1USWA

Crystal structure of ferulic acid esterase from aspergillus niger
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
260
structure length
260
Chain Sequence
ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPADEGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Feruloyl Esterase a from Aspergillus Niger Suggests Evolutive Functional Convergence in Feruloyl Esterase Family
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
molecule keywords FERULOYL ESTERASE A
total genus 84
structure length 260
sequence length 260
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uswA00
4GXNA 4EY8A 3O95A 1FFBA 1ZGBA 4UBOA 4B0PA 1YAHA 3STUA 2WHPB 1JI3A 4DMCA 4UUQA 3RKSA 5AK3A 4IH1A 4B82A 2G5TA 2C58A 3B3QA 4U2CA 2R11A 4RE6A 1XRRA 4FBLA 4DNFA 4LHEA 2ORYA 3R3ZA 3WWPA 5AM0A 2BKLA 3SC2A 3IVMA 4Y2UA 4UBJA 1CV2A 3WWCA 4QA9A 1QIHA 4DM7A 4BE9A 2DR0A 4DMKA 4ZREA 1EK2A 4X97A 5ISMA 4KE9A 4UBNA 1DT3A 4KRYA 3PICA 2XQFA 4NZZA 2WM2A 5ALEA 4TGLA 3LIIA 1UT6A 3DDUA 4CIAA 2XUPA 1DT5A 2RHTA 1QTRA 4DMHA 5JADA 2V9ZA 3H17A 1KU6A 1QOZA 4PW0A 3AZQA 1LNSA 4C6HA 4KAFA 3H19A 5ALLA 2WKWA 4H7HA 1CPYA 4PV7A 4XJVA 5CT8A 3BIWA 1A7UA 4UHEA 4BCDA 2ZSIA 2CUTA 1P0QA 2JGEA 2C0QA 2ACEA 3FLEA 3FCXA 1UFOA 1SC9A 1EDEA 5K3CA 4BVJA 3WZLA 2Z8XA 5AI6A 1PJAA 4W1RA 5HF5A 1CRLA 5K3FB 5JASA 4UBLA 3TGLA 1DQYA 3R41A 4FFWA 1XZDA 5CT4A 3WLAA 4BYMA 2HA6A 4W9RA 2VJDA 5AK5A 3EBLA 4CG2A 1SCQA 5JAHA 3QMWA 3PF9A 4C4YA 3N0TA 1SFRA 3PDCA 1EHYA 3ESDA 1HDEA 2ZJ6A 3KXPA 5FRDA 2D5LA 4LXGA 4LYEA 5ESRA 3HACA 4AO8A 5JAPA 3JWEA 1VLQA 3ESCA 2HU7A 2VSQA 3GA7A 1A8SA 2OXEA 4KAAA 2OGZA 3ESAA 1G42A 1L7RA 1UKAA 3C5WP 3C8DA 2WIGA 5AIBA 3FNBA 2J4FA 3HJUA 1BS9A 4DSZA 2AJCA 4AO6A 1YS1X 3DJYA 1EVQA 5ALRA 1L7QA 2WHQA 3V48A 4GHWA 5DWDA 4O08A 3OC0A 2PVSA 3I2FA 3H04A 3K6KA 3G7NA 2FUKA 1GGVA 3MUOA 1THGA 5ALZA 5A7HA 5CH8A 1FSSA 4OD0A 4B0OA 5AI4A 2HFJA 3BF7A 4P92A 1CFJA 4QDOA 1XRMA 3DKRA 4MEAA 1WB5A 1XZAA 3WKDA 5C7YA 1S8OA 4J0JA 5CRIA 5CTAA 4CG1A 4M0FA 4C4XA 3LIPA 1ORWA 2I3DA 4H77A 5BV7A 5LP1A 5FOQA 1J1IA 5FPPA 2HA7A 2WIFA 4Y2SA 3G0CA 4UHDA 3H0CA 3DNMA 1C4XA 3G0DA 5ALIA 5CH3A 1K8QA 3FOBA 2WUFA 2HADA 3CCCA 4HRYA 2ZYRA 2X76A 5AOAA 5AM4A 5FV4A 3AZPA 4QDXA 3DEAA 2QTBA 1F0NA 3STVA 5JD5A 2XUFA 1EXWA 4QEKA 1BEZA 1RWQA 2JGJA 3K9BA 4UHHA 4DGQA 1O6FA 2BUCA 5T4FA 5EHQA 1ACLA 1GZ7A 3D0KA 1HQDA 4CFSA 3QZUA 5EIHA 3B5EA 4J0DA 1P0MA 5LKRA 4L0CA 1FFDA 2VJCA 5K3BA 1MX9A 5J3JA 3BDIA 4DNOA 5HKBA 3EQ7A 3WWDA 2OQIA 3CCBA 2O2HA 1W75A 5A7GA 4WFKA 1AZWA 1L7AA 1XKTA 2BGRA 4D9JA 1CUSA 1AGYA 2WUGA 4ZRDA 1WB4A 1E66A 2WJ4A 4K6GA 1NU6A 3V9AA 2RGUA 1YAJA 1W1IA 5H3HA 2RI6A 2V96A 2WILA 2Z3WA 3WJ2A 2RAUA 2WQZA 4UBKA 1AKNA 4UBIA 2EDCA 3ESBA 5CT6A 1XZCA 4P08A 4ETWA 4OB8A 5T4HA 3O4IA 5HZGA 1AUOA 4BDSA 2YH2A 1E89A 1JJIA 1LPBB 4HAIA 5LZ5A 4IQ4A 3AINA 1XZBA 2HA2A 1E5TA 1MAHA 4FHZA 3KD2A 4Y2TA 4BP9A 3G02A 4DYHA 2VAVA 4UHCA 4WDRA 2JBWA 1XZGA 4Y2PA 3OURA 3M3DA 4Q3KA 3AUKA 1CUXA 4X93A 4HZGA 1FFAA 4EHBA 1GKLA 4AMZA 4Q34A 4ZWNA 1G5FA 3LCRA 5DNUA 3AFIA 1ETHA 3HRHA 5LIPA 2I03A 2CJPA 5DYTA 4RNCA 4PNZA 1RP1A 3AZOA 3HI4A 1XRPA 3RARA 2X8BA 1FFCA 2GYWA 5AP9A 4HXEB 5ALWA 1ZJ4A 4Y2RA 1NU8A 4C01A 4IH4A 5T4EA 1R9MA 5AI8A 1R9NA 1CUCA 3IDAA 3WA7A 2I3ZA 5AHXA 5K3EA 2ZJ7A 2XUGA 4FMPA 3N2ZB 4WDQA 4KRXA 3GROA 1MN6A 5LZ7A 1G66A 1EVEA 1DX4A 4PSUA 1FJ2A 5AK6A 4IO0A 4G8CA 3C87A 1GPNA 4GECA 3BXPA 3JW8A 5LZ8A 2RONA 4E11A 4PSCA 1BCSA 1EA5A 3AIKA 3WYNA 3KWFA 5KREA 2OPHA 4E15A 2QUBA 1HBJA 1UOPA 4KR0A 1QIGA 3F97A 4B9EA 3QVMA 4H7FA 5ALXA 3QH4A 2BFNA 3HXKA 3F67A 4C87A 3Q0TA 3R3WA 2WFLA 1XQXA 5A71A 2HFKA 4WFJA 3KSRA 1WPRA 2HA5A 1UKBA 2QM0A 2O7VA 2EEPA 3JYHA 2HA3A 5EHZA 4LIPD 3WK7A 5IH7A 5HQ3A 3DYIA 1UK8A 4B80A 2ACKA 2LIPA 3IUMA 5LZ4A 5AKLA 5F4ZA 4F21A 3H2GA 3I2HA 2OCGA 2ZYIA 2WG0A 2VATA 5C8XA 3D2BA 5ALQA 4H7IA 3QBJA 1ODSA 3WK4A 1K5PA 4J0HA 3A2NA 3DL7A 3EIOA 3C6YA 1IUPA 3WL7A 1MU0A 1DTEA 3PUIA 4U2EA 4KEAA 1QO9A 2BCEA 2H9YA 4X7BA 1ODTC 4FDMA 3STXA 2ZYSA 4OPMA 1BN6A 2ECFA 3F96A 2XUDA 4GLBA 2QRUA 3DQZA 1LPNA 3OTQA 5CH5A 4DTCA 3WL6A 3BL8A 4CCYA 4BTVA 3IBTA 3V1KA 3I6YA 2XMBA 4Q05A 4KE6A 3FVTA 4H7DA 4H7JA 2JGMA 2C0PA 2HDWA 1UOOA 5AKJA 2Z3ZA 5AH0A 5FPQA 2HA0A 2OCKA 3S8YA 1BRTA 4YK7A 3RM3A 5I7UA 2YYSA 4ZV9A 5FP0A 4BE4A 3U1TA 3W05A 5HFAA 3FYUB 4GDMA 3HC7A 2QJWA 5EFZA 1YB7A 5LYYA 3PUHA 1VA5A 1XRNA 1TRHA 4LKOA 4WY8A 3ICVA 1HKHA 2YXPX 5AKYA 4B9AA 1SCKA 3IUQA 4PO3X 1CLEA 3FSGA 4YPVA 2HHAA 1ZD4A 4H7EA 5HF9A 5A7FA 4INZA 1EB9A 1TQHA 3H1AA 4W1SA 1H23A 4H35A 3X3HA 5EIAA 5JD6A 2P8SA 1ZOIA 5AM5A 2JF0A 2OAEA 3YASA 3Q8WA 2W6CX 4CG3A 4ITVA 5AM3A 1VKHA 3D2AA 2QS9A 1XFDA 5EIEA 3IULA 3D3NA 4OU4A 4X91A 3PI6A 4N5HX 4H7KA 4L9AA 2XLCA 1JT2A 2WFLB 1XLVA 4B83A 1QTIA 1EH5A 4HXFB 1K63A 1W4LA 3R0VA 5AOBA 3F98A 3WWEA 2C5FA 2ONCA 3W9UA 7YASA 5IVIA 1DWOA 5IVKA 3UMJA 2WFMA 3VKFA 1MO2A 1LPAB 3D5EA 2HA4A 5ALMA 2QUAA 1BCRA 1UOQA 1CUDA 5JANA 3QPDA 3D59A 4UBMA 3IUNA 3WL8A 4U2GA 4WJLA 3BF8A 4A23A 3WIOA 1B41A 4AZ0A 1E8DA 2PUJA 1ORVA 3NWOA 4OU5A 1IUOA 3I6ZA 1LBTA 2CB9A 4X92A 5T4BA 4X6UA 1THTA 2DCMA 1DWQA 2PX6A 1GPLA 1O6GA 5EHNA 5JIBA 1MNQA 