1USWA

Crystal structure of ferulic acid esterase from aspergillus niger
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
260
structure length
260
Chain Sequence
b'ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPADEGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERULOYL ESTERASE A
publication title The Crystal Structure of Feruloyl Esterase a from Aspergillus Niger Suggests Evolutive Functional Convergence in Feruloyl Esterase Family
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 84
structure length 260
sequence length 260
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uswA00
2HFJA 3VKFA 3HLKA 4DSZA 1XRRA 4XIIA 5A7GA 3F98A 4UFNA 3WKEA 3JWEA 3FBWA 5FV4A 3BJRA 5CRIA 2HU7A 4Y2TA 3AINA 4CIBA 3LS2A 4GBGA 4WY8A 5FXMA 3WJ2A 1TRHA 4KACA 3O4HA 4S0XA 2B61A 1XFDA 4DMCA 3WKCA 4BAUA 1XZCA 4BCCA 4QWWA 4K6HA 1VOTA 1EDEA 3C6BA 4MWTA 3H2JA 4PSCA 1R9MA 4BZZA 4KAFA 4UHFA 2WJ6A 3ANTA 3CCCA 4B0PA 4EY8A 5DYTA 5ALVA 2XUQA 4DNQA 4G8DA 3M81A 1W6RA 4ZRDA 3R40A 2GYWA 3STXA 5EHZA 1Q0RA 1AKNA 1E8MA 4W63A 3WA7A 2RHWA 5AKKA 5SYNA 4J03A 2CUTA 1ZJ5A 5DTJA 1E89A 2ZVDA 5A62A 1EB9A 4U2EA 2ZYHA 1DT3A 3JYHA 5AI8A 1SCKA 3AIKA 2BJHA 1JMYA 5AM5A 2XMZA 3LIIA 3H0CA 3QMMA 4ITVA 4B9AA 2HA5A 3I2HA 1THGA 1QONA 2G5TA 3IUQA 2QKYA 4UHDA 2WHRA 3QYJA 1U8EA 1XZMA 4JH0A 3AIOA 1USWA 1XQXA 2ZJ7A 1YASA 4X97A 2VATA 1MAHA 4Q05A 3STVA 1MX1A 2QJWA 3C43A 2GBFA 4X6XA 4K6KA 2WLSA 4Y2RA 2QVBA 3DCNA 4C89A 1EX9A 2AJLI 1EVEA 2RI6A 4TPKA 1QTRA 3VISA 5YASA 1YSCA 5C8VA 1ZIXA 1EVQA 3O0DA 3AIMA 1GPNA 2WFMA 1Z68A 4Y2YA 4K6GA 5AK3A 4G4IA 4H7FA 3I1YA 1JKMA 2JGLA 2R8BA 1F8UA 5JAUA 4BCBA 1L7AA 2WILA 4IQ4A 1IMJA 3C87A 4H0CA 4CCYB 1H2YA 3OM8A 5AOAA 3KXPA 1JI3A 3QITA 2XUHA 2VSQA 4X93A 2XT0A 4LKOA 1DWQA 1SFRA 3WA6A 3K6KA 4DMKA 5DYWA 5JANA 1AGYA 3WMRA 3K9BA 1QIIA 4ZWNA 1UOOA 3R3ZA 5AKJA 1JFRA 2PU5A 3R3WA 4QLAA 1VJ5A 1QIDA 1BE0A 2DQZA 4GECA 5ALTA 2EDCA 1WHTA 4UHCA 1CPYA 4A23A 3SX4A 4GLBA 3ANSA 1ACJA 3N0TA 5JYCA 1GQRA 3TGLA 5ALSA 3R3UA 4Y2VA 4B84A 2WIGA 4PO3X 1T2NA 3QZUA 3H19A 4C01A 1DU4A 4AO6A 1HBJA 4CG3A 3QH4A 2V9ZA 4OUKX 5IH7A 2WUDA 1OILA 2FJ0A 4E15A 2XUOA 3V9AA 2DFPA 4LYEA 2JGEA 5FRDA 5LKRA 3A70A 1GPKA 1QFMA 4OB7A 4XWGA 1CVLA 5AHXA 1LNSA 1CRLA 5IVIA 1PV1A 2AJCA 3KWJA 4BP9A 4XX1A 1L7QA 3O4JA 3WK8A 4ETWA 5FDFA 5T4HA 4BE4A 2DHDA 3QBJA 1MPXA 4BYMA 5HF8A 1J1IA 4ROTA 2GYUA 3DL4A 1LPMA 5KWIA 4WJLA 5FPQA 3FVRA 2H1IA 3AZQA 3BIXA 1CR6A 5SYMA 2XUFA 2J4CA 2C0PA 2QUAA 2XMRA 1XRLA 3O9MA 1QGED 4AZ3A 5HKBA 2W22A 1G42A 2XQKA 4QDXA 3MVEA 5AKXA 4AO7A 3QPDA 4H7IA 4HAIA 3WIBA 3ZLVA 5A7FA 4TGLA 5AO9A 3UMJA 4DSAA 2JIDA 3V1KA 5LZ5A 5AM4A 1SOMA 1AX9A 5AKHA 3R41A 1U2EA 4RE6A 5ALOA 1P0QA 2QTBA 1RWQA 1ZI8A 3R0VA 3AJAA 5D3KA 3C5VA 3FCXA 4KRYA 1VLQA 4J3JA 2ES4A 2V97A 2XQJA 4HXFB 2XLCA 1XZJA 4N8EA 1HDEA 1DQYA 1CUWA 2WKWA 1QIGA 5EHQA 4NMWA 4QA9A 2C5GA 4FFVA 4UPDA 3IIIA 5D6OA 2XMQA 3ZPXA 3C8DA 3LLCA 3A6ZA 4MQLA 1VXRA 1VZ2A 2OGTA 1YA8A 1YR2A 4GWLA 4BRSA 1OCEA 4BBZA 2Y6UA 3G02A 3C6ZA 1QOZA 5IKXA 5T4FA 4KAAA 4K2AA 4EB0A 1ODSA 2WIDA 5K3AA 4BB0A 3RLIA 4H35A 1IZ8A 4HVTA 5HK9A 2WFLB 3WK6A 3TRDA 5FLKA 1UFOA 5HQ3B 4BAZA 4KRXA 3ED1A 4L0CA 4EUSA 1LPAB 4FLFA 2XMBA 1LPOA 3LIPA 4XVCA 4BCDA 5K3DA 5J3JA 5EIAA 3DLTA 2JGFA 2WHPB 3V48A 3VJKA 4KE9A 5JZBA 1YAJA 1GT6A 1P0PA 4DTCA 4X92A 5BV7A 1GKKA 5DJ5A 4Q34A 3WL6A 5EGNA 3WZMA 3T52A 4UFPA 2PM8A 2ZYRA 4EA6A 4DNFA 2J3QA 2RAUA 4HRYA 4AQDA 5JD5A 1UK8A 1CUIA 3FYUC 3PFCA 1M33A 4NS4A 2UZ0A 4C4ZA 2CKMA 3G0IA 2HIHA 4F5ZA 4D9JA 2Q0XA 3E3AA 1EHYA 3H04A 3W04A 4M0FA 5ALKA 4BE9A 3O9VA 1F0NA 2QUBA 5AH0A 2D0DA 2WIFA 1W1IA 3ZLTA 4OCZA 3M3DA 1DX6A 5JADA 2DCMA 3C70A 1K63A 2VAXA 4W9RA 4UBOA 2H7XA 3KWFA 1UKBA 3HC7A 1EXWA 3F97A 2JGJA 3FLBA 1EDBA 3PF9A 1DWPA 2PX6A 1QIFA 1CUJA 2Z5GA 5A71A 5AP9A 3E1GA 1UOPA 2OPHA 4J0CA 2VJDA 4W1SA 1GZ7A 2RGUA 5CH3A 1JMKC 4UBNA 3Q0TA 5ALLA 5AK4A 3AZOA 3VVLA 2WUEA 1JJIA 3H1BA 4C88A 1Q84A 1THTA 2G5PA 4Z49A 3CXUA 1EA5A 2QMQA 2JBWA 1CQZA 2XLBA 5HF5A 4X95A 5ALNA 5LZ9A 2Z8ZA 1QLWA 2WTNA 2WTMA 1SC9A 1BU8A 2GBGA 5JD4A 5CXUA 3W06A 4PV7A 3F67A 4B9EA 2OCKA 4BTLA 5ALFA 1UOQA 3R3VA 3PF8A 5T4BA 3IA2A 2PVSA 4KEAA 2JGKA 1QIJA 2WG0A 4BRZA 1ZD3A 2D5LA 4U2BA 2PL5A 1DQZA 2H9YA 3QMWA 3NUZA 4KYVA 4FFWA 4OB6A 4Y2PA 1BEZA 3SWWA 3H17A 1EDDA 5LLSA 3EQ9A 3FAKA 4J7AA 4X6UA 1LZLA 3FLAA 2H7YA 5ALYA 2VQ6A 3F96A 4X90A 3H2HA 3G0GA 4DGQA 5DTIA 1MO2A 2ROQA 4MJ3A 1R88A 2V96A 2ZJFA 4MYSA 3IUMA 1SCIA 3IVMA 1IVYA 1K6EA 2O7VA 1TK3A 4INZA 5ALMA 1UKCA 3G9ZA 5ALPA 1O6FA 2B20A 3H1AA 5EHNA 5AI0A 3G7NA 3PFBA 2WJ4A 1JJBA 4B6GA 1CV2A 1CUHA 5A7HA 3RKSA 4EY7A 1MNQA 5IVKA 2PBLA 4XJVA 1CIJA 5HK8A 1NX9A 2XQIA 4Y2QA 4GXNA 3W05A 5ALEA 3BF7A 4EY6A 1UT6A 2ECFA 2C0QA 2HRRA 4X7BA 1QIKA 5AI5A 5BOVA 4P92A 3I28A 3L1HA 5AM0A 1YAHA 1MN6A 1AC5A 4E14A 3AILA 4FDMA 1YB6A 5I7UA 3IUJA 4V2IA 3WI7A 1XZDA 