8A 3FM5A 3P9IA 3IC7A 2LVSA 2ELKA 4ZYEA 3ZR8X 3LAPA 3QP6A 3TP0A 1H89C 2FX0A 3SYTA 3SZTA 1BC8C 2GOXB 1ZG3A 5E1WA 4M6YA 2M4GA 3UNGC 2WBMA 5HLIA 4YEJA 1S7EA 5DD8A 1QHHD 3D5RC 4NQWA 4A69C 3OYLA 3MD2A 4C3IJ 1QBJA 2VN2A 1KQ0A 3OOPA 3C1DA 1ON1A 5CQEA 3OL4A 2ID3A 5IP6A 2LLKA 2EWNA 2P5KA 2VC1A 2QVOA 3ZQLA 4A5NA 3K1MA 3FXMA 3ZRGA 2WB1N 3SFZA 3VYRB 2DBBA 4RGXA 1RETA 2DMQA 2BXZA 4D7NA 4AIJA 1MIJA 1T2KA 1NHAA 1E3PA 4AM3A 2M9HA 1YTYA 4M9SA 3CC2I 1ZYRF 1D3YA 5BMZA 1LDDA 5JLWA 3LQQA 3TEDA 1YG2A 3CJQB 2IAIA 1XMXA 3JRDA 2Z16A 1V54H 4KITB 4XRSA 4BBRJ 2P5VA 1I6XA 4ENKA 2Y69H 2WADA 2Y30A 1K6OA 2ZKZA 1V5GA 2ZJQF 5CPRB 3GLXA 4FE7A 2V79A 3F9KA 3JAMZ 3OS0A 1HKSA 5AIQA 1FJLA 4W1UA 3KZYA 4CDGA 2BBYA 2QA4I 2LFBA 2EIMH 5TJJA 5L3BA 1GUUA 3E1SA 4XBFA 1VQPI 2VQLA 3QU3A 1PP8F 1BOAA 2IVMA 2PG4A 4G6QA 3CMMA 2P7VB 2CS3A 1IN8A 4MNUA 3IKVA 2GQQA 4DBRA 1N25A 2K40A 3S1QJ 2LY1A 3O8GA 5AONA 2NYXA 2HYGD 4I7HA 3R0AA 1XDSA 2PMUA 1MH3A 1M1EB 3TQNA 1HBXG 1DQUA 1QU3A 1TWHJ 2BY2A 1O3SA 2VJIA 2ZFWA 5BS6A 1IRGA 2XB5A 4ON0A 2IJLA 3SHFA 4ESJA 4UUSB 1WH5A 2F5VA 1X1PA 1SANA 1B9NA 2DU9A 3WGGA 2XB0X 4UVBA 4BDYA 2IT0A 2D45A 3QOEA 1FIAA 1HA8A 3G1LA 1UFMA 3S2WA 3OYGA 2K02A 4RGRA 4X1EA 3L1PA 4YIFA 2NS7A 1KU3A 2EIKH 3WE3A 2W7NA 2EINH 2E71A 2DOFA 3CCEI 2CV2A 5KNLA 3JSOA 1RIOH 1WPKA 1VQ7I 1MMAA 4LG0B 2M1BA 1W7PB 3MMYB 5LRRA 4AWXB 2LNBA 2JRTA 2V9VA 4GXOA 2XVCA 4J19A 2E35A 1HW5A 3S3OA 2MLKA 3K9TA 2E60A 4EVIA 4MEXF 4XLNF 2FMLA 4NC6A 1MKMA 4JQFA 2XKPA 3TOAA 1MMNA 1OR7A 2F48A 5IYDJ 3KZIC 2R7RA 3ZQFA 2M4KA 3CP8A 4RAFA 2DJIA 2IEKA 1LUJB 3IV5A 1BOBA 1RR7A 5DS9A 4GCVA 1B6AA 2NAZA 4AD9A 1RKTA 4JX4A 1F9NA 3FK6A 2P6SA 5LGTA 2K86A 4YRVA 3WODF 2WB1A 5GAGJ 5GAHJ 1BA5A 2L9SA 1SFXA 2L4AA 1P2FA 3C2BA 4IL6C 5M3MJ 3RQ4A 5J1RA 1EA3A 2FMYA 1S5LC 2V1DA 2TCTA 2BEOA 3GO5A 3HPGA 1YRNA 2LD5A 2NOGA 1TBXA 2RREA 5J8CA 2UWMA 3E6DA 1VQ8I 3K10A 3KP2A 3DTIA 1G4DA 1B72B 4HDVA 1T95A 4P9FA 3BJAA 5GAEJ 3A2KA 4HLXA 2DQRA 1PDNC 5LBQA 4AC0A 1YIJI 2EBIA 3HJEA 1OCPA 4MFDA 2IS4A 1A6QA 1ZQ3P 1XGOA 2QBYB 2CQ7A 3AAFA 5KAIC 3PUFA 4EM2A 2KDOA 1SAXA 2VBWA 2LKSA 4MGRA 1IGNA 2KRFA 1OQYA 2DTRA 3OMYA 4I76A 3K2ZA 3REOA 3CF5F 4EV0A 2OV7A 4WF2A 4FASD 2CQKA 5EGOB 4YG2F 1J9IA 1BN5A 3CC4I 1AOYA 3DQVC 4A3KJ 1IW7F 1OISA 4M3GA 2E2HJ 3V8LA 2YR2A 1IN7A 3KP7A 2F5EA 2FA5A 2M8GX 1HC8A 1BR1A 5HLTA 4KN4X 3HIFA 3GYHX 5FD5A 1R71A 4EQQA 3MEXA 3CUQA 2WV1A 2MABA 1T56A 4FISA 2QLZA 1T38A 4QIWN 2OPTA 1W1WE 5HLHA 3DPLC 1XG1A 3ZQIA 2ADUA 1CF7B 1USTA 4IHXA 2L01A 1OPCA 3O2PE 4E7JA 2ZJ2A 1Z6TA 5D5XB 3J80K 5C4JJ 4Y7NJ 1WJDA 3QYFA 4L5EA 1J75A 4PUSA 5B5EC 1R4NB 3WTYC 1E3OC 2NNYA 3JTGA 5BQTA 4A12A 4CCOA 2FXAA 2VOPA 4Y15A 4HV5A 3WE2A 1GVJA 4CCLA 5LFAA 1F5TA 4EM0B 2K85A 4UV8A 3U1KA 1H8AC 5ICEA 5K7HA 1MSEC 1YLFA 3Q5FA 5EEGA 1ENHA 3OS2A 2ELJA 3N97A 2ZNYA 2VC0A 2YSRA 2HGCA 1YS7A 3QRFF 2F4OB 1K79A 2HS5A 1FOWA 4PJMA 1J0RA 1D8KA 5M3FJ 2EA2A 1ZG5A 1MDMA 1OFCX 4MTDA 2BY3A 2VJ5A 1FNNA 4MHGA 1VQ4I 2B63J 3CQZJ 1BI0A 1MH4A 1ZAOA 3S15J 2LMDA 4NQWB 5JR3A 4X6AJ 5K7ZA 5ILVA 3G2BA 5IOYA 1LJ9A 1OCOH 4B4CA 4EGZA 5DV5A 3PSIA 4KIBA 1IRXA 3O8HA 2MSYA 1VQLI 3ABLH 3ZP5A 3IHUA 2Q1ZB 2E34A 3K70D 4A3IJ 2Z33A 2KL4A 2A69F 3FK7A 1FOKA 1V3FA 3NARA 5EZHA 3W3CA 5L3CA 4XLCA 3BP8A 3CCYA 2RQPA 4M9XA 3EUHC 1EH8A 3PO3J 3WTXC 4L9VA 4B47A 1R9TJ 2MLGA 2JMWA 4PFOA 2L4MA 1K4TA 5JFRA 1VQOI 1XPXA 2ECCA 4B8XA 3MN2A 1R5ID 5E3NA 3HOWJ 4C30A 2DPDA 3T0YA 2ZJRF 2IA0A 1UHMA 3MVPA 4RAYA 3F0CA 3GX4X 3ZQ7A 3CDIA 4BXFA 1IJWC 1LE8A 2GZWA 3E97A 1IXCA 3EUKL 1X1BA 2Y75A 4UVAA 4BGDA 4HYEA 2CWEA 3DXJF 2L9VA 5C3EJ 1S72I 1AA7A 2ZO4A 1SEUA 1WJBA 1W5SA 2NS8A 3H5AA 3SXYA 4XNFA 1VNDA 2XRNA 5D5VB 1U78A 5DYMA 3GTGJ 1FMVA 3OL3A 3NQOA 5LHGA 2O9LA 2PMZA 4OINF 2IS6A 3GLLA 4KJZA 4II3A 5FO5A 4WXCA 3BR3A 1BR2A 1MMDA 1R36A 2WAEA 3I9V2 1NTCA 4KIGA 1XSVA 1Y8QB 3CDHA 3BROA 3SDGA 5JVTA 2W1OA 1KU9A 5A2QK 3CCVI 2PX9A 1IDZA 2N8GA 4HF1A 1ODDA 2JVHA 3LSTA 3L2CA 2VQHA 4OIPF 4IO9F 2K27A 4RM3A 1BL0A 1T39A 3ZN1A 4A3EJ 4M3BA 2KRHA 2HVRA 1U0JA 5IT9Z 1H9GA 2DA4A 3OV8A 2ICWG 3CJNA 4A3DJ 4ZJZA 1QZZA 5HS7A 1OJLA 1IV6A 3WTTC 2V4JC 5HNFA 4DOZA 4UNOA 2DW4A 1JKQC 4B48A 2X1CA 3I54A 3C3WA 1ZRFA 3BJ6A 4ESBA 3IUOA 5ICCA 1OLTA 5E8GA 3FDYA 3F6OA 3RKYA 4I6ZA 2HPMA 2LY9A 2KFDA 3PFIA 3FMQA 3TW7A 4D5CA 2L54A 3KEQA 4IOCF 2M5WA 4LK0F 2HZDA 4HEA2 1WKMA 5L3EA 4XKCA 3BG9A 1S3JA 3KPHA 3SEZA 4RS8A 1A35A 2JT1A 4HOBA 1K78A 1BI3A 5F1RA 4CCNA 2AQEA 5E1ZB 3ULQB 3ERMA 2Z9OA 5HODA 3G6EI 3LSPA 3SZGA 4BHBA 3GBGA 2EZLA 3ZOBA 1POGA 3RPQA 3QPTA 2STWA 2EPFA 3DLLF 3HL2A 4HLYA 1STZA 3HSEA 5D8LB 4D0PA 1YRNB 3NWSA 2R7WA 1PP7U 1X19A 1VQNI 1TT5B 2WAQN 2HZTA 1Z3XA 2YS9A 3OYCA 2VQCA 2DN0A 3DBHB 2F2EA 2R3SA 4RAZA 4CCKA 2VLAA 1JJ6C 1KU7A 1YOVB 1TWGJ 5L3DA 3JR9A 3KYDB 5DUKA 1FP2A 2J5OA 2F4MB 2DK8A 4DJAA 1ETWA 1QQIA 5IT3A 2P4WA 2V1UA 2HFHA 2WV0A 1GXQA 3BC8A 5LGNA 4FT8A 4UXNA 4BUPA 2HEOA 5K5OA 1ZREA 5J1UA 5DCMA 3QP5A 2CQNA 1LEBA 1TTYA 3U9GA 4E7IA 2Q2EA 3WHBA 2R7SA 4H4KC 5GADJ 2GIZA 3JW4A 4RGUA 4TV7A 4NBQA 4HG2A 2HQNA 1Z77A 1X58A 2W57A 1W4MA 1K61A 1ORKA 2HYFA 2WAFA 4BU2A 1T98A 3QYBA 2HOSA 1IZ1A 3QOPA 3HKZA 5L3FA 2Y2ZA 4AVPA 3F3XA 4C2UA 3GUDA 3TDZC 4WWCA 1ONVA 1BC7C 2EA4A 4JX5A 3IRRA 3BJOA 1Z67A 4UVCA 4NUBA 2V7FA 3DPUA 5ICGA 3M9AA 3CUQB 2LKXA 4ZZDA 5DEQA 1P7IA 2L2OA 3J7ZI 3JRHA 3HOXJ 3RZDJ 2H6BA 3H1CA 4XRMA 1IV8A 5F0HA 2E1CA 1VI0A 1I5ZA 1YO5C 2D1VA 4G9YA 4YIIA 2MD0A 5TGTA 2CYYA 2JSCA 2AS5F 2EFQA 3L2QA 2R7OA 2H1LA 3BOQA 4ZYAA 2XGEA 3CLOA 1REPC 5LLQA 2NRAC 3HEFA 1MBFA 5FLXK 1Q1VA 4N0BA 4RMNA 2Q8KA 4E7HA 3ECHA 3PNVA 5LEKA 3KP5A 1PYVA 1Y39A 4PSXA 3GZ5A 2UXXA 5BPIA 3VFZA 4I0BA 4BQOA 1FTZA 2O8KA 4HNUA 2IXSA 2GIVA 4JX6A 1YX3A 2ESHA 3FMSA 2VONA 3KYCB 2VQGA 5FKKA 1ZK8A 1WI3A 1W0TA 2P8TA 1U3EM 1W7PD 2LREA 2G9WA 1GHCA 2XDVA 1MDMB 1FSEA 2E7WA 4CO8A 2YX7A 4S0HB 4W97A 4YELA 1XCBA 3FHNA 4XORA 2CGPA 4PJ0C 2CV1A 3K4JA 3LAJA 4BS9A 3CCSI 5EEHA 1G3SA 4XSXF 3EUHA 4HZFA 3J7AO 1JI8A 1LVAA 1R00A 1RKWA 2LC2A 3EPZA 1ACIA 3OIOA 3B6AA 1WSUA 1TQPA 3DF8A 1JT6A 4PJLA 1CQTA 3KP4A 2ACJA 4LGWA 3BR2A 4CYCA 3MKZA 3HSRA 4M71A 4U0YA 2XSDC 4G7OF 1T08B 1YW7A 2EH3A 3ECOA 4N4NB 4CSWA 1E17A 4A6DA 2DK5A 4Q4ZF 1B9MA 4BEHA 1J09A 4BDZA 2ESNA 4OAZA 3GCMA 2V6EA 2DDAA 3D1NI 1ZHFA 3JRAA 4FCYA 3CCMI 4I2OA 1FYKA 1A5JA 3OOUA 1SVOA 2VBYA 1E2XA 2K3FA 3EYIA 3CF2A 1AHDP 1LE8B 1QVTA 1E0EA 4B3XA 3FISA 3HOSA 1IF1A 2Y48A 3T5XA
chains in the Genus database with same CATH topology
2YX4A 5DCFA 2MBFA 3F8FA 4KN7X 1KQ8A 2EFNA 1S8NA 3EDPA 4HV6A 1L0OC 1Q1HA 2XAFA 5FD6A 3J81K 2QQAA 4KYWA 1RI7A 2EV0A 1ZH5A 5J6XA 1R5HA 2M45A 2GA1A 3E5XA 3F8MA 2G7UA 1G3YA 4UUVA 1R22A 2QM3A 1U5TC 3WU1B 4O3MA 1XMAA 2OZUA 4DNCA 2CSOA 1EH6A 4WK8F 1EV7A 3WTUC 5DDGA 1OMIA 1ZN2A 2PFBA 4LD5A 4S04A 1D8JA 3W6KB 2HKXA 4I02A 2Q0OA 4K2EA 4A0ZA 3HTSB 1K78B 3JTHA 1OYIA 1FZPB 3C7JA 1XN7A 2STTA 2ELHA 1W5TA 2D1HA 3HUGA 4KUMA 1XB4A 5BPDA 5F6FA 2O3FA 4ZH4F 4G6DA 3G73A 3F72A 2HKOA 3ZMUA 4L5IA 1UHWA 1B1BA 3F21A 2WTEA 3NEUA 2F5CA 2MH2A 3EQLF 3K1PA 3K69A 5DCMB 1R58A 2GAUA 2W25A 3HHHA 2LKPA 2PEXA 4IRIA 1P92A 1BJAA 4I09A 3E5UA 4L5JA 1QGPA 4L0ZB 3EETA 3I59A 1Z6RA 2A6EF 2XV4S 4RB2C 3B02A 2P5LC 1TNSA 5HDNA 4IRGA 1LB2A 2H94A 1XGNA 3TO9A 5D5UB 2XKOA 1LQ1A 1XGSA 4M72A 4A0YA 2MH9A 1YYVA 4ENMA 2K4JA 4IVNA 2CG4A 2VE8A 1IN5A 1I1SA 4HX7A 1OKRA 3RIRA 3R60A 4LLGF 3TGNA 2K4BA 2FBKA 1BI1A 2PBIA 3SQNA 4WCGA 1FBSA 3ERED 1K7AA 4MTEA 2VBZA 5FB2A 4Z2YA 3ZPLA 3HOTA 4M6XA 4P9UA 4EJTA 4WXDA 3RYPA 2XAHA 4JK1X 2KJBA 1JHFA 4F7ZA 2O6GE 3V7CA 5E8IA 1YW9A 3MFKA 3ABTA 3KZZA 1P4AA 3C18A 4N9HA 2IW5A 4U0WA 1YW8A 3KEOA 3GXOA 4EGYA 3I71A 1RUOA 3U1DA 2K7LA 5D5WB 4P55A 1V4RA 2JTVA 3ZMDA 4MEYF 2DLLA 1JE8A 3G3ZA 4KIFA 1IUYA 4UV9A 1ZG1A 4IPAA 4EJWA 2QWWA 4HQMA 1HSTA 3D5LA 3DP7A 2VT3A 3RPUA 4LLNA 1C0WA 5FGMA 3GFLA 1U5TA 1IN4A 1YQAA 3RYRA 1Z7UA 1OYWA 3V8KA 2ISZA 1ON2A 2EB7A 4EJUA 1L3LA 4OIRF 1RUNA 4G8XA 3GF2A 4LK1F 4ZYHA 4IXAA 2BGCA 5L3GA 3RJPA 3TOBA 3N4MA 2G7HA 3DFGA 2MD5A 3FF5A 3F6VA 4NB5A 3HRMA 1I1GA 2XROA 2OQGA 1FYLA 5D6FA 3KP3A 2ZBKA 4R1HA 3E6BA 1HQCA 2M8EA 4CYDA 1FY7A 4GGGA 3MZHA 1AWCA 3ML6A 4HDUA 2PQ8A 3D0SA 1IXRC 2FBIA 4FHTA 2HOEA 4ZYGA 1SD4A 3E3VA 1YIOA 2PLYA 1O7FA 2FU4A 1J59A 1HW1A 1YS6A 5DUIA 1TNTA 3GW2A 4OIQF 2FF4A 5D6EA 2ZCWA 1R7JA 2PJPA 2RKHA 2LDUA 3F22A 3BY6A 2GXGA 3NRVA 4CXFA 2B0LA 4GYIA 1R1UA 1EH7A 2C6YA 3R4KA 1IRFA 4OU0A 3O6BB 3I59B 2XAGA 2JPBA 5K5RA 3IWZA 3E6MA 3I64A 2XAJA 4L9JA 2P6TA 3SZPA 3QAHA 1XGMA 2OU2A 5CJ9A 4U7BA 1TQIA 2RNJA 5TRDA 2FBHA 3HRSA 5A2QZ 2KIFA 1XD7A 5HDGA 5E20A 4LB6B 1DP7P 1R5GA 1YFHA 1QO0D 5ICFA 1Z05A 1GXPA 4BQAA 2E7XA 2LSOA 2HTSA 4EJOA 2FOKA 5E18F 1FYMA 4AIHA 4BNCA 3ELKA 2OA4A 4RB3C 3TO6A 1F1ZA 1BIBA 1XCVA 4QLCU 3FX3A 1WQ2A 2FQ3A 1S29A 3T8RA 1XSDA 3LA7A 1S6LA 2H27A 1KYZA 5D8KB 5H20A 2ZMEA 3R61A 3KLOA 3DKWA 1P4WA 4Q47A 2O03A 3QU6A 3KP6A 1DDNA 2P7CB 4MQ9F 5JI6A 1TLHB 3I0TA 1ULYA 3BPVA 3I5UA 1X3UA 4QWQA 2COMA 3H92A 