4MWSA 1QIKA 1QIFA 2PSHA 5CURA 1EK1A 1Q0RA 4PQEA 3DL4A 2I78A 1Y37A 3C6ZA 2JGIA 1AC5A 2PSFA 1N1MA 3A70A 4J0KA 4H18A 2VEOA 2WLSA 2RIPA 3A2LA 3IB3A 3B12A 1ZICA 2OGSA 4I4CA 3ZPXA 3CN7A 3R3UA 4J03A 1XZMA 3OOSA 5AIAA 1EX9A 1I6WA 4BAGA 2XUAA 1XLUA 3MGAA 1GKKA 2PU5A 5AM1A 1QIEA 3PFCA 2G5PA 1YB6A 2XLBA 1GT6A 4J0CA 3STTA 2WHRA 4FWBA 3PFBA 1CUBA 1ZGCA 1H2WA 4HVTA 3G9TA 5K3AA 5HFNA 3G9ZA 4KYVA 5KWIA 2O2GA 4CI9A 2AJBA 3LS2A 5CW2A 4DMFA 2Y2VA 1CUUA 4ARBA 4RE5A 5A6VA 1TCBA 5E4YA 3M82A 5EHXA 3V1MA 1LPOA 5ALDA 4QLOA 3G0BA 2OCIA 3R3YA 5JAOA 4E46A 3HLKA 4F5ZA 3KWJA 2GZRA 5AKEA 1HLGA 1Z68A 2XMQA 3I1YA 2VT7A 4OB7A 4FBMA 1LZKA 4BAUA 4QZVA 2H7XA 1E3QA 2HM7A 5SYNA 4Y9SA 5BWCA 1J2EA 2VJBA 2WJ3A 3QMMA 3STYA 3WKEA 1LPMA 3H2HA 4BDTA 1LGYA 4JUIA 2DHDA 2XUOA 2WSLA 4QLAA 3DD5A 1QIMA 2BAGA 3HEAA 2QT9A 2Y6VA 4QDUA 3R3VA 2V98A 1CIJA 1ZIXA 1R88A 4UFPA 2QR5A 1ZI9A 3QITA 3FYUA 1QIDA 4UFNA 2BUAA 3M83A 4Y2XA 3G0IA 5DJ5A 2XQKA 3H18A 4EB0A 5SYMA 4W1PA 4FTWA 4FLFA 1U8EA 3EQ9A 1FFEA 4Y2VA 1CUZA 1JKMA 1DQZA 4HS9A 4NS4A 5AOCA 5JZSA 4B7ZA 2DQZA 5JAUA 3O4JA 1AQLA 4Y2QA 1W76A 3WI7A 3GFFA 4G1FA 1CUYA 2QXTA 3AIMA 2W22A 5E4JA 4JYMA 4BVKA 5ALYA 1DINA 2FJPA 1CUWA 4U2BA 4AN0A 2XI4A 4QWMA 3TJMA 3IA2A 3ZI7A 5ALJA 5AICA 5ALNA 1Q83A 1ZJ5A 2WG2A 4G4JA 4Q1VA 1BEEA 4FLMA 4N8SA 3CN9A 3VJMA 4EBBA 5EI5A 2JIDA 4MYDA 5K5EA 3WL5A 4UPDA 4BZWA 4UHBA 3GBSA 4BRSA 2WIKA 2XQJA 4X6YA 3ZLTA 3FBWA 3FYTA 2B4KA 2HRRA 1F0PA 3W06A 3WK6A 4QNNA 2HL6A 4H0CA 4EY5A 4HRXA 1JFRA 3MVEA 1UZAA 4GBGA 2PSDA 1X70A 1CUJA 4ROTA 2WJ6A 4EUSA 3F9CA 2E3JA 3SK0A 4AO7A 2XT0A 3G9UA 4BZZA 3SWWA 3FYUC 1WOMA 4AZ3A 3TEJA 3LP5A 3WK5A 4JEIA 2PKYX 1OCEA 2QKYA 5CBKA 3PF8A 5AKGA 1USWA 4U2DA 5CT5A 4EY4A 3L1HA 1XZFA 5ALSA 3S2ZA 2DQYA 5FKJA 1PV1A 1A88A 1VOTA 1WCYA 4GWLA 1XROA 3WK8A 4UFOA 2PU7A 3ED1A 1LBSA 4YASA 3OPMA 1VE6A 2AJDA 4JH0A 1QJ4A 2WFZA 3VISA 5AK4A 3VJLA 4A16A 5BWBA 4P93A 5JATA 2OG1A 3GELA 4LYDA 1XRQA 1KEZA 2CKMA 3E1GA 1K6EA 1WHTA 5IVDA 1QIJA 2GYUA 1GXSA 4A5SA 4W63A 3HABA 5I8PA 1CUAA 1PFQA 2VAXA 4QDZA 3NOXA 3ZWQA 1J07A 4L3WA 4X71A 4MQMA 2H1IA 5ALUA 4W1QA 4BC1A 5JYCA 4LXHA 6YASA 1ZD2P 4RGYA 3EQ8A 5AKXA 2NW6A 2JEZA 3I6MA 3F8SA 1ZD3A 4X90A 2GYVA 4N8DA 1YA4A 1N8SA 5C8VA 2QVBA 2VJAA 4C4ZA 5FLKA 1UKCA 2PUHA 2Y6UA 4JNCA 4OUKX 2CEKA 2XE4A 4QE3A 5JZ9A 5A2GA 3O4GA 1QGED 4EY6A 3TRDA 4F60A 4MJ3A 2RHWA 4OB6A 3C6BA 3PE6A 1LPSA 2OAGA 1EDDA 1BROA 1XZEA 3IURA 1JMYA 3D7RA 1F8UA 1EI9A 2QZPA 3RK4A 1NX9A 4N5IX 4XVCA 4J3JA 2WU4A 1ACJA 3DLTA 3KOOA 5IKXA 4CIBA 5CXUA 2D0DA 2WIJA 4JYPA 1CUIA 3HYSA 4OYLA 4WCVA 1IMJA 1DX6A 3O0DA 5HQ3B 1YSCA 5YASA 1YASA 2O7RA 1QO7A 3V1LA 1ZIYA 1T4MA 4GI1A 3H2IA 2OQVA 3D4LA 5DNVA 3O9VA 3WKBA 5LZ9A 1ZI6A 1Y7HA 1JMKC 3ZLUA 4UHFA 3C6XA 5ALKA 4Q3LA 4I19A 2VA9A 5HK8A 1X2BA 4NMWA 4C88A 3LLCA 5DTJA 5HKAA 4M0EA 4Q82A 4K5QA 2GBIA 2HU5A 2AJLI 3WJ1A 4B84A 1U65A 4B85A 3AILA 1BE0A 2YASA 3ZLVA 4BCBA 1T2NA 4AB1A 3CXUA 3T4UA 3AIOA 1KU0A 2B20A 1TCAA 2ZVDA 1CUVA 1C7IA 5ALOA 5ALHA 3DKKA 2AJ8A 4L72A 4FFVA 1JJFA 4X95A 1GPKA 1YA8A 2Y1KA 5AI0A 1WM1A 1DWPA 1M33A 2EDAA 5AI9A 3IIIA 3OG9A 4KACA 1K4YA 4C89A 4FLEA 2XMSA 1CUEA 3GUUA 4XIIA 1TKRA 2B61A 2O2IA 5ALPA 1B6GA 4AXBA 1W52X 2WTMA 5AKZA 3QPAA 3I28A 4ZI5A 5D3ZA 3VDXA 2PBLA 3KDAA 2AXEA 4KE8A 2OGTA 3G0GA 4DLNA 2XUKA 3BJMA 4BP8A 4LXIA 2QMQA 2OLEA 3H1BA 3NUZA 1MPXA 2XUQA 4PSDA 5K3FA 2IIVA 5BOVA 1MNAA 1ISPA 5LKAA 3DOIA 4TPKA 5ALFA 3V1NA 3G8YA 2J3QA 2FJ0A 1MJ5A 4IH9A 3WK9A 5AJHA 1GQRA 5C81A 4CCWA 1MTZA 1DU4A 3BWXA 5DYWA 3STWA 2DHCA 3VVLA 2OCLA 5D6OA 2IX9A 3G9XA 2IITA 5JZBA 1ZI8A 4E14A 5AM2A 3BDVA 1UK6A 3C70A 2XDWA 1UK7A 3BJRA 3D2CA 3QM1A 1A8QA 3C45A 5AO9A 4G4IA 4J7AA 3HSSA 2XB6A 1UXOA 4DNPA 4FNMA 4AX4A 3WQHA 5CXXA 3VXKA 1JU3A 1IUNA 1JU4A 2XMRA 3NGMA 5HCUA 4Z49A 1XZLA 1P0PA 1VZ3A 3FVRA 4ZXFA 4ZGBA 1WPXA 4FKBA 1MX1A 1LPPA 3UUEA 2GBGA 1QIIA 1H2ZA 4S0XA 2WU3A 3A2MA 5ALVA 4N8EA 3FWHA 4X00A 3L1JA 1J06A 1VZ2A 3E4DA 2H7YA 3W04A 4XX1A 3AJAA 1IVYA 1P0IA 4BRZA 3W9BA 3W2TA 3ICWA 5CT9A 2WUDA 3C8HA 4BCCA 4FOLA 2CBGA 4KE7A 1HPLA 4WY5A 4NVRA 5AI5A 4AN1A 1U2EA 2JGFA 1XRLA 3C5VA 3ANTA 4PF1A 1MX5A 2ZYHA 2XQGA 4HXGA 5KBYA 3R3XA 2H7CA 5AKHA 2WHPA 2Z8ZA 2B9VA 3C43A 1N5RA 3I2KA 3BIXA 1CR6A 1CQZA 3DOHA 1XZKA 4Y2YA 3VJKA 1WB6A 5ALGA 1XQYA 5DLPA 2QOEA 1OILA 5E2IA 2QXUA 2GZSA 3RLIA 3H2JA 2C7BA 1C7JA 2PPLA 4G9EA 3OM8A 3ILSA 2WIDA 1WHSA 2XMGA 5K3DA 5A62A 1E8NA 3HZOA 1LLFA 3O9MA 4OSEA 4KJXA 5AKIA 5D7BA 4MQLA 1TCCA 1UWCA 2XUJA 3UUFA 1G4HA 2JEYA 5IVHA 1R50A 1VJ5A 4X6XA 2C4HA 2G4LA 2DHEA 4BBZA 4ARAA 1D07A 1QE3A 3WIBA 1R4ZA 1AX9A 2HRQA 1VXRA 4I3FA 1AURA 3QYJA 1IZ7A 3IUJA 2ROQA 1XZHA 2WG1A 3QMVA 3T52A 3FAKA 3P2MA 3I2IA 1ZD5A 1CUHA 2PSEA 1XZIA 3FLAA 2J4CA 3FCYA 4K2AA 1UK9A 2XUIA 1R3DA 1E8MA 4MEBA 5LZ2A 4J0IA 2ZSHA 4EA6A 1XQVA 4FNGA 5AKKA 2BGNA 2Z5GA 2X5XA 2ES4A 4BC0A 4OYYA 2VT6A 4EZIA 2PL5A 1SOMA 5CMLA 3WWOA 3DYVA 2DSNA 1QFSA 1W6RA 1CEXA 3WKCA 4F0JA 4M0MA 1X2EA 4KAJA 3WA6A 1MT3A 5DNWA 4G9GA 3I2GA 4OCZA 4DIUA 5E4TA 2V97A 5HF8A 4IHAA 4X94A 1Q0ZA 2C5GA 2XUHA 3I2JA 4CCYB 1CVLA 5EGNA 1IZ8A 1YR2A 4QWWA 4B81A 1H2XA 1H2YA 5HK9A 2BJHA 4BATA 2VF2A 4BVLA 4U2FA 1RYYA 