4X3CA 4GDMA 3F9CA 4PQEA 5EHXA 4KE7A 1R9NA 4C4YA 2VEOA 2C58A 1JT2A 2PSDA 3BIWA 3DL7A 2QM0A 4I19A 3C45A 4PW0A 3ILSA 4DNOA 2HM7A 3U0VA 3WKDA 5CT6A 4ARAA 2XUGA 4AXBA 4RGYA 5HF9A 1ZD2P 4QDOA 3OC0A 3FNBA 4X00A 5CMLA 5FKJA 1W52X 3IDAA 3GROA 3BDIA 4OU4A 3WQHA 4U2FA 1CUFA 4QLOA 4FTWA 1G5FA 3TEJA 4ZV7A 3E0XA 2QJRA 4LYDA 4BP8A 3B3QA 3IULA 2YYSA 3C5WP 5HF6A 4BVLA 2ORYA 1WB4A 1WOMA 1BRTA 2PSFA 2QZPA 1IZ7A 3HACA 1FFBA 5E4JA 5BWBA 1WHSA 3CCBA 5E4YA 1S8OA 1CUYA 1Y7IA 3RARA 5ALRA 3C6XA 4QEKA 6YASA 3VXKA 1H2ZA 3KDAA 1A8QA 4BVKA 5CT9A 3FSGA 1TKRA 5KBYA 5LP1A 4H77A 3CN9A 4PF1A 3C6YA 3FYTA 5ALWA 2VTVA 4FOLA 1JU3A 4WFIA 2Y6VA 3EIOA 4FBMA 1OXMA 4QDTA 1WPRA 5D3ZA 2OG1A 4KJXA 1ZD4A 4HTAA 4KE8A 1EK1A 4MQMA 2RHTA 3WL7A 4Y2UA 4GHWA 4AB1A 1XZKA 2ZSHA 1JJFA 2P8SA 2JEYA 3G8YA 1ZD5A 5FUMA 3DKRA 3G0DA 2BUAA 2XUAA 3TJMA 2DR0A 3I6ZA 4MWSA 5JAOA 4KAJA 5JARA 3WJ1A 4ARBA 1TCBA 4ZI5A 4AMZA 4W1RA 3BWXA 3AZPA 5CT8A 3OTQA 3LP5A 1CUEA 2RIPA 3R3YA 4CI9A 4DM7A 4JEIA 5EI5A 1K4YA 2W6CX 4J0DA 4PSDA 2XUKA 4AN0A 4FKBA 4BVJA 4HXGA 1CUVA 3V1MA 4B0OA 1VXOA 2WHQA 3MUOA 2WM2A 1XRMA 3WIOA 2HA2A 4Y7DA 2CEKA 4MYDA 1TQHA 3DYVA 1P0IA 3LCRA 2VAVA 2K2QB 1O6GA 4G5XA 3D0KA 3T4UA 4QDUA 5JAHA 3FWHA 5T4EA 2HA4A 5AK5A 3B12A 3WK9A 3WYDA 4JNCA 5ALQA 4UBKA 3W9UA 4CCWA 4L72A 3IBTA 3WKBA 1U4NA 5ESRA 4DMFA 4UBLA 4RPCA 4B83A 4YK7A 3PUIA 5JALA 4HZGA 2OAEA 3WLAA 4Y2JA 1QTIA 5ALHA 2XUIA 1A88A 1F0PA 3HXKA 4Q1VA 5D7BA 1QJ4A 1X70A 5ISMA 4DMHA 1ACLA 2JF0A 3G9UA 3HABA 4BAGA 4EHBA 2WIKA 4BATA 1N1MA 4J0GA 3A2LA 1CUDA 4MEBA 1QZ3A 3V1LA 3D2AA 4CG2A 1PJAA 2GZSA 1CUGA 3GZJA 5ALUA 2DQYA 1UK9A 4OU5A 3D3NA 1QO7A 4JUIA 1XLUA 1T4MA 4UBIA 5CH5A 4AX4A 4LHEA 4TVKA 1XZIA 2ONCA 4KE6A 4G4JA 3GBSA 3STYA 3DOIA 2VF2A 5DLPA 1AZWA 1GPLA 1BROA 3DEAA 4AN1A 4NZZA 3OG9A 3ICWA 1ZIYA 1LBSA 2QT9A 2BCEA 2OGZA 1XQWA 2XMGA 4YASA 2PSEA 1FFAA 2Y2UA 3N2ZB 3RK4A 2WUGA 3FYUA 4GEGA 1EH5A 4U2CA 1LZKA 3BXPA 1H23A 2WSLA 1ORWA 3M83A 3ZV7A 3KSRA 3WKAA 2AJDA 5AOBA 1R50A 4W1QA 2HA0A 5C8XA 5DNVA 5AM1A 4ZGBA 5AKYA 4QWMA 1XKTA 2O2IA 1CUCA 1Y37A 5LYYA 4UHHA 4A16A 5CXXA 3C8HA 4MEAA 3D7RA 2I3ZA 1E66A 5ALZA 3STUA 2XQFA 1XLVA 2QXTA 5C8ZA 2WFZA 4BTVA 1JU4A 2OCIA 1LPSA 3CN7A 2X76A 5I9IA 1LGYA 3FLEA 3QPAA 3I2FA 3G0CA 2O7RA 1L7RA 3PI6A 3WK5A 2HA6A 4EY5A 2PUHA 2XUPA 4OSEA 2GBCA 4QDZA 4Q3LA 2DSNA 1XRNA 1XRQA 2VT6A 4X71A 3RM3A 2C5FA 1EB8A 4RE5A 5IVHA 3GFFA 2PSJA 5AKZA 1W4LA 3H18A 4HRXA 4P08A 1CUZA 5C7YA 2I3DA 4Q3KA 1BEEA 1KEZA 2Z8XA 5AI6A 3OPMA 1WB5A 4YX9A 5KWJA 2IX9A 1ISPA 1ZI6A 5HFAA 3HYSA 2PSHA 4E46A 3WL5A 3H2IA 5CH8A 5ALIA 2XE4A 3GUUA 1CFJA 2ZSIA 5LZ7A 2HRQA 5AICA 1E8NA 3MGAA 4J0KA 4X85A 2Y2VA 3BL8A 1IUPA 4WY5A 2WFLA 4C4XA 2J3DA 4JYMA 1ETHA 2ZYSA 2V98A 1VE6A 2VT7A 1R1DA 2BKLA 4KR0A 1J2EA 2ACEA 1E3QA 3DKKA 1QFSA 3UUEA 4AZ0A 1SCQA 2I03A 3NWOA 2FX5A 4AMYA 5AIBA 2QRUA 1CUUA 3PUHA 5AKEA 3GELA 2XI4A 4YPVA 4FLMA 3S8YA 4UFOA 2QOEA 5K3FA 1ODTC 1TCCA 5AI9A 1C7JA 1VE7A 1YB7A 3W2TA 1EINA 2CZQA 3BJMA 3IB3A 3DS8A 4LIPD 4WCVA 1XROA 3OURA 4JYPA 5AKLA 1Q0ZA 4B7ZA 1QIHA 4DNPA 2JGIA 3DNMA 4E11A 3WK7A 3DJYA 5FOQA 1CUAA 2XUDA 3JW8A 5CURA 4Q82A 4F60A 4K5QA 5LIPA 4ZV9A 1UWCA 2WIJA 3ESDA 5EIHA 1W76A 1XZAA 2CMFA 2XDWA 1DWOA 2O2HA 2BUCA 4H7JA 4B85A 3VJMA 2GBIA 1B6GA 1R3DA 3IURA 4HS9A 3EQ8A 2O2GA 3AUKA 1MU0A 5A6VA 5ALJA 3BF8A 3FSGD 4H7HA 5LZ4A 3G9TA 1YA4A 2B9VA 2QS9A 5CTAA 3EF3A 3ESCA 1ZGBA 1HPLA 1YCDA 4FWBA 4F21A 3EBLA 4J0HA 2J4FA 3STTA 4Q3OA 5I8PA 4EZIA 2BFNA 1LLFA 3PICA 5LZ2A 3G9XA 1WCYA 1W75A 4G8CA 4J0IA 1HQDA 4OD0A 1ZICA 3O4GA 5DWDA 2XMSA 2E3JA 3O4IA 1WPXA 1H2WA 4EBBA 5FPPA 3HRHA 2Z3ZA 3DQZA 5JAPA 1FFCA 1I6WA 2VJBA 2ZYIA 4WFJA 3D4LA 2AJBA 5K3BA 3SK0A 2BAGA 4AO8A 4LXGA 5E2IA 1MX5A 1ZOIA 4OPMA 5AI4A 3L1IA 1H22A 4OYLA 1J07A 4G1FA 2HDWA 3V1NA 3DDUA 3HJUA 1BN6A 1G4HA 3W9BA 4H7KA 1CLEA 3MUNA 4BDSA 1A7UA 3BE8A 1N8SA 3DD5A 1VKHA 3OOSA 5FP0A 5AOCA 3ZLUA 1HKHA 1PFQA 3I6YA 4M0EA 2HU5A 2XMDA 2WG1A 4IH1A 1AMNA 4BDTA 1P0MA 3WYNA 4A5SA 1K5PA 2WU4A 2CB9A 1QO9A 4Y2XA 2G4LA 4G4GA 1HL7A 3QM1A 4HXEB 1EI9A 3FOBA 3HSSA 3I2KA 1KU0A 1AURA 2IIVA 1ODCA 2VJCA 4FHZA 2OLEA 5K3EA 2WQZA 1X2BA 4H7EA 4Y2SA 3STWA 2AXEA 3VJLA 1XRPA 3X3HA 4DIUA 4QNNA 2NW6A 1RP1A 3WWEA 7YASA 2GZRA 4GI1A 1BS9A 3D59A 2CJPA 1TCAA 5JD6A 1HLGA 5AKGA 1E8DA 3QMVA 1E5TA 4LXHA 4ZREA 1FSSA 2LIPA 1QIEA 1MNAA 4ZXFA 5C81A 1DX4A 5JATA 4DLNA 2YXPX 4IH4A 1XZBA 2BUBA 3G0BA 4BZWA 5E4TA 4OYYA 2JGMA 4UBJA 5EFZA 2Z3WA 2RONA 2PU7A 5AIAA 5KREA 3I2GA 4UHBA 1XKLA 1YS1X 3WWPA 1VA5A 2WJ3A 4X94A 3EQ7A 1QIMA 3D2CA 5F4ZA 4BC0A 3FYUB 1GXSA 5CT5A 4WFKA 4FLEA 1F6WA 2EDAA 5DNUA 1EK2A 2G63A 3GA7A 1UXOA 1FFDA 4Y9SA 2OCLA 2XUJA 4P9NA 4FNMA 2CBGA 2VJAA 1D07A 1UK6A 2OQVA 1B41A 4CFSA 5BWCA 1NU6A 5K3CA 3UUFA 4CCYA 4EY4A 2DHCA 2BGNA 4N8DA 1CUXA 3DOHA 1IUOA 4O08A 2C4HA 5CW2A 4G8BA 2HA3A 2ACKA 5DYYA 5EIEA 2R11A 5LKAA 5CBKA 1XQYA 1ZGCA 