2RV8A 4M9ZA 1ZRDA 1ZGAA 3TKYA 1JXSA 1LDJA 4M74A 5E1XA 2O8XA 3LA2A 1KQ9A 5ILUA 3P7NA 4KDPA 2FEZA 1P6RA 4JBAA 3CO7C 3WU0A 2EFOA 5JHUA 1ZGJA 4CHUA 4ZZLA 3F8BA 1O57A 3VEPA 3JAMK 4WXHA 2NS0A 1ZLJA 4YFXF 4RB0A 1BI2A 2TDXA 3JSPA 5H6QA 1T0FA 2MC3A 3U2RA 4WX9A 2J5PA 4EJVA 5H6RA 3WTWC 4U88A 2QUFA 3K0LA 2O0YA 2OD5A 2DAOA 3FM3A 2X4HA 3R6SA 3P9CA 1SMYF 1FX7A 3MZYA 5FFXA 2DQLA 4CGZA 4U0VA 5LHHA 1MZBA 2VT2A 4LFUA 5K1YA 3V7SA 2DI3A 2Z5UA 2BYVE 1HKTA 4XSZF 2HQRA 1FPQA 3V7RA 4UHTA 4GYGA 4L9TA 1R23A 1XMKA 3HTUA 2IA1A 3HSFA 2QZ8A 4OMYA 4NHJA 2OZ6A 4O5VA 2KJCA 2QYOA 2L3DA 3KLNA 2Z3YA 2XHKA 4BH9A 5AIPA 1FC3A 1B59A 2A07F 3BZ6A 1RNLA 3GEZA 1Z9CA 4G7ZF 4G7HF 3F23A 3LA3A 2R7FA 3WTZA 2XUBA 3E6CC 2KIUA 3KE2A 4IJAA 1WWXA 3ABUA 3V8JA 4P5OA 3GFIA 2QENA 2EFWA 4IHSA 3DPTA 5FFZA 1DPUA 2JPCA 4KT5C 1FBUA 5J8FA 2O61A 3H3ZA 1Z91A 2RC4A 1KU2A 2FSWA 1TW3A 4B09A 3VODA 4A2UA 2IA2A 3FZVA 5HVQC 3J81Z 2CW0F 5ED4A 2FNAA 1U6GA 1SFUA 4LJZF 4E70A 1MGTA 5D4SA 1Z1DA 4HW0A 1ZRCA 2W24A 5HOOA 1TQMA 1A04A 2V1XA 3T1BA 2IPQX 1H9TA 3ZN0A 2A61A 3R0JA 3ZMTA 3L9FA 1I27A 3PQJA 1SD7A 4RGSA 2R7DA 4Q48A 1LNWA 3F8CA 3LFKA 3VOEA 4I98B 2XAQA 1WRJA 3M8FA 4BYYA 3MWMA 4PGGA 4EM1A 5K5QA 1R1VA 2LF8A 1U8RA 3MAJA 2W85A 1O7LA 1PUEE 1T6SA 3RDIA 2H09A 3TO7A 2EFPA 2AXLA 4HF0A 2ZMEB 4Y17A 1IN6A 1LEAA 2BV6A 4I01A 3TDUC 4ASNA 3M1EA 3KETA 3COAC 4KICA 5DD4A 3KCCA 3CO6C 3FXRA 4LMYA 3L7WA 4KFCA 2A68F 3BWGA 1R1TA 3HHGA 1ZARA 4HBLA 1BM9A 4A6EA 3HYIA 4Q5SF 2XASA 2XGXA 4IHTA 2YPRA 5ERIA 4ETSA 2A6HF 4ZYDA 3WGIA 3DEUA 2GWRA 3E5QA 4KMUX 1JHHA 1XSXA 2WWYA 1JGSA 3VB2A 2F5FA 3F8NA 3O3KA 2Y0MA 2OQRA 3WTSC 1SD6A 4KA4A 2FRHA 5LEJA 2GA2A 4BHPA 4CZZA 3DV8A 2HWVA 5CVRA 1UCRA 3IWFA 2RN7A 4FX0A 5CVJA 3EYYA 2RGVA 1H0MA 1G3TA 2A3SA 3ROUA 1FP1D 1HW2A 1HKQA 5CLSA 2VBXA 4H0EA 3B73A 2EV6A 4PZJA 3HRTA 3RKXA 2Z99A 3BDDA 6PAXA 3L00A 1O3RA 3M8EA 3KFWX 1USSA 3BPXA 1SD5A 5IT9K 4I0AA 2DT5A 1DPRA 4P96A 4BHCA 1DUXC 4IF4A 2QQBA 3ISPA 2OBPA 3LQRA 3GZ6A 2YU3A 1MJAA 1KA8A 2XIGA 3J80Z 1BIAA 1MJ9A 3RTRA 2IP2A 4ENNA 4HX8A 2F5DA 1FT9A 2EK5A 4XLPF 3T8TA 5BOXA 1G3WA 2M87A 1XDUA 1VTNC 1MJBA 1FWZA 3V4GA 1QNTA 5HS9A 4HA8A 2VE9A 3CTAA 4PDKA 2IRFG 3FXUA 1HXDA 4S05A 2VXZA 1Y0UA 1SMTA 4OMZA 4OOIA 2ZXJA 4M73A 3MCZA 4XRFA 1F4KA 3FWEA 2A5YB 2MA3A 3RI4A 4OIOF 2ZNZA 2CO5A 1S7AA 1FSHA 4HQEA 4PCQA 4L9NA 3H3UA 3FHZA 3CUOA 3I58A 3GVAA 4ENJA 2PI0A 2RDPA 5D4RA 4BAYA 1G6NA 2HR3A 2DFIA 2PMHA 2V6CA 4FX4A 3WTVC 2D2WA 1QZYA 3RKWA 4A0XA 1RZ4A 4BXUA 1J2XA 2CFXA 4GO1A 4A5MA 1KYWA 3PQKA 5LRSA 2VODA 3ZMVA 3W6JB 1U2WA 1B4AA 2NNNA 3Q9VA 4R79A 4LG0A 1W7PA 2X0LA 3ZMZA 3Q9SA 4LB5A 5KK1A 2KIMA 4RB1A 3MQ0A 1FLIA 2WC2A 3FMRA 2FNPA 1BBYA 3FXQA 4N9IA 4HX4A 5KVRA 2DO7A 1J5YA 1IXSB 1IAWA 4PGHA 5CVVA 4U7DA 3IRQA 3K1NA 4KMFA 3M7GA 1TW2A 4EMSA 4R8HA 5CVUA 3P9KA 1OYYA 2HTJA 2PN6A 1CGPA 4AIKA 1O3TA 2QBYA 3LWFA 1MD0A 2M30A 3IL2A 4L0YB 2W84A 1ZLKA 4G94A 2VOOA 2GXBA 2UXNA 3GWZA 4ESFA 5F64A 3WGHA 2H6CA 4IRHA 5CVIA 2BE5F 2RVCA 2ISYA 4LLLA 1UB9A 1P4XA 1WI9A 3ZMSA 4Y13A 2JZYA 4DQ2A 2FE3A 4YFKF 3GFJA 1HSJA 1J7KA 2L02A 1QPMA 2EJRA 3WG9A 4MQVA 2UZKA 1SFEA 2HDCA 3I4PA 1O3QA 1CF7A 5E17F 2QQ9A 2OAZA 5LHIA 2E1NA 3CUQC 1D5VA 1LDKB 1U5TB 4CICA 2KKOA 1FBQA 2ETHA 3IKTA 4HF2A 3L09A 1S7OA 4L18B 2DPUA 4O6JA 5HDKA 3HRUA 3GFMA 2EV5A 3I53A 4HAMA 4KNYA 5HLGA 5LGUA 5ILSA 1KGSA 4YFNF 2LF7A 3QPHA 5FLXZ 5CYVA 5HS8A 3FM5A 3P9IA 3IC7A 4ZYEA 3LAPA 3QP6A 3SZTA 1BC8C 1ZG3A 5E1WA 4M6YA 5HLIA 5DD8A 4NQWA 1QBJA 2VN2A 1KQ0A 3OOPA 3C1DA 1ON1A 2EWNA 2P5KA 2VC1A 2QVOA 4A5NA 3K1MA 3SFZA 2DBBA 4RGXA 4AIJA 1T2KA 1NHAA 1YTYA 4M9SA 1ZYRF 1D3YA 5BMZA 1LDDA 3LQQA 1YG2A 2P5VA 1I6XA 4ENKA 1K6OA 2ZKZA 3GLXA 2V79A 3JAMZ 1HKSA 5AIQA 3KZYA 4CDGA 2BBYA 5TJJA 5L3BA 1PP8F 4XBFA 3QU3A 1BOAA 2IVMA 2PG4A 4G6QA 2P7VB 4MNUA 1IN8A 3IKVA 2GQQA 5AONA 2NYXA 2HYGD 4I7HA 3R0AA 1XDSA 2PMUA 3TQNA 1HBXG 1O3SA 2ZFWA 5BS6A 1IRGA 4ON0A 2IJLA 3SHFA 4ESJA 1B9NA 2DU9A 3WGGA 4UVBA 2IT0A 2D45A 1UFMA 3S2WA 2K02A 4RGRA 4YIFA 1KU3A 3WE3A 3JSOA 1RIOH 4LG0B 2M1BA 1W7PB 5LRRA 4AWXB 2LNBA 2JRTA 2V9VA 4GXOA 2XVCA 1HW5A 2MLKA 3K9TA 4EVIA 4MEXF 4XLNF 2FMLA 1MKMA 4JQFA 2XKPA 3TOAA 1OR7A 4GCVA 1B6AA 2NAZA 4AD9A 1F9NA 5LGTA 2P6SA 2K86A 3WODF 1SFXA 2L4AA 1P2FA 2FMYA 2V1DA 2BEOA 3GO5A 2UWMA 1TBXA 5J8CA 3E6DA 3KP2A 1G4DA 4HDVA 4P9FA 3BJAA 4HLXA 2DQRA 1PDNC 5LBQA 1XGOA 2QBYB 3AAFA 4EM2A 1SAXA 2VBWA 4MGRA 2KRFA 2DTRA 3K2ZA 3REOA 4EV0A 4WF2A 2CQKA 4YG2F 1J9IA 1BN5A 1AOYA 3DQVC 1IW7F 3V8LA 2YR2A 1IN7A 3KP7A 2F5EA 2FA5A 4KN4X 3HIFA 3GYHX 5FD5A 4EQQA 3MEXA 3CUQA 2QLZA 1T38A 5HLHA 3DPLC 2ADUA 1CF7B 1USTA 2L01A 1OPCA 3O2PE 2ZJ2A 1Z6TA 5D5XB 3J80K 1J75A 3WTYC 2NNYA 3JTGA 5BQTA 4A12A 2FXAA 2VOPA 4Y15A 4HV5A 3WE2A 1GVJA 1F5TA 4EM0B 4UV8A 5ICEA 1YLFA 3Q5FA 5EEGA 3N97A 2ZNYA 2VC0A 2YSRA 2HGCA 1YS7A 3QRFF 1K79A 2HS5A 1J0RA 1D8KA 2EA2A 1ZG5A 1MDMA 4MTDA 4MHGA 1FNNA 1BI0A 1ZAOA 5JR3A 5ILVA 1LJ9A 4EGZA 5DV5A 4KIBA 3ZP5A 3IHUA 2Z33A 2A69F 1FOKA 1V3FA 5L3CA 3BP8A 2RQPA 4M9XA 1EH8A 3WTXC 4L9VA 2MLGA 2L4MA 5JFRA 4B8XA 2DPDA 3T0YA 2IA0A 1UHMA 4RAYA 3GX4X 3ZQ7A 2GZWA 3E97A 1IXCA 4UVAA 2Y75A 4HYEA 2CWEA 3DXJF 2ZO4A 1W5SA 3SXYA 2XRNA 5D5VB 1U78A 5DYMA 3NQOA 5LHGA 4OINF 5FO5A 4WXCA 1R36A 4KIGA 1XSVA 3CDHA 3BROA 5JVTA 1KU9A 5A2QK 4HF1A 1ODDA 3LSTA 3L2CA 4OIPF 2K27A 1T39A 3ZN1A 5IT9Z 1H9GA 3OV8A 3CJNA 1QZZA 5HS7A 3WTTC 4UNOA 2DW4A 3I54A 3C3WA 1ZRFA 3BJ6A 4ESBA 5ICCA 5E8GA 3F6OA 3RKYA 3PFIA 3FMQA 2L54A 3KEQA 2M5WA 4LK0F 1WKMA 5L3EA 1S3JA 4RS8A 2JT1A 4HOBA 1K78A 1BI3A 5F1RA 5E1ZB 3ULQB 2Z9OA 4BHBA 3RPQA 3QPTA 2STWA 4HLYA 1STZA 3HSEA 5D8LB 4D0PA 1PP7U 2HZTA 2F2EA 2R3SA 4RAZA 1KU7A 5L3DA 5DUKA 1FP2A 2J5OA 2DK8A 1QQIA 5IT3A 2P4WA 2V1UA 2HFHA 2WV0A 1GXQA 5LGNA 4FT8A 4UXNA 2HEOA 5K5OA 1ZREA 5DCMA 3QP5A 1LEBA 1TTYA 3U9GA 2Q2EA 3JW4A 4RGUA 4TV7A 2HQNA 2W57A 1W4MA 2HYFA 1T98A 1IZ1A 3QOPA 5L3FA 4AVPA 3F3XA 3GUDA 3TDZC 4WWCA 1ONVA 1BC7C 2EA4A 3IRRA 3BJOA 4UVCA 5ICGA 3M9AA 3CUQB 4ZZDA 5DEQA 2H6BA 2E1CA 1I5ZA 1YO5C 2D1VA 4G9YA 4YIIA 2CYYA 2JSCA 2AS5F 2EFQA 3BOQA 3CLOA 1REPC 5LLQA 2NRAC 5FLXK 4N0BA 2Q8KA 3ECHA 5LEKA 3KP5A 3GZ5A 2UXXA 5BPIA 3VFZA 4I0BA 2GIVA 2ESHA 3FMSA 2VONA 2P8TA 1U3EM 1W7PD 2G9WA 1GHCA 1MDMB 1FSEA 2E7WA 4CO8A 2YX7A 2CGPA 1XCBA 3LAJA 5EEHA 1G3SA 4XSXF 3EUHA 4HZFA 3J7AO 1LVAA 1R00A 1WSUA 1TQPA 3DF8A 3KP4A 2ACJA 4LGWA 3HSRA 4M71A 4U0YA 4G7OF 1E17A 1YW7A 3ECOA 4A6DA 2DK5A 4Q4ZF 1B9MA 2ESNA 1ZHFA 4I2OA 1FYKA 2VBYA 1E2XA 3EYIA 3HOSA 1IF1A 2Y48A 3T5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YX4 A;  5DCF A;  2MBF A;  3F8F A;  4KN7 X;  1KQ8 A;  2EFN A;  1S8N A;  3EDP A;  4HV6 A;  1L0O C;  1Q1H A;  2XAF A;  5FD6 A;  3J81 K;  2QQA A;  4KYW A;  1RI7 A;  2EV0 A;  1ZH5 A;  5J6X A;  1R5H A;  2M45 A;  2GA1 A;  3E5X A;  3F8M A;  2G7U A;  1G3Y A;  4UUV A;  1R22 A;  2QM3 A;  1U5T C;  3WU1 B;  4O3M A;  1XMA A;  2OZU A;  4DNC A;  2CSO A;  1EH6 A;  4WK8 F;  1EV7 A;  3WTU C;  5DDG A;  1OMI A;  1ZN2 A;  2PFB A;  4LD5 A;  4S04 A;  1D8J A;  3W6K B;  2HKX A;  4I02 A;  2Q0O A;  4K2E A;  4A0Z A;  3HTS B;  1K78 B;  3JTH A;  1OYI A;  1FZP B;  3C7J A;  1XN7 A;  2STT A;  2ELH A;  1W5T A;  2D1H A;  3HUG A;  4KUM A;  1XB4 A;  5BPD A;  5F6F A;  2O3F A;  4ZH4 F;  4G6D A;  3G73 A;  3F72 A;  2HKO A;  3ZMU A;  4L5I A;  1UHW A;  1B1B A;  3F21 A;  2WTE A;  3NEU A;  2F5C A;  2MH2 A;  3EQL F;  3K1P A;  3K69 A;  5DCM B;  1R58 A;  2GAU A;  2W25 A;  3HHH A;  2LKP A;  2PEX A;  4IRI A;  1P92 A;  1BJA A;  4I09 A;  3E5U A;  4L5J A;  1QGP A;  4L0Z B;  3EET A;  3I59 A;  1Z6R A;  2A6E F;  2XV4 S;  4RB2 C;  3B02 A;  2P5L C;  1TNS A;  5HDN A;  4IRG A;  1LB2 A;  2H94 A;  1XGN A;  3TO9 A;  5D5U B;  2XKO A;  1LQ1 A;  1XGS A;  4M72 A;  4A0Y A;  2MH9 A;  1YYV A;  4ENM A;  2K4J A;  4IVN A;  2CG4 A;  2VE8 A;  1IN5 A;  1I1S A;  4HX7 A;  1OKR A;  3RIR A;  3R60 A;  4LLG F;  3TGN A;  2K4B A;  2FBK A;  1BI1 A;  2PBI A;  3SQN A;  4WCG A;  1FBS A;  3ERE D;  1K7A A;  4MTE A;  2VBZ A;  5FB2 A;  4Z2Y A;  3ZPL A;  3HOT A;  4M6X A;  4P9U A;  4EJT A;  4WXD A;  3RYP A;  2XAH A;  4JK1 X;  2KJB A;  1JHF A;  4F7Z A;  2O6G E;  3V7C A;  5E8I A;  1YW9 A;  3MFK A;  3ABT A;  3KZZ A;  1P4A A;  3C18 A;  4N9H A;  2IW5 A;  4U0W A;  1YW8 A;  3KEO A;  3GXO A;  4EGY A;  3I71 A;  1RUO A;  3U1D A;  2K7L A;  5D5W B;  4P55 A;  1V4R A;  2JTV A;  3ZMD A;  4MEY F;  2DLL A;  1JE8 A;  3G3Z A;  4KIF A;  1IUY A;  4UV9 A;  1ZG1 A;  4IPA A;  4EJW A;  2QWW A;  4HQM A;  1HST A;  3D5L A;  3DP7 A;  2VT3 A;  3RPU A;  4LLN A;  1C0W A;  5FGM A;  3GFL A;  1U5T A;  1IN4 A;  1YQA A;  3RYR A;  1Z7U A;  1OYW A;  3V8K A;  2ISZ A;  1ON2 A;  2EB7 A;  4EJU A;  1L3L A;  4OIR F;  1RUN A;  4G8X A;  3GF2 A;  4LK1 F;  4ZYH A;  4IXA A;  2BGC A;  5L3G A;  3RJP A;  3TOB A;  3N4M A;  2G7H A;  3DFG A;  2MD5 A;  3FF5 A;  3F6V A;  4NB5 A;  3HRM A;  1I1G A;  2XRO A;  2OQG A;  1FYL A;  5D6F A;  3KP3 A;  2ZBK A;  4R1H