2WTNA 1GQSA 5KWJA 1EDBA 4G8DA 1F6WA 2DFPA 2J3DA 3FLBA 2QJRA 2R8BA 4AQDA 3SX4A 5FUMA 5FDFA 4DSAA 1EINA 5LLSA 2FX5A 3I1IA 3WKAA 5I9IA 1XKLA 5FXMA 1SCIA 3U0VA 3O4HA 4J0GA 4DNQA 1QLWA 4G4GA 5C8ZA 1BN7A 1VE7A 1VXOA 3GZJA 4MYSA 1Q84A 3QPCA 1R1DA 1TIBA 2XMZA 4EY7A 1A8UA 1XQWA 1CUFA 2PSJA 1CQWA 3ANSA 4RPCA 4XWGA 3ZV7A 4TVKA 3WYDA 5HF6A 4Q3OA 4K6KA 1CUGA 1Y7IA 1QFMA 4G8BA 2CMFA 5JALA 4Y7DA 2XMDA 1N5MA 2JGKA 4BB0A 3DCNA 4X3CA 1TAHA 4BTLA 2VTVA 4GEGA 3EF3A 1HL7A 1EB8A 2K2QB 2JGLA 2G63A 4B6GA 3FSGD 4MXDA 2UZ0A 2PM8A 1YS2X 2HU8A 3VVMA 2HIHA 4GW3A 4AMYA 3E3AA 3R40A 1H22A 2WUEA 2ZJFA 2Q0XA 3M81A 5DTIA 3MUNA 4ZV7A 2CZQA 1QZ3A 4QDTA 1BU8A 2BUBA 1AMNA 3WZMA 1QONA 3E0XA 3L1IA 5JD4A 5ALTA 5JARA 1ODCA 4MWTA 1VA4A 1OXMA 2Y2UA 1MAAA 2XMCA 1TK3A 4Y2JA 4X85A 1YCDA 1JJBA 4HTAA 5DYYA 3DS8A 4G5XA 4K6HA 3WMRA 5D3KA 4P9NA 4BAZA 4YX9A 2XQIA 2GBCA 3K2IA 4WFIA 3BE8A 3A6ZA 3H2KA 1LZLA 1U4NA 4V2IA 1XLWA 2GBFA 2VQ6A 1XZJA
chains in the Genus database with same CATH superfamily
1JALA 5CM2Z 3O95A 4IIFA 1ULSA 5FOUA 4DCOA 721PA 3F9RA 3K6SA 4YRJA 1V71A 3VOTA 2H65A 1FW8A 1EE1A 2JBAB 2C2KA 3I73A 4NCXA 3R09A 3U9SA 3RABA 1A1SA 3N0XA 4CETA 2IA5A 1NG9A 3BGOS 4Z8YA 2Q3FA 4NFSA 3H84A 4JJIA 3EDOA 1TZBA 2XCSB 3ZVKA 2WDZA 1RPJA 4OLJA 1E6KA 4RE6A 1XRRA 2W5UA 1VI6A 3LBNA 4AJ2A 2G25A 4HAWA 4PXAA 2ORYA 3QIAA 1UINA 2ZITA 3KHKA 3RUAA 5KOHA 2J08A 1VL2A 3Q5GA 1AE1A 1R6TA 3INRA 1CZKA 3GD7A 5LQUA 1YB2A 3TTWA 3CKYA 2GPYA 4N4AA 4NICA 4ERNA 4UBJA 3KCQA 4TXMA 3WWCA 4CRWB 1I1OA 4QPJC 4TKLA 4Z54A 5KDLA 4ZAFA 5JCXA 5MFZA 2FEAA 5CFZA 2F3PA 2DR0A 1PT8A 1Y6QA 1L4BA 2PAFA 2PRKA 2X5NA 3KL2A 4MYRA 4TV8B 4BX2A 4F5DA 1UPAA 3LFUA 4U00A 3T3NA 2Z9BA 3CKKA 2PPVA 3QX9A 4MKIA 3AEYA 4ZZ1A 2YVQA 4LMBA 1SO8A 1YD7A 3TMYA 4LF7B 4NZZA 1HEIA 3KT6A 1SKYB 2ZIEA 4GD3Q 4ZO4A 1WLSA 3VNSA 1QE0A 2R8OA 5ALEA 1KDPA 2AEJA 3QELA 1QH0A 1ZS9A 3THWB 4P6VF 2ZETA 3G8BA 3M6IA 4CIAA 3QVXA 2PZAA 2GKGA 3OPYI 3EXHB 3PC2A 4ASUD 3ADPA 4RM2A 5IAGA 1P5JA 2I34A 2ZIXA 1M1NA 4DMHA 5C5CA 5JADA 4P7KA 4BMPB 2E49A 4LF4B 1R00A 3FPCA 1RKVA 3G3EA 1P3JA 2HYDA 4CHGA 1I7LA 3IBSA 4IDGA 2DCUA 2IYXA 4RENA 3AJEA 1XEWX 1OVMA 3AWIA 3VYWA 1LNSA 2M1XA 1B26A 3C16C 4KAFA 3T38A 1U2ZA 1TD9A 3OJ0A 5ALLA 2XJ9A 4EZBA 1UP6A 1OLOA 3PFIA 1RXCA 3BIWA 1NOJA 4IJ5A 2IPAB 1MXFA 4EVQA 4RFSA 3V33A 5ADHA 3ICCA 4W8HA 2XIQA 4E5DA 3TX6A 3DVAA 1EDOA 4BCDA 5LOVB 2ZSIA 1A9XA 1TJ4A 3AFOA 2PA3A 1A7KA 1P0QA 2GAIA 1S01A 2JGEA 1O95A 2R1TB 4IQFA 2ETXA 2C0QA 3P2EA 4AU1A 4B76A 5THXA 2FMUA 1NPYA 3RLFA 1ZN2A 2ZIZA 1IAQA 2EXXA 1XLTC 4AC9A 1WO8A 2JH8A 2RGCA 4EJFA 2I1LA 5D5PA 1NYLA 2P11A 3K4PA 1F9AA 1TJNA 4FCWA 4KSYA 1UANA 1MMFB 1U0TA 4R8VA 4LPKA 3BFKA 5H68A 4XR9A 3VUEA 4HAZA 4BVJA 2CLDX 3TOZA 1SVWA 4LG1A 2BKUA 3PEEA 3A6DA 1VL6A 1CT9A 5FJJA 3WZLA 4LXXA 4P34A 1PJAA 2CUKA 4UU0A 2WU8A 1CRLA 4NYIQ 5CVDA 3TGLA 2WINI 1N2EA 4QVIA 3HO1A 1DQYA 5I5GA 6AT1A 4KHPB 1U2SA 3Q8KA 1I4LD 2QTNA 1UWKA 3JD1A 4P3OA 3E03A 4URHA 3WLFA 3CRZA 5SY9A 1Q44A 2H5IA 4MV5A 2OYCA 1E9VA 5I8WA 1C0KA 4HV4A 5AW0A 3GGJA 3LHIA 5T3YA 4CG2A 4DKJA 4FMCF 1DG3A 4BNFA 3ZI0A 3ZN2A 5FJIA 4UPVA 5FTKA 3N0TA 1ORDA 2QRVA 3G23A 3GGGA 3NC4A 1HFKA 2WUWE 3ANNA 4X8HA 2FW7A 5TVGA 1WVIA 2Z04A 4PLPA 3MG9A 2Z2IA 3PDCA 4KNWA 2J9YB 4TWJA 1K97A 1V3UA 2ZRCA 1E0KA 4K7JA 2IYZA 4YCJA 4DB2A 4TRJA 4S12A 4CUKA 3RC8A 3CTMA 2IHBA 5AVSA 3JYNA 4BVAA 4CEIB 1GUYA 4TV9A 3R4VA 2QTRA 2AW3A 2R79A 4HHEA 3UB3A 3COPA 5IEBA 4HWGA 5JAPA 4S04A 1ODKA 1HNZB 2C3YA 4FFPA 2PGOA 2H2DA 7MHTA 4XIGS 3G0HA 1A8PA 4AI6A 4G07A 4HH4A 3QI2A 1KNQA 1FYEA 3ETGA 2LKDA 4WZBA 1Z36A 4QFBA 1BMFD 2FN4A 2HU7A 1JLKA 1HEYA 1T4CB 1ZM3A 2R00C 2VSQA 1D3AA 3ZXIA 2PLAA 1A8SA 3HXPA 2Z4RA 2BKVA 3BK1A 3JQPA 3VPAA 4RKQA 4RY9A 3UFXA 8ATCA 3C1TA 4FDAA 5T5QA 1BMTA 1IHPA 2OGZA 3ESAA 4XYMA 2O8FB 1L7RA 2PFSA 1FOEB 4KFRA 1EFHA 5AIBA 1ZL0A 2JVJA 5IS2A 1GU0A 3C6MA 3A1NA 3V7UA 4G9BA 1VP3A 2GPJA 2WNIA 3QVGA 4C0QC 1DRJA 2B5OA 2E4AA 1BS9A 2OXCA 2HZ7A 2AR7A 4BWGA 1N5OX 2B78A 3EJWA 2ODPA 3GB9A 4V3CA 3RWOA 2HSWA 5A4FS 2P78A 2F8TA 5G0TA 3GG9A 3JAKA 1VJGA 4JLWA 4TYWA 1S3GA 4GHWA 4LY6A 1ST2A 4HWKA 1MDFA 4W7IA 5D1NA 1XL1A 3V32A 3SFTA 2ZTLA 3QVOA 5A4MS 2PVSA 3OC0A 5JAZA 3K6KA 1XNQB 1I5OA 2GDJA 2VNKA 3K1TA 3WP1B 2Q0HA 4KBFA 4G24A 2IOYA 3EPPA 5CH8A 1P33A 5FD8A 5A7HA 3IMFA 1T1IA 2G08A 2GAOA 3BH0A 1DAOA 2YUTA 4OD0A 1B8NA 4JJGA 4GLLA 1G63A 5CLHA 3FVWA 4Q18A 4OXKA 2VJPA 3ZK8A 3ZJ5A 5J2TA 1KEVA 3ENVA 3NBKA 4QDOA 1PS9A 3V3TA 4FI3F 1XRMA 3WGKA 4F71A 1V35A 3DKRA 2PL1A 3KDPA 1WB5A 3OFND 1XZAA 3I9NA 4XARA 5FYDA 3VHLB 3EC7A 1JG4A 2OA0A 1S8OA 2W98A 4MV3A 1FUUA 2WWGA 5EVJA 1Q3TA 1GZUA 1IFXA 2HMUA 3G2KA 4J0JA 2HO4A 4MPDA 1BMDA 3OZBA 2G1UA 2JIOA 4JAVC 1CW2B 2O2SA 3USZA 1SVLA 1L8OA 3COWA 4BEJA 3PX7A 3NONA 4HEQA 1SBCA 2I3DA 1R5NA 5BV7A 5LP1A 4X1YB 4XLZA 1I4OA 4Z2AA 5IWAB 1IEVA 3PD7A 1EJ0A 2A33A 2WP8J 1KR5A 3QTLA 4H4CA 4AIIA 2XT6A 1NJ1A 3CKLA 3MJVA 4Y2SA 3E18A 2X41A 1Q16A 5CG1A 5K01A 4M9CA 1B8VA 1UUFA 4G5OA 2L17A 3FMIA 1JDVA 4G0XA 2WJHA 2PZ8A 2Z30A 4KO1S 3ZBTA 3NGLA 3FDIA 3NASA 1K8QA 2RAFA 3QYFA 4WXYB 4Z0HO 1JBEA 1UIMA 2CVOA 2X76A 3Q1KA 4PANA 3BS4A 2V0GA 4MW1A 4C2UA 