4I4CA 2HFKA 4J0JA 1DTEA 3YASA 2QR5A 1AUOA 2I78A 3F8SA 3U1TA 4MXDA 3WK4A 4X91A 1U65A 1TIBA 5AM3A 1LPNA 4CG1A 4U2GA 4C87A 1VZ3A 1BCRA 3NOXA 3WWDA 1GQSA 1FFEA 3AFIA 1CUBA 1LBTA 4NVRA 4WDQA 2Y1KA 1WM1A 1XZEA 5ALDA 4FBLA 4I3FA 2XMCA 3QVMA 1UZAA 2AJ8A 3M82A 1X2EA 3A2MA 1QE3A 4PSUA 5K5EA 2EEPA 3ZWQA 3E4DA 1CUSA 1BN7A 2B4KA 1NU8A 2HU8A 4PNZA 1A8UA 4P93A 3HZOA 3BDVA 2OQIA 3B5EA 2QXUA 3D2BA 1H2XA 2WU3A 1YS2X 3WZLA 1GGVA 3NGMA 4L9AA 3P2MA 2XB6A 2X8BA 4LXIA 4FNGA 1MX9A 1XZFA 4B81A 3HEAA 1J06A 2C7BA 2OCGA 2YASA 2YH2A 2HA7A 5ALGA 1C7IA 4L3WA 2VA9A 4W1PA 4X6YA 5AK6A 3SC2A 2DHEA 2FJPA 5A2GA 3VDXA 5K3FB 3I1IA 3S2ZA 1Q83A 1N5RA 2X5XA 4U2DA 3PE6A 5JZ9A 3WWOA 2XQGA 1IUNA 3WL8A 2PKYX 3HI4A 4IO0A 1RYYA 3ZI7A 1MT3A 1CQWA 1DT5A 1Y7HA 3R3XA 2H7CA 1LPBB 2JEZA 5AM2A 4N8SA 5DNWA 4N5HX 2OGSA 4QZVA 5HFNA 3A2NA 4RNCA 3ESBA 1MTZA 3QPCA 4G9EA 5IVDA 2WUFA 1N5MA 3D5EA 3KOOA 3ESAA 5JIBA 4CIAA 1TAHA 2FUKA 1XZLA 4FMPA 4OB8A 2BGRA 1R4ZA 1CEXA 1GKLA 1MAAA 1FJ2A 5HZGA 1XZHA 3O95A 3H2GA 2OAGA 5ALXA 5LZ8A 3L1JA 3I2IA 4M0MA 1XQVA 4DYHA 2OXEA 1MJ5A 1VA4A 2GYVA 2IITA 1WB6A 1XZGA 5JASA 1ZJ4A 3VVMA 3DYIA 2HHAA 4IHAA 5AKIA 1ORVA 1DINA 4IH9A 3H2KA 4H7DA 2ZJ6A 4H18A 1LPPA 3WWCA 3I2JA 4BC1A 1C4XA 3Q8WA 1BCSA 4G9GA 1K8QA 1ZI9A 5HCUA 1A8SA 3IUNA 5H3HA 1KU6A 5AJHA 1AQLA 1G66A 2HADA 2WG2A 5HQ3A 3FVTA 5HKAA 4QE3A 1UK7A 5CT4A 3KD2A 4UUQA 3I6MA 4WDRA 2PUJA 2WHPA 1UKAA 4UBMA 4C6HA 3FCYA 4B82A 2HL6A 3PDCA 4F0JA 4GW3A 4B80A 1XLWA 2PPLA 3K2IA 4UHEA 5JZSA 3ICVA 4N5IX
chains in the Genus database with same CATH superfamily
4DB2A 5TMDA 3A7DA 5ITWA 1ESZA 2ZDHA 2LGJA 1RPZA 4IYRA 3VKGA 3HEMA 4N0PA 4XQCA 1SQGA 2ZRQA 3WRYC 4QUBA 1E7QA 5KAPA 4YACA 2XTJA 1K6JA 1YMVA 1RAGA 2CV1A 4Y2TA 4F91B 1QE5A 2AGVA 3I83A 5FORA 3S40A 4GI7A 1KYIA 4JBNA 2JHFA 2YXDA 1TTTA 1VFPA 2QLBA 2O6HA 1YIOA 4P3YA 1QVZA 3PGKA 3RQIA 5K3OA 1PEYA 5DB4A 2C9OA 3HCPA 3FUCA 2B35A 3K72B 1C8KA 2OYRA 1RI3A 1RM0A 1VIVA 2AOUB 3EA4A 4NYIQ 5EXXA 3B51X 4FFBB 1EDZA 3WJ2A 3CRZA 3ELBA 4JODA 1KOLA 2YVKA 2QNIA 1GGNA 3SZUA 2F3UA 4UEKA 3J7AC 4OI2A 1FRFS 1XWWA 4MR9A 5TV2A 3WKCA 4C7VA 121PA 3NAZA 4QWWA 4B33A 4Q03A 1KSFX 4K6HA 3FG9A 1IIRA 3KJIA 4MLPA 1G1MA 5D3MA 3FCEA 4PNPA 4Z4EA 4YJHA 4TSFD 2XW6A 4XWTA 3GFBA 4QARA 4TV8A 4CQMB 2XXAA 1XJCA 1XXHE 4IDGA 3TVYA 5EVJA 1R9MA 4MS1B 5DBIA 4ED9A 3UAXA 4QPZA 3LMKA 1YZUA 2VK1A 1OZGA 4DXDA 2HF9A 2QZ9A 2WJ6A 3CCCA 3DTYA 4WH0A 4B0PA 2MCFA 4EY8A 1JDUA 1JVSA 3EOZA 3Q3CA 5HCNA 1E0AA 1HG1A 1MV8A 2BFCA 2DKFA 2WP8J 3OZAA 4PG7A 3DFUA 1ONSA 1JEYB 4XGQA 4LXXA 5A02A 5BQ5A 1E96A 2X8AA 5IC5A 1DDIA 1Q0RA 1C0IA 1MHTA 1X7XB 1HE4A 1Z0KA 2BFBB 2XYQA 4LZZA 1NWCA 2NYVA 1JPJA 4BZQA 4B3DA 3NXKA 2YS7A 3I45A 3PYMA 3WBJA 4DLVA 5AKKA 5JAZA 1KP3A 3KJHA 5JUWA 1T4BA 4N9QA 2VUUA 3TB6A 3TCKA 1S2GA 2D8AA 2VNIA 3LBYA 1J00A 2ANCA 4M0LA 2ADOA 2ZRNA 4OL0A 1E2EA 2Q3JA 3EDRA 1XRJA 1E89A 4KGVA 1RWKA 4JT8A 4GQBA 5C8DA 1M1ZA 3SSAA 3M70A 3L93A 4D9HA 4RZ2A 3CLUC 1X9HA 3AQ4A 3PQ5A 2ISCA 5HNKA 3LECA 2W93A 4UNQA 1R8QA 2D2FA 3GJQA 1DT3A 5HVNA 4C2AA 4URVR 1LS6A 5AI8A 1P7VA 4E12A 4DA0A 1FFXA 3AIKA 3HA2A 3R7LA 1AO3A 2D2VA 3UMVA 4BO5A 1USUA 2X23A 3L82B 3R2JA 1T6NA 4BMYA 4Z3DA 4C5CA 3G2OA 2WZCA 1JR4A 3OZIA 1II8B 4XDYA 1DAHA 1JMYA 4Z9BA 1O95A 2F43B 1K27A 3OQIA 4D8UA 4MUJA 4GMHA 3AKCA 1UBSB 4B9AA 2Q3BA 2HQOA 4LY6A 3A6KA 1QONA 2G5TA 2KHZA 3IUQA 3MK31 2QKYA 5KO2A 5D2CA 5LWHA 1BVRA 2P67A 4UHDA 2WHRA 2HLHA 3AT1A 1W0KD 1XZMA 3BVPA 3AIOA 1USWA 3O8QB 1CS0A 1ZBDA 1XQXA 2VHJA 3G2IA 5AESA 1X39A 1TU4A 3ZD7A 4CF4A 4W8GA 4X97A 4DA7A 3AVXA 2YMMA 1ST3A 3STVA 3GFVA 5A4JA 1MX1A 2V55B 3E82A 4WKNA 3FVQA 4KQHA 2CD7A 3AJ9A 4JVSB 3VU9A 5BSGA 3HVJA 5KMGB 1GCGA 2IY9A 2QVBA 1Y3FE 3DCNA 2QE7A 4OK5A 2AJLI 3UC9A 3M4ZA 1EMDA 2EFHB 2NZWA 2QJOA 1ORDA 4NAHA 5DTEA 4IX9A 3EAGA 1QTRA 3JD3A 4PY2A 2GO1A 1RAFA 2EIHA 3F6CA 3QXCA 4KFSA 4B7CA 1GR1A 1MA0A 5GGXA 3TUZC 1NP3A 4HWSA 1TM1E 1KY2A 3OPVA 4CPDA 3HV2A 4KIUA 2UZ1A 1KRWA 2AN1A 2C57A 1UCFA 1YB1A 3IVCA 3MPUA 2YVLA 4C1NA 4IPTA 4WTOA 5L6LB 3ETHA 1FEZA 1GAJA 1P17A 2HQSA 1Z0DA 3JQBC 3KO8A 5T5QA 4ID3A 1F8YA 2AD1A 4NZ9A 3AJDA 3TYXA 1RXEA 1ZK4A 2QAGC 2GN4A 5TRTA 2B6NA 3NGXA 1JKMA 2R2AA 4JJFA 1ABEA 3JD2A 5H82A 3ZKAA 1F8UA 3BULA 3ELWA 3R5XA 4BNFA 1RJ9A 2Z8YM 3PX2A 2WTAA 4CMHA 2JIBA 4TYNA 3PJFA 3C87A 2P69A 4LAFA 5JNUA 1OU0A 5CLGA 1Q3KA 2RJOA 3OM8A 5DHUA 2O8EA 2ASVA 1JKJA 3WADA 1IDN1 2D1RA 1XCGB 1XEFA 2VKTA 2Z9CA 5G02A 4A8HA 3BXZA 4N54A 5LQAA 2PYIA 1XQ9A 3QU4A 1C9MA 3OQOA 1UBFA 3KDPA 2XPCA 4QU8A 4ZMBA 2WU0A 3JQAD 5B4TA 2VAWA 3WA6A 3S44A 3OZUA 3LC0A 2FLWA 3TZCA 1KK2A 3U26A 1KSHA 1AN9A 4JLKA 1OT3A 2J3MA 4B6PA 5JANA 3UB4A 1N5OX 5CVUA 1JSXA 4B8WA 3EDOA 4RQUA 1BWPA 3SLKA 3T12A 1ISJA 1DIGA 1QIIA 4QQ8A 1NVBA 3K1AB 2MIIA 1VL2A 1RQNA 3L02A 1XNGA 4MRSA 4J3NA 4PG5A 2FDCA 4X66B 2UUPA 1C8BA 3OZDA 5L40A 1CRZA 3LY5A 2KI5A 2PU5A 3E2IA 2E85A 4I14A 