A;  3E6B A;  1HQC A;  2M8E A;  4CYD A;  1FY7 A;  4GGG A;  3MZH A;  1AWC A;  3ML6 A;  4HDU A;  2PQ8 A;  3D0S A;  1IXR C;  2FBI A;  4FHT A;  2HOE A;  4ZYG A;  1SD4 A;  3E3V A;  1YIO A;  2PLY A;  1O7F A;  2FU4 A;  1J59 A;  1HW1 A;  1YS6 A;  5DUI A;  1TNT A;  3GW2 A;  4OIQ F;  2FF4 A;  5D6E A;  2ZCW A;  1R7J A;  2PJP A;  2RKH A;  2LDU A;  3F22 A;  3BY6 A;  2GXG A;  3NRV A;  4CXF A;  2B0L A;  4GYI A;  1R1U A;  1EH7 A;  2C6Y A;  3R4K A;  1IRF A;  4OU0 A;  3O6B B;  3I59 B;  2XAG A;  2JPB A;  5K5R A;  3IWZ A;  3E6M A;  3I64 A;  2XAJ A;  4L9J A;  2P6T A;  3SZP A;  3QAH A;  1XGM A;  2OU2 A;  5CJ9 A;  4U7B A;  1TQI A;  2RNJ A;  5TRD A;  2FBH A;  3HRS A;  5A2Q Z;  2KIF A;  1XD7 A;  5HDG A;  5E20 A;  4LB6 B;  1DP7 P;  1R5G A;  1YFH A;  1QO0 D;  5ICF A;  1Z05 A;  1GXP A;  4BQA A;  2E7X A;  2LSO A;  2HTS A;  4EJO A;  2FOK A;  5E18 F;  1FYM A;  4AIH A;  4BNC A;  3ELK A;  2OA4 A;  4RB3 C;  3TO6 A;  1F1Z A;  1BIB A;  1XCV A;  4QLC U;  3FX3 A;  1WQ2 A;  2FQ3 A;  1S29 A;  3T8R A;  1XSD A;  3LA7 A;  1S6L A;  2H27 A;  1KYZ A;  5D8K B;  5H20 A;  2ZME A;  3R61 A;  3KLO A;  3DKW A;  1P4W A;  4Q47 A;  2O03 A;  3QU6 A;  3KP6 A;  1DDN A;  2P7C B;  4MQ9 F;  5JI6 A;  1TLH B;  3I0T A;  1ULY A;  3BPV A;  3I5U A;  1X3U A;  4QWQ A;  2COM A;  3H92 A;  2RV8 A;  4M9Z A;  1ZRD A;  1ZGA A;  3TKY A;  1JXS A;  1LDJ A;  4M74 A;  5E1X A;  2O8X A;  3LA2 A;  1KQ9 A;  5ILU A;  3P7N A;  4KDP A;  2FEZ A;  1P6R A;  4JBA A;  3CO7 C;  3WU0 A;  2EFO A;  5JHU A;  1ZGJ A;  4CHU A;  4ZZL A;  3F8B A;  1O57 A;  3VEP A;  3JAM K;  4WXH A;  2NS0 A;  1ZLJ A;  4YFX F;  4RB0 A;  1BI2 A;  2TDX A;  3JSP A;  5H6Q A;  1T0F A;  2MC3 A;  3U2R A;  4WX9 A;  2J5P A;  4EJV A;  5H6R A;  3WTW C;  4U88 A;  2QUF A;  3K0L A;  2O0Y A;  2OD5 A;  2DAO A;  3FM3 A;  2X4H A;  3R6S A;  3P9C A;  1SMY F;  1FX7 A;  3MZY A;  5FFX A;  2DQL A;  4CGZ A;  4U0V A;  5LHH A;  1MZB A;  2VT2 A;  4LFU A;  5K1Y A;  3V7S A;  2DI3 A;  2Z5U A;  2BYV E;  1HKT A;  4XSZ F;  2HQR A;  1FPQ A;  3V7R A;  4UHT A;  4GYG A;  4L9T A;  1R23 A;  1XMK A;  3HTU A;  2IA1 A;  3HSF A;  2QZ8 A;  4OMY A;  4NHJ A;  2OZ6 A;  4O5V A;  2KJC A;  2QYO A;  2L3D A;  3KLN A;  2Z3Y A;  2XHK A;  4BH9 A;  5AIP A;  1FC3 A;  1B59 A;  2A07 F;  3BZ6 A;  1RNL A;  3GEZ A;  1Z9C A;  4G7Z F;  4G7H F;  3F23 A;  3LA3 A;  2R7F A;  3WTZ A;  2XUB A;  3E6C C;  2KIU A;  3KE2 A;  4IJA A;  1WWX A;  3ABU A;  3V8J A;  4P5O A;  3GFI A;  2QEN A;  2EFW A;  4IHS A;  3DPT A;  5FFZ A;  1DPU A;  2JPC A;  4KT5 C;  1FBU A;  5J8F A;  2O61 A;  3H3Z A;  1Z91 A;  2RC4 A;  1KU2 A;  2FSW A;  1TW3 A;  4B09 A;  3VOD A;  4A2U A;  2IA2 A;  3FZV A;  5HVQ C;  3J81 Z;  2CW0 F;  5ED4 A;  2FNA A;  1U6G A;  1SFU A;  4LJZ F;  4E70 A;  1MGT A;  5D4S A;  1Z1D A;  4HW0 A;  1ZRC A;  2W24 A;  5HOO A;  1TQM A;  1A04 A;  2V1X A;  3T1B A;  2IPQ X;  1H9T A;  3ZN0 A;  2A61 A;  3R0J A;  3ZMT A;  3L9F A;  1I27 A;  3PQJ A;  1SD7 A;  4RGS A;  2R7D A;  4Q48 A;  1LNW A;  3F8C A;  3LFK A;  3VOE A;  4I98 B;  2XAQ A;  1WRJ A;  3M8F A;  4BYY A;  3MWM A;  4PGG A;  4EM1 A;  5K5Q A;  1R1V A;  2LF8 A;  1U8R A;  3MAJ A;  2W85 A;  1O7L A;  1PUE E;  1T6S A;  3RDI A;  2H09 A;  3TO7 A;  2EFP A;  2AXL A;  4HF0 A;  2ZME B;  4Y17 A;  1IN6 A;  1LEA A;  2BV6 A;  4I01 A;  3TDU C;  4ASN A;  3M1E A;  3KET A;  3COA C;  4KIC A;  5DD4 A;  3KCC A;  3CO6 C;  3FXR A;  4LMY A;  3L7W A;  4KFC A;  2A68 F;  3BWG A;  1R1T A;  3HHG A;  1ZAR A;  4HBL A;  1BM9 A;  4A6E A;  3HYI A;  4Q5S F;  2XAS A;  2XGX A;  4IHT A;  2YPR A;  5ERI A;  4ETS A;  2A6H F;  4ZYD A;  3WGI A;  3DEU A;  2GWR A;  3E5Q A;  4KMU X;  1JHH A;  1XSX A;  2WWY A;  1JGS A;  3VB2 A;  2F5F A;  3F8N A;  3O3K A;  2Y0M A;  2OQR A;  3WTS C;  1SD6 A;  4KA4 A;  2FRH A;  5LEJ A;  2GA2 A;  4BHP A;  4CZZ A;  3DV8 A;  2HWV A;  5CVR A;  1UCR A;  3IWF A;  2RN7 A;  4FX0 A;  5CVJ A;  3EYY A;  2RGV A;  1H0M A;  1G3T A;  2A3S A;  3ROU A;  1FP1 D;  1HW2 A;  1HKQ A;  5CLS A;  2VBX A;  4H0E A;  3B73 A;  2EV6 A;  4PZJ A;  3HRT A;  3RKX A;  2Z99 A;  3BDD A;  6PAX A;  3L00 A;  1O3R A;  3M8E A;  3KFW X;  1USS A;  3BPX A;  1SD5 A;  5IT9 K;  4I0A A;  2DT5 A;  1DPR A;  4P96 A;  4BHC A;  1DUX C;  4IF4 A;  2QQB A;  3ISP A;  2OBP A;  3LQR A;  3GZ6 A;  2YU3 A;  1MJA A;  1KA8 A;  2XIG A;  3J80 Z;  1BIA A;  1MJ9 A;  3RTR A;  2IP2 A;  4ENN A;  4HX8 A;  2F5D A;  1FT9 A;  2EK5 A;  4XLP F;  3T8T A;  5BOX A;  1G3W A;  2M87 A;  1XDU A;  1VTN C;  1MJB A;  1FWZ A;  3V4G A;  1QNT A;  5HS9 A;  4HA8 A;  2VE9 A;  3CTA A;  4PDK A;  2IRF G;  3FXU A;  1HXD A;  4S05 A;  2VXZ A;  1Y0U A;  1SMT A;  4OMZ A;  4OOI A;  2ZXJ A;  4M73 A;  3MCZ A;  4XRF A;  1F4K A;  3FWE A;  2A5Y B;  2MA3 A;  3RI4 A;  4OIO F;  2ZNZ A;  2CO5 A;  1S7A A;  1FSH A;  4HQE A;  4PCQ A;  4L9N A;  3H3U A;  3FHZ A;  3CUO A;  3I58 A;  3GVA A;  4ENJ A;  2PI0 A;  2RDP A;  5D4R A;  4BAY A;  1G6N A;  2HR3 A;  2DFI A;  2PMH A;  2V6C A;  4FX4 A;  3WTV C;  2D2W A;  1QZY A;  3RKW A;  4A0X A;  1RZ4 A;  4BXU A;  1J2X A;  2CFX A;  4GO1 A;  4A5M A;  1KYW A;  3PQK A;  5LRS A;  2VOD A;  3ZMV A;  3W6J B;  1U2W A;  1B4A A;  2NNN A;  3Q9V A;  4R79 A;  4LG0 A;  1W7P A;  2X0L A;  3ZMZ A;  3Q9S A;  4LB5 A;  5KK1 A;  2KIM A;  4RB1 A;  3MQ0 A;  1FLI A;  2WC2 A;  3FMR A;  2FNP A;  1BBY A;  3FXQ A;  4N9I A;  4HX4 A;  5KVR A;  2DO7 A;  1J5Y A;  1IXS B;  1IAW A;  4PGH A;  5CVV A;  4U7D A;  3IRQ A;  3K1N A;  4KMF A;  3M7G A;  1TW2 A;  4EMS A;  4R8H A;  5CVU A;  3P9K A;  1OYY A;  2HTJ A;  2PN6 A;  1CGP A;  4AIK A;  1O3T A;  2QBY A;  3LWF A;  1MD0 A;  2M30 A;  3IL2 A;  4L0Y B;  2W84 A;  1ZLK A;  4G94 A;  2VOO A;  2GXB A;  2UXN A;  3GWZ A;  4ESF A;  5F64 A;  3WGH A;  2H6C A;  4IRH A;  5CVI A;  2BE5 F;  2RVC A;  2ISY A;  4LLL A;  1UB9 A;  1P4X A;  1WI9 A;  3ZMS A;  4Y13 A;  2JZY A;  4DQ2 A;  2FE3 A;  4YFK F;  3GFJ A;  1HSJ A;  1J7K A;  2L02 A;  1QPM A;  2EJR A;  3WG9 A;  4MQV A;  2UZK A;  1SFE A;  2HDC A;  3I4P A;  1O3Q A;  1CF7 A;  5E17 F;  2QQ9 A;  2OAZ A;  5LHI A;  2E1N A;  3CUQ C;  1D5V A;  1LDK B;  1U5T B;  4CIC A;  2KKO A;  1FBQ A;  2ETH A;  3IKT A;  4HF2 A;  3L09 A;  1S7O A;  4L18 B;  2DPU A;  4O6J A;  5HDK A;  3HRU A;  3GFM A;  2EV5 A;  3I53 A;  4HAM A;  4KNY A;  5HLG A;  5LGU A;  5ILS A;  1KGS A;  4YFN F;  2LF7 A;  3QPH A;  5FLX Z;  5CYV A;  5HS8 A;  3FM5 A;  3P9I A;  3IC7 A;  4ZYE A;  3LAP A;  3QP6 A;  3SZT A;  1BC8 C;  1ZG3 A;  5E1W A;  4M6Y A;  5HLI A;  5DD8 A;  4NQW A;  1QBJ A;  2VN2 A;  1KQ0 A;  3OOP A;  3C1D A;  1ON1 A;  2EWN A;  2P5K A;  2VC1 A;  2QVO A;  4A5N A;  3K1M A;  3SFZ A;  2DBB A;  4RGX A;  4AIJ A;  1T2K A;  1NHA A;  1YTY A;  4M9S A;  1ZYR F;  1D3Y A;  5BMZ A;  1LDD A;  3LQQ A;  1YG2 A;  2P5V A;  1I6X A;  4ENK A;  1K6O A;  2ZKZ A;  3GLX A;  2V79 A;  3JAM Z;  1HKS A;  5AIQ A;  3KZY A;  4CDG A;  2BBY A;  5TJJ A;  5L3B A;  1PP8 F;  4XBF A;  3QU3 A;  1BOA A;  2IVM A;  2PG4 A;  4G6Q A;  2P7V B;  4MNU A;  1IN8 A;  3IKV A;  2GQQ A;  5AON A;  2NYX A;  2HYG D;  4I7H A;  3R0A A;  1XDS A;  2PMU A;  3TQN A;  1HBX G;  1O3S A;  2ZFW A;  5BS6 A;  1IRG A;  4ON0 A;  2IJL A;  3SHF A;  4ESJ A;  1B9N A;  2DU9 A;  3WGG A;  4UVB A;  2IT0 A;  2D45 A;  1UFM A;  3S2W A;  2K02 A;  4RGR A;  4YIF A;  1KU3 A;  3WE3 A;  3JSO A;  1RIO H;  4LG0 B;  2M1B A;  1W7P B;  5LRR A;  4AWX B;  2LNB A;  2JRT A;  2V9V A;  4GXO A;  2XVC A;  1HW5 A;  2MLK A;  3K9T A;  4EVI A;  4MEX F;  4XLN F;  2FML A;  1MKM A;  4JQF A;  2XKP A;  3TOA A;  1OR7 A;  4GCV A;  1B6A A;  2NAZ A;  4AD9 A;  1F9N A;  5LGT A;  2P6S A;  2K86 A;  3WOD F;  1SFX A;  2L4A A;  1P2F A;  2FMY A;  2V1D A;  2BEO A;  3GO5 A;  2UWM A;  1TBX A;  5J8C A;  3E6D A;  3KP2 A;  1G4D A;  4HDV A;  4P9F A;  3BJA A;  4HLX A;  2DQR A;  1PDN C;  5LBQ A;  1XGO A;  2QBY B;  3AAF A;  4EM2 A;  1SAX A;  2VBW A;  4MGR A;  2KRF A;  2DTR A;  3K2Z A;  3REO A;  4EV0 A;  4WF2 A;  2CQK A;  4YG2 F;  1J9I A;  1BN5 A;  1AOY A;  3DQV C;  1IW7 F;  3V8L A;  2YR2 A;  1IN7 A;  3KP7 A;  2F5E A;  2FA5 A;  4KN4 X;  3HIF A;  3GYH X;  5FD5 A;  4EQQ A;  3MEX A;  3CUQ A;  2QLZ A;  1T38 A;  5HLH A;  3DPL C;  2ADU A;  1CF7 B;  1UST A;  2L01 A;  1OPC A;  3O2P E;  2ZJ2 A;  1Z6T A;  5D5X B;  3J80 K;  1J75 A;  3WTY C;  2NNY A;  3JTG A;  5BQT A;  4A12 A;  2FXA A;  2VOP A;  4Y15 A;  4HV5 A;  3WE2 A;  1GVJ A;  1F5T A;  4EM0 B;  4UV8 A;  5ICE A;  1YLF A;  3Q5F A;  5EEG A;  3N97 A;  2ZNY A;  2VC0 A;  2YSR A;  2HGC A;  1YS7 A;  3QRF F;  1K79 A;  2HS5 A;  1J0R A;  1D8K A;  2EA2 A;  1ZG5 A;  1MDM A;  4MTD A;  4MHG A;  1FNN A;  1BI0 A;  1ZAO A;  5JR3 A;  5ILV A;  1LJ9 A;  4EGZ A;  5DV5 A;  4KIB A;  3ZP5 A;  3IHU A;  2Z33 A;  2A69 F;  1FOK A;  1V3F A;  5L3C A;  3BP8 A;  2RQP A;  4M9X A;  1EH8 A;  3WTX C;  4L9V A;  2MLG A;  2L4M A;  5JFR A;  4B8X A;  2DPD A;  3T0Y A;  2IA0 A;  1UHM A;  4RAY