2GETA 5E9AA 3I09A 4RZHA 1AZLA 4IIUA 5AOVA 1D6JA 1XEXA 3HWX1 4R83A 1LW7A 4IFBA 3QE0A 1M8JA 4LQDA 3KTAB 4JLAA 4IJVA 3EXIA 1DZ3A 4QEKA 3T5PA 1BHSA 2HN9A 4BO1A 3L4BA 1LLCA 3MGBA 1EFCA 1FRNA 3O2NA 5JRZA 4TTJA 1NVEA 5HIAA 2D13A 3ET4A 4UHHA 1QPGA 3QU7A 2Y93A 1NT4A 3ANMA 4U6NA 4LWZA 4BNIA 1W36D 5EHQA 3IOYA 1C9YA 1SXJA 2EWMA 1OZHA 3HEBA 3L6OO 3SMVA 2C7RA 3B1VA 3BCRA 1HFJA 4RMIA 2CMDA 2VWGA 3PNLA 4P3XA 1Z5ZA 4X8OA 4LDRA 3IA7A 2YBDA 4WXEA 3W8DA 5U4XA 5KTRA 2VJOA 4PHHA 3KSAC 1U7PA 4NYIR 3DVAB 4XX0B 2Q8NA 3GNSA 1P62B 3H75A 1M6NA 4X1KA 3LDUA 1OYWA 4B3BA 1V4VA 3NDJA 1OT3A 2R96A 3CMMA 4K28A 4BNZA 1E2KA 4J16C 5GV8A 4UQPA 2VJCA 2IWRA 5K3BA 4Y9TA 1P9RA 2C77A 1AF7A 1NF2A 4G0ZA 5LXTF 2HXGA 4F06A 5KYWA 1KZ9A 3AG5A 3LVBA 1RNLA 3GLUA 1E60A 1VDMA 3MELA 3MSCA 3S5JA 3WWDA 3RUHA 4WFKA 2VHXA 1EUQA 1XKTA 4R81A 1OBCA 3CFYA 2X2OA 2WW8A 4RWEA 1A95A 1RW4A 4ZTUB 3SCZA 1DCFA 1HDIA 3IXLA 3R23A 2OQRA 4ZRDA 5IN4A 1W29A 1WB4A 1WG8A 3ME5A 1G6Q1 2B30A 2PT9A 4Q24A 1Y1KE 1OU4A 4I66A 4TUYA 1NU6A 1HTWA 2JKVA 1YAJA 4CM8B 5KVSA 3EH2A 2YINC 4ZU3A 1S02A 4PTYA 1N0IA 3DSRA 3AG6A 5ESDA 1G21E 3T3MB 4Z7OB 1PW5A 3NBYC 1G5TA 3A3YA 1B42A 2D2FA 1LDMA 3MNFA 4OM8A 1U3TA 2H1OA 3NORA 3RU3A 1GZSA 2DUMA 2RI6A 4U0KA 2WILA 1QG0A 4EG8A 2R5FA 4D56A 5EKXA 1AGNA 1UJCA 4IYJA 3WJ2A 4AWXA 3WGVA 2WQZA 1M6YA 3IEUA 3O2QB 5ARDA 2BDEA 1NNLA 5CT6A 2Y0PA 1FQKA 1V6AA 3C1UA 1GTJ1 4FHCA 3QNMA 5JCZA 2CY0A 1QUFA 1WD7A 1EFPA 3F3MA 3N2IA 4HUQA 3RNOA 2QN3A 2FRDC 3L0ZA 2QP4A 3B51X 1SEPA 3O1JC 3E5RA 4P08A 3W1VA 1H69A 2C57A 2QRKA 4KGZA 4BNXA 4DPKA 4TKVA 2ZSFA 3M3HA 2W42A 4E0BA 1IH8A 3SE0A 4RK1A 3SJAA 3IBFA 1I4DD 1WY5A 1F2VA 1MR3F 1IDN1 3MRXA 3Q7SA 1G20E 4HSEA 3RE1A 1AUOA 3UV7A 1NF3A 2YH2A 3CUVA 1MB0A 2BTQA 4HAIA 2GF2A 5JH7A 4HNQA 1Q0HA 1CDDA 1MORA 4LMPA 3ACBA 3JYLA 5DX1A 1XZBA 4ZVPA 4UTPA 5BSHA 3COJA 1TCVA 1ULUA 3S2FA 1SUPA 4M0PA 1FFSA 2H8KA 4OJTA 2B8EA 4UHCA 1IXZA 1C3LA 2IXAA 3DJFA 1M8FA 4XGIA 3BGIA 3T9EA 4BQPA 4L5JA 4N5NA 3OURA 4Q6BA 5IT0A 3M3DA 1NE2A 3CWQA 3ZZ0A 2FW9A 4EABA 5A5EA 4Q3KA 1U63A 1YS7A 1CUXA 5EIFA 1FFAA 4TQAA 1D1TA 4I3HA 4EHBA 1GKLA 4Y1EA 3ZX5A 5D84A 3KZ1E 2IP2A 3OZIA 4D02A 1IG3A 4RJKA 3S55A 3HRHA 3JPYA 4WT7A 3G2OA 4RF2A 3EC2A 1Z2EA 2D8MA 1N3IA 4RNCA 3FZEA 4AJJA 1T9HA 1K8RA 1KWGA 2WLTA 4X3OA 1KHHA 2A9PA 1M2JA 2P2SA 4RL4A 4YAEA 5IYZA 2O5CA 4N6OA 3DDZX 1W581 3C4QA 1EVKA 2X8BA 1FFCA 1HF3A 2C2BA 3G5TA 4Q19A 4AM8A 3THWA 3V8RA 4JD5A 1Y8QA 3JARB 4IJWA 3CBGA 1QRRA 1R0YA 2PX4A 2I71A 3GQBA 3HJBA 5HW0A 4EHHA 4DBZA 2E1PA 4N7RA 5KTYA 1WAMA 4ZQGA 5ENZA 3WICA 4F3CA 3QOFA 4B7AA 3ECAA 3EIWA 1AMOA 1CUCA 3O6VA 2VOEA 1QHHA 4RLSA 3PTZA 4ZA2A 1OFUX 1Y1TA 2BMFA 1STOA 4I2NA 4UPEA 4ISBA 5AHXA 4QDJA 5GONA 2FWPA 3HDQA 2B4AA 1QQ7A 1QG6A 4R1TA 4Y0VA 2ZJ7A 1UFRA 2IC5A 2GOYA 1JXMA 1TM4E 4I55A 4LDAA 3VA7A 5DO9A 1SKQA 3EODA 3EUFA 1E1RA 1J2RA 1PWHA 1V37A 1NQAO 2C4MA 3PZRA 2FR1A 4RFSB 4XM0A 4B3SB 4BY9E 4GYJA 1PU2A 1U5CA 2YN4A 3MWLA 4DY6A 4MVWA 4RV4A 1DRVA 2YQZA 3MQ4A 4NAVA 2AK3A 1EVEA 2JLZA 1CB0A 1JHRA 4R9NA 1DEHA 3HM9A 1ZU5A 2YXEA 3BCUA 3HB7A 3L3BA 4KZPA 1V8OA 4OY3A 5BR7A 2CC2A 1WXXA 4JBNA 3CZCA 3C87A 4G8CA 3SZRA 2P9JA 3T5AA 2RONA 1Z38A 1NJ2A 3EISA 5BVHB 3EEIA 5DHRA 2OCXA 1RIIA 2V8OA 4PLGA 3KYCB 2GF9A 1U9JA 3TOVA 3WYNA 3SC6A 2XPCA 2DAPA 2QRQA 1UH5A 1OASA 3AF4A 3KWFA 1IDOA 3M2PA 4JITA 4U6QA 3HZHA 2OPHA 5KREA 4J1SA 3RTGA 3TRIA 2JK1A 3H3XA 5K0JA 3KG2A 1N2OA 4NZNA 3BREA 3HP7A 2FDCA 2BR5A 3P9QA 4WA7A 1NR5A 2O05A 3GRPA 3WDMA 2JFGA 4ZEOA 1H94A 2BHTA 3O4FA 1E1QD 2I80A 3OKFA 4JIMA 2Q4RA 1DO8A 5BQ5A 3T1TA 5IF9A 1JDJA 2Q5CA 3MCVA 1L5QA 4J3FA 3V2HA 3KRTA 3ZOKA 1KE2A 2O3UA 3KBOA 1S2MA 2E21A 3K1ZA 3L7AA 4RDXA 5A71A 1G5PA 1I3KA 1KDYA 1V1RA 1FDTA 1K7YA 1ODJA 3CRNA 5J4KA 4FFBA 4G81A 3BH7A 2HBZA 1AN9A 3X2EA 4IWXA 3L4SO 2BSQA 5M2QA 2Q4OA 3PRYA 4B4DA 5CLQA 1FNCA 1DADA 4YYEA 3JYHA 2VNSA 5AUQA 4IGKA 4E5SA 1GYPA 3IVRA 5JI2E 4CEIA 1GRNA 4RPHA 1Z17A 2IW3A 3QE3A 3WK7A 2VQ3A 4KQHA 4B71A 2ZAIA 1K9SA 1LW6E 2PWAA 3NP9A 3ORSA 2JLVA 1H8EA 2WWRA 3BQNB 1N6HA 3DYIA 2BOVA 1UK8A 2D74A 2WJIA 1GPDG 4FWIB 2C5BA 5D85A 2ACKA 1CE8A 5JSQA 2LIPA 3IUMA 3WLSA 4AMGA 2H92A 4OHRA 1PNRA 1B0AA 1DKQA 4BZXA 3AOEA 3ZE6A 5A5VA 2NAFA 4RAQA 4WY2A 1NXTA 4KQFA 1X42A 1NASA 2YVUA 3ZQKA 3TLGB 3DDSA 1LK7A 3BMOA 1XCOA 2UVPB 4RZUA 5EC8A 1F5SA 1V4BA 3U09A 4LQCA 4EI8A 4I6EA 4KK4A 3UG6A 1V9CA 2RB4A 3V80A 1YZLA 1NOIA 2FF7A 1SZJG 2IE8A 4H7IA 4HO1X 1SD5A 3PK0A 4LZAA 2CK3D 5A6SA 2IYPA 2XRMA 1CY8A 1HG1A 2QR3A 4QGSA 4D9MA 1DBVO 5FQOA 2PUTA 4BP1A 2KB0A 4DLTA 3IEMA 3AEKB 4XFDA 3AVQA 4BGEA 1CP2A 4HQFA 2UXDB 3PUIA 4NDZA 1PWYE 4M37A 4C0BA 1GADO 5FAKA 4R84A 2XB8A 2ZIUB 4ARSA 1E18A 4DREA 3A6EA 2H9YA 3OU2A 4HDNA 4X7BA 4HNTA 1ODTC 3FUVA 4FDMA 3I62A 1XDBA 2VHEA 3SU8A 2O8CB 2XJ4A 4MO2A 4TMZA 1P7PA 4MA5A 2ZYSA 1TFUA 4R1SA 3ISJA 3GT0A 3E7XA 4LDZA 1P75A 3F3SA 1JQKA 5HGJA 4XVUA 3NTQA 1Z5NA 2VOJA 4Z4FA 4CV1A 1JKJB 1JSXA 1CY4A 2XUDA 4JOSA 1KNXA 1C3VA 1PDOA 2FV8A 2Q1YA 3NR2A 3PU6A 1DBRA 1D2CA 4NU6A 4O02B 4TKZA 3EPKA 5JSZB 5B53A 2UYCA 4WESA 1DUVG 5DTEA 3IEVA 2MOKA 4DTCA 2WKRA 5BQ3A 1LK5A 2GXQA 2F59A 3V4RA 1G1MA 2WYOA 3V7NA 4EHAA 2HB6A 