4JJIA 1WUYA 4NJMA 5K8LA 4LI0A 1PKXA 1E3TA 1AS0A 5AHRA 1VJ5A 1REQA 3RJTA 1HA3A 1A4IA 1UQUA 2DPHA 1DTWA 2P2ZA 5EWJA 2QEQA 3TLEA 1NQWA 3RSFA 5HE9A 3G7UA 4O02B 4BEVA 3MTBA 5L3VA 4NX2A 3UVEA 4E5UA 3RSHA 2IVZA 4LJ9A 3VRHA 4JZKA 1SC6A 1VGQA 4NCKA 2VK8A 4QQFA 2YW2A 2VSXA 1NN3A 3EUEA 1UQTA 3BH6A 4TWJA 4MGYR 4F3TA 3JWIA 3Q4GA 2JFHA 3ENVA 1UBGA 3A9UA 5HG0A 4CMIA 1SD1A 2IYTA 3FDFA 1P7WA 4Z99A 4HDKB 3GP8A 3EXHC 3V7UA 1ZIDA 2HLDD 3KLBA 3R3UA 2C4WA 4MV3A 4RKEA 4Y2VA 2WIGA 1NYTA 3GAFA 4Q01A 4PO3X 3W5CA 4KVFA 1T2NA 1Q7GA 1DV1A 2YW9A 4IOJA 1MX3A 5FBRB 1UC8A 2Q4TA 1R12A 1GZ4A 1HBJA 1SUFA 4PRYA 1XMVA 3S8MA 2V9ZA 4OUKX 2P27A 3LQFA 5IH7A 2PTGA 3V97A 2FJ0A 4E15A 3OIDA 3H11A 1JTVA 3V9AA 1QHFA 1BXGA 1G3RA 4BNXA 3ONVA 1SC1A 2H8GA 3A70A 1XQ6A 2JK1A 3MGBA 4O4LF 2FAXA 2VUIB 2QTTA 1UWVA 4RETA 2VJYA 2BSQA 4LGVA 2WM9B 4GMDA 4LN1A 3DUFB 1R27A 4YDSA 3SDBA 3FY4A 3MTDA 3AVVA 6AT1A 1FQJA 1CVLA 2WNHA 1LNSA 5AHXA 3R7BA 2WJHA 2OLJA 3VPGA 3Q8MA 2C42A 4RW0A 1PV1A 2NPFA 5KWVA 4RFVA 1L7QA 1I1OA 4BO7A 4BNVA 1RPJA 2YV2A 2R1TA 3GN1A 3AHFA 4A03A 1Z5ZA 1ISRA 1UBTS 1I3KA 4HPWA 1GUDA 1A04A 4BFVA 3AFHA 5FWYA 1BX0A 5T4HA 1G2IA 1QGUA 2DHDA 4HPJB 2HMWA 2R8XA 4HS4A 4JEUA 4HL6A 4C0BA 3ZCTA 3P2OA 3WGIA 1T9HA 3EAQA 1OBOA 4WLUA 4PAQA 5U9CA 2QVLA 4ZQBA 2PX8A 2QD1A 1MLDA 3EEYA 2K7FA 2H4ZA 1J1IA 5DHPA 1XHFA 3VYRB 1QVAA 4ROTA 2C4UA 4WRRA 4JBGA 4MSUA 2V6JA 5DISB 2FW9A 4F06A 1MHPA 1AUQA 2Q7OE 2FSSA 2HIGA 1EXMA 2AL7A 3HO8A 2HMVA 2PRKA 3DWGA 3QI2A 1TAUA 2ZZKA 3O8RA 1PGQA 1LX7A 1KEEA 2PAFA 4MUIA 4H3KB 5H83A 3CONA 4DLAA 4GLFA 5KNDA 2C0PA 1GUAA 2QUAA 1ISMA 1Y6GA 5CYFA 1EEHA 1H2HA 1QGED 1GSOA 2VJMB 1KZHA 4HDCA 4CN9A 1DQNA 2CYBA 4XR9A 3QWHA 4I4TF 4OQXA 4OI1A 1N4AA 4Y18A 4D8TA 5GTDA 2FE1A 2EBHX 2W22A 4BO8A 4MUBA 1TIPA 4O33A 4BGIA 4Z4FA 4KP7A 2YNMC 4AJHA 1FMJA 3TQSA 1XX6A 4R1QA 4LEIA 4I9HA 4DWJA 3E23A 1Z33A 3DP9A 4ISCA 3PQ3A 2FR1A 2BTOA 4UCXA 1UH5A 3U7JA 4IV0A 3WIBA 4D79A 1ZLXA 1N36B 1YI0A 2NU7B 5JAMA 1WX1A 3AESA 1I4LD 4I81A 5A7FA 3LXRA 5ABPA 1IEQA 4BLQA 1GEEA 2LE0A 2OO5C 1DBIA 4RHUA 4DSAA 2WAYA 3L77A 2UYOA 2JIDA 2JA1A 4Z0NA 1K86A 2ETVA 2F1RA 3AI2A 2QUJA 3DEKA 3CH7A 3TVTA 3V1KA 1J24A 5EMKA 5LZ5A 1I2CA 5AM4A 4D96A 2BDEA 4Q3CA 1NVFA 1ADGA 1U2DA 1JYFA 2PJDA 1QX3A 1FX0B 3ZHBA 3WMFA 4KBYA 3WGLA 4QKQA 5K9ZA 5ALOA 1P0QA 2VTKA 3A8TA 3QVXA 1XQ1A 5EIBD 3AUXA 3NHJA 1VTKA 2HF7A 3T0IA 4CM4B 5D3KA 3FCXA 3I53A 2VYQA 3BQNB 4J3JA 4KRYA 1WOYA 2H00A 2JANA 4FKMA 2HO4A 4Q48A 5ECYA 5K6AA 1KTIA 3WNDA 3S99A 2VKQA 1DS6A 2DQKA 2X4GA 4FW9A 5DN6A 2J30A 3A26A 3LUFA 4IYJA 5H1YA 3B9RA 3GLFE 1I4OA 2Q8QA 1L8AA 2IODA 1ZQ1A 2R6HA 2YHIB 5KYVA 4EW1A 4MVYA 2HF2A 2NUPB 2XWJI 1XK7A 3UH0A 1DEHA 2F3QA 2PRIA 2X5OA 4QA9A 1XELA 2C5GA 3MWEA 1TOAA 4XFDA 1DBVO 2MT9A 3DOUA 3H2SA 2AQKA 4FFVA 5HDQA 5IUJC 3TG8A 3I52A 4G5FA 2A67A 3FHCB 4MICA 1I36A 1JLRA 1FOEB 2NU6A 4D02A 3DLPX 3Q15C 4OQ4A 1U7HA 4YCCA 1LBQA 4DC1A 4M36A 2EJCA 3M2TA 2Q29A 4QNRA 3S29A 3H2ZA 4J16A 1RC8A 1NUQA 2Z04A 4XEUA 4BNDA 2AFHA 1A9PA 4PPQA 1OFUA 1K7EB 3SZLA 5ED4A 3FPGA 1DZ3A 1V71A 4YAKA 4TKZA 4UOZA 4TMXA 1M76A 2FN8A 4IFTA 3U3XA 4Z3OA 1HK7A 2J85A 1MMFB 1VCNA 2HZ7A 4MGKR 4O5OA 5CLHA 1JR3E 1V6CA 4D46A 4ENRA 5DSZA 3CUTA 4C4OA 5F2KA 5FIUA 3PGLA 4BRSA 2OG2A 1OCEA 2B9EA 3NM4A 4QOSA 5T8KC 3VKWA 1L4GA 2XDQB 3BD6A 2Q0HA 4GO1A 3RKRA 3U3DA 4BBZA 5B30A 3PRKE 2CYAA 3C6ZA 4ASUD 3LX5A 1XEXA 1HOTA 4J90A 5ES4B 2XZTA 5FBVB 4EB0A 2Q49A 4E5DA 1JIXA 2VRCA 2WIDA 4YQEA 4DEYA 3RS0A 1J42A 3SBOA 2P5UA 3PDHA 4ZA2A 4ZYYA 5K0BA 5B3KA 4YY3B 1EFUA 2WZBA 5TQ2A 3RLIA 4JB3A 1HTTA 1IZ8A 4HVTA 1Z6QA 2HOQA 2ZUVA 1V47A 3M4NA 3D81A 1AUPA 4IXWA 2HSJA 2DAPA 5FLKA 3VDNB 5HQ3B 2XA1A 3RWOA 4F11A 1B42A 4DWWA 2FG7C 3DVAB 1VJ1A 3U3KA 2X2OA 4S1PA 4ZKDA 4BBJA 1IQUA 1EBBA 1P2UA 4K87A 2IXTA 5LB4A 5D7NA 2XMBA 4R2WA 3SNKA 3UAGA 4XTCS 3UQZA 4XVCA 4ZT5A 3WZ2A 1P77A 4P84A 3WDLA 2QW8A 2VBCA 3K8YA 2P75A 4S1TA 2XBUA 4HEA1 3LQRA 3CS3A 3LVRE 621PA 3GZ4A 1GRVA 4L6AA 2WHPB 1YDWA 2GF9A 5LYJA 3U9TA 3DO5A 1WXHA 4OHCA 1V9LA 4FB4A 3B9BA 4TLDA 1WKVA 3OAAA 1P0PA 4LKRA 4FGLA 1V25A 5EXEA 1G21E 2R3SA 4DVJA 1NY6A 1Y8RA 3E35A 1SJ9A 3BA1A 3PRHA 4Q34A 3USCS 4YV2A 4RVFA 1MC5A 2EGUA 3QMMA 5IVPA 1NN0A 3BSFA 3DBHA 2QRVB 4QHYA 5IABA 2QLNA 3HP4A 3RS2A 1LV7A 4GQAA 4R9VA 4C20A 2P6OA 1TKCA 5AWFC 3NBUA 5F12A 2O1XA 4UFPA 1DWUA 1D4AA 1JHOA 3IUSA 5E9AA 3ZCSA 1UFVA 1FE8A 3TSOA 4O4LA 4EA6A 1MXHA 4X1OA 5LU9A 1T6ZA 4HGPA 4EFKA 1H9AA 4KAXA 3KEGA 5LP6B 3OQMA 4FQ7A 4MKRA 1U2TA 3BWYA 2G1AA 2HSGA 3SOPA 1JTEA 1W35A 2XKJE 4D81A 1ZDMA 1WU8A 1CUIA 4W6QA 3FYUC 3Q5GA 3K0SA 3MMZA 2GRAA 3C3KA 3F78A 2UZ0A 5ECWA 3TBHA 1SB8A 1E9AA 1OD6A 1YDHA 5KYWB 2CKMA 3G0IA 3RANA 2Z6AA 4HAVA 5EY5B 5LXTB 1YRYE 1A8HA 4NZMA 3UH1A 3TTWA 4P4SB 4G5RA 2WM3A 5ARDA 2GPJA 4D9JA 3T5CA 3VV2A 4JLBA 2Q0XA 1O58A 1SBNE 3AV0B 5DX8A 1T2CA 3BGIA 4TLLB 3W2HA 3I04A 5SZHB 3U16A 1CDEA 1CT9A 