A;  3GX4 X;  3ZQ7 A;  2GZW A;  3E97 A;  1IXC A;  4UVA A;  2Y75 A;  4HYE A;  2CWE A;  3DXJ F;  2ZO4 A;  1W5S A;  3SXY A;  2XRN A;  5D5V B;  1U78 A;  5DYM A;  3NQO A;  5LHG A;  4OIN F;  5FO5 A;  4WXC A;  1R36 A;  4KIG A;  1XSV A;  3CDH A;  3BRO A;  5JVT A;  1KU9 A;  5A2Q K;  4HF1 A;  1ODD A;  3LST A;  3L2C A;  4OIP F;  2K27 A;  1T39 A;  3ZN1 A;  5IT9 Z;  1H9G A;  3OV8 A;  3CJN A;  1QZZ A;  5HS7 A;  3WTT C;  4UNO A;  2DW4 A;  3I54 A;  3C3W A;  1ZRF A;  3BJ6 A;  4ESB A;  5ICC A;  5E8G A;  3F6O A;  3RKY A;  3PFI A;  3FMQ A;  2L54 A;  3KEQ A;  2M5W A;  4LK0 F;  1WKM A;  5L3E A;  1S3J A;  4RS8 A;  2JT1 A;  4HOB A;  1K78 A;  1BI3 A;  5F1R A;  5E1Z B;  3ULQ B;  2Z9O A;  4BHB A;  3RPQ A;  3QPT A;  2STW A;  4HLY A;  1STZ A;  3HSE A;  5D8L B;  4D0P A;  1PP7 U;  2HZT A;  2F2E A;  2R3S A;  4RAZ A;  1KU7 A;  5L3D A;  5DUK A;  1FP2 A;  2J5O A;  2DK8 A;  1QQI A;  5IT3 A;  2P4W A;  2V1U A;  2HFH A;  2WV0 A;  1GXQ A;  5LGN A;  4FT8 A;  4UXN A;  2HEO A;  5K5O A;  1ZRE A;  5DCM A;  3QP5 A;  1LEB A;  1TTY A;  3U9G A;  2Q2E A;  3JW4 A;  4RGU A;  4TV7 A;  2HQN A;  2W57 A;  1W4M A;  2HYF A;  1T98 A;  1IZ1 A;  3QOP A;  5L3F A;  4AVP A;  3F3X A;  3GUD A;  3TDZ C;  4WWC A;  1ONV A;  1BC7 C;  2EA4 A;  3IRR A;  3BJO A;  4UVC A;  5ICG A;  3M9A A;  3CUQ B;  4ZZD A;  5DEQ A;  2H6B A;  2E1C A;  1I5Z A;  1YO5 C;  2D1V A;  4G9Y A;  4YII A;  2CYY A;  2JSC A;  2AS5 F;  2EFQ A;  3BOQ A;  3CLO A;  1REP C;  5LLQ A;  2NRA C;  5FLX K;  4N0B A;  2Q8K A;  3ECH A;  5LEK A;  3KP5 A;  3GZ5 A;  2UXX A;  5BPI A;  3VFZ A;  4I0B A;  2GIV A;  2ESH A;  3FMS A;  2VON A;  2P8T A;  1U3E M;  1W7P D;  2G9W A;  1GHC A;  1MDM B;  1FSE A;  2E7W A;  4CO8 A;  2YX7 A;  2CGP A;  1XCB A;  3LAJ A;  5EEH A;  1G3S A;  4XSX F;  3EUH A;  4HZF A;  3J7A O;  1LVA A;  1R00 A;  1WSU A;  1TQP A;  3DF8 A;  3KP4 A;  2ACJ A;  4LGW A;  3HSR A;  4M71 A;  4U0Y A;  4G7O F;  1E17 A;  1YW7 A;  3ECO A;  4A6D A;  2DK5 A;  4Q4Z F;  1B9M A;  2ESN A;  1ZHF A;  4I2O A;  1FYK A;  2VBY A;  1E2X A;  3EYI A;  3HOS A;  1IF1 A;  2Y48 A;  3T5X A; 
#chains in the Genus database with same CATH topology
 2YX4 A;  3HPH A;  4J01 A;  5DCF A;  2MBF A;  1RES A;  3A02 A;  4BQQ A;  3F8F A;  5DM7 F;  2XRL A;  3IH2 A;  4KN7 X;  2KLO A;  1KQ8 A;  2EFN A;  1P7J A;  1S8N A;  3EDP A;  2BVL A;  4HV6 A;  4E7S A;  1L0O C;  1Q1H A;  1ZTR A;  2XAF A;  3DKY A;  5FD6 A;  3J81 K;  3ASO H;  2QQA A;  4KYW A;  1RI7 A;  2EV0 A;  1ZH5 A;  2HI3 A;  5J6X A;  1R5H A;  3LNQ A;  2M45 A;  3AL0 C;  2GA1 A;  3E5X A;  5FLM J;  2M7B A;  3DTK A;  3VSL A;  3F8M A;  2G7U A;  1G3Y A;  2CJJ A;  5KHD A;  4PJJ A;  5IP7 J;  2HOT A;  1WH7 A;  4UUV A;  1UMQ A;  1ETV A;  1N75 A;  3JRC A;  4E7L A;  1R22 A;  3FBN B;  2QM3 A;  3ZQG A;  2JQ7 A;  1U5T C;  4M6V A;  3WU1 B;  4O3M A;  1XMA A;  4IHY A;  2FD5 A;  2OZU A;  2Y0S A;  1Y8R B;  2CSO A;  4DNC A;  1EH6 A;  4WK8 F;  1EV7 A;  3OR2 C;  3WTU C;  3EUA A;  5DDG A;  1OMI A;  2MG4 A;  1ZN2 A;  2PFB A;  3G1O A;  4CH7 A;  1FIP A;  1GT0 C;  1NK3 P;  4LD5 A;  3JRF A;  4S04 A;  1D8J A;  3RSN A;  3W6K B;  3BTI A;  4JOM A;  3JRG A;  2HKX A;  4I02 A;  2Q0O A;  2GBY A;  2R4G A;  4A3J J;  3LSJ A;  4K2E A;  4A0Z A;  3WHC A;  4XOP A;  3HTS B;  4XM3 A;  2DA3 A;  1K78 B;  5EDN A;  3JTH A;  3S3N A;  1OYI A;  1FZP B;  2L7K A;  2OCC H;  3C7J A;  3TMO A;  1XN7 A;  3VSK A;  2BOL A;  2STT A;  2CW7 A;  3LSK A;  2DFH A;  1B8I A;  2ELH A;  1D1C A;  1W5T A;  2D1H A;  3HUG A;  1Y6I A;  4KUM A;  2B9S A;  4GDF A;  1XB4 A;  3QYE A;  5BPD A;  2Y9Z A;  3QOD A;  5F6F A;  2ZJP F;  3Q3S A;  1SFO J;  3B6C A;  2O3F A;  2E19 A;  4ZH4 F;  5M5W J;  3ZXS A;  4G6D A;  3G73 A;  1XS9 A;  3HG9 A;  2XGD A;  5J40 A;  3F72 A;  3OYJ A;  3DBL B;  2HKO A;  3IAS 2;  3ZMU A;  4L5I A;  3G71 I;  1UHW A;  2JA7 J;  2LTP A;  3QQA A;  1B1B A;  3F21 A;  1VFC A;  4F93 B;  4BE2 A;  4A3C J;  4IQJ A;  2WTE A;  3NEU A;  2F5C A;  4M3F A;  3AG1 H;  2MH2 A;  3EQL F;  3FXK A;  3K1P A;  4AID A;  2CFO A;  3K69 A;  2M2E A;  1VQ5 I;  5DCM B;  1R58 A;  2GAU A;  2W25 A;  2Q2E B;  3LSM A;  3S1N J;  2NOJ B;  3FIW A;  3QPL A;  3HHH A;  3G1M A;  2LKP A;  2PEX A;  4IRI A;  1P92 A;  5CQG A;  1BJA A;  4I09 A;  2BHY A;  2YUS A;  3E5U A;  4L5J A;  1QGP A;  4L0Z B;  3EET A;  3I59 A;  1Z6R A;  1T33 A;  2A6E F;  3BTL A;  2XV4 S;  4RB2 C;  3VYT B;  3B02 A;  1Z21 A;  2P5L C;  5DTD A;  4F91 B;  1TNS A;  5HDN A;  4IRG A;  1LB2 A;  1W36 D;  2V26 A;  1D5Y A;  5B1B H;  4P1W A;  4M3E A;  1ETQ A;  3BG5 A;  1R49 A;  2H94 A;  4CUG A;  1XGN A;  3HB9 A;  5GTH C;  1IUF A;  2HVQ A;  3TO9 A;  3ESW B;  5D5U B;  5E3L A;  1LPQ A;  2XKO A;  3LOC A;  1BW6 A;  4BQN A;  1LQ1 A;  2KZV A;  1XGS A;  3PO2 J;  4A93 J;  4M72 A;  4A0Y A;  2MH9 A;  1YYV A;  4ENM A;  2GM4 A;  3DCF A;  2K9Q A;  2K4J A;  4IVN A;  5TIS C;  3BG7 A;  2CG4 A;  2VE8 A;  1JTX A;  1Y56 A;  1IN5 A;  2VI6 A;  1I1S A;  1SVM A;  4HX7 A;  2KIQ A;  3J7Y J;  1OKR A;  3RIR A;  3R60 A;  2KHM A;  3SFI A;  2LOO A;  4LLG F;  3TGN A;  4QSH A;  2K4B A;  2VPR A;  4DZJ A;  2FBK A;  2M0M A;  3AG2 H;  4C2M J;  2WY8 Q;  2R5Z B;  1BI1 A;  3I56 I;  3S3M A;  2PBI A;  3SQN A;  2GXA A;  3CES A;  5J4V A;  5GPA A;  4WCG A;  1FBS A;  4AYB N;  3ERE D;  1K7A A;  1DP3 A;  4MTE A;  3GME A;  5JHF A;  2VBZ A;  5FB2 A;  4Z2Y A;  2W82 A;  3A0B C;  3ZPL A;  2HOA A;  2RAE A;  3HOT A;  4M6X A;  4XLH A;  4P9U A;  4EJT A;  2NVX J;  1SAU A;  2PMZ N;  4WXD A;  2XAH A;  3RYP A;  4ZDO A;  4BAC A;  1I3A A;  4JK1 X;  2KJB A;  2K3P A;  2A5W A;  2VKE A;  1JHF A;  3GTK J;  4IEJ A;  4F7Z A;  1MSF C;  2O6G E;  4N4O B;  3V7C A;  1UEL B;  5E8I A;  3S2H J;  1YW9 A;  3MFK A;  3ABT A;  4CYC B;  3KZZ A;  4Y33 A;  1P4A A;  3C18 A;  4N9H A;  2E2I J;  3H0G J;  4BEH B;  2HVS A;  3OYH A;  2LBF A;  2IW5 A;  2YU9 J;  2ZME C;  4U0W A;  1YW8 A;  4PJN A;  3KEO A;  4Y52 J;  1MND A;  4PFP A;  4ITV A;  2D5V A;  3C2H A;  4HNT A;  2DMT A;  3GXO A;  2ZXW H;  4XLF A;  1KON A;  4EGY A;  3S2D J;  2DOA A;  3I55 I;  3I71 A;  1RUO A;  3U1D A;  2B7E A;  4RBO A;  2KMU A;  4PSW A;  2K7L A;  5D5W B;  1ZEL A;  4XLE A;  1V5E A;  1VQM I;  4P55 A;  1V4R A;  2JTV A;  2AHQ A;  1W5C C;  3ZMD A;  1I50 J;  4MEY F;  2DLL A;  5J4Y A;  1JE8 A;  1UZC A;  3G3Z A;  1HCR A;  5KAF C;  3PFY A;  3HM5 A;  4KIF A;  3W2A A;  1IUY A;  4UV9 A;  4CZC A;  4IPA A;  4EJW A;  1ZG1 A;  3H9Q A;  2QWW A;  4HQM A;  4GFB A;  1HST A;  2FUG 2;  3CMA I;  1HDD C;  4X0G A;  3D5L A;  3DP7 A;  2VT3 A;  3RPU A;  3K4K A;  4HST A;  4XN0 A;  3JRI A;  4LLN A;  1C0W A;  5FGM A;  3GFL A;  1U5T A;  1IN4 A;  1YQA A;  2R7X A;  4XR6 A;  3RYR A;  3ZQC A;  1Z7U A;  2Z2S B;  1OYW A;  1QZE A;  3V8K A;  2JSP A;  2ISZ A;  1ON2 A;  1GV2 A;  1X1D A;  2XAU A;  2EB7 A;  4EJU A;  3I4N J;  1GV5 A;  1L3L A;  2LR8 A;  4OIR F;  1RUN A;  4DW6 A;  5F1J A;  1WHU A;  4NC8 A;  5B1A H;  2R92 J;  4G8X A;  3GF2 A;  3BZC A;  3IH3 A;  4LK1 F;  4ZYH A;  2FQ4 A;  3JCU C;  3LSI A;  2BGC A;  1T0F C;  4IXA A;  5L3G A;  3RJP A;  2BY0 A;  2BW3 A;  5FKL A;  2HXI A;  4FE4 A;  3TOB A;  3H5R A;  3N4M A;  1Y1W J;  2DYS H;  2G7H A;  3H36 A;  4AYB A;  3DFG A;  5FLV A;  5J47 A;  2MD5 A;  4IHW A;  3FF5 A;  3F6V A;  5IYB J;  2DMU A;  4NB5 A;  3HRM A;  3D5S C;  1I1G A;  2XRO A;  2OQG A;  1FYL A;  5D6F A;  3KP3 A;  2WA0 A;  1Z0X A;  2ZBK A;  4R1H A;  3E6B A;  3RZO J;  1EJ9 A;  1HQC A;  2M8E A;  1YJ9 I;  5CKT A;  4A3B J;  2ZSI B;  3BQZ A;  1W0U A;  4CYD A;  1G59 A;  1FY7 A;  1D1A A;  4GGG A;  3MZH A;  1JUM A;  1O4X A;  1AWC A;  3HKZ N;  3ML6 A;  9ANT A;  2RQQ A;  3NAU A;  4V19 K;  4HDU A;  2DA5 A;  2PQ8 A;  3D0S A;  4M3D A;  4E6K G;  3OYM A;  4XON A;  1IXR C;  1SFK A;  2FBI A;  4FHT A;  4C2T A;  2CW8 A;  2HOE A;  4ZYG A;  1B8I B;  1SD4 A;  3E3V A;  2OCE A;  5GPC A;  3I4M J;  4A3M J;  3HUG B;  1YIO A;  3RQI A;  2PLY A;  3L2V A;  5EEA A;  1O7F A;  2FU4 A;  1J59 A;  1HW1 A;  1YS6 A;  5DUI A;  1ERD A;  1TNT A;  3GW2 A;  4OIQ F;  2FF4 A;  5D6E A;  3PNY A;  2ZCW A;  4XKB A;  4BXX J;  1R7J A;  3OIQ A;  2PJP A;  3CD6 I;  3CZ6 A;  3AKZ A;  2RKH A;  1X1C A;  2LDU A;  4II2 A;  3OSG A;  3FXJ A;  2COB A;  3OYE A;  3TBI A;  3F22 A;  2LY2 A;  2H8R A;  3K6G A;  3BY6 A;  2GXG A;  3NRV A;  4CXF A;  3M8J A;  2B0L A;  2GOM A;  3OYI A;  1TWC J;  5E79 C;  2X9D A;  2MW8 A;  2BZT A;  1R1U A;  4GYI A;  3HOU J;  1UAA A;  1EH7 A;  2C6Y A;  4RA2 A;  3R4K A;  1V5F A;  1IRF A;  3S1M J;  4OU0 A;  3O6B B;  3I59 B;  2H8W A;  2DOE A;  1G8X A;  3MZ8 A;  2XAG A;  3OYA A;  2ZC2 A;  3CDL A;  1S9H A;  2JJ7 A;  2JPB A;  4EEF G;  4MO7 A;  3CME I;  3E0J B;  5K5R A;  3IWZ A;  1OCC H;  3E6M A;  4E7Z A;  4RDU A;  2IGK A;  3I64 A;  3UR3 C;  2XAJ A;  3K4M A;  4LIU A;  4L9J A;  2P6T A;  3BCA A;  3SZP A;  3QAH A;  1XGM A;  1ETO A;  2OU2 A;  5CJ9 A;  2Y31 A;  2QCO A;  4D5F