1LBEA 4XQ0A 4R68A 3HUDA 4UTRA 3RAPR 1GAEO 4GPD1 5MN6A 2BZGA 3NALA 4E6PA 3WAJA 3DLCA 5HIMA 3I6YA 2XMBA 3RHSA 1WUYA 1TZMA 1DC7A 2IP4A 1ZD8A 2PK3A 4J3NA 2H0QA 4AS2A 4H7DA 3F90A 4H7JA 4A2PA 1J21A 4C7BA 5H9VA 1M2OA 2HDWA 2Q9BA 2PX2A 4YP5A 2G17A 1ABFA 1JHXA 1A4XA 4Y9DA 1Q2XA 2Z3ZA 3DE7X 2C9BA 1WKBA 2HA0A 1QDLB 1SQ0A 2HT1A 1SBIA 3CSSA 4TMKA 1BRTA 4DQDA 3S8YA 3EGWA 2J9ZB 2W8BB 3PJFA 2Z2JA 5CK4A 1Z6YA 3RM3A 4IWYA 3VKUA 2YYSA 3EDQA 1Q0TA 1NLFA 1INLA 2RGEA 5KDDA 5AXAA 1MDBA 1DG9A 3WTBA 2B69A 5EXEA 4CTMA 4LX0A 3RFFA 4Z4QA 3HC7A 2BCGY 2J9RA 1R5OA 2M6LA 3BRQA 3UMRA 5H4GA 1MAVA 5EFZA 3LQ1A 4WEQA 2OB1A 3L0OA 3ETDA 1JNXX 3BKWA 2FDXA 4LRWA 2P9QA 4QKQA 2R25B 2W4IA 3PUHA 2QRHA 2CLCX 1MB2A 4CCAA 3HXMA 5HTOA 2VLBA 3LWZA 1E6CA 1FNNA 4LKOA 2WAAA 4RUKA 1ZDMA 1T8UA 2QPAA 3NEYA 3U60B 2REQB 4YMSA 1Q50A 2Q1SA 1HKHA 1DEKA 2P0YA 1PFUA 4FT4A 4IHQA 1TTTA 2DXIA 5B3JC 5KSZA 4DFDA 1SCKA 2C3UA 4M9SA 1TL7C 1CLEA 2GH1A 3W5SA 2GAFA 4KR6A 5EEGA 1I32A 4P31A 1P3DA 2WE8A 4PBTA 3EWNA 3U4GA 4MDHA 3ZWOA 2BFFB 1V8DA 3H2ZA 1AXGA 1BXGA 1MAWA 3KQSA 1TM5E 4I55B 1YKGA 4EUFA 2O57A 2J3IA 3SC2B 4UAUA 3SN6A 3J7AC 3FETA 2O50A 4JK3A 2B1GA 4M55A 4NAHA 2EERA 1PG5A 2HF8A 3LC1O 3K70B 3TQQA 2R4TA 2CV2A 3RYHB 3HMKA 3BD7A 1IOVA 3T9DA 2W4QA 2JCVA 1TW2A 3RWMB 3T9BA 1TQHA 4AJPA 4RD6A 4JL6A 5E7IA 5EJAA 3H1AA 3I0NA 3ZW9A 1OI7A 3OOJA 4C2AA 1R5BA 3EH1A 3JQCA 4QUDA 1Y80A 1FJHA 1C30B 1KR2A 3UMMA 3TSYA 5BVHA 1ZOIA 5AM5A 5I9SA 3NHJA 2QB5A 4PLWA 3I61A 2QRZA 2WM8A 1WB9A 1Z39A 4ROSA 3V4FA 1M6VA 5J23A 3TECE 1AGPA 1RPAA 3WG9A 3KQYA 4GYKA 5L3QA 2Z95A 3P0RA 3NLLA 1JIIA 2KJQA 3SS9X 4E12A 4I6GA 4HAXA 5BUQA 3NNNA 2K5UA 3ZCUA 5ES4B 1QGDA 4IUYA 1JVNA 5JMOA 4TMVA 3D3NA 4CKWB 2UYOA 2HRDA 4H0NA 5K03A 4L9AA 4R1MA 3PUVA 3PX2A 4ER7A 1H4QA 1O8CA 5TSDA 1Y8ZA 4NMXB 3IO3A 3AFHA 5DLQC 4HUTA 3GPBA 3IVXA 4B83A 1VSQA 3LWNA 2BHSA 4I4LA 3ZWPA 5A04A 3BFPA 1YRLA 2FH5B 3U81A 1P1IA 2RD2A 1GEGA 5H0IA 5HUHA 5FNVB 1DQPA 4O4HF 8MHTA 2XYHA 1P1RA 1W4LA 3V4OA 1GUZA 5AOBA 3F98A 1IHOA 4B46A 5CYFA 2C5FA 3PVZA 2ONCA 3OH8A 3GJ0A 1Z0AA 1KK2A 3O8QA 3VDRA 2WJGA 3W9UA 4ACBA 4HK4A 4JC8A 5CYOA 4B6JA 4DJFC 7YASA 3VO8A 1Y4SA 1OXVA 2QAGA 3P94A 2G06A 2W2LA 3UMJA 2HJVA 5IVKA 4B5LA 4ME6A 2WOJA 3BVPA 3JATB 3A9TA 4R9UC 2VTBA 3K0HA 2X0NA 2NQTA 5COBA 4OQQA 1MO2A 1QV9A 3DV9A 3PNYA 4YMWA 5HJ5A 3DAPA 1WDKA 3K0FA 4R2WA 5HVNA 3D5EA 2Q9UA 3LVQE 4IM7A 3SXJA 5LOVF 3E48A 2WHEA 1TC2A 3L5KA 4UM7A 2EVWX 1OHHA 1U04A 4F2GA 3VR6D 2ZUCA 3NCTA 3PDIA 3N3AC 3BMOB 3ST7A 1U80A 4ZQEA 4F8JA 2PMCA 4TTPA 3M49A 3BXGA 3WX0A 1S1MA 3CW2A 1TC1A 3RC3A 4BNHA 4D57A 5TGZA 5CFOA 4IIGA 3SIWA 1WXHA 4YWHA 1IULA 4YAGA 1PR4A 4D25A 1TGYA 1M8KA 4LNAA 3L6BA 3VH3A 3D59A 3II6X 3TQIA 3UO8B 3UOAB 4R5HA 1QFXA 3OOHA 4JVNA 3EAQA 5T6BA 3GJYA 2QL7A 3O9ZA 5TMEA 4TTRA 1W48A 4RS3A 2YWJA 3URKA 1QP8A 5L53A 4G86A 4UOQA 1XXLA 1C2TA 1PSDA 1SXIA 4P86A 4UEOA 1GTMA 5EG5A 2JL1A 3GGOA 3LF2A 3R7DA 3WIOA 3ZD6A 4D4MA 1E8DA 3GX1A 3DR3A 1DBWA 3B1JA 3PX3A 2C4TA 1CX9B 3TZLA 4W8GA 1JA9A 4M0LA 1ORVA 2F3SA 3M4YA 3FCAA 3N8GA 5DXJA 4CMJA 3NWOA 1QHYA 1FSFA 1WR8A 2UZ3A 3ZV3A 2L42A 1A9TA 2OHIA 3OE7D 2YYYA 3GQBB 1S2OA 3C0KA 1DEAA 2I7VA 3BRCA 3X1XA 1RRKA 1HSOA 1NVFA 5JQGA 1S7CA 1YA6A 4ZI7A 3WGGA 1GPLA 3F7OA 4TV8F 1MNQA 1K2VN 1FP4B 4YRFA 1QHHB 2ZJYA 3GARA 1CZOA 4AYWA 1RAIA 1IB0A 2Q5EA 2UUPA 4E4RA 4P7FA 2XE6A 2R66A 1BE1A 1KI8A 1VHLA 1S3FA 1JDNA 5AW2A 3DL4A 4L8WB 2I78A 1OTXA 5BW4A 3TL6A 1E3LA 1M5UA 2PSFA 4YRAA 1TZCA 3FJ1A 5KOJA 5IT5A 1ZU4A 2WU1A 4YT2A 1KOGA 3KKKA 3UAXA 5KJFA 4L73A 3LUCA 3ZHUA 2FUG1 2WLSA 2GCIA 2DUJA 3KLPX 5JHGB 2YJ6A 1P4SA 1Y1QA 3LDFA 1PZGA 1NUQA 3B3AA 3A2LA 3B89A 3B53X 3LLSA 3VR5D 1IJKA 3IP7A 1RHMA 3KUKA 1JQLB 4MI6A 1BFKA 2OLKA 4ZC8A 3CN7A 4J03A 4R40A 3T9AA 4YAJA 1CY0A 2NYAA 4RD2A 1MZPA 5JRDS 5AIAA 2XA9A 1AQUA 1PR2A 1I0ZA 2F43B 2WB4A 1TPZA 1HG0A 3ICPA 4ZIRA 1Z2CA 5I3CA 4OSPA 1G6KA 2E4WA 2XUAA 3G49A 1TA4A 2R6R1 3RADC 5AVZA 4IS2A 2IH4A 8GPBA 4E51A 1L5YA 2QP3A 2PZJA 4OH7A 4E5MA 1RM0A 2W93A 3GFVA 3OZSA 2UU9B 2UZAA 3GJ3A 2CLIB 1JPNA 4KQMA 5JAQA 3W0LB 1UPTA 1DHTA 4AAYA 5FI3A 3B5JA 1NA5A 2VFAA 1AY0A 1BJRE 3N0WA 4PBSA 5EQJB 3VO1A 1U5BA 4A8HA 1DV1A 4XB2A 2J3JA 5EN4A 1GT6A 1N0WA 2BFBA 3OEHA 1G3IA 3QPUA 4J0CA 3N8KA 3TJRA 1BXGB 3LYAA 2QM8A 2VDOB 4EHFA 4AN4A 2GD0A 2P27A 1TOAA 3KWLA 4F6RA 3H5NA 5B6IA 2R4UA 5L40A 4HPXB 3HVRA 3VR3D 3SLKA 2P3LA 5KYYB 5BY2A 2FMXA 1ZKMA 2R8ZA 5B30A 3CZAA 4AFNA 1OE0A 4I1YA 2AFHE 4RJ2A 4OXRA 5DX0A 4I46A 1A82A 5K3AA 4A2QA 2OCBA 2R5WA 4W9NA 2IV3A 3RIXA 4Z1OA 4EEKA 5JBIA 3A4IA 3KQLA 1M6WA 3DMTC 2IZ7A 5JV5A 5DTRA 1XA0A 4Z99A 2Q5IA 4CI9A 2YR0A 2QZSA 1YQDA 2ATVA 1A9OA 1ZCJA 5DW0A 1CQXA 1GITA 4RE5A 1HWYA 1U0OC 1U7UA 3QF4B 1SELA 5TPWB 4QGAA 4B3XA 5A6VA 3JQAD 4O4IA 4OI1A 3M82A 2ZB4A 2HGSA 4MB0A 1LPOA 1HK7A 1VHQA 1QP0A 3ORHA 2AFRA 2O0HA 3E7WA 1P2BA 1RWMA 1Y4AE 4QEDA 3RCBA 1JTEA 1ML3A 1KMHB 1PR0A 3R3YA 4MKRA 4OHVA 3UV6A 3MILA 5JXIA 3U44B 1KO8A 4KXFB 2FSHA 1U0SY 5IXSA 4AKGA 1JDBC 1JNYA 2GD6A 1HKUA 1YI0A 2H5EA 3W34A 1AGRA 1N25A 1ZH6A 1ZK0A 2PN1A 2XCIA 4KWHA 1E3EA 3SSNA 1LSSA 3EQZA 1P9LA 1QWSA 2FRVA 4IEIA 1V7QA 3IALA 4LVOA 1S96A 3KOYA 