3RT1A 3W04A 5ALKA 1C0PA 2GARA 3TSZA 3HYCA 3N8DA 3WNCA 1EP9A 2VDOB 5KEIA 1EFAA 2EKDA 2CLDX 2D0DA 4PBTA 2IS1A 2W6JA 3G5TA 1W1IA 4NHOA 4JZYA 3RS4A 1YHYA 3BEOA 5DXJA 3M9XA 2A7QA 2KPOA 3BXEA 3FFTA 2HD4A 4LE2A 4GLJA 4M1TA 1NJ2A 4I1IA 5HMLA 4D4KA 3F5FA 2EKLA 2D1FA 4QU5A 1ONPA 2H7XA 1XVUA 3D1JA 3KWFA 1DKPA 2P5SA 4NRDA 2A0UA 2V7WA 4TWIA 5ICCA 3MILA 5CX1B 3MTAA 1U9JA 3AKDA 4I4TA 4LOHA 1XP5A 4ZVTA 4BL5A 4UTRA 4Z4QA 2QBYA 3OFNA 4JLDA 2EX0A 3QLUA 3BKWA 2JGJA 1I1QB 1RT9A 4LVOA 2AEJA 2VDMB 4M9ZA 3RU7A 2BFEB 4NC9A 3PEWA 2DTXA 2OL4A 2XOEA 4RESA 3KQUA 3VGJA 4MVJE 1ATZA 3VDRA 1CUJA 3BJEA 3LT5A 4M38A 2Z5GA 2VPYA 4ZO9A 5A71A 1H8HD 1TPZA 4WBSA 1N2SA 1XCJA 3DHNA 4YMLA 4A15A 1MJNA 4G07A 1UOPA 2FG6C 1F4VA 3WL4A 2R5NA 4J0CA 4B79A 4EDFA 4K9OA 2PRSA 3NMUF 4KDRA 4BNUA 2QTCA 1FZTA 2B98A 1Q14A 2BELA 2IDZA 2RGUA 3QUTA 3GYBA 4QXOA 2B8WA 3HFRA 3N28A 4GGMX 4IXDA 5KYYA 1AJEA 2C2HA 4PGFA 2DB3A 3DFFA 2JS7A 2OAP1 3GOQA 4ZJPA 2P2YA 1AXGA 3IAHA 5ITVA 1SKAA 5L4NA 5K20A 1Y98A 1R0WA 1PLLA 4N03A 4ZODA 1N8TA 5CDSA 5ALLA 3EARA 3FA2A 2A35A 1R4NB 3VTAA 3GG9A 5ARCA 1PR0A 5FI5A 3LFHA 3FGOA 5K0SA 4DCCA 3N2KA 1EXDA 1WMEA 1K3TA 3WLTA 2YUIA 3W2GA 1Q84A 1CJTC 3S6JA 3KZVA 4IIJB 4XI9A 3P20A 2C4MA 3U4DA 4Z49A 2ZXEA 2XLBA 3BIJA 1FXUA 2AR7A 2OBYA 1KQPA 2CHQA 2WSSD 4N3AA 4QNMA 1PZMA 3PQ6A 1M8GA 1TVKA 3O1IC 3AUJB 3V4SA 2ECPA 5HUQA 1E1RA 1DC7A 2KB0A 1D0VA 3K7EA 3GLGA 2WTMA 1OI7A 1U0RA 3P0FA 2QM3A 1W85B 3PDIA 4LCBA 1A4RA 3MIIA 4GKBA 5HOEA 2ZBUA 3NR2A 4LDRA 1YZHA 1YBVA 2BM9A 1I3LA 1XZPA 2NG1A 2VAPA 2QE7D 2IYPA 2G07A 2XGOA 3H5IA 4MVXA 3GPBA 4FCCA 2JKZA 4R1MA 4K1XA 2NO1A 3IC5A 3IX7A 3TIIA 1FQKA 2VCHA 3L1VA 4ER7A 3S7TA 4DL9A 3OOYA 4I5EA 1KFBB 1EFVB 2QIPA 2IYVA 5K8IA 4EH1A 3IODA 1WPQA 1U1FA 2R62A 4DR7B 4EI8A 1HGXA 3KAJA 4LZPA 2C4NA 1VL1A 2EEZA 2EHDA 1GN9A 3FWPA 4PCAA 2GWRA 3MJSA 1Y4ZA 5LM3A 1YDMA 2HHLA 2MMGA 1PZXA 1RYMA 4ZI7F 2A33A 3IA2A 2ILVA 1R4AA 5J4YA 1XMSA 2D0PB 4EJSA 4ENVA 4HNVA 2ZIAA 3FZGA 3GCDA 4PS1A 4RVSA 3V5NA 2Q07A 3BTUA 4PO9A 4Q1AA 1PT7A 3MWDA 5DNDA 1AU9A 5G1OA 5AVRA 1X8XA 4GXQA 1P18A 2AI3A 1C9DB 3B85A 3W1EA 4RENA 3SSNA 1ZD3A 3H5RA 4YRIA 1TU0A 2J3IA 3NUGA 5KYNA 3IE1A 5FHQA 4DCUA 2PL5A 1Z4LA 3LQKA 2GILA 5KWEA 1W4BA 5A4IS 3GN2A 2FVYA 2HMUA 3B7WA 1YOVB 1SAYA 1I1HA 1V16B 1VLZA 2SKEA 5LNK6 3SWWA 1U0JA 3ME5A 1DEXA 3SXUA 3OEEA 3PUXA 4RDIA 1EDDA 4IDFA 2AV6A 5KX5F 2Q6OA 4M86A 1TKBA 3O47A 1W9MA 1IQRA 1M2FA 1WMDA 2X2FA 3N39C 3F7NA 3LBFA 3P96A 4X6UA 1LZLA 3C3YA 1DB3A 1ZVQA 3KOMA 2FWJA 4U6QA 4WJZA 1EE1A 4BLVA 3GLIB 5K0CA 1OZFA 1BWSA 4RYLA 3D6MA 4FDUA 2H7YA 3KU1A 2C03A 5KOJA 1SA0B 3ORQA 2VQ6A 3L46A 3LUPA 1XCPA 4MPTA 2YC2C 4DGQA 3TPZA 3HNRA 5CFMA 4AT1A 1XNJA 4YUWA 3CGGA 3QLVA 4OKSA 3IPYA 2V96A 2VBGA 2ZJFA 4R3NA 2XNJA 4I99A 3GGDA 4MYSA 5FTNA 5CB4B 1F5SA 5LSAA 5HFJA 4WKCA 5CNKA 5CA0B 4HQLA 3BHNA 4NH0A 4QIHA 5EESA 5CDGA 1BHSA 3ENNA 3P27A 1GPAA 3ZXYA 4ER0A 3DEIA 5EQTA 5EHNA 5AI0A 2QRKA 1PTJA 3OUZA 5E6RB 1UEJA 2ZUEA 3TM4A 2CGEA 3PFBA 4Q9AA 1R8SA 4B6RA 2W2KA 4DLRA 2IZ6A 2WJ4A 1PW7A 3GJ4A 2HBQA 2X5KO 4JHXA 2BC9A 5D87A 3PEUA 5GIPE 1J9GA 3OKCA 2FPPB 1CQIB 1S2NA 4RM2A 3GFPA 3DL2A 1NUPA 3PX3A 5A7HA 4EY7A 4D42A 4B7XA 2XBLA 2BZ0A 4R1OA 4BLOA 1LC0A 4BNLA 3GT3A 1NONA 3IAS1 4IKOA 4EHKA 4KSCA 4BWYA 1TYEB 2X9LA 3EW9A 4XJVA 4GSYA 4I1VA 1EUYA 2XDYA 3L01A 1IB6A 3F74A 4AUMA 1YQEA 3T7AA 3G2HA 2GH1A 2VBFA 1KZ4A 1WW8A 1ZRNA 2Z4RA 1NX9A 4U8GA 2PEYA 2XCRB 4FMDB 2XQIA 2JCSA 3PHCA 2NP6A 1NVVQ 1SHKA 1SG9A 5DULA 1QHXA 3Q8XB 1KAQA 3B3AA 4ZQHA 1J8DA 2VYVA 3SOZA 5ALEA 5I5EA 1U31A 3AP2A 1BKYA 2WMOB 1UT6A 2QX6A 3FNHA 4EY6A 3CUUA 3WG9A 1XD9A 4X7BA 1YVRA 4KUHA 3ZWYA 4RQTA 1A5BB 1P9LA 2MTBA 1QIKA 5AI5A 5F5LA 1RWVA 3R7WA 3WXMA 2B0CA 3IEPA 5BOVA 4M0PA 1JXMA 3KUCA 5CJPA 4P81A 3UT0A 3PHJA 3DTVD 5AM0A 1CU1A 1N2EA 1YAHA 1ZNYA 3QXGA 3CVWA 1RMTA 2MSCB 3VO9A 1YB6A 1JLLA 4M8IA 4EFNA 3L6UA 1XVIA 1O96A 1US8B 3IUJA 3MFYA 2EG9A 4V2IA 3U3JA 2GZMA 5CNMA 3W79A 4D98A 6GPBA 1QYDA 5DWVA 3HB5X 5C3UA 3KHKA 3V2HA 3EBPA 3L7NA 3MWGA 3WAKA 3Q6IA 5DM2A 4PQEA 5FUBA 2NZ2A 1AKQA 4DQUA 1DARA 2GXUA 3GCGA 2AXQA 2AW5A 2FP3A 2WBLC 3JASA 3L0BA 1Z0ZA 1ZRSA 3A06A 3P8ZA 4R5HA 3IHWA 4ARZA 4KSYA 1UFQA 1BMDA 5A3SA 1T6BY 3CKKA 3GJ8A 3KJXA 3TAUA 4N47A 2EWWA 1J0CA 1XYVA 1Z0FA 5DO9A 4EM6A 4RIHA 4XUCA 1L8OA 2X1LA 2BI7A 2C2ZA 2CNWD 4ABYA 1UMBB 2H5LA 2OE2A 4X1IB 5M5BA 2NMVA 2B1GA 5AT1A 4OO3A 1M75A 2P2LA 3HVKA 3CW9A 3W9SA 4ZI3A 1KY3A 1R0SA 1T5SA 3ILSA 3CRQA 3JQ9C 4P7BA 5IBQA 4DNOA 4F2PA 1RADA 3UGTA 3RBZA 1ZN7A 3VPCA 2PMDA 1U3GA 2IHKA 5CJJA 4CMCA 4F96A 3K05A 4O8CA 4I36A 4AXBA 4GR9A 5HGXA 1G0NA 3S2UA 4H1WA 1W52X 3QX7A 3FUTA 3UA3A 3U13A 4V03A 2H4JA 4YI3A 2R00A 2ENUA 3R3HA 4OU4A 5D6NA 3Q7EA 1NBME 2PZKA 3R3SA 3WWYA 2JDIA 1NRIA 3SHQA 2O8NA 3FF4A 3JQAB 4UJ3A 4CN8A 1AZLA 1OAOA 3G5LA 2BHRA 3PXUA 1G6HA 3WV5A 3VR2D 2EVWX 4FTWA 4RTJA 3AV3A 3H87A 4L4XA 