A;  4U7B A;  1TQI A;  2RNJ A;  3OR1 C;  3Q0U A;  5TRD A;  2E1O A;  3W2V A;  2FBH A;  3HRS A;  5A2Q Z;  2VPL A;  3BR5 A;  1A6I A;  2KIF A;  1XD7 A;  2G0E A;  5E20 A;  5HDG A;  4LB6 B;  1DP7 P;  1R5G A;  2L7M P;  1QO0 D;  1YFH A;  5ICF A;  3HOV J;  1Z05 A;  3L2R A;  1GXP A;  2VIX A;  2DT6 A;  4BQA A;  2E7X A;  1SC7 A;  2LSO A;  2HTS A;  2M34 A;  4I99 C;  4EJO A;  2FOK A;  4AVZ A;  5E18 F;  3AG4 H;  4FQG A;  1FYM A;  2F4I A;  3M4O J;  4AIH A;  4BNC A;  3DBR B;  1OR7 C;  2CV0 A;  2XPU A;  3ELK A;  2OA4 A;  4FTH A;  1MMS A;  4RB3 C;  3TO6 A;  1F1Z A;  1BIB A;  1XCV A;  2JWT A;  1D1B A;  4QLC U;  3FX3 A;  4BY7 J;  2X1D A;  1WQ2 A;  3DU5 A;  2FQ3 A;  1S29 A;  3BLY A;  3T8R A;  1XSD A;  3LA7 A;  1LFP A;  1FMW A;  1S6L A;  1B72 A;  2H27 A;  1VQ6 I;  1KYZ A;  2K9L A;  5F08 A;  5D8K B;  4CCJ A;  4IHV A;  5H20 A;  4KIS A;  2EZK A;  3K4C A;  3DTE A;  2ZME A;  3R61 A;  2VB6 A;  3KLO A;  3DKW A;  1P4W A;  4Q47 A;  2O03 A;  3QU6 A;  2FJ1 A;  4F92 B;  3KP6 A;  1DDN A;  2P7C B;  3ONQ A;  4MQ9 F;  2NVU B;  1TLH B;  5JI6 A;  5IYC J;  1YI2 I;  4Z6Y A;  3I0T A;  3GTO J;  2LBF B;  3WU2 C;  3S1R J;  2BVM A;  1ULY A;  2K9S A;  1FEX A;  1X3Z B;  2KPM A;  2Y0S N;  4DZP A;  2OTJ I;  2R0Q C;  2HXO A;  1JUS A;  3BPV A;  3I5U A;  1SVL A;  1X3U A;  3CMY A;  4QWQ A;  1NG7 A;  2COM A;  3H92 A;  2LRD A;  3CCL I;  1QVU A;  2RV8 A;  1XC5 A;  1U9N A;  4M9Z A;  1ZRD A;  5EJC A;  4A3L J;  4DBQ A;  3K70 C;  3TP3 A;  1ZGA A;  3TKY A;  4NNJ A;  1JXS A;  1LDJ A;  4M74 A;  5E1X A;  2O8X A;  3LA2 A;  1MBH A;  4OWR B;  1KQ9 A;  5FKO A;  3W6V A;  5ILU A;  2XPV A;  3P7N A;  4KDP A;  2FEZ A;  4XOT A;  3AL0 B;  2AQF A;  1P6R A;  2XGC A;  3OY9 A;  4JBA A;  2VJJ A;  3CO7 C;  3WU0 A;  1MMG A;  2EFO A;  2L7Z A;  5JHU A;  1ITY A;  1ZGJ A;  4XN3 A;  2QSF X;  4CHU A;  2R7Z J;  4ZZL A;  2VAS A;  3F8B A;  1O57 A;  3H9J A;  3SEQ A;  3VEP A;  3JAM K;  4WXH A;  2NS0 A;  1ZLJ A;  2KQR A;  5J1Y A;  5IOZ A;  4YFX F;  3MKL A;  1YX5 A;  2CRG A;  4RB0 A;  1BI2 A;  2TDX A;  4LG3 A;  3MKY B;  3FXL A;  3JSP A;  5H6Q A;  1T0F A;  2MC3 A;  3U2R A;  4ABZ A;  1BW5 A;  4WX9 A;  3S16 J;  2OC6 A;  2LK2 A;  2J5P A;  4JP0 A;  2R7V A;  4EJV A;  1K83 J;  2JA5 J;  5H6R A;  4HNV A;  3WTW C;  4U88 A;  4IOA F;  3AFH A;  4XQF A;  1NG6 A;  2QUF A;  3K0L A;  2O0Y A;  2OD5 A;  3VYU B;  4XL9 A;  2DAO A;  3KYL A;  2DJN A;  3FM3 A;  2DXI A;  2X4H A;  3OYK A;  3R6S A;  1D0Z A;  2BW3 B;  4F52 A;  1RR8 C;  3A01 A;  1WJE A;  3P9C A;  2DFE A;  1ETX A;  1SMY F;  5FRO A;  2XC7 A;  1D0X A;  1FX7 A;  2L9N A;  3CC7 I;  1TP4 A;  3MZY A;  5FFX A;  2DQL A;  3CCJ I;  4CGZ A;  3WG7 H;  4U0V A;  5GP9 A;  5LHH A;  1MZB A;  2VT2 A;  4B3A A;  2X85 A;  3IP4 B;  4LFU A;  1IC8 A;  4LIV A;  5IPA A;  2MFZ A;  2PJR A;  1ZKG A;  5K1Y A;  3K7A J;  3J7A Y;  3V7S A;  4E7K A;  2DI3 A;  2Z5U A;  3A1Y A;  2BYV E;  1N77 A;  1HKT A;  5HNH A;  2M7A A;  4XSZ F;  2HQR A;  1FPQ A;  3V7R A;  2VL8 A;  3G4S I;  2OF7 A;  3OYB A;  2Z1D A;  4UHT A;  4GYG A;  3S14 J;  4L9T A;  1R23 A;  2TRT A;  4RLQ A;  3M1C A;  1XMK A;  3GTQ J;  3VPR A;  4UB8 C;  5EF6 A;  3HTU A;  4ZC3 A;  2IA1 A;  3HSF A;  2L7F P;  3H35 A;  2I8D A;  3PUB A;  2DYR H;  2QZ8 A;  1XX5 A;  3HGG A;  4OMY A;  1EKE A;  1LFB A;  3I3L A;  5JLX A;  4NHJ A;  2IS1 A;  2O5R A;  2OZ6 A;  2HYJ A;  4O5V A;  2KJC A;  3BT9 A;  2QYO A;  2L3D A;  3KLN A;  1YE9 A;  1PVE A;  2E1M C;  1K6Y A;  2R7Q A;  2Z3Y A;  2XHK A;  1Z7L A;  4EAT A;  1IRZ A;  4BH9 A;  1ETK A;  5AIP A;  3PIP F;  2NVQ J;  2X1E A;  2WY7 Q;  1FC3 A;  1B59 A;  5F04 A;  3BZ6 A;  1RNL A;  3GEZ A;  1Z9C A;  2A07 F;  2JA6 J;  4G7Z F;  2NXN B;  3F23 A;  4G7H F;  3VWB A;  2CUZ A;  3LA3 A;  2R7F A;  2OJE D;  3WTZ A;  1N78 A;  2XUB A;  3E6C C;  2KIU A;  3KE2 A;  5C44 J;  2XF5 A;  3E7L A;  2CMP A;  4IJA A;  1WWX A;  2HU9 A;  3ABU A;  3V8J A;  4P5O A;  3GZN B;  5BNG A;  3DEE A;  3ZQQ A;  3GFI A;  3DWL E;  5E3M A;  1Y0N A;  5B66 C;  1YJN I;  2QEN A;  2EFW A;  4IHS A;  3DPT A;  5FFZ A;  1DPU A;  2JPC A;  3BQY A;  4KT5 C;  1FBU A;  5J8F A;  4D7M A;  2O61 A;  3H3Z A;  1Z91 A;  2V9K A;  1TL8 A;  2RC4 A;  4B43 A;  1JGG A;  1KU2 A;  2FSW A;  1TW3 A;  2CH0 A;  4B09 A;  3VOD A;  4A2U A;  2IA2 A;  1UG0 A;  2DMN A;  4AU7 A;  3FZV A;  5HVQ C;  3OYF A;  4LOC A;  4RAG A;  3J81 Z;  2CW0 F;  5ED4 A;  3HOY J;  2FNA A;  1VQK I;  2M3A A;  1U6G A;  2AO9 A;  2XSJ C;  3LSR A;  2JUG A;  1SFU A;  4LJZ F;  4RLF A;  4E70 A;  3JRB A;  2XF6 A;  1JKP C;  4XLA A;  1MGT A;  2KIS A;  3Q0V A;  1MBG A;  4CCM A;  3SJM A;  5D4S A;  1Z1D A;  4HW0 A;  1ZRC A;  4U87 A;  2W24 A;  5HOO A;  1TQM A;  1A04 A;  1WJF A;  2L0K A;  2V1X A;  3T1B A;  2K9M A;  4IZZ A;  2DA7 A;  2IPQ X;  4BJT A;  3OIP A;  3GTP J;  1MBE A;  5KCM A;  1H9T A;  3ZN0 A;  2A61 A;  2R7T A;  3R0J A;  3ZMT A;  3L9F A;  4C9Y A;  3BTJ A;  4B1R A;  2DDB A;  4DGW B;  1I27 A;  3SDB A;  3GTJ J;  2OUM A;  3CCR I;  1VF9 A;  5FRN A;  3PQJ A;  1SD7 A;  2HNH A;  4RGS A;  3CCQ I;  4PK4 A;  1WJA A;  2R7D A;  4Q48 A;  1LNW A;  2MC4 A;  2JK3 A;  3F8C A;  3LFK A;  5EG0 A;  3VOE A;  1GLN A;  3ZGK A;  4I98 B;  5JVG F;  2XAQ A;  2MYS A;  1MNM C;  2W4S A;  3W2W A;  3IH4 A;  1WRJ A;  3M8F A;  1DU0 A;  4BYY A;  5LD2 C;  1JT0 A;  1HDP A;  3U21 A;  4BE0 A;  2BXY A;  5M5X J;  4IX7 A;  3MWM A;  4PGG A;  4EM1 A;  5K5Q A;  1R1V A;  4V2F A;  2LF8 A;  1IDY A;  1U8R A;  2W48 A;  3KEY A;  2X6W A;  3MAJ A;  2JRM A;  2W85 A;  1O7L A;  1PUE E;  1T6S A;  2KP6 A;  2L5Q A;  3RDI A;  2H09 A;  3TO7 A;  1RRJ A;  2EFP A;  2AXL A;  4HF0 A;  2ZME B;  1OCZ H;  4Y17 A;  3DEW A;  1IN6 A;  1JTY A;  2KT0 A;  1RPW A;  2UUZ A;  1LEA A;  2BV6 A;  4I01 A;  3TDU C;  1X1A A;  4QTR A;  4ASN A;  3H9G A;  1X2N A;  3M1E A;  1FOY A;  1WJ5 A;  1X4P A;  2DCE A;  3KET A;  4XIC A;  3COA C;  3CJR B;  4KIC A;  2X6Y A;  5DD4 A;  3KCC A;  3CO6 C;  3FXR A;  4LMY A;  3L7W A;  4KFC A;  2A68 F;  2IS2 A;  3BR1 A;  1HF0 A;  3BWG A;  2DT7 B;  2ME0 A;  1R1T A;  2IGO A;  3PL8 A;  4Y3O A;  1HLV A;  3HHG A;  1ZAR A;  1TWA J;  2DA1 A;  1UHS A;  1WZ2 A;  4HBL A;  3N05 A;  1R6R A;  2EIJ H;  3PSF A;  1BM9 A;  4C3J J;  4A6E A;  1TT0 A;  3NWT A;  3S17 J;  4A3F J;  3HYI A;  4ZTF A;  1GDT A;  4Q5S F;  1AKH A;  3L2W A;  2XAS A;  3LFU A;  2XGX A;  4IHT A;  2YPR A;  5ERI A;  3TL4 X;  1WVR A;  5IP9 J;  4ETS A;  3Q0W A;  2A6H F;  4ZYD A;  3WGI A;  1LKX A;  2IBD A;  3DEU A;  2GWR A;  4ANJ A;  3E5Q A;  4KMU X;  4MFE A;  1JHH A;  1R4M B;  1XSX A;  4GRI A;  2WWY A;  4UY8 I;  1JGS A;  3VB2 A;  2F5F A;  1QRY A;  1I3Q J;  3F8N A;  3O3K A;  2Y0M A;  2OQR A;  3WTS C;  1SD6 A;  3FKJ A;  3KX2 A;  4OAY A;  4KA4 A;  2CU7 A;  2FRH A;  2IGM A;  5LEJ A;  2CQX A;  2GA2 A;  1JUP A;  4BHP A;  4CZZ A;  3DV8 A;  1BR4 A;  2JA2 A;  4E4H A;  1IO2 A;  2HWV A;  1DU6 A;  1Z3Y A;  5CVR A;  1UCR A;  3IWF A;  2LG4 A;  3H0D A;  2RN7 A;  4FX0 A;  3VDX A;  5CVJ A;  4HRI A;  3EYY A;  4BL0 B;  2VJ4 A;  2E36 A;  4YIR X;  2BHZ A;  1TWF J;  2RGV A;  4UUT A;  1G3T A;  1H0M A;  3ZQH A;  5E3O A;  2R93 J;  3DU6 A;  1TC3 C;  2FOW A;  1PJR A;  2VKV A;  3A01 B;  2A3S A;  3K4N A;  3ROU A;  4QPQ A;  1FP1 D;  3BTC A;  2R7U A;  5H2F C;  1HW2 A;  1HKQ A;  1EF4 A;  5CLS A;  2VBX A;  4HPQ A;  2RNG A;  4H0E A;  4FET A;  1PUF A;  3B73 A;  2EV6 A;  4PZJ A;  3HRT A;  2QGU A;  3PM1 A;  3RKX A;  1YHQ I;  2Z99 A;  3OWT A;  4BJ6 C;  2R5Y A;  4ZTJ A;  1QA6 A;  3PJR A;  3BDD A;  6PAX A;  3L00 A;  3HC7 A;  3HGY A;  3M8E A;  1O3R A;  4BE1 A;  3BR0 A;  2PJR B;  3QPS A;  2JVG A;  4XID A;  3KFW X;  2ZSH B;  1USS A;  1X4O A;  2JUC A;  3BPX A;  2CUF A;  1SD5 A;  5IT9 K;  3TW6 A;  4I0A A;  2DT5 A;  2QEX I;  2F6C A;  1DPR A;  4P96 A;  5B3S H;  4BHC A;  3HXL A;  1DUX C;  2QSG X;  2LH9 A;  4V2G A;  3H3V K;  4IF4 A;  5FKM A;  2QQB A;  3M07 A;  3ISP A;  2OBP A;  3LQR A;  3GZ6 A;  1BJZ A;  2YU3 A;  1U8B A;  5FJ8 J;  1MJA A;  1KA8 A;  2XIG A;  3J80 Z;  1BIA A;  1MJ9 A;  3ABK H;  3RTR A;  3K4L A;  3V42 A;  1IG7 A;  2VKD A;  2IP2 A;  5IY5 H;  4ENN A;  1QPI A;  4HX8 A;  1F36 A;  1KZH A;  2LP0 A;  2F5D A;  3BR6 A;  1FT9 A;  2EK5 A;  3P5J A;  3LMM A;  3LSH A;  4XLP F;  3OYD A;  1YJW I;  4LIT A;  3T8T A;  5BOX A;  1G3W A;  5GTI C;  1I39 A;  3OS1 A;  1H88 C;  3BZK A;  2M87 A;  1XDU A;  2EZI A;  2ZXI A;  1OCR H;  1VTN C;  1MJB A;  1FWZ A;  3UKG A;  1UG2 A;  5C4X J;  3DLA A;  2Y9Y A;  3V4G A;  1QNT A;  5HS9 A;  2DA6 A;  2A6T A;  3QWL A;  2KDZ A;  1JKR C;  4HA8 A;  2VE9 A;  1JJ8 C;  1RC9 A;  2KZG A;  3CTA A;  4DYC A;  4AUX A;  4PDK A;  1T8I A;  2E2J J;  2DFF A;  2IRF G;  1LVK A;  1V55 H;  2CUE A;  3DKX A;  1G2H A;  3CP2 A;  3FXU A;  1HXD A;  4S05 A;  2VUM J;  2VXZ A;  1Y0U A;  3HBL A;  1SMT A;  4OMZ A;  2VXD A;  2E5Z A;  3BG6 A;  3MKW B;  4OOI A;  2ZXJ A;  4M73 A;  3M3Y J;  4Y4R A;  3MCZ A;  