2X8AA 1RYEA 4QYIA 1XNHA 2B5WA 3FN4A 4HPWA 4HVAA 4LGCA 1UJ6A 2NQ2C 1XRSB 1W2GA 2Z2XA 4GMFA 4E1BA 1Z68A 1DJMA 3KPWA 2GBLC 5F9MA 3AVVA 2MYUA 1RYFA 1A5ZA 1ORHA 2WYHA 3RC2A 3DBIA 2QTMA 3R7FA 1AG9A 4DV0B 3K0EA 2GJKA 1XWIA 1L5NA 3O8QB 5B64A 4LEIA 1A9RA 1W1UA 2C0CA 1AA6A 2YMMA 1UEJA 5CA1A 4MQ4A 1BHO1 4OFWA 3K35A 1SIBE 3OCZA 3RT9A 3KZXA 4P4GA 3ZHSA 5IFLA 4Y9SA 5BN3A 5JR3A 2VTBB 1P61B 1FMJA 1V4NA 1Y6RA 2AMLA 1XP8A 5CYPA 2AF4C 2VP2A 3ZHXA 4A8JB 3LPCA 5F35A 3L79A 2IV7A 1I7DA 1H1LA 3G59A 1ZR4A 1EM8A 4QIHA 2Z9CA 3HCWA 2HDHA 1G8HA 4BDTA 2NPFA 3IMEA 1ZM7A 1PYDA 2VR1A 1T8WA 3Q4GA 4V0RA 1L2TA 4Z7QB 2ZUEA 4LF6B 1N9GB 1A7JA 4JZYA 1O5OA 1Y3BE 4W5JA 3HR7A 1RM3A 3LUJA 1SU7A 2FFHA 2Q7XA 4EHLA 5C3MA 4YECA 4E3ZA 1JDUA 4H4EA 1XYYA 3SYRA 3HFSA 3ELUA 1UBFA 4ZAGA 3MJEA 4L76A 4PGFA 1M6EX 2FAXA 1XE3A 5DHAA 3B20A 4I9GA 3WMGA 3EFOB 4KP7A 3KPUA 4N18A 1DKPA 1XAGA 2R65A 2R6FA 2HLNA 1R88A 3S81A 1R3UA 3QITA 4UFPA 3UQZA 3TDNA 3WBJA 4BQSA 1PQ4A 2A0YA 4KO4S 1QIDA 4MITA 3B1YA 1HE3A 3EXEB 1E3WA 1KFJB 2BH9A 5BMVF 3KR1A 2WWIA 5C8YB 4YRNA 2L2QA 4TXLA 3DV2A 4EJSC 2ZYGA 1X7YA 1XIVA 4Y2XA 1UPCA 4V1CA 1KH2A 4X60A 4PAMA 4L9WA 2XQKA 3RUEA 3SHOA 5A05A 5KNDD 2OCYC 1I8TA 1W7AA 1E92A 4MVJP 5B7GA 4DC9A 3UG7A 1MC4A 2CNDA 3RYFA 4L6AA 5A0TA 4LDJA 2VDPB 4OBWA 1V2HE 3PYXA 4F4JA 1U8EA 3EQ9A 4HX5A 1AM4D 4WN9B 3EEYA 2ECPA 2OO3A 3WRYA 2FW1A 1RM4A 3LDAA 3C7DB 5IUKC 1P4GA 1DQZA 3HA2A 2JC3A 3I9LA 3K1JA 4MRVA 5AOCA 4DSTA 3W5BA 5EUCA 2HRBA 2B6NA 4TL9A 2FE1A 5HBGA 3ZE9A 2BFAA 3EG9B 2BP7B 1NP6A 5JAUA 2H85A 2Y1WA 2QMUA 1NBWB 2JH9A 3KNZA 5FCDA 2EJTA 2PD4A 3I23A 3LCCA 3GFFA 2N46A 4MLCA 3WI7A 4C4OA 5IHPA 2A84A 1Y1LA 4G1FA 2GF0A 3OZCA 1CUYA 2FP4A 2ZUVA 4GZLA 3DEIA 4JP8A 4G25A 4BNDB 3SZLA 4W7HA 4WLEA 4EW3A 1EHIA 1ZD1A 5C4MA 2EF1A 5JJIA 3CB2A 5SYAA 4BV8A 2O8BB 2P5YA 4HDRB 4JC5A 2HF7A 1TA9A 2XEDA 2O8DA 4QWMA 2P3SA 3IA2A 2LPMA 3E27A 2IVFA 3AR8A 4QREA 4LJLA 3LQQA 3T7EA 4N40A 4CNQA 4QBIA 5ALNA 4GH5A 2QSUA 2OLJA 5AVOA 3E3LA 4F3KA 1Q6ZA 5K1ZA 1ZJ5A 2WG2A 5B4TA 1U0LA 2SICE 1EXVA 1TKCA 2ZBVA 2G9RA 5AW9A 4F72A 3TTUA 3FF1A 4OKSA 2QMHA 3AR9A 3FA2A 3HI6A 4Q1VA 4US0R 4C07A 5K2OA 2WAYA 3JVDA 3EXIB 3LECA 4PO9A 1ZIOA 2I65A 4FLMA 1V5EA 1BMFA 4GLOA 4N8SA 5F64A 2QMYA 3K1AA 5CFMA 3IQZA 1SIUA 4EBBA 5F3DA 1P0CA 3NWBA 5EI5A 5CGQB 4RA6B 2JIDA 3W4IA 1U5BB 1VPLA 4Q16A 3WL5A 3W3AA 2OY0A 5ITSA 4JLPA 5EE5B 4GKBA 1BA2A 3FBGA 4L2IB 1P0FA 2QD5A 2G7MC 3DWFA 3P5SA 4X6YA 4H6VA 5FA5A 3ZLTA 1FDSA 1J20A 3W06A 3ITKA 1C9NA 4MMZB 1CY6A 1UF9A 3ICQB 2IE0A 3W7BA 5MN4A 3WK6A 1C8BA 3ZXXA 1Q7CA 1QH8A 2Z0MA 3LO8A 2O06A 3AUFA 3N7AA 5GM2A 4KC0A 4LSMA 5J2TF 4EB8A 4F1KA 3DM9B 3WLPA 4NPHA 3UH0A 1JR3A 4P38A 1G1AA 3H3JA 1T4GA 1WDWB 2ENUA 3HNPA 3M5PA 2BEWA 5KYWB 2FFBA 2YWFA 3I04M 3ZU4A 4A6EA 2OP0A 3MVEA 3PUJA 4BZQA 1ULZA 3QF4A 1NTOA 6CHYA 4JCOA 2FN9A 1C0EA 3N74A 2FFQA 1UQRA 1GL3A 1S3IA 3MBOA 3BSWA 1WU8A 1SVOA 4GBGA 1CUJA 2B1QA 3I58A 3T0FA 2XH8A 1W8DA 4K6CA 2FMIA 2E3JA 1JS1X 1N7GA 3F9CA 4HDKA 4WWHA 1CY1A 3WGOA 4AO7A 4NABA 3UPTA 1WP4A 2DUNA 1J8VA 2UVQA 5DLEA 3DLBA 3DTVD 1VJTA 4DMMA 1AA9A 4WE3A 4JOQA 1G19A 3BYZA 2BE7A 1EAMA 4R3WA 2POCA 3KJIA 5E4FA 3JS5A 2BBSA 1QYWA 3WB2A 3U7FB 1QV7A 1SCDA 2FHPA 4JUFA 4U7WA 5LP6C 4BMNA 5B7NA 3JRWA 3N8NA 3CRW1 4Y7CA 4XCVA 1Z08A 3IILA 3PI7A 2FXVA 5EJ2A 2CJWA 3LP5A 5CK5A 1RI1A 4FINA 2I7XA 3I9V1 3WK5A 1RXYA 1GSOA 4N6GA 2PKYX 1RJWA 1UXHA 1MQ9A 1QOPB 1FU8A 1LDGA 1EFPB 2X1VA 3FZQA 3DO8A 4WHMA 2GASA 3O3NB 1ZRNA 2WTXA 3A6FA 3PRKE 4U2DA 5CT5A 2IF2A 5AKGA 4EY4A 4Q7KA 3ZE7A 3I9KA 3T0GA 3PA8A 4I9NA 3ZVLA 1Y4DE 1UAGA 4OK6A 5D51S 4JDPA 1PV1A 3SSMA 2H2GA 1XXHA 2PIDA 1NWCA 1TUIA 4Z9BA 3EZ9A 3FWZA 3OJCA 1XROA 1P29A 4B43A 3WK8A 5FLEX 2ERXA 2NWQA 4KQKA 4HATA 5GV7A 2P69A 3B2QA 3OPYA 5C2JB 4UFOA 5JCPA 1Y8AA 1FSPA 1YJBA 2E7ZA 4FMDB 1DAMA 2ID9A 4L8LA 3D6UA 3OPMA 2XYQA 4FFOA 4O4HA 1BVYF 3F3KA 4M1MA 1VE6A 4YASA 5EXPA 1DOHA 2QD1A 3W6ZA 1V11B 3QOXA 1QJ4A 2PE5A 3HBLA 1QF7A 3IUPA 4UNSA 1F3LA 3G68A 3G8AA 2WFZA 3VISA 1J25A 1B0PA 3HR8A 4MV6A 4MH0R 4EKYA 4IGFA 1WXGA 3DDOA 1GAWA 3G82C 3TZEA 1USUA 1PTJC 3VJLA 4P93A 4UOZA 5LBTA 4AK9A 2PVPA 1H0RA 4GXTA 3JAWB 5TEVA 3H9JA 4UU7A 4YLYA 5EE0A 4FQ5A 1IN4A 1CJTC 1YU6A 4MVJA 5KUTA 3UJCA 3MLEA 1KOLA 4LY0A 5INTA 1Z4LA 4ND7A 4WASA 2OK7A 3R3JA 2LTAA 1C3OA 2WHXA 3K8OE 4BLOA 3W3ZB 1A2BA 1JVSA 2WP0A 5EXTA 3VH4A 2BHNA 4FONA 5LD2B 1EFLA 1ORTA 2I4RA 2AXNA 3GYGA 2O8EA 3PDWA 4JYBA 1J2YA 1HLPA 2FY8A 3PUZA 3L9WA 1N6KA 2ABWA 2VAXA 4QDZA 5DBGA 1ZVVA 4L3WA 4TL7A 2PX5A 4KPFC 4L7VA 3IKTA 4L8VA 2ZQZA 1XMQB 2H1IA 4RD4A 4W1QA 4A9AA 3CCFA 3GW8A 3SI7A 1YRQA 5JYCA 4QGHA 4DLUA 1QX3A 1EWKA 3G7UA 4EG6A 3EQ8A 3LC0A 2DH5A 1MEEA 5ERGB 1JN0A 5AKXA 2HF2A 2IOFA 4CN9A 4DHEA 1Y3CE 5LR6A 1M0SA 3PUWA 1Z34A 3T3HA 4PLZA 2Z5FA 1ST3A 3AL0C 4QOGA 4AJEA 2GYVA 2VSOA 1N8SA 2V6FA 5J58A 1KDOA 4YFYA 3A6PC 4P36A 2QVBA 3AF0A 4FUTA 1E59A 3H5TA 4RABA 4US2R 1GTSA 4BKPA 4Y3UA 1GDHA 5FLKA 3LU1A 3W9YA 2H7VA 1SG6A 1TQ8A 4M9XA 1UBRS 3LT0A 4MVJF 4CU5A 4NEHB 5CCXA 4E2WA 3RIEA 2RSLA 2AN9A 1YQXA 4HNAB 4IY1A 4JNCA 1U8XX 4C4AA 2XE4A 2HMSA 1NOKA 1V7PC 5HMLA 5FPYA 4BFZA 4IHJF 3S8EA 4N01A 3OUTA 4U8HA 