3AERA 3TEJA 1XRSB 3W5HA 3BBPA 1S8AA 1QORA 3KQSA 1KJQA 2O2XA 2VXYA 2Z95A 2E4AA 4KRGA 4V0QA 1Y9AA 2PWAA 3ANXA 4MJXA 4BP8A 1IBKB 1ADCA 1VHDA 3LW7A 3UMYA 1SOAA 1Z15A 2FPUA 3W06A 5ITZB 3NWBA 4KCGA 3ROTA 1UBJS 2JIZA 2BGGA 2Y68A 3VR5A 4G26A 2PSFA 1JA0A 3BK7A 3UFXA 2MU1A 4L5AA 2QZPA 3HY6A 1YQDA 1QV9A 1I7LA 3MTQA 2YIJA 4Y67A 1WIWA 2Y05A 3JAKA 3N86A 5BWBA 2IZ1A 3X0DA 1Z39A 2ZUWA 2HBRA 2EFEB 1RPNA 5C7LO 1MKYA 3L8MA 4ZI7A 3O8CA 3H3JA 4BX0A 4M9QA 4JWTA 5FYDA 2GPAA 2QGFA 4CQNA 4JOSA 4QEKA 1M74A 2ZPUA 4F5DA 5CD9A 2KX7A 3CTPA 4XUGB 4DTIA 3FROA 3VXKA 4B3RB 1H2ZA 1FY2A 4Y9RA 4BVKA 2JVJA 5EERA 4QBKA 5CT9A 2D54A 1HT3A 1TKRA 3FSGA 2QR2A 3LT2A 4PAWA 4DJJA 3HCRA 3LPDA 4YN3A 2O48X 3UAVA 2O2DA 3CN9A 1MXFA 1YI1A 4GRAA 3SJUA 2GZAA 3WYAA 4LNAA 3IIMA 4QDKA 3A58B 3BGVA 1PIWA 3FYTA 4QBIA 4JUDX 5FLXA 1ODKA 3AEUA 6REQB 4FD3A 1EFKA 4FOLA 1WCIB 2H4FA 4A8PA 1Z5PA 3FPAA 4AJLA 1YTLA 4URXR 5AW6A 3SC4A 4X41A 3SKVA 5KX5A 1SPBS 3JQ8B 4D9KA 3QF7A 1BW9A 4FZJA 2FFRA 1G20B 4ALMA 1D6MA 4KB5A 4WZZA 1JVBA 5LDHA 2AQ8A 4RWZA 2DBQA 3QA3E 4XYGA 1EUQA 5H59A 1QH8A 4O0LA 4HTAA 1SXQA 2F8LA 3QOWA 3KLNA 1YRQA 3IT3A 4G67A 4NY1A 4Q4AA 1XA0A 3Q9NA 4V0OA 4Y2UA 2AWOA 4W9NC 4WASA 2N1BA 3WLFA 5EXSA 3QVKA 1NF8A 1KO1A 1XZKA 2ZSHA 4GYWA 2FUEA 3ZX5A 4AB1A 6LDHA 2VPXA 2P65A 3KL2A 2H54A 2M1XA 2OVFA 4YEDA 3LFTA 3CNQS 2UAGA 5JVDB 3ZHXA 2P8SA 1MB0A 4B2IA 4C0JA 5HW0A 1OB5A 4JLUA 2EFJA 3IEKA 3O73A 2CDRA 2I2CA 4LFAB 3F46A 5FUMA 1XMOB 2J0QA 3OQPA 1C1DA 3PD0A 4HDMA 5AXBA 3N2YA 1RDFA 4B2PA 5FI0B 1G0OA 3ZVMA 3FN4A 4DJEC 1B3BA 1X87A 3ZNNA 3RRNA 1RYHA 2QI9C 5JARA 1WSAA 5TJ9A 3WJ1A 3B2QA 4ZI5A 3IP9A 5DBOA 5CFZA 3BQMB 3W34A 1Y3IA 4CTJA 4MZDA 2HR1A 3BWXA 4YCAA 2AN4A 5EJ4A 1Y7TA 3ASYA 2NO6A 3EVEA 3Q7PA 3RU3A 3V7FA 4E94A 1MIOA 4RM3A 3HY4A 3OTQA 5KYXA 3ZE6A 3WGUA 4NV0A 4F4JA 1II0A 5L53A 2IE8A 5BSWA 3I9FA 5JJBA 4G0VA 3V6LA 1CUEA 3RC7A 1J2YA 3OE7A 3R3YA 4URFA 1JQAA 2DFDA 4CI9A 1OJLA 5EI5A 3RYCA 3E2MA 1K4YA 2ZE7A 1E1MA 4FXPA 1U1DA 1E2GA 2W6CX 3OAAD 1Q1GA 1NVMB 2ZIGA 3RRBA 1IHXA 4N3GA 4Q21A 5ELXA 2P3OA 1EIWA 2YZ2A 2X7JA 4COOA 5BQXA 5AVOA 1ID1A 1S4QA 5PGMA 5IKPA 4UASA 4Y6SA 4DV4B 1P1RA 4I4LA 2PKCA 3PCTA 3V1MA 3KVVA 4ZK6A 4BX2A 4YMVA 4UZEA 4G5YA 2R6AA 1XRMA 4MW1A 4KWEA 2ZK7A 4M9UA 3SLGA 4HWRA 2J33A 3DEJA 1T6XA 1KAEA 2MSDB 2WF7A 4AZSA 3ORHA 2AHRA 3C4QA 4C06A 1L3CA 1O97D 4IOMA 3MFQA 2NZYA 3PKIA 2F62A 1C7EA 1A7AA 1P0IA 1PJ8A 3LCRA 1XYGA 3BDAA 1W4AA 1HDZA 1SK8A 4XJTA 2ZB8A 4OGFA 2W9XA 4U5QA 5BWMA 4ZCLA 1C50A 3IMFA 1JJVA 3O84A 4LZAA 3C1TA 1QC5B 3D0KA 4RA6A 1S3GA 4HB4A 2P2CA 3SZGA 2FEXA 2ZYWX 3GW8A 2H59A 5CFQA 4QDUA 1DBSA 2ZUDA 5JAHA 4CCSA 2YJGA 1VI6A 2CHGA 2L42A 1AKMA 1GA6A 4MQFB 1LDEA 3VMMA 2PL1A 3O7MA 4IFEA 5AVXA 4X44A 1TMOA 3MLAA 4BV3A 4RJJA 4UTZA 3WK9A 2K5UA 2OZKA 4QTYA 3CA8A 1DIRA 1NKTA 4IJMA 5DT2A 5KVVA 3QW2A 2QW1A 1PL7A 2J41A 4FCTA 4UBKA 2CNNA 3W9UA 1MDFA 3WX0A 4B7AA 2FR8A 4O4HF 4LWPA 3IBTA 4MZXA 4OF4A 5LJLA 2OV6A 3RD5A 4FGJA 2V0CA 5E6UA 4RPCA 1T0BA 4HN4B 2BTQA 4IIFA 3H7IA 2OORA 2X6TA 2BBTA 5C5EA 3PUIA 3ZWWA 4Q3DA 5LBIA 2GYYA 4TTAA 4GM0A 2OAEA 2O1WA 3GLQA 5DPMA 2GNOA 2XNDA 1QTIA 3IJRA 2PUWA 3NBKA 4H2DA 4UUNA 5FPHA 3UAYA 3UK6A 4WINA 5CEFA 2I3AA 1WKBA 1PDWA 3FOWA 4YJDA 3DMTA 3GRFA 4RVCA 1OWPA 4DA8A 5A6SA 3KR2A 4RK4A 3IIEA 5JNSA 1ST2A 3MSXA 1X70A 4P6VF 3QTLA 4Z8XA 4D5EA 2P11A 4A26A 2QX4A 3OFVA 2IPMA 4DMHA 1XUOA 3MJFA 4RMNA 3ZZ0A 4BAGA 3PEVA 4FNOA 2WIKA 4BATA 4EHBA 1X1SA 4TV9B 5B4VA 1CUDA 5E7IA 2X6QA 1N6HA 4REQA 1JH8A 4IRUB 2QRQA 4P80A 3V1LA 1SM4A 3LPAA 1TYBE 2V7XA 4M4SA 5GADl 4CG2A 3TQQA 1Z3CA 4PWYA 4NPCA 2R8ZA 1LTKA 2VZLA 2XYRA 1G9SA 1JPVA 1KZ1A 2JHCA 1G9TA 4FYXA 4LJ7A 3FDZB 3V4ZA 5JCPA 4L28A 1ZESA 3NAGA 1CUGA 5KCZA 1PJCA 2DQYA 1JIVA 2R25B 1JBQA 4KX5A 4OU5A 2VTBA 2Q0QA 3HE3A 2QNRA 4KL8S 3D3NA 4WOJA 3OD5A 1GPDG 1HQCA 3QVJA 2GA9A 1V2HE 3S2EA 3FKSD 5EP4A 1Q7CA 1NDUA 1CZOA 5CH5A 3BHIA 4LHEA 5EZ5A 3UM9A 3IHTA 4G1EB 1LSOA 5IMBA 5DHSA 1SOVA 4KE6A 4B4KA 4B6JA 2XA2A 4G4JA 4PZ0A 3GYGA 3Q85A 5DHRA 5LU8A 2FZWA 1ZVKA 3DOIA 4LJRA 3GEMA 1TLFA 5DLPA 4H0FA 3AETA 4PGGA 4D82A 2HK8A 1ZJJA 2AYYA 1T24A 2IHZA 3VR5H 3JZDA 3IRUA 4Y30A 5EKUA 2SKCA 3KZKA 2AG6A 3DEAA 4IDNA 1P7YA 2D7JA 3PC8C 4ZO4A 5TX7A 1ZUNB 4HLUA 3HYRA 3I6BA 4AN1A 4XGKA 2XE8A 3AM4A 1N6OA 1S7CA 3NEJA 5CK4A 1F2DA 1LBSA 1YF3A 3TKYA 2BCEA 2QPLA 2OGZA 4NDZA 2DUMA 2XMGA 3VYWA 1S2DA 4ZCPA 3OMWA 4HNHA 1I5RA 3IKLA 3O8BA 1FFAA 2VHCA 3ESZA 1E1CB 4L5YA 2Y2UA 3UIEA 4DZTA 1BGWA 3FE2A 1XF9A 1H05A 4Q3AA 2WUGA 3RK4A 3N0VA 4WIAA 2RGBA 4GEGA 1EH5A 1CF9A 3GQBA 5C1IA 3U7EB 3HTXA 3BA6A 3CLVA 2BRUC 1H23A 1W5TA 2AKYA 1J2JA 2PBFA 3ZV7A 4BQQA 4HK4A 3IOCA 4YI5A 4TS3A 2D7DA 3KSRA 3L4JA 2YN4A 4ZHQF 3PK0A 1R50A 5CG1A 2WJGA 3C41J 1ZH2A 4AXXA 4DR5B 4OX9Y 3CEJA 3QF4B 3GVCA 4LJLA 4JDUA 1W0JA 1TQ2A 3NPAA 4XQEA 5DNVA 5AM1A 1B6SA 4L0QA 2AE1A 3NEPX 3OJOA 2A1UA 4UXHA 5JO9A 4PYKA 