1APL C;  2MGQ A;  3CJT B;  2X6X A;  4XRF A;  5F0C A;  1F4K A;  1UJ8 A;  2UV1 A;  3FWE A;  5FRM A;  2A5Y B;  2MA3 A;  3JRE A;  3RI4 A;  4JYK A;  4OIO F;  2HQA A;  2ZNZ A;  2CO5 A;  1S7A A;  1FSH A;  3C2G A;  4D9J A;  4HQE A;  3A4C A;  4PCQ A;  3L2U A;  2ZB9 A;  4L9N A;  3H3U A;  1WCM J;  3FHZ A;  3CUO A;  3I58 A;  2NVY J;  2AXT C;  3RPU D;  4BJ5 C;  3GVA A;  3CCU I;  3HOZ J;  4KT6 A;  4ENJ A;  2PI0 A;  2RDP A;  1LFU P;  5D4R A;  4BAY A;  3LL7 A;  4G6T B;  1G6N A;  2JN6 A;  2HR3 A;  4B44 A;  2DFI A;  4RM2 A;  2P81 A;  2PMH A;  2IGN A;  2V6C A;  3H5N A;  5DM6 F;  1W36 C;  4G12 A;  3ABM H;  4FX4 A;  4BBS J;  3WTV C;  4IQ4 A;  2D2W A;  3VYS B;  1TZL A;  4XRS G;  1JKO C;  1QZY A;  2KRC A;  3BG3 A;  1RZ4 A;  3RKW A;  4A0X A;  4BXU A;  3GTM J;  5EG0 B;  1F43 A;  4UUS A;  1J2X A;  1OCT C;  3HDD A;  1E3H A;  2HQ5 A;  2VKH A;  2CFX A;  4GO1 A;  1MNE A;  2V1N A;  4A5M A;  1KYW A;  3PQK A;  1U9O A;  5LRS A;  2P0W A;  3OYN A;  1DGR M;  3ZMV A;  2VOD A;  1VQ9 I;  1ZR4 A;  2BY1 A;  3FXO A;  3W6J B;  5K7F A;  1U2W A;  2XF7 A;  4HSR A;  1B4A A;  1MBK A;  2NNN A;  1A31 A;  3Q9V A;  1P9Q C;  1NK2 P;  4QPO A;  4R79 A;  4LG0 A;  4NC7 A;  1W7P A;  1GVD A;  4DYQ A;  2X0L A;  3ZMZ A;  3Q9S A;  4LB5 A;  5KK1 A;  2KIM A;  2JA8 J;  2X48 A;  1K4S A;  4RB1 A;  2DA2 A;  3MQ0 A;  2M0C A;  3OSF A;  1FLI A;  2WC2 A;  2W00 A;  4BY1 J;  4XKV A;  1VZ0 A;  1HOM A;  3AG3 H;  3FMR A;  1WJC A;  3K2A A;  1XTA A;  2FNP A;  1BBY A;  2DMP A;  4D1Q A;  3FXQ A;  4N9I A;  4XKW A;  4HX4 A;  5KVR A;  2DO7 A;  1J5Y A;  2EIL H;  1IXS B;  2ZXH A;  1YIT I;  3FKI J;  1IAW A;  4ZDL A;  1X2M A;  4PGH A;  3LSG A;  5CVV A;  5F0F A;  4U7D A;  3IRQ A;  1A36 A;  3K1N A;  4KMF A;  4J00 A;  3M7G A;  1TW2 A;  2QQ8 A;  4EMS A;  3RCO A;  2ME6 A;  2DOD A;  3ASN H;  4R8H A;  5CVU A;  1ZR2 A;  2NVT J;  1AKH B;  3S32 A;  2V9P A;  3P9K A;  1DGW Y;  1D0Y A;  2X51 A;  1OYY A;  3KIO A;  1WFX A;  2HTJ A;  2PN6 A;  1CGP A;  4AIK A;  1MBJ A;  1FTT A;  2H1K A;  2QF7 A;  5J3L A;  1O3T A;  3HZJ A;  2QBY A;  4MIM A;  3LWF A;  1MD0 A;  1ZGW A;  2CUJ A;  2M30 A;  4BKX A;  3IL2 A;  3CLQ A;  1QHG A;  4L0Y B;  2W84 A;  3X2Q H;  2EQR A;  1ZLK A;  1WGX A;  5FKN A;  2XPW A;  2I5U A;  2K9N A;  3PNT A;  4G94 A;  2ECB A;  2HPI A;  4C3H J;  2VOO A;  5EGO A;  2GXB A;  5EZG A;  2UXN A;  3GWZ A;  2DTZ A;  4ESF A;  4XK4 A;  5F64 A;  2OTL I;  3S8P A;  2H6C A;  3FBI B;  4IRH A;  3K4B A;  4MLO A;  2BE5 F;  2RVC A;  2ISY A;  5CVI A;  3WGH A;  1NH3 A;  4XMY A;  4NDL A;  4IKF A;  4LLL A;  1UB9 A;  2I10 A;  1P4X A;  1WI9 A;  3ZMS A;  4ZDP A;  4Y13 A;  2JZY A;  4DQ2 A;  2FE3 A;  5F27 A;  4YFK F;  1X3W B;  3S93 A;  3A0H C;  3A03 A;  3GFJ A;  2X6O A;  2R5Z A;  2EZH A;  1HSJ A;  1J7K A;  2QSH X;  2L02 A;  1QPM A;  5M5Y J;  2EJR A;  3WG9 A;  4MQV A;  3IAM 2;  2E5N A;  4UB6 C;  2UZK A;  1MW7 A;  1SFE A;  1PUF B;  2HDC A;  2WAQ A;  3I4P A;  1Y1V J;  1O3Q A;  3PIO F;  1CF7 A;  5E17 F;  4F3Q A;  2QQ9 A;  2R5Y B;  2CQQ A;  2OAZ A;  4DYR A;  5LHI A;  2E1N A;  3CUQ C;  1D5V A;  2HDW A;  5EYR A;  1LDK B;  3GTL J;  1U5T B;  4CIC A;  4DIQ A;  2L9R A;  2ID6 A;  2KKO A;  3ZCO A;  2O7O A;  1FBQ A;  2ETH A;  2QKM B;  4CA0 A;  3IKT A;  4HF2 A;  3L09 A;  1S7O A;  2HDD A;  4L18 B;  1AU7 A;  1I6H J;  3RKQ A;  2DPU A;  2GLO A;  4O6J A;  5HDK A;  2ZFU A;  3HRU A;  3BCB A;  2LYC A;  2E1M B;  3GFM A;  2EV5 A;  2QKL B;  3I53 A;  4HAM A;  4F55 A;  5HLG A;  4KNY A;  1ETY A;  2A05 A;  5LGU A;  1FOX A;  5ILS A;  1KGS A;  4YFN F;  4A3G J;  2LF7 A;  3QPH A;  5FLX Z;  2K5C A;  5CYV A;  5HS8 A;  3FM5 A;  3P9I A;  3IC7 A;  2LVS A;  2ELK A;  4ZYE A;  3ZR8 X;  3LAP A;  3QP6 A;  3TP0 A;  1H89 C;  2FX0 A;  3SYT A;  3SZT A;  1BC8 C;  2GOX B;  1ZG3 A;  5E1W A;  4M6Y A;  2M4G A;  3UNG C;  2WBM A;  5HLI A;  4YEJ A;  1S7E A;  5DD8 A;  1QHH D;  3D5R C;  4NQW A;  4A69 C;  3OYL A;  3MD2 A;  4C3I J;  1QBJ A;  2VN2 A;  1KQ0 A;  3OOP A;  3C1D A;  1ON1 A;  5CQE A;  3OL4 A;  2ID3 A;  5IP6 A;  2LLK A;  2EWN A;  2P5K A;  2VC1 A;  2QVO A;  3ZQL A;  4A5N A;  3K1M A;  3FXM A;  3ZRG A;  2WB1 N;  3SFZ A;  3VYR B;  2DBB A;  4RGX A;  1RET A;  2DMQ A;  2BXZ A;  4D7N A;  4AIJ A;  1MIJ A;  1T2K A;  1NHA A;  1E3P A;  4AM3 A;  2M9H A;  1YTY A;  4M9S A;  3CC2 I;  1ZYR F;  1D3Y A;  5BMZ A;  1LDD A;  5JLW A;  3LQQ A;  3TED A;  1YG2 A;  3CJQ B;  2IAI A;  1XMX A;  3JRD A;  2Z16 A;  1V54 H;  4KIT B;  4XRS A;  4BBR J;  2P5V A;  1I6X A;  4ENK A;  2Y69 H;  2WAD A;  2Y30 A;  1K6O A;  2ZKZ A;  1V5G A;  2ZJQ F;  5CPR B;  3GLX A;  4FE7 A;  2V79 A;  3F9K A;  3JAM Z;  3OS0 A;  1HKS A;  5AIQ A;  1FJL A;  4W1U A;  3KZY A;  4CDG A;  2BBY A;  2QA4 I;  2LFB A;  2EIM H;  5TJJ A;  5L3B A;  1GUU A;  3E1S A;  4XBF A;  1VQP I;  2VQL A;  3QU3 A;  1PP8 F;  1BOA A;  2IVM A;  2PG4 A;  4G6Q A;  3CMM A;  2P7V B;  2CS3 A;  1IN8 A;  4MNU A;  3IKV A;  2GQQ A;  4DBR A;  1N25 A;  2K40 A;  3S1Q J;  2LY1 A;  3O8G A;  5AON A;  2NYX A;  2HYG D;  4I7H A;  3R0A A;  1XDS A;  2PMU A;  1MH3 A;  1M1E B;  3TQN A;  1HBX G;  1DQU A;  1QU3 A;  1TWH J;  2BY2 A;  1O3S A;  2VJI A;  2ZFW A;  5BS6 A;  1IRG A;  2XB5 A;  4ON0 A;  2IJL A;  3SHF A;  4ESJ A;  4UUS B;  1WH5 A;  2F5V A;  1X1P A;  1SAN A;  1B9N A;  2DU9 A;  3WGG A;  2XB0 X;  4UVB A;  4BDY A;  2IT0 A;  2D45 A;  3QOE A;  1FIA A;  1HA8 A;  3G1L A;  1UFM A;  3S2W A;  3OYG A;  2K02 A;  4RGR A;  4X1E A;  3L1P A;  4YIF A;  2NS7 A;  1KU3 A;  2EIK H;  3WE3 A;  2W7N A;  2EIN H;  2E71 A;  2DOF A;  3CCE I;  2CV2 A;  5KNL A;  3JSO A;  1RIO H;  1WPK A;  1VQ7 I;  1MMA A;  4LG0 B;  2M1B A;  1W7P B;  3MMY B;  5LRR A;  4AWX B;  2LNB A;  2JRT A;  2V9V A;  4GXO A;  2XVC A;  4J19 A;  2E35 A;  1HW5 A;  3S3O A;  2MLK A;  3K9T A;  2E60 A;  4EVI A;  4MEX F;  4XLN F;  2FML A;  4NC6 A;  1MKM A;  4JQF A;  2XKP A;  3TOA A;  1MMN A;  1OR7 A;  2F48 A;  5IYD J;  3KZI C;  2R7R A;  3ZQF A;  2M4K A;  3CP8 A;  4RAF A;  2DJI A;  2IEK A;  1LUJ B;  3IV5 A;  1BOB A;  1RR7 A;  5DS9 A;  4GCV A;  1B6A A;  2NAZ A;  4AD9 A;  1RKT A;  4JX4 A;  1F9N A;  3FK6 A;  2P6S A;  5LGT A;  2K86 A;  4YRV A;  3WOD F;  2WB1 A;  5GAG J;  5GAH J;  1BA5 A;  2L9S A;  1SFX A;  2L4A A;  1P2F A;  3C2B A;  4IL6 C;  5M3M J;  3RQ4 A;  5J1R A;  1EA3 A;  2FMY A;  1S5L C;  2V1D A;  2TCT A;  2BEO A;  3GO5 A;  3HPG A;  1YRN A;  2LD5 A;  2NOG A;  1TBX A;  2RRE A;  5J8C A;  2UWM A;  3E6D A;  1VQ8 I;  3K10 A;  3KP2 A;  3DTI A;  1G4D A;  1B72 B;  4HDV A;  1T95 A;  4P9F A;  3BJA A;  5GAE J;  3A2K A;  4HLX A;  2DQR A;  1PDN C;  5LBQ A;  4AC0 A;  1YIJ I;  2EBI A;  3HJE A;  1OCP A;  4MFD A;  2IS4 A;  1A6Q A;  1ZQ3 P;  1XGO A;  2QBY B;  2CQ7 A;  3AAF A;  5KAI C;  3PUF A;  4EM2 A;  2KDO A;  1SAX A;  2VBW A;  2LKS A;  4MGR A;  1IGN A;  2KRF A;  1OQY A;  2DTR A;  3OMY A;  4I76 A;  3K2Z A;  3REO A;  3CF5 F;  4EV0 A;  2OV7 A;  4WF2 A;  4FAS D;  2CQK A;  5EGO B;  4YG2 F;  1J9I A;  1BN5 A;  3CC4 I;  1AOY A;  3DQV C;  4A3K J;  1IW7 F;  1OIS A;  4M3G A;  2E2H J;  3V8L A;  2YR2 A;  1IN7 A;  3KP7 A;  2F5E A;  2FA5 A;  2M8G X;  1HC8 A;  1BR1 A;  5HLT A;  4KN4 X;  3HIF A;  3GYH X;  5FD5 A;  1R71 A;  4EQQ A;  3MEX A;  3CUQ A;  2WV1 A;  2MAB A;  1T56 A;  4FIS A;  2QLZ A;  1T38 A;  4QIW N;  2OPT A;  1W1W E;  5HLH A;  3DPL C;  1XG1 A;  3ZQI A;  2ADU A;  1CF7 B;  1UST A;  4IHX A;  2L01 A;  1OPC A;  3O2P E;  4E7J A;  2ZJ2 A;  1Z6T A;  5D5X B;  3J80 K;  5C4J J;  4Y7N J;  1WJD A;  3QYF A;  4L5E A;  1J75 A;  4PUS A;  5B5E C;  1R4N B;  3WTY C;  1E3O C;  2NNY A;  3JTG A;  5BQT A;  4A12 A;  4CCO A;  2FXA A;  2VOP A;  4Y15 A;  4HV5 A;  3WE2 A;  1GVJ A;  4CCL A;  5LFA A;  1F5T A;  4EM0 B;  2K85 A;  4UV8 A;  3U1K A;  1H8A C;  5ICE A;  5K7H A;  1MSE C;  1YLF A;  3Q5F A;  5EEG A;  1ENH A;  3OS2 A;  2ELJ A;  3N97 A;  2ZNY A;  2VC0 A;  2YSR A;  2HGC A;  1YS7 A;  3QRF F;  2F4O B;  1K79 A;  2HS5 A;  1FOW A;  4PJM A;  1J0R A;  1D8K A;  5M3F J;  2EA2 A;  1ZG5 A;  1MDM A;  1OFC X;  4MTD A;  2BY3 A;  2VJ5 A;  1FNN A;  4MHG A;  1VQ4 I;  2B63 J;  3CQZ J;  1BI0 A;  1MH4 A;  1ZAO A;  3S15 J;  2LMD A;  4NQW B;  5JR3 A;  4X6A J;  5K7Z A;  5ILV A;  3G2B A;  5IOY A;  1LJ9 A;  1OCO H;  4B4C A;  4EGZ A;  5DV5 A;  3PSI A;  4KIB A;  1IRX A;  3O8H A;  2MSY A;  1VQL I;  3ABL H;  3ZP5 A;  3IHU A;  2Q1Z B;  2E34 A;  3K70 D;  4A3I J;  2Z33 A;  2KL4 A;  2A69 F;  3FK7 A;  1FOK A;  1V3F A;  3NAR A;  5EZH A;  3W3C A;  5L3C A;  4XLC A;  3BP8 A;  3CCY A;  2RQP A;  4M9X A;  3EUH C;  1EH8 A;  3PO3 J;  3WTX C;  4L9V A;  4B47 A;  1R9T J;  2MLG A;  2JMW A;  4PFO A;  2L4M A;  1K4T A;  5JFR A;  1VQO I;  1XPX A;  2ECC A;  4B8X A;  3MN2 A;  1R5I D;  5E3N A;  3HOW J;  4C30 A;  2DPD A;  3T0Y A;  2ZJR F;  2IA0 A;  1UHM A;  3MVP A;  4RAY A;  3F0C A;  3GX4 X;  3ZQ7 A;  3CDI A;  4BXF A;  1IJW C;  1LE8 A;  2GZW A;  3E97 A;  