3VR2A 1GP2A 4NC9A 5GAJA 1U9YA 5DIFA 3EASA 1XJQA 4EELA 5LMNB 4RORA 5B7QA 2JFBA 3HBJA 1KSJA 2QD2A 1YL5A 4EAQA 4NL4H 5BSFA 3NTOA 3KM0A 3HRKA 1C1XA 1KVRA 4J4HA 3K70D 5IJ0B 4F97A 4WLNA 5I7RA 2QN1A 3C6BA 1WEHA 3E70C 4BEBA 3QJYA 3PE6A 1LPSA 2PO7A 3A37A 2P2CA 4ZCPA 5TEWA 2OAGA 1V5WA 2HWKA 3D3WA 1UR5A 1XWWA 5DNEA 1JMYA 4QHSA 4Q02A 4RXTA 1N3YA 3F4KA 4KXMA 1ZSNA 2R7LA 4F4CA 2FOIA 3D7RA 3BH6A 3QKRB 1EI9A 2QZPA 2VZLA 3D1JA 3DM5A 4LKRA 4HFNA 2GN0A 4RA6A 1EP3B 3RK4A 2CMHA 2RDMA 1JSZA 1V26A 5H1YA 5B1IA 2CHUA 2NO9A 3ENZA 4MWBA 2XZPA 3LUAA 3DPUA 4EHJA 1R0XA 2VF7A 4L2IA 1X1QA 5IKXA 1ZNZA 1LV8A 2GNPA 2QTVB 2W00A 4FVTA 2CL7X 4Z9YA 1G7SA 4GUDA 4Q0MA 1XHLA 3GJQA 5AVQA 5CNIA 1IZ0A 3IQHX 2OD7A 3D1VA 1RJ9B 3USES 1JG7A 3HYSA 4WGGA 3UGKA 2O3QA 2H3EA 3MIZA 1QXSA 5HQ3B 1Z9BA 2E5WA 1X7ZB 4HDQB 1XU7A 3KFVA 5G0WA 4K9MA 1SOAA 4TKMA 5GONF 1Y9AA 3RT1A 2F1HA 2O7RA 5DNDA 5ECGC 3C7AA 1QO7A 1YU9A 3KP1A 2W71A 4DJEC 3Q6NA 2A58A 4MPJA 4XM2A 3ROFA 5JHHB 3D6MA 1ZIYA 3AU9A 3GUHA 4KDRA 4EW6A 3QJ5A 2R8RA 1KKMA 4X5OA 4L3VA 1ADJA 2WABA 2ZYTX 3Q0EA 4I5GA 4G4SO 5BSKA 3R9XB 1PG2A 4UASA 4KOAA 1BTOA 2QN9A 4I5IA 4RD1A 1U1FA 4EARA 4MJLA 1K75A 5GIOE 2G1JA 3BBPA 3OJFA 6ADHA 5I7OA 3IT2A 2BH2A 2XYRA 3V7YA 1MHPA 2IXEA 4K9LA 3ZDXB 3HKCA 4XJTA 1L5HB 4C2TA 3C6XA 2CXRA 5LDGA 4RM3A 4EKGA 3U7QA 2UUAB 1P4HA 4I19A 3RFCA 5MF6A 1D4FA 2OQ2A 2QJFA 3G88A 4PWZA 3B9BA 3RK0A 1ZK1A 1QORA 4RZ3A 4WNIA 3ZCXA 5I5EA 3ZXUB 2R60A 2ZI4A 4IZOA 2B6HA 1K6JA 3CPJB 3IE2A 5JDIC 4V1CB 2ZUBA 1II9A 3L0CA 2Q2OA 4KR7A 5ED0A 1H5QA 3ZDZB 1LLUA 3HU5A 3PGLA 4IDAA 2YNMA 1LWNA 3TR0A 2GBIA 5TMBA 2ZB7A 2D62A 4G41A 3EGEA 3FMVA 1MGPA 2ORED 2E89A 4MINA 4WESB 2Q99A 4MYUA 5A0FA 4B85A 2OO5C 4YAUA 1CR2A 2QHXA 3AILA 4N6NA 4RULA 1AS2A 3RIYA 1CRPA 3GZNB 4HUJA 3CRQA 3V34A 3PQ5A 3O83A 4DR6B 3CXUA 1Z47A 3F5QA 4L16A 1IY2A 3T4UA 3AIOA 3QBEA 3IBCA 3ZCPA 3F73A 1AS0A 1FFXA 1GG9A 4YR9A 3NS7A 3BCSA 2VH1A 3EF1A 3JAMA 2R1VA 1NRXA 4TN5A 2AGVA 2VHJA 1M2OB 1BD3A 5DM70 4PPFA 4EW1A 1TCAA 3ZDAA 3KYJB 1GPJA 3FDZB 5DXFA 3FFTA 1SCUA 2D4AA 1NN3A 4U7FA 1PVDA 2AZ4A 4PO8A 3W8FA 2HJWA 4V0OA 4XOUA 5FBQB 1YOBA 1EGHA 4PLFA 3QUAA 1T10A 3CNOA 2WTAA 2AJ8A 2KE5A 2W8BA 3C3KA 3CRMA 3QRWA 3L06A 1UC9A 4NSNA 2B1JA 4ACAA 2POQX 1JJFA 3FM9A 5AVVA 4NHEA 4C0JA 2RFLA 4ER5A 4ZHQF 4MKHA 4XVRA 2DBRA 1R0BA 1T3GA 2XTAA 2ZB2A 4GP7A 2CD9A 1JQEA 2BEUB 4FE3A 4EEZA 4NBNA 4IVQA 4Q4JA 1J5EB 2DX7A 1TAQA 2Y1KA 5JDCC 4ENRA 1ZC3A 1W0CA 5EJ9A 1M33A 2XNDD 1O97D 2EDAA 1TM7E 4L8GA 4XYBA 2ADFA 1BGXT 5AFSA 4GNKA 4KFSA 1D8TA 1H9AA 3QJGA 3NBZC 4KACA 4GFDA 1K4YA 4F91B 3K32A 3F0TA 4PZYA 3A31A 1AHHA 2P0AA 1FDIA 3I6BA 1XEAA 3IH5A 4B7XA 3GAAA 4RACA 1Y0BA 5LWQA 4OIFA 3RHZA 4ZO7A 4CYMA 4AXBA 2EJUA 1KO4A 2QTZA 4FYXA 2H1LA 3NOOA 4ODIA 3V6MA 3UJDA 3EW9A 2QQ0A 1PJ3A 3LW8A 3VOBA 5CAEA 5CB4A 3VPSA 2P3OA 2XXBA 1D0VA 1RWOA 2J5BA 3AOEC 3I8SA 3PD1A 3PHLA 3QHAA 4HH1A 4KVAA 4WKCA 5D3ZA 3RRJA 5IC4A 1ZUNA 1WTAA 4GMDA 1SUIA 1U4OA 2R1TA 3FRIA 3DQPA 3MYRA 1EFRA 1IY8A 2AXEA 4EMSA 3KKNA 1ZN8A 2C54A 4ZYZA 1QC5B 2LDBA 1B73A 1S89A 1V6CA 2QVYX 3T3IA 1KMMA 3G0GA 4C0SA 3BT7A 4DR4B 1RYZA 1XU4A 4BJ5A 5GGYA 2OBXA 1E1DA 4QO8A 4HMPA 1UBOS 2AZTA 4V0SA 3BJMA 3IAEA 3CR3C 3AESB 5JVDA 1ZM2A 3E23A 4FU0A 4HGYA 1YMVA 1ZHHA 1U9IC 2WM9B 1IBRA 1W94A 5F2EA 4C22A 4E33A 2C5EA 5F4BA 4N47A 5KNBH 1MPXA 2XUQA 4MIEA 2EFEB 1B1CA 3R44A 1XNRB 3A3OA 1DB3A 4DJAA 1OMOA 1MNAA 1PFKA 2G72A 1ISPA 2IIVA 4GF5A 3T7JA 3TLYA 4TPKA 5ALFA 1TFRA 1ZVKA 1HE1C 4RJTA 2HJHA 2NO6A 2G3YA 3ZBQA 4IH9A 3PEVA 3GLRA 5EQTA 3WLJA 2HHCA 5ICSA 3KVVA 3U2QA 4Q39A 3DLAA 3DE3X 3FJYA 4RYDA 4MTCA 3RBAA 4U5QA 2ILTA 1FUYB 1FA9A 1JRLA 5B4VA 2NIPA 4XIFA 5DGCA 3VC2A 1H2BA 2XWBF 3B6KA 4HH3C 4M22A 1YNSA 1VG1A 1GLVA 1C7ZA 5MN5A 1E98A 2VDNB 3K2QA 4BMCA 3R5HA 4QC2A 2GN4A 4Y98A 4IIVA 5GJWC 4DIOA 1N4DA 3DAGA 3QENA 3KQVA 2XYPA 1NNSA 4MKXA 4CW7A 3FCSB 1TT7A 2BISA 2C2MA 5EWJB 4ZVKA 2PAAA 5TV2A 4ZOLF 3DW1X 5FEMA 5I01A 3VVLA 1OYYA 1E2HA 2QRNA 4YT8A 1OIXA 4KFUA 2VP6A 5JI3E 1PE0A 3RSQA 2Z2YA 2JBHA 5K8TA 1XR3A 3CVVA 4BB6A 3LNCA 2IITA 4X24A 4HLNA 1T5LA 5JZBA 5EHIA 4ARIA 3GRAA 4E14A 2FQWA 3BDVA 3N05A 4OL0A 2DR2A 3C70A 4CMCA 5LXTA 3BJRA 3GH3A 3D2CA 4O5AA 1LDBA 2V9PA 4NP6A 1VBKA 4EWLA 5A02A 3GP8A 5CPBA 4YP6A 2PMWB 3UYKA 4H4DA 3ZE1B 1JFFA 3C45A 3Q2KA 5AO9A 4ZDIA 4L5AA 4G4IA 4JHXA 1VMIA 4QGGA 4C5AA 2AMVA 4DPMA 5A3JA 1Z13A 3KSZO 4MUHA 2V55B 4MGZR 1V16B 3TAHA 3GAFA 4AKTA 2XB6A 2GSDA 1Z83A 1GTL1 1PJ2A 1HOXA 3KKMA 1KAHA 5EIBD 3DC2A 4EA7A 3R2JA 3OE4A 4OK5A 5TQ2B 4HWRA 3FBTA 3S2YA 5KWEA 4YJFB 3JAWA 4PAWA 5EE3A 1H65A 3CLKA 2CCGA 1AUVA 3MJFA 3JAKB 5M5BA 4MW2A 3TQSA 1G8KA 4C78A 1J2UA 2P4UA 4I1UA 2Q2NA 4U1RA 4P84A 1H2EA 1PJSA 4UDXX 4ZXFA 4NOKA 5HCUA 4BJHB 4F85A 3CVOA 1DO2A 3LQ2A 3CSUA 3ADKA 4PSAA 4DUGA 4CLDA 4ZGBA 4WCFA 3KQQA 1OTYA 4CM9A 1I7PA 3GJTA 1LPPA 1NVXQ 2VKTA 2PRZA 2W43A 2WU3A 4TYMA 4WINA 2EJBA 3H7IA 4ZP1A 2WQ7A 1FP4A 4K9OA 5EPOA 1Q15A 2HCBA 3FWHA 4HGQA 3IDSA 3TSAA 2E5LB 2GK6A 2JLYA 4O4JF 2J41A 4YAWA 5K51A 1RE0A 3OZGA 2CXTA 1NG1A 1FFXB 1J06A 1VZ2A 2PFKA 3C97A 4FEEA 4FFDA 4YRGA 3LAWA 4XGNA 4CKBA 2H7YA 3OTIA 2ZRQA 4FZJA 3ZZ1A 3QUTA 1XMOB 1A76A 