4ZGBA 1XLTA 2FFBA 4QWMA 5HOQA 1U98A 2QVYX 4NK4A 4Y2GA 5TNXA 4XJSA 4Z7OB 3GLHE 1BTOA 2C07A 3I5YA 4XPIA 3G13A 1JFLA 4CEHA 4HQ0A 1FP1D 1HDXA 1KVRA 2DPGA 3IP3A 3VKHA 4A16A 1P7CA 4M87A 1E1QD 3EEIA 1QB8A 3C8HA 1V7ZA 1WXWA 2Z5FA 1GSHA 4LZWA 4FZRA 3TZLA 4MR9B 1P0FA 2C92A 4QYWA 5ALZA 2F3RA 2RKOA 2GGSA 1KPIA 3IO5A 1L5LA 2Q3DA 4A91A 1A5ZA 2HH9A 4HN9A 5D3MB 4C0AC 1CHNA 2QXTA 3BS4A 3RADC 1UAGA 4MS4B 1TRKA 4QXAA 2CW5A 3DHEA 2OFXA 2EFDB 5BSKA 2OCBA 2AVNA 4P22A 1H3EA 5TMPA 1W581 2WWRA 1C9KA 1DXQA 1X14A 2MSKA 2YVUA 2C5BA 3AY7A 1TJPB 2JGAA 3FLEA 3R6TA 3SC6A 3W2FA 1GG8A 1IXRC 2XAUA 5T41A 4Z2AA 1GNSA 5HUJA 2BFCB 3K20A 3N5CA 2PN1A 2ATIA 1WCV1 4UATA 1C9YA 3A37A 1YJ8A 4R2HA 2PUHA 4MGIR 2W48A 2GBCA 1UP4A 1XOIA 2INGX 3FPBA 4PZCA 3CT4A 1GA1A 4Q3LA 4PAMA 1XRNA 4MQBA 3CEMA 3IKTA 3DLBA 3QV1A 3AF4A 1A82A 2C5SA 4GBMA 2C5FA 1N5IA 4O2BB 4RZUA 1YVDA 2E4WA 1EB8A 2R87A 2GM3A 3CB4A 4RE5A 2JC3A 5JW6A 2JGDA 4I6GA 2GPSA 4L9WA 3GFGA 3PXEA 3S7ZA 3VPFA 3AEQA 2Q2NA 3RVMA 4AZ3A 1NM5A 5IVHA 2IY7A 1URPA 3B52X 2W70A 3GMSA 1W4LA 3H18A 5D85A 5SY6A 1JP7A 1S96A 3EZ7A 3ZJYA 2ACVA 4Z8YA 4KJZA 1FFXB 1FNNA 1HFJA 3ZVLA 4D9EA 4YLYA 2R0QC 4LHYA 4BQFA 2NAFA 4RACA 4Q3KA 1M66A 1WXGA 1H0KA 3TAXA 3PTLA 1GL9B 2YJ6A 4GKAA 1MEJA 1JSCA 4XTRA 2NUAA 4OQEA 5A4FS 2Z8XA 4YP1A 2HPZA 5LB2A 3WY9A 1WB5A 1TUIA 2Q5OA 3AR6A 1Y80A 3WISA 2DZDA 2GN0A 1SKBA 4BNYA 1NYRA 1ISPA 4FJ2A 4O4HA 2CY0A 3JQGB 3VYSB 5KWJA 2J32A 5L3SB 2X6RA 2H2HA 2H48A 1Z5WA 3F9RA 3IXQA 2GF2A 4EPYA 3DVQX 1ZS9A 3OESA 3SQDA 1CS0B 3WL5A 4R2LA 3H2IA 3BSYA 5ALIA 2FPKA 1PQ4A 1QGDA 4HAZA 4IMJB 4NU6A 4CLHA 1I0ZA 3R6GA 4JBXA 2HAEA 4ZK2A 5BWNA 5A9SA 3TRKA 1X1BA 1NT4A 5KQRA 3VU9B 4J0KA 4Q93A 2Y2VA 4PBRA 5B12A 2B7CA 1NX6A 2G7MC 1BKDR 2B0JA 2N0SA 4GFDA 1I9GA 2WFLA 2HDNB 1R3UA 2QYHA 1RIFA 2VPWA 1E0DA 3BTVA 3FD8A 3FXAA 3Q88A 4BLUA 4M8KA 3OU6A 1VE6A 2XX3A 1H4TA 3LG2A 3QELB 4PXSA 3UV3A 3WRYA 5JC8A 4CIWA 3TQIA 1EKXA 4BVHA 5K45A 2G6BA 2BEUB 4WOKA 5FQOA 3WTBA 1E6UA 1JEOA 2XKAA 1UM8A 4GZ6A 3ULKA 4II3A 3AY0A 1J2EA 2PMKA 1ZM4A 3F1LA 4NEGA 4EHNA 2P9GA 1A9SA 1UT8A 1NURA 1K7FB 4UTPA 4BP1A 3AGPA 4JL5A 4QODA 5I7HA 5LOVF 5EXPA 4UUAA 2I03A 3NWOA 1F20A 4P7GA 2FK7A 5LQKA 1L1QA 4JK3A 2FX5A 5TDHA 2NU9A 4FR5A 4HAWA 4BB6A 2IU3A 3ZWAA 3BMQA 2FR0A 1YQQA 2DLCX 2YJ4A 4Q7EA 4AKGA 1JEQA 1E92A 4PGHA 5ELLA 3DDOA 4N40A 1P1KA 3HDVA 3CUVA 3TIGA 1RJ9B 2XI4A 3QE9Y 1YJQA 1QGOA 3S8YA 1E62A 3CJQA 3L6BA 1NV9A 1S6YA 1C7RA 1D2GA 1MR3F 4OHPA 1VE7A 4CWAA 3UW3A 1CR1A 1H0HA 1F1BA 1V1MA 2WJIA 1TW2A 5C18A 4OFBA 1EINA 2CZQA 2XHEA 2P77A 3UJHA 4AY5A 2G1PA 1JG3A 1V3UA 1A2BA 2COEA 2GPYA 3KTAA 4LIPD 1O6ZA 3L0CA 1XROA 3ONDA 4OJMX 4KQ1A 4EPTA 2NACA 3K0FB 3MTJA 3P71T 2W0SA 5JH7F 2EGHA 3LUHA 3DNMA 3DBRA 5FFMA 3HDJA 5EKSA 5SY9A 1PNOA 5FA5A 4EPWA 4LCEA 1TYDE 3ISJA 2Z9BA 3UOWA 1COWA 5DP1A 4ZVKA 1KDVA 3D6FA 4KO4S 3FYDA 1DG3A 4IGAA 4YCDA 2AX3A 2BFPA 5B3JC 3N2NA 1W8DA 2JIZD 4PN3A 1GPMA 3VR5D 3D8NA 2NSHA 2HXYA 4K0RA 2MSLA 3W6ZA 3X1ZA 3CB2A 2OKCA 1D3AA 5AXDA 5JCZA 1W76A 3PTAA 1QWOA 1C2TA 3A1VA 1REQB 3CUYA 3NTVA 3PNPA 3SF0A 5A5VA 4E5PA 2VH5R 2CNKA 3HDYA 4LK3A 3QKRB 4HP8A 3WJ7A 1B6GA 2PX3A 3DXYA 4HBZA 4Q3BA 5BSVA 1R3DA 1N2HA 3L18A 5HIJA 4TUYF 2WYVA 5HQTA 5AJTA 1BXZA 4ZC8A 4ZHQA 1YR8A 1J90A 4FEAA 4HS9A 4GVPA 3HSKA 1LLDA 2C8JA 1O8CA 5BV1A 1SKYB 3F7TA 1K6IA 3AUKA 1QU2A 3NS7A 2RH5A 5FPSA 3DE5X 3QQ5A 3OT1A 1YKFA 3FSGD 4N7MA 1UBEA 4F4UA 3G9TA 4D26A 1GL7A 3LPNA 1PCXA 2ZJAA 4YLEA 5C32A 4FBGA 1KFEB 5CTAA 4X61A 2VT2A 4PZ9A 3EG9B 3ESCA 1X8KA 4XDZA 2WZQA 1LSSA 1ZGBA 4K6FA 2OQRA 5DK4A 2G4VA 2VDWA 4BMVA 4DCPA 5KVAA 1B0UA 1IHOA 4JIMA 3GF4A 4FWBA 4RH3A 1D0IA 2P3QA 3RC2A 2LCFA 2YWGA 4RKRA 2NTNA 3VZRA 3WGJA 2UU9B 1U3TA 4U9HS 4FYKA 1MC1A 4HWPA 4IR7A 3LDGA 3RAPR 2BP7A 5TF4A 3N2GB 4P0PB 3H5OA 2AF3C 2G28A 5I8PA 1N0WA 5ERYA 1PS9A 3EEQA 4JOCA 1N3YA 4UTXA 3RAFC 4F2GA 1K7CA 1KYTA 3D7LA 2YRFA 1V3TA 2H0AA 4C05A 1GVNB 3B7GA 3DTVB 3EGXB 5HIMA 5L4LA 3TQFA 2OBXA 1Z4PX 2IZOA 3H83A 4ZTBA 4YRBA 2YBDA 1W75A 3K53A 5CXQA 2K6GA 2UYHA 3O4GA 3GT7A 4IG9A 1TW3A 3I6QA 2GRJA 4XWWA 3MIZA 1L4KA 4U6SA 4H1TA 5ILOA 4P5PA 2YBEA 4MWCA 4IGEA 1QH9A 2BF7A 2GHTA 3O4IA 4IRMA 5ESDA 4I9GA 1WPXA 2A0WA 3AW8A 4DZRA 4F86A 4DJ5X 2HW8A 3PHGA 1H2WA 2D74A 3KG2A 4EBBA 3JQBA 3WC4A 5FPPA 2QD4A 1CZKA 3N1UA 3HRHA 4M9SA 4HLQB 3VNBA 2X40A 4HDRA 3DQZA 1ZINA 2QAGA 2A9KA 4NMHA 1F6BA 3E9ZA 3QVLA 4TWRA 3V42A 5FO0A 4Q4DA 2Z1MA 2ZYIA 4QFCA 4G0WA 1GCOA 4WFJA 1N1DA 4OFWA 4IV5A 2H29A 4PNEA 4DWOA 1OGJA 4WZAB 3JPWA 3SK0A 5KNBH 3OE7D 1CB7A 1M2KA 1N92A 4LXGA 3UAZA 5JCOC 2E55A 4ETMA 1L8LA 1KEEB 1ZOIA 1X3LA 4NOMA 5LUBA 4MS3B 3L1IA 2HBZA 1H22A 3MLEA 5AI4A 2IUYA 3PX7A 1M8JA 3KDSE 3MXOA 2FOXA 1J07A 4UAUA 2HJ9A 4UAVA 1AZTA 1K5HA 1RRPA 3PNOA 4MYTA 1IC6A 1XAJA 2HDWA 2YC4C 1T9AA 3DDUA 3LZDA 4HFRA 4WXMA 3G0HA 4BMOB 2LUOA 1TZ2A 1KI3A 4ZOLF 5LIRA 1Z7BA 3VNUA 3W9BA 1NF9A 3OO0A 