1IXC A;  3EUK L;  1X1B A;  2Y75 A;  4UVA A;  4BGD A;  4HYE A;  2CWE A;  3DXJ F;  2L9V A;  5C3E J;  1S72 I;  1AA7 A;  2ZO4 A;  1SEU A;  1WJB A;  1W5S A;  2NS8 A;  3H5A A;  3SXY A;  4XNF A;  1VND A;  2XRN A;  5D5V B;  1U78 A;  5DYM A;  3GTG J;  1FMV A;  3OL3 A;  3NQO A;  5LHG A;  2O9L A;  2PMZ A;  4OIN F;  2IS6 A;  3GLL A;  4KJZ A;  4II3 A;  5FO5 A;  4WXC A;  3BR3 A;  1BR2 A;  1MMD A;  1R36 A;  2WAE A;  3I9V 2;  1NTC A;  4KIG A;  1XSV A;  1Y8Q B;  3CDH A;  3BRO A;  3SDG A;  5JVT A;  2W1O A;  1KU9 A;  5A2Q K;  3CCV I;  2PX9 A;  1IDZ A;  2N8G A;  4HF1 A;  1ODD A;  2JVH A;  3LST A;  3L2C A;  2VQH A;  4OIP F;  4IO9 F;  2K27 A;  4RM3 A;  1BL0 A;  1T39 A;  3ZN1 A;  4A3E J;  4M3B A;  2KRH A;  2HVR A;  1U0J A;  5IT9 Z;  1H9G A;  2DA4 A;  3OV8 A;  2ICW G;  3CJN A;  4A3D J;  4ZJZ A;  1QZZ A;  5HS7 A;  1OJL A;  1IV6 A;  3WTT C;  2V4J C;  5HNF A;  4DOZ A;  4UNO A;  2DW4 A;  1JKQ C;  4B48 A;  2X1C A;  3I54 A;  3C3W A;  1ZRF A;  3BJ6 A;  4ESB A;  3IUO A;  5ICC A;  1OLT A;  5E8G A;  3FDY A;  3F6O A;  3RKY A;  4I6Z A;  2HPM A;  2LY9 A;  2KFD A;  3PFI A;  3FMQ A;  3TW7 A;  4D5C A;  2L54 A;  3KEQ A;  4IOC F;  2M5W A;  4LK0 F;  2HZD A;  4HEA 2;  1WKM A;  5L3E A;  4XKC A;  3BG9 A;  1S3J A;  3KPH A;  3SEZ A;  4RS8 A;  1A35 A;  2JT1 A;  4HOB A;  1K78 A;  1BI3 A;  5F1R A;  4CCN A;  2AQE A;  5E1Z B;  3ULQ B;  3ERM A;  2Z9O A;  5HOD A;  3G6E I;  3LSP A;  3SZG A;  4BHB A;  3GBG A;  2EZL A;  3ZOB A;  1POG A;  3RPQ A;  3QPT A;  2STW A;  2EPF A;  3DLL F;  3HL2 A;  4HLY A;  1STZ A;  3HSE A;  5D8L B;  4D0P A;  1YRN B;  3NWS A;  2R7W A;  1PP7 U;  1X19 A;  1VQN I;  1TT5 B;  2WAQ N;  2HZT A;  1Z3X A;  2YS9 A;  3OYC A;  2VQC A;  2DN0 A;  3DBH B;  2F2E A;  2R3S A;  4RAZ A;  4CCK A;  2VLA A;  1JJ6 C;  1KU7 A;  1YOV B;  1TWG J;  5L3D A;  3JR9 A;  3KYD B;  5DUK A;  1FP2 A;  2J5O A;  2F4M B;  2DK8 A;  4DJA A;  1ETW A;  1QQI A;  5IT3 A;  2P4W A;  2V1U A;  2HFH A;  2WV0 A;  1GXQ A;  3BC8 A;  5LGN A;  4FT8 A;  4UXN A;  4BUP A;  2HEO A;  5K5O A;  1ZRE A;  5J1U A;  5DCM A;  3QP5 A;  2CQN A;  1LEB A;  1TTY A;  3U9G A;  4E7I A;  2Q2E A;  3WHB A;  2R7S A;  4H4K C;  5GAD J;  2GIZ A;  3JW4 A;  4RGU A;  4TV7 A;  4NBQ A;  4HG2 A;  2HQN A;  1Z77 A;  1X58 A;  2W57 A;  1W4M A;  1K61 A;  1ORK A;  2HYF A;  2WAF A;  4BU2 A;  1T98 A;  3QYB A;  2HOS A;  1IZ1 A;  3QOP A;  3HKZ A;  5L3F A;  2Y2Z A;  4AVP A;  3F3X A;  4C2U A;  3GUD A;  3TDZ C;  4WWC A;  1ONV A;  1BC7 C;  2EA4 A;  4JX5 A;  3IRR A;  3BJO A;  1Z67 A;  4UVC A;  4NUB A;  2V7F A;  3DPU A;  5ICG A;  3M9A A;  3CUQ B;  2LKX A;  4ZZD A;  5DEQ A;  1P7I A;  2L2O A;  3J7Z I;  3JRH A;  3HOX J;  3RZD J;  2H6B A;  3H1C A;  4XRM A;  1IV8 A;  5F0H A;  2E1C A;  1VI0 A;  1I5Z A;  1YO5 C;  2D1V A;  4G9Y A;  4YII A;  2MD0 A;  5TGT A;  2CYY A;  2JSC A;  2AS5 F;  2EFQ A;  3L2Q A;  2R7O A;  2H1L A;  3BOQ A;  4ZYA A;  2XGE A;  3CLO A;  1REP C;  5LLQ A;  2NRA C;  3HEF A;  1MBF A;  5FLX K;  1Q1V A;  4N0B A;  4RMN A;  2Q8K A;  4E7H A;  3ECH A;  3PNV A;  5LEK A;  3KP5 A;  1PYV A;  1Y39 A;  4PSX A;  3GZ5 A;  2UXX A;  5BPI A;  3VFZ A;  4I0B A;  4BQO A;  1FTZ A;  2O8K A;  4HNU A;  2IXS A;  2GIV A;  4JX6 A;  1YX3 A;  2ESH A;  3FMS A;  2VON A;  3KYC B;  2VQG A;  5FKK A;  1ZK8 A;  1WI3 A;  1W0T A;  2P8T A;  1U3E M;  1W7P D;  2LRE A;  2G9W A;  1GHC A;  2XDV A;  1MDM B;  1FSE A;  2E7W A;  4CO8 A;  2YX7 A;  4S0H B;  4W97 A;  4YEL A;  1XCB A;  3FHN A;  4XOR A;  2CGP A;  4PJ0 C;  2CV1 A;  3K4J A;  3LAJ A;  4BS9 A;  3CCS I;  5EEH A;  1G3S A;  4XSX F;  3EUH A;  4HZF A;  3J7A O;  1JI8 A;  1LVA A;  1R00 A;  1RKW A;  2LC2 A;  3EPZ A;  1ACI A;  3OIO A;  3B6A A;  1WSU A;  1TQP A;  3DF8 A;  1JT6 A;  4PJL A;  1CQT A;  3KP4 A;  2ACJ A;  4LGW A;  3BR2 A;  4CYC A;  3MKZ A;  3HSR A;  4M71 A;  4U0Y A;  2XSD C;  4G7O F;  1T08 B;  1YW7 A;  2EH3 A;  3ECO A;  4N4N B;  4CSW A;  1E17 A;  4A6D A;  2DK5 A;  4Q4Z F;  1B9M A;  4BEH A;  1J09 A;  4BDZ A;  2ESN A;  4OAZ A;  3GCM A;  2V6E A;  2DDA A;  3D1N I;  1ZHF A;  3JRA A;  4FCY A;  3CCM I;  4I2O A;  1FYK A;  1A5J A;  3OOU A;  1SVO A;  2VBY A;  1E2X A;  2K3F A;  3EYI A;  3CF2 A;  1AHD P;  1LE8 B;  1QVT A;  1E0E A;  4B3X A;  3FIS A;  3HOS A;  1IF1 A;  2Y48 A;  3T5X A; 
#chains in the Genus database with same CATH homology
 2YX4 A;  5DCF A;  2MBF A;  3F8F A;  4KN7 X;  1KQ8 A;  2EFN A;  1S8N A;  3EDP A;  4HV6 A;  1L0O C;  1Q1H A;  2XAF A;  5FD6 A;  3J81 K;  2QQA A;  4KYW A;  1RI7 A;  2EV0 A;  1ZH5 A;  5J6X A;  1R5H A;  2M45 A;  2GA1 A;  3E5X A;  3F8M A;  2G7U A;  1G3Y A;  4UUV A;  1R22 A;  2QM3 A;  1U5T C;  3WU1 B;  4O3M A;  1XMA A;  2OZU A;  4DNC A;  2CSO A;  1EH6 A;  4WK8 F;  1EV7 A;  3WTU C;  5DDG A;  1OMI A;  1ZN2 A;  2PFB A;  4LD5 A;  4S04 A;  1D8J A;  3W6K B;  2HKX A;  4I02 A;  2Q0O A;  4K2E A;  4A0Z A;  3HTS B;  1K78 B;  3JTH A;  1OYI A;  1FZP B;  3C7J A;  1XN7 A;  2STT A;  2ELH A;  1W5T A;  2D1H A;  3HUG A;  4KUM A;  1XB4 A;  5BPD A;  5F6F A;  2O3F A;  4ZH4 F;  4G6D A;  3G73 A;  3F72 A;  2HKO A;  3ZMU A;  4L5I A;  1UHW A;  1B1B A;  3F21 A;  2WTE A;  3NEU A;  2F5C A;  2MH2 A;  3EQL F;  3K1P A;  3K69 A;  5DCM B;  1R58 A;  2GAU A;  2W25 A;  3HHH A;  2LKP A;  2PEX A;  4IRI A;  1P92 A;  1BJA A;  4I09 A;  3E5U A;  4L5J A;  1QGP A;  4L0Z B;  3EET A;  3I59 A;  1Z6R A;  2A6E F;  2XV4 S;  4RB2 C;  3B02 A;  2P5L C;  1TNS A;  5HDN A;  4IRG A;  1LB2 A;  2H94 A;  1XGN A;  3TO9 A;  5D5U B;  2XKO A;  1LQ1 A;  1XGS A;  4M72 A;  4A0Y A;  2MH9 A;  1YYV A;  4ENM A;  2K4J A;  4IVN A;  2CG4 A;  2VE8 A;  1IN5 A;  1I1S A;  4HX7 A;  1OKR A;  3RIR A;  3R60 A;  4LLG F;  3TGN A;  2K4B A;  2FBK A;  1BI1 A;  2PBI A;  3SQN A;  4WCG A;  1FBS A;  3ERE D;  1K7A A;  4MTE A;  2VBZ A;  5FB2 A;  4Z2Y A;  3ZPL A;  3HOT A;  4M6X A;  4P9U A;  4EJT A;  4WXD A;  3RYP A;  2XAH A;  4JK1 X;  2KJB A;  1JHF A;  4F7Z A;  2O6G E;  3V7C A;  5E8I A;  1YW9 A;  3MFK A;  3ABT A;  3KZZ A;  1P4A A;  3C18 A;  4N9H A;  2IW5 A;  4U0W A;  1YW8 A;  3KEO A;  3GXO A;  4EGY A;  3I71 A;  1RUO A;  3U1D A;  2K7L A;  5D5W B;  4P55 A;  1V4R A;  2JTV A;  3ZMD A;  4MEY F;  2DLL A;  1JE8 A;  3G3Z A;  4KIF A;  1IUY A;  4UV9 A;  1ZG1 A;  4IPA A;  4EJW A;  2QWW A;  4HQM A;  1HST A;  3D5L A;  3DP7 A;  2VT3 A;  3RPU A;  4LLN A;  1C0W A;  5FGM A;  3GFL A;  1U5T A;  1IN4 A;  1YQA A;  3RYR A;  1Z7U A;  1OYW A;  3V8K A;  2ISZ A;  1ON2 A;  2EB7 A;  4EJU A;  1L3L A;  4OIR F;  1RUN A;  4G8X A;  3GF2 A;  4LK1 F;  4ZYH A;  4IXA A;  2BGC A;  5L3G A;  3RJP A;  3TOB A;  3N4M A;  2G7H A;  3DFG A;  2MD5 A;  3FF5 A;  3F6V A;  4NB5 A;  3HRM A;  1I1G A;  2XRO A;  2OQG A;  1FYL A;  5D6F A;  3KP3 A;  2ZBK A;  4R1H A;  3E6B A;  1HQC A;  2M8E A;  4CYD A;  1FY7 A;  4GGG A;  3MZH A;  1AWC A;  3ML6 A;  4HDU A;  2PQ8 A;  3D0S A;  1IXR C;  2FBI A;  4FHT A;  2HOE A;  4ZYG A;  1SD4 A;  3E3V A;  1YIO A;  2PLY A;  1O7F A;  2FU4 A;  1J59 A;  1HW1 A;  1YS6 A;  5DUI A;  1TNT A;  3GW2 A;  4OIQ F;  2FF4 A;  5D6E A;  2ZCW A;  1R7J A;  2PJP A;  2RKH A;  2LDU A;  3F22 A;  3BY6 A;  2GXG A;  3NRV A;  4CXF A;  2B0L A;  4GYI A;  1R1U A;  1EH7 A;  2C6Y A;  3R4K A;  1IRF A;  4OU0 A;  3O6B B;  3I59 B;  2XAG A;  2JPB A;  5K5R A;  3IWZ A;  3E6M A;  3I64 A;  2XAJ A;  4L9J A;  2P6T A;  3SZP A;  3QAH A;  1XGM A;  2OU2 A;  5CJ9 A;  4U7B A;  1TQI A;  2RNJ A;  5TRD A;  2FBH A;  3HRS A;  5A2Q Z;  2KIF A;  1XD7 A;  5HDG A;  5E20 A;  4LB6 B;  1DP7 P;  1R5G A;  1YFH A;  1QO0 D;  5ICF A;  1Z05 A;  1GXP A;  4BQA A;  2E7X A;  2LSO A;  2HTS A;  4EJO A;  2FOK A;  5E18 F;  1FYM A;  4AIH A;  4BNC A;  3ELK A;  2OA4 A;  4RB3 C;  3TO6 A;  1F1Z A;  1BIB A;  1XCV A;  4QLC U;  3FX3 A;  1WQ2 A;  2FQ3 A;  1S29 A;  3T8R A;  1XSD A;  3LA7 A;  1S6L A;  2H27 A;  1KYZ A;  5D8K B;  5H20 A;  2ZME A;  3R61 A;  3KLO A;  3DKW A;  1P4W A;  4Q47 A;  2O03 A;  3QU6 A;  3KP6 A;  1DDN A;  2P7C B;  4MQ9 F;  5JI6 A;  1TLH B;  3I0T A;  1ULY A;  3BPV A;  3I5U A;  1X3U A;  4QWQ A;  2COM A;  3H92 A;  2RV8 A;  4M9Z A;  1ZRD A;  1ZGA A;  3TKY A;  1JXS A;  1LDJ A;  4M74 A;  5E1X A;  2O8X A;  3LA2 A;  1KQ9 A;  5ILU A;  3P7N A;  4KDP A;  2FEZ A;  1P6R A;  4JBA A;  3CO7 C;  3WU0 A;  2EFO A;  5JHU A;  1ZGJ A;  4CHU A;  4ZZL A;  3F8B A;  1O57 A;  3VEP A;  3JAM K;  4WXH A;  2NS0 A;  1ZLJ A;  4YFX F;  4RB0 A;  1BI2 A;  2TDX A;  3JSP A;  5H6Q A;  1T0F A;  2MC3 A;  3U2R A;  4WX9 A;  2J5P A;  4EJV A;  5H6R A;  3WTW C;  4U88 A;  2QUF A;  3K0L A;  2O0Y A;  2OD5 A;  2DAO A;  3FM3 A;  2X4H A;  3R6S A;  3P9C A;  1SMY F;  1FX7 A;  3MZY A;  5FFX A;  2DQL A;  4CGZ A;  4U0V A;  5LHH A;  1MZB A;  2VT2 A;  4LFU A;  5K1Y A;  3V7S A;  2DI3 A;  2Z5U A;  2BYV E;  1HKT A;  4XSZ F;  2HQR A;  1FPQ A;  3V7R A;  4UHT A;  4GYG A;  4L9T A;  1R23 A;  1XMK A;  3HTU A;  2IA1 A;  3HSF A;  2QZ8 A;  4OMY A;  4NHJ A;  2OZ6 