1CHNA 4XVHA 1EK5A 4XX1A 3SZ3A 1N1EA 1X1RA 1ZIDA 3MMPA 4BXOB 1E0JA 3W2TA 5DI3A 3L7DA 5KOIA 4ZANA 2WUDA 3BUSA 4NCBA 2RK6A 2EATA 4JU9A 1HDGO 1AD2A 1EG7A 4MW4A 2F4NA 4JI7B 1SZCA 2GKSA 1Q0PA 3E82A 4ZT2A 4NVRA 3TVDA 1SCNE 2PLWA 2PS3A 3DFUA 3PIIA 2WF8A 5REQA 1RYNA 3K0CC 1IPHA 4LMRA 5JEEA 1C1HA 3DOUA 1YUNA 1Z0KA 5GOZA 5J2UF 2X1HA 1JFTA 1WUJS 3F9IA 5I7FA 1XEXB 2P9FA 4B75A 2JBAA 5KBYA 3QU2A 5AKHA 2Z8ZA 3DE5X 4MA4A 4YMUA 1MJNA 4EJSB 4GXRA 3NWPA 3UFBA 1IZ9A 5HP4A 1GZ3A 3FYDA 1N5RA 4M0CA 1E2EA 3RS9A 1JTVA 4PRKA 3B60A 3QKRA 1BKSB 2LCFA 2PLFA 3AGQA 4YRKA 2V65A 5ADUS 1EX7A 3DOHA 1XZKA 5DLYA 4JSYA 2J46A 4WBXC 2V5AA 4N3NA 5HKLA 3DT6A 4WNYA 5ALGA 2B3DA 2OBMA 3ACDA 4JXZA 5E2IA 3SJCA 1QFYA 4NV0A 5JPCA 2GXAA 1UZMA 3UZUA 3WLLA 5JAIA 4KUGA 1PKEA 3AETA 3I2YX 3RS3A 1P6XA 1QLHA 1BC5A 2O4CA 3RLIA 3ZWNA 1M2WA 4KMOA 4OFBA 4FGKA 4BNUA 4OQFA 4AJ1A 4EUKA 2BGIA 2IYQA 2RH8A 3OM8A 4GX1A 4G5HA 3C4VA 3ILSA 1CF4A 2BI7A 1R8XA 1PZHA 2OXFA 2RGYA 3PPVA 3MTGA 5K3DA 3UCXA 3OE1A 4F3NA 5A62A 3JQRA 5CPFA 1FP6A 1E4EB 1OAOC 2WSMA 3QPBA 4C0WA 4CDMA 2GRJA 2J45A 3UAVA 5ITZB 3NWEA 4WTOA 5ER9A 3P52A 4OSEA 2B1RA 3N7UA 3GJ4A 1JP7A 1L5FA 2R47A 3GZTB 4RVOA 3SBEA 2IBTA 4INPA 4CL3A 2CLMB 3HA3A 1XZQA 2IXDA 4HQ6A 4UXHA 1YFLA 2F55A 4ZVOA 4TUYB 1ETUA 1YO6A 1SXJD 1UPUA 2HJ9A 3HU1A 4QM6A 521PA 5KPJA 4L74A 1I0IA 4QGFA 4A0FA 3F7NA 1M5RA 4O25A 5IVHA 1E79D 5H7XA 4Q3CA 4MWOA 5BT8A 3HDTA 4Z9FA 4IIJB 5FWYA 5KWVA 1ULAA 3L6DA 4CG0A 4GMKA 4QYIB 4BBZA 3GNQA 1FQWA 3FE2A 4ARAA 1AKVA 2JFUA 3ZJVA 1D07A 3FCCA 5B55A 4N48A 5DHTA 4YUVA 1R4ZA 4I81A 3NBAA 1NQUA 1YZGA 3FNGA 3RRZA 5IG2A 2HZBA 2Q1WA 2IPNA 4I3FA 1WW3A 5EKTA 1AURA 2VLIA 2WR8A 1QH1A 5HIIA 4K9DA 4B6GA 4D3DA 3QYJA 3LWDA 4FDTA 4LRYA 2YWDA 5CA1B 2NU9A 2VDJA 2AL7A 1IZ7A 3IUJA 4J7UA 2ROQA 2WG1A 3QMVA 2W6ID 1KPIA 1C3JA 3FAKA 5FEUA 3LCVB 4Z53A 5H8WA 1ZXLA 1ZD5A 4FNAA 3UA3A 4CEHB 3VBEA 2PSEA 5HS6A 1Z4MA 2BKAA 2WKSA 1TMKA 1TGVA 3FLAA 1NVBA 1Z82A 4K2AA 4JMPA 4TTTS 2Q1TA 1H2FA 3FNFA 4UAJA 5D3QA 3CINA 4C4PA 1KVQA 4ZOAA 1E8MA 3QBTA 5GINE 2H1CA 4LNUA 1ZN9A 4J43A 1DLIA 1CULC 5FORA 4J0IA 2ZJZA 3LT4A 4BLPA 3DB2A 4C30A 1N9GA 1Z7EA 5B1DA 5CW1A 4NIMA 1O54A 4C06A 3PT5A 4PCLA 2BGNA 2Z5GA 5TY0A 4ZMRA 4FC7A 1XSEA 4OUDB 3T5CA 4MMYB 2QVCA 3WHKA 1V48A 2DTXA 1ISRA 3HXLA 4ZK2A 4JWKA 4OYYA 2X6TA 1BFUA 2OM6A 3KKPA 1OWPA 4U9UA 3KZVA 4MKGA 1HNNA 3QLEA 5CMLA 5HDQA 5LMCA 1ONSA 1WMDA 3N2EA 1A9ZA 4JJ8A 2CFIA 3TW6A 3M9XA 2J87A 1SGWA 1XTQA 2VXBA 1X2EA 4FE4A 2BELA 4BKUA 1BJTA 4KAJA 3WA6A 5DW3A 4BQNA 2GLXA 1XT6A 4BQRA 2CD7A 3GLHE 3TTYA 4DWWA 4C6RA 4ZHSA 4ZVUA 3BD8A 3JTEA 5LYJF 1Q7GA 3A10A 4OCZA 2OENG 1R4MB 3UIEA 4DT1A 3T4XA 2OAQ1 4DIUA 3DAYA 3ZH9B 3SFZA 2V97A 1DOZA 1YMUA 3IGFA 2ZW9A 5E7JA 1G8JA 1CQIB 7REQB 4QXOA 4RF3A 5BSUA 5HF8A 3AUUA 3ZWWA 2MTBA 2ZTSA 4X94A 4RLQA 3ONWA 4PTZA 1E2LA 2ZATA 1G8PA 4I0WB 2VUHB 4J6FA 4O2AF 1NUUA 1B8PA 2H51A 1T9AA 2QTFA 3CVXA 3M6MD 5EZYB 3JD0A 4QWWA 1Z6PA 2P7HA 1Y3DE 2ZJ0A 4B81A 3S1LA 3FZGA 4LGYA 2DKNA 2F8LA 1DKOA 2DPYA 2VF2A 3EXG2 2D5BA 3HRIA 5HJEA 1YR9A 2B7CA 3ZHCA 4CMIA 1OXSC 3U4MA 4U2FA 3R0JA 4CQLB 1VDZA 3T1OA 1EM6A 2CMGA 1X94A 1GQSA 4R5MA 4IIBA 4G8DA 4BVFA 2J3DA 2FPPA 3LT1A 4KPEC 5TGTA 3O93A 1E94E 3H5OA 5CCDA 5A1JA 2V7BA 5JXGA 1JHQA 2J0SA 3LVFO 9LDBA 3EIHA 1M76A 3PQ2A 2PKCA 2Y4OA 2O8DB 4R2LA 2O3SA 4YYZA 5FUMA 5LQNA 1FDOA 1QGOA 1U5AA 1ESDA 2VO1A 4XQEA 1H8HD 1O77A 4CF3A 3FMOB 1XKLA 3A9CA 4CQMB 2HMYB 2PGIA 2ZDGA 3DBRB 2I87A 4FEYA 2FZWA 2LIVA 5F1OA 5F7JA 1FU7A 3I72A 3TCNA 4KUEA 4ESVA 1THZA 3HJFA 3IAFA 4C6SA 3OD1A 3U0VA 5JNRA 3I1FA 4FFMA 1NC3A 3CMCO 5EP4A 1C0LA 3ITDA 4M7WA 4RPIA 1TEXA 4NCJA 4YXWD 2PGJA 4R8KA 2CVFA 4BNNA 3K1AB 5AW1A 3UYLA 5FFMA 2GEJA 3O90A 1AOXA 5C7LO 3N5CA 1E96A 5FUQA 5B6JA 1Y3AA 1VXOA 3ID6C 1JH9A 4U63A 4G0WA 2PJUA 4GQBA 1Y6JA 3AUXA 4HNGA 4QPPA 5CDFA 4FFBB 4RIIA 3MFQA 1NY5A 4W7SA 1ISSA 1KOJA 1TO1E 2AXQA 2X9NA 2Z57A 5HSGA 3W90A 4BMDA 2C96A 5DNYB 3MJCA 4D6PA 1CUFA 5BORA 5LQMA 4DCMA 2FVXA 5LQDA 4Q9NA 1QH8B 2HK6A 4HJXA 4X1YA 5DM4A 2L18A 3OX4A 2BBTA 3LUHA 5D00A 3W5CA 3ZLJA 3CF0A 2GRUA 1KAQA 2KM1A 3F1LA 3Q7PA 3GH1A 4HD8A 4W6ZA 4OOFA 3IMGA 3WYDA 1JWAB 2BEWB 2FF5A 4R1LA 4TT8A 3QA3E 3DVSX 4XXHA 5EMMA 2HDNB 4D0NA 5HYVA 2RHBA 6ABPA 3QSYA 4B6SA 4Q5IA 1F2TA 3DTTA 4JI5B 4LFCB 4M99A 3SQXA 3PEWA 1QFMA 1MIOA 2UYYA 1E77A 2Q7OE 4NNPA 5B12A 4Y7DA 3GI1A 1P60A 3A28A 5KHLB 4A36A 1ZWKA 3ONVA 1CS4C 3N07A 4RPJA 3LL4A 4XYLA 3CPSA 3U7HB 3ZU3A 2FLVA 1N5MA 1H1DA 1DPGA 3DCNA 1HQYE 3IIKA 1K06A 1OXBB 3GFRA 1DDGA 3PQ3A 1R2QA 3QSGA 4JVOA 4LK2A 5CNJA 1W87A 4CF4A 5CCEA 4GEGA 2ZM5A 3EF3A 1SPXA 5TB5A 3NBUA 4NNJA 3B38A 1XNJA 3OQ1A 4GBMA 5IC5A 4YPFA 3UQYS 2PBRA 4KLZA 2Q27A 3LTNC 2C88A 2G63A 3WYAA 3EEQA 4EHIA 4BPRA 5JNUA 2KSQA 2IHYA 1ZMTA 4FCVA 4JLNA 3SXPA 2EX0A 1M72A 2F9FA 3PSHA 1T0PA 3FSGD 3KJXA 1ECPA 1UFKA 1ZXBA 4LJ9A 3VR5A 4DDKA 1A2QA 1J39A 5IAOA 1J7JA 2QR2A 3BXFA 3FX2A 4Q3EA 1D2NA 1RLOA 5KQMA 1AN0A 4HWOA 4F9GA 4HRVA 1NC1A 1X9IA 2QYSA 1TLTA 2HD4A 4IWNA 5NULA 1TO6A 1XA4A 3LBAA 3PGXA 4JQZA 3E3AA 2A78A 1ZO8A 1H22A 1RRFA 4KLAA 4KTVE 3FPHA 4KN8A 1G7TA 4IIDA 2EARA 2D3WA 2XWQA 2PBFA 4KQJA 1O6BA 2G5CA