A;  4O5V A;  2KJC A;  2QYO A;  2L3D A;  3KLN A;  2Z3Y A;  2XHK A;  4BH9 A;  5AIP A;  1FC3 A;  1B59 A;  2A07 F;  3BZ6 A;  1RNL A;  3GEZ A;  1Z9C A;  4G7Z F;  4G7H F;  3F23 A;  3LA3 A;  2R7F A;  3WTZ A;  2XUB A;  3E6C C;  2KIU A;  3KE2 A;  4IJA A;  1WWX A;  3ABU A;  3V8J A;  4P5O A;  3GFI A;  2QEN A;  2EFW A;  4IHS A;  3DPT A;  5FFZ A;  1DPU A;  2JPC A;  4KT5 C;  1FBU A;  5J8F A;  2O61 A;  3H3Z A;  1Z91 A;  2RC4 A;  1KU2 A;  2FSW A;  1TW3 A;  4B09 A;  3VOD A;  4A2U A;  2IA2 A;  3FZV A;  5HVQ C;  3J81 Z;  2CW0 F;  5ED4 A;  2FNA A;  1U6G A;  1SFU A;  4LJZ F;  4E70 A;  1MGT A;  5D4S A;  1Z1D A;  4HW0 A;  1ZRC A;  2W24 A;  5HOO A;  1TQM A;  1A04 A;  2V1X A;  3T1B A;  2IPQ X;  1H9T A;  3ZN0 A;  2A61 A;  3R0J A;  3ZMT A;  3L9F A;  1I27 A;  3PQJ A;  1SD7 A;  4RGS A;  2R7D A;  4Q48 A;  1LNW A;  3F8C A;  3LFK A;  3VOE A;  4I98 B;  2XAQ A;  1WRJ A;  3M8F A;  4BYY A;  3MWM A;  4PGG A;  4EM1 A;  5K5Q A;  1R1V A;  2LF8 A;  1U8R A;  3MAJ A;  2W85 A;  1O7L A;  1PUE E;  1T6S A;  3RDI A;  2H09 A;  3TO7 A;  2EFP A;  2AXL A;  4HF0 A;  2ZME B;  4Y17 A;  1IN6 A;  1LEA A;  2BV6 A;  4I01 A;  3TDU C;  4ASN A;  3M1E A;  3KET A;  3COA C;  4KIC A;  5DD4 A;  3KCC A;  3CO6 C;  3FXR A;  4LMY A;  3L7W A;  4KFC A;  2A68 F;  3BWG A;  1R1T A;  3HHG A;  1ZAR A;  4HBL A;  1BM9 A;  4A6E A;  3HYI A;  4Q5S F;  2XAS A;  2XGX A;  4IHT A;  2YPR A;  5ERI A;  4ETS A;  2A6H F;  4ZYD A;  3WGI A;  3DEU A;  2GWR A;  3E5Q A;  4KMU X;  1JHH A;  1XSX A;  2WWY A;  1JGS A;  3VB2 A;  2F5F A;  3F8N A;  3O3K A;  2Y0M A;  2OQR A;  3WTS C;  1SD6 A;  4KA4 A;  2FRH A;  5LEJ A;  2GA2 A;  4BHP A;  4CZZ A;  3DV8 A;  2HWV A;  5CVR A;  1UCR A;  3IWF A;  2RN7 A;  4FX0 A;  5CVJ A;  3EYY A;  2RGV A;  1H0M A;  1G3T A;  2A3S A;  3ROU A;  1FP1 D;  1HW2 A;  1HKQ A;  5CLS A;  2VBX A;  4H0E A;  3B73 A;  2EV6 A;  4PZJ A;  3HRT A;  3RKX A;  2Z99 A;  3BDD A;  6PAX A;  3L00 A;  1O3R A;  3M8E A;  3KFW X;  1USS A;  3BPX A;  1SD5 A;  5IT9 K;  4I0A A;  2DT5 A;  1DPR A;  4P96 A;  4BHC A;  1DUX C;  4IF4 A;  2QQB A;  3ISP A;  2OBP A;  3LQR A;  3GZ6 A;  2YU3 A;  1MJA A;  1KA8 A;  2XIG A;  3J80 Z;  1BIA A;  1MJ9 A;  3RTR A;  2IP2 A;  4ENN A;  4HX8 A;  2F5D A;  1FT9 A;  2EK5 A;  4XLP F;  3T8T A;  5BOX A;  1G3W A;  2M87 A;  1XDU A;  1VTN C;  1MJB A;  1FWZ A;  3V4G A;  1QNT A;  5HS9 A;  4HA8 A;  2VE9 A;  3CTA A;  4PDK A;  2IRF G;  3FXU A;  1HXD A;  4S05 A;  2VXZ A;  1Y0U A;  1SMT A;  4OMZ A;  4OOI A;  2ZXJ A;  4M73 A;  3MCZ A;  4XRF A;  1F4K A;  3FWE A;  2A5Y B;  2MA3 A;  3RI4 A;  4OIO F;  2ZNZ A;  2CO5 A;  1S7A A;  1FSH A;  4HQE A;  4PCQ A;  4L9N A;  3H3U A;  3FHZ A;  3CUO A;  3I58 A;  3GVA A;  4ENJ A;  2PI0 A;  2RDP A;  5D4R A;  4BAY A;  1G6N A;  2HR3 A;  2DFI A;  2PMH A;  2V6C A;  4FX4 A;  3WTV C;  2D2W A;  1QZY A;  3RKW A;  4A0X A;  1RZ4 A;  4BXU A;  1J2X A;  2CFX A;  4GO1 A;  4A5M A;  1KYW A;  3PQK A;  5LRS A;  2VOD A;  3ZMV A;  3W6J B;  1U2W A;  1B4A A;  2NNN A;  3Q9V A;  4R79 A;  4LG0 A;  1W7P A;  2X0L A;  3ZMZ A;  3Q9S A;  4LB5 A;  5KK1 A;  2KIM A;  4RB1 A;  3MQ0 A;  1FLI A;  2WC2 A;  3FMR A;  2FNP A;  1BBY A;  3FXQ A;  4N9I A;  4HX4 A;  5KVR A;  2DO7 A;  1J5Y A;  1IXS B;  1IAW A;  4PGH A;  5CVV A;  4U7D A;  3IRQ A;  3K1N A;  4KMF A;  3M7G A;  1TW2 A;  4EMS A;  4R8H A;  5CVU A;  3P9K A;  1OYY A;  2HTJ A;  2PN6 A;  1CGP A;  4AIK A;  1O3T A;  2QBY A;  3LWF A;  1MD0 A;  2M30 A;  3IL2 A;  4L0Y B;  2W84 A;  1ZLK A;  4G94 A;  2VOO A;  2GXB A;  2UXN A;  3GWZ A;  4ESF A;  5F64 A;  3WGH A;  2H6C A;  4IRH A;  5CVI A;  2BE5 F;  2RVC A;  2ISY A;  4LLL A;  1UB9 A;  1P4X A;  1WI9 A;  3ZMS A;  4Y13 A;  2JZY A;  4DQ2 A;  2FE3 A;  4YFK F;  3GFJ A;  1HSJ A;  1J7K A;  2L02 A;  1QPM A;  2EJR A;  3WG9 A;  4MQV A;  2UZK A;  1SFE A;  2HDC A;  3I4P A;  1O3Q A;  1CF7 A;  5E17 F;  2QQ9 A;  2OAZ A;  5LHI A;  2E1N A;  3CUQ C;  1D5V A;  1LDK B;  1U5T B;  4CIC A;  2KKO A;  1FBQ A;  2ETH A;  3IKT A;  4HF2 A;  3L09 A;  1S7O A;  4L18 B;  2DPU A;  4O6J A;  5HDK A;  3HRU A;  3GFM A;  2EV5 A;  3I53 A;  4HAM A;  4KNY A;  5HLG A;  5LGU A;  5ILS A;  1KGS A;  4YFN F;  2LF7 A;  3QPH A;  5FLX Z;  5CYV A;  5HS8 A;  3FM5 A;  3P9I A;  3IC7 A;  4ZYE A;  3LAP A;  3QP6 A;  3SZT A;  1BC8 C;  1ZG3 A;  5E1W A;  4M6Y A;  5HLI A;  5DD8 A;  4NQW A;  1QBJ A;  2VN2 A;  1KQ0 A;  3OOP A;  3C1D A;  1ON1 A;  2EWN A;  2P5K A;  2VC1 A;  2QVO A;  4A5N A;  3K1M A;  3SFZ A;  2DBB A;  4RGX A;  4AIJ A;  1T2K A;  1NHA A;  1YTY A;  4M9S A;  1ZYR F;  1D3Y A;  5BMZ A;  1LDD A;  3LQQ A;  1YG2 A;  2P5V A;  1I6X A;  4ENK A;  1K6O A;  2ZKZ A;  3GLX A;  2V79 A;  3JAM Z;  1HKS A;  5AIQ A;  3KZY A;  4CDG A;  2BBY A;  5TJJ A;  5L3B A;  1PP8 F;  4XBF A;  3QU3 A;  1BOA A;  2IVM A;  2PG4 A;  4G6Q A;  2P7V B;  4MNU A;  1IN8 A;  3IKV A;  2GQQ A;  5AON A;  2NYX A;  2HYG D;  4I7H A;  3R0A A;  1XDS A;  2PMU A;  3TQN A;  1HBX G;  1O3S A;  2ZFW A;  5BS6 A;  1IRG A;  4ON0 A;  2IJL A;  3SHF A;  4ESJ A;  1B9N A;  2DU9 A;  3WGG A;  4UVB A;  2IT0 A;  2D45 A;  1UFM A;  3S2W A;  2K02 A;  4RGR A;  4YIF A;  1KU3 A;  3WE3 A;  3JSO A;  1RIO H;  4LG0 B;  2M1B A;  1W7P B;  5LRR A;  4AWX B;  2LNB A;  2JRT A;  2V9V A;  4GXO A;  2XVC A;  1HW5 A;  2MLK A;  3K9T A;  4EVI A;  4MEX F;  4XLN F;  2FML A;  1MKM A;  4JQF A;  2XKP A;  3TOA A;  1OR7 A;  4GCV A;  1B6A A;  2NAZ A;  4AD9 A;  1F9N A;  5LGT A;  2P6S A;  2K86 A;  3WOD F;  1SFX A;  2L4A A;  1P2F A;  2FMY A;  2V1D A;  2BEO A;  3GO5 A;  2UWM A;  1TBX A;  5J8C A;  3E6D A;  3KP2 A;  1G4D A;  4HDV A;  4P9F A;  3BJA A;  4HLX A;  2DQR A;  1PDN C;  5LBQ A;  1XGO A;  2QBY B;  3AAF A;  4EM2 A;  1SAX A;  2VBW A;  4MGR A;  2KRF A;  2DTR A;  3K2Z A;  3REO A;  4EV0 A;  4WF2 A;  2CQK A;  4YG2 F;  1J9I A;  1BN5 A;  1AOY A;  3DQV C;  1IW7 F;  3V8L A;  2YR2 A;  1IN7 A;  3KP7 A;  2F5E A;  2FA5 A;  4KN4 X;  3HIF A;  3GYH X;  5FD5 A;  4EQQ A;  3MEX A;  3CUQ A;  2QLZ A;  1T38 A;  5HLH A;  3DPL C;  2ADU A;  1CF7 B;  1UST A;  2L01 A;  1OPC A;  3O2P E;  2ZJ2 A;  1Z6T A;  5D5X B;  3J80 K;  1J75 A;  3WTY C;  2NNY A;  3JTG A;  5BQT A;  4A12 A;  2FXA A;  2VOP A;  4Y15 A;  4HV5 A;  3WE2 A;  1GVJ A;  1F5T A;  4EM0 B;  4UV8 A;  5ICE A;  1YLF A;  3Q5F A;  5EEG A;  3N97 A;  2ZNY A;  2VC0 A;  2YSR A;  2HGC A;  1YS7 A;  3QRF F;  1K79 A;  2HS5 A;  1J0R A;  1D8K A;  2EA2 A;  1ZG5 A;  1MDM A;  4MTD A;  4MHG A;  1FNN A;  1BI0 A;  1ZAO A;  5JR3 A;  5ILV A;  1LJ9 A;  4EGZ A;  5DV5 A;  4KIB A;  3ZP5 A;  3IHU A;  2Z33 A;  2A69 F;  1FOK A;  1V3F A;  5L3C A;  3BP8 A;  2RQP A;  4M9X A;  1EH8 A;  3WTX C;  4L9V A;  2MLG A;  2L4M A;  5JFR A;  4B8X A;  2DPD A;  3T0Y A;  2IA0 A;  1UHM A;  4RAY A;  3GX4 X;  3ZQ7 A;  2GZW A;  3E97 A;  1IXC A;  4UVA A;  2Y75 A;  4HYE A;  2CWE A;  3DXJ F;  2ZO4 A;  1W5S A;  3SXY A;  2XRN A;  5D5V B;  1U78 A;  5DYM A;  3NQO A;  5LHG A;  4OIN F;  5FO5 A;  4WXC A;  1R36 A;  4KIG A;  1XSV A;  3CDH A;  3BRO A;  5JVT A;  1KU9 A;  5A2Q K;  4HF1 A;  1ODD A;  3LST A;  3L2C A;  4OIP F;  2K27 A;  1T39 A;  3ZN1 A;  5IT9 Z;  1H9G A;  3OV8 A;  3CJN A;  1QZZ A;  5HS7 A;  3WTT C;  4UNO A;  2DW4 A;  3I54 A;  3C3W A;  1ZRF A;  3BJ6 A;  4ESB A;  5ICC A;  5E8G A;  3F6O A;  3RKY A;  3PFI A;  3FMQ A;  2L54 A;  3KEQ A;  2M5W A;  4LK0 F;  1WKM A;  5L3E A;  1S3J A;  4RS8 A;  2JT1 A;  4HOB A;  1K78 A;  1BI3 A;  5F1R A;  5E1Z B;  3ULQ B;  2Z9O A;  4BHB A;  3RPQ A;  3QPT A;  2STW A;  4HLY A;  1STZ A;  3HSE A;  5D8L B;  4D0P A;  1PP7 U;  2HZT A;  2F2E A;  2R3S A;  4RAZ A;  1KU7 A;  5L3D A;  5DUK A;  1FP2 A;  2J5O A;  2DK8 A;  1QQI A;  5IT3 A;  2P4W A;  2V1U A;  2HFH A;  2WV0 A;  1GXQ A;  5LGN A;  4FT8 A;  4UXN A;  2HEO A;  5K5O A;  1ZRE A;  5DCM A;  3QP5 A;  1LEB A;  1TTY A;  3U9G A;  2Q2E A;  3JW4 A;  4RGU A;  4TV7 A;  2HQN A;  2W57 A;  1W4M A;  2HYF A;  1T98 A;  1IZ1 A;  3QOP A;  5L3F A;  4AVP A;  3F3X A;  3GUD A;  3TDZ C;  4WWC A;  1ONV A;  1BC7 C;  2EA4 A;  3IRR A;  3BJO A;  4UVC A;  5ICG A;  3M9A A;  3CUQ B;  4ZZD A;  5DEQ A;  2H6B A;  2E1C A;  1I5Z A;  1YO5 C;  2D1V A;  4G9Y A;  4YII A;  2CYY A;  2JSC A;  2AS5 F;  2EFQ A;  3BOQ A;  3CLO A;  1REP C;  5LLQ A;  2NRA C;  5FLX K;  4N0B A;  2Q8K A;  3ECH A;  5LEK A;  3KP5 A;  3GZ5 A;  2UXX A;  5BPI A;  3VFZ A;  4I0B A;  2GIV A;  2ESH A;  3FMS A;  2VON A;  2P8T A;  1U3E M;  1W7P D;  2G9W A;  1GHC A;  1MDM B;  1FSE A;  2E7W A;  4CO8 A;  2YX7 A;  2CGP A;  1XCB A;  3LAJ A;  5EEH A;  1G3S A;  4XSX F;  3EUH A;  4HZF A;  3J7A O;  1LVA A;  1R00 A;  1WSU A;  1TQP A;  3DF8 A;  3KP4 A;  2ACJ A;  4LGW A;  3HSR A;  4M71 A;  4U0Y A;  4G7O F;  1E17 A;  1YW7 A;  3ECO A;  4A6D A;  2DK5 A;  4Q4Z F;  1B9M A;  2ESN A;  1ZHF A;  4I2O A;  1FYK A;  2VBY A;  1E2X A;  3EYI A;  3HOS A;  1IF1 A;  2Y48 A;  3T5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...