1RYEA 3AVOA 1JB1A 2AHOA 2GA8A 4JUAA 4ZVOA 2JGRA 4RV9A 4D74A 4X3PA 3P2JA 3U9LA 1XPJA 4CXMA 1ILEA 3X1XA 2PZ8A 2IDKA 1MQAA 3MUNA 3QX9A 4C4RA 4F46A 4DB4A 1N7JA 2QVZX 2JW5A 3UZUA 4NKRA 1GLGA 4BDSA 1A7UA 3BE8A 3AESB 1R0XA 5B58C 1VKHA 3EFOA 5FP0A 2ZLBA 2DFKB 2VRBA 3EK2A 3GVPA 4MVCA 3R9XB 2O8DA 2V8BA 4RLSA 3DOCA 3RHSA 1HKHA 5I9NA 3T1TA 1QLJA 3HUDA 3JX9A 3P4UA 2XUZA 3VR4A 2F4VB 3PEFA 5L7YA 1JG6A 2QTMA 3LVQE 3I6YA 5LD2B 1Y81A 5M34A 5IBCA 4HZUB 4M0EA 1HLPA 4B45A 4KQGA 1E2IA 4PGMA 5CLQA 3RW9A 4E5NA 1I2MA 8ATCA 2K87A 3VR1A 2L2QA 1PFKA 2GX6A 1FMTA 2B4RO 2YZ7A 3HU3A 4IH1A 1IOLA 4PC2A 3EZ6A 4PCLA 5IJ9A 4MRMA 1AMNA 4DV5B 4ZT4A 1P0MA 2JBAB 3H2BA 4D0SA 1RI4A 4CQJA 3RU9A 2DHQA 5TY0A 2ODAA 2LVBA 1V8BA 1K5PA 4A5SA 1BU5A 4MRPA 2ZJOA 2FP4B 1E5XA 3LPMA 1ZZEA 3NBMA 4J07A 4YRZA 5LOVA 5TGDA 2IT1A 1KYWA 3U31A 1CF4A 3EXHA 2JASA 1Z0AA 4JLJA 1E3WA 3F71A 3ZDEA 2C82A 1LXCA 2QSZA 2OCPA 1MENA 4LF8B 2C8VA 4HQNA 3OJCA 1PVVA 3MWEB 3QVVA 4R0MA 3DMYA 5BORA 3BSWA 5NLLA 3W9YA 1AQYA 1RWMA 2QTVA 4BFUA 5KU1A 3O26A 3U4MA 5TMEA 1TECE 2JFPA 3VHXA 4HXEB 1EI9A 1SRQA 2NU6B 3OEHD 5HJ2A 1PSDA 3H4MA 1STOA 1E6WA 1G3UA 1KARA 1FQWA 2GWHA 3HSSA 4H1HA 4XVRA 4ZVQA 4JVOA 4CM5A 1KU0A 2GM9A 3HH8A 2PRYA 1BS2A 2D2XA 3OQ1A 4TT3A 4ARSA 2PGXA 4TMTA 2QP4A 2XXJA 4MYUA 1DDOA 3OX4A 3QOXA 4M6WB 2YMLA 4A8TA 2VJCA 4KOAA 1K89A 3EIFA 2R68A 3UUWA 2BFMA 2AXEA 4NBUA 1LF0A 1YRWA 5CDFE 4N5LA 2OFFA 5JH7A 3GCZA 1M34A 1QHIA 1VB3A 3AJRA 3GPCA 1YZTA 1PR4A 2NW6A 5A5EA 4IGIA 3H16A 4ABTA 2RJ3A 5FBKA 3QKWA 1V39A 1D1TA 1AK2A 2BMEA 2BM0A 1OLSB 4JVNA 3TG2A 1GZ3A 3KYDB 1L5NA 5DP2A 4ZT6A 8OHMA 2JL1A 5JD6A 1NMQA 1XEXB 2J9FA 2Z98A 5PNTA 3V6MA 3DWEX 2F17A 3K94A 2O8FB 1K7XB 3ZWXA 4FM9A 2GJ8A 1X9IA 2KJQA 5KYKA 3T06B 5LR6A 5EAIA 2XRZA 1SCBA 4ZO8A 3DMPA 1XTJA 5TQ2B 5INTA 1GRCA 5AJUA 4P0QB 1N7IA 2YQZA 1WB9A 5JSFA 1DXYA 1SCDA 5ESWA 4CEJA 3CVOA 4AS1A 1T9CA 3R0JA 4TUYA 4QRHA 3RIXA 2EIXA 3QVSA 4U02A 4AY4A 2LKDA 4ZXFA 1G3MA 3SVTA 5C81A 1ZX1A 1OUMA 1BD3A 3F5DA 2GK3A 1DBPA 3AFNA 3VH1A 3CPHA 3LPLA 3LBAA 4IH4A 1AKUA 2OV4A 5JS2A 3T95A 5JO0A 8AT1A 2BUBA 3RBXA 3G0BA 4C7JA 5EJ7A 3PLAE 1GTJ1 2WTEA 4WKGA 3ZC3A 1E3JA 3HJFA 2WWWA 2QRHA 5EFZA 2DEUA 1M2OA 1U3CA 1S2LA 2CC2A 1J6UA 2RONA 4MR7A 2PU7A 4BIIA 2DPLA 5K2MA 5TPZD 2ZE6A 3P2YA 2YNMA 1Q5PA 2YHSA 1S8FA 4GZ5A 4CI0B 1AO0A 1L5OA 1M0WA 1U8CB 3WWPA 4OI0A 1N9ZA 4XIFA 2HPVA 1IZYA 3EQ7A 1O9GA 4PAGA 2BJWA 1QIMA 3D2CA 4V0NA 3U1VA 3DBIA 2FPIA 3O8DA 4MROA 3WB0A 3FYUB 3MINA 3NNNA 3MWLA 3OQBA 2Q6TA 2XECA 3EZGA 3FPFA 4QOHA 5CT5A 4YP9A 1EESA 2F64A 3WYBA 1F6WA 2EDAA 3O83A 4KQXA 1U7TA 3KHTA 5KC9A 4YP5A 2IFTA 4L0MA 1UXOA 2X8JA 1P9WA 3OIUA 1LTQA 5J2UF 2A1TS 2IA5A 2OCLA 2XUJA 3PGMA 4BBPA 2WHEA 3PZBA 3X43A 1ZSYA 4E2XA 3GH1A 3JYPA 3Q12A 3DUWA 5DGTA 3GJ3A 5DX1A 2XT9A 3D5TA 4EUEA 1X77A 3AEYA 2OQVA 3PT9A 1P81A 5FEMA 1UMDB 4PRKA 5JXJA 4CFSA 4L73A 2FG5A 1NU6A 1U5AA 1X80B 3F8WA 3UJCA 3OIGA 2C8LA 1Z8DA 3O03A 1SUBA 2IEDA 2V6FA 4LNHA 3TMAA 5C7OO 4QOGA 4BKPA 5GM1A 1QGAA 2R4UA 1XPUA 2B8NA 1Y48E 3DOHA 4MR8B 5REQA 1VIMA 2M6KA 3D54D 3GJYA 1QDUA 1OF1A 3ANMA 4IJWA 2IJGX 4R8MA 1HURA 2C4HA 1JN0A 4RH1A 1UKZA 3FZQA 4TL6A 1NG9A 1RKQA 3ZBTA 4F7WA 1J39A 4ONEA 3UKJA 4K05A 2NYRA 1SO8A 3B60A 3U7QA 3GRCA 2ID9A 3ET4A 4GMGA 4KLNA 1E77A 1V7QA 1PJBA 2UYCA 1XQYA 2IV3A 1J7JA 2H1FA 3HZZA 4HX2A 2JLSA 2Q2QA 2ZRJA 3R7DA 1DTEA 1R9GA 1T15A 3U1TA 4DQKA 1E4EB 3F8SA 4BPBA 4MI3A 4JLSA 4F38A 5KNBD 3NHFA 3ROMA 3PPVA 2DERA 4DUGA 4IUYA 3WLKX 4Q7QA 4I4TB 4BP3A 1U65A 4BEJA 2HWWA 2ZSBA 1TIBA 3NW9A 4FX2A 5KTMA 3CLTD 4ZOLA 1ZK2A 2GHRA 3R4CA 1QMPA 2PZAA 2QG4A 3E3NA 2PQ0A 2FEKA 4FE7A 5T8KA 1XDDA 3AG5A 4R8KA 4U2GA 5LQSA 3SYMA 3AEKA 1VZ3A 3TGWA 4BNNA 3PR1A 4WQMA 1BCRA 1FFEA 2QIOA 3GJSA 4X1KB 1I6MA 2OXFA 3LUGA 1AQUA 4KVGA 4FPXA 1D2NA 3D1LA 2JFGA 3EVGA 1TAQA 4HKTA 1UFRA 2VDPB 2A5YB 1VHLA 1IJBA 2A8YA 2H16A 2OAQ1 3CWZA 4IJ5A 3FIJA 3TLXA 1OWOA 2R1VA 3MEQA 3QNWA 2I91A 2GETA 1GLVA 1E2DA 2Y1WA 4E2FA 1V26A 2E0IA 4ZZIA 1IN6A 2ZB2A 2JCVA 2DULA 2FTKE 2O2YA 2ZWPA 4XW2A 2BGMA 4HAUA 3RIHA 1RZVA 4QXPA 3OUTA 5EOVA 3HVRA 1UZAA 1K08A 3LKBA 4W82A 3ZWDA 3F6EX 5AQ1A 3S1AA 3CH5A 3M82A 4J7UA 1X2EA 2XJ9A 2H5EA 4UNIA 2CWWA 1UXKA 4KUEA 5AW9A 1VHTA 2WD8A 2JJ1A 1ISFA 3V33A 3WGHA 4OQLA 4JD5A 3BXXA 1BIFA 4IHQA 1QE3A 4K28A 1HSOA 4LHVA 3FZYA 2PTHA 3BAFA 4Z7NB 5K5EA 1TVKB 3VR4H 3D1VA 3P0RA 1PNRA 3T5GA 1TF2A 5BVHA 3ITNA 3MWYW 3PQCA 1L4NA 1OBCA 4Q4HB 1R6XA 5CPBA 1O89A 1QDLB 3MRVA 4O2AB 1ULZA 2OQ2A 3AI7A 3B38A 4P93A 4XB1A 5E7MA 3UC5A 1W5FA 3U39A 2RSLA 3B5EA 4KNWA 1O94C 4CM6A 1H2XA 5FUXA 4AF6A 5A1JA 4C21A 4KZPA 4NZYA 1VBKA 3JWPA 4DLKA 1WQ4A 1KDTA 1ZW1A 3PU6A 2F9MA 1DKMA 3C0KA 4FDLA 4J6EA 4MHOA 2X9QA 2A2ZA 4UCFA 4B75A 3G6KA 2PGAA 2C5HA 2ZJ5A 1JU9A 2GBLC 4HH3C 3P2MA 5ILGA 2YWXA 4CM8B 5AVYA 2XAAA 5E0OA 1OWNA 1P8AA 4LDQA 4IQFA 3WLJA 5LA6F 4QM7A 2WD7A 1V8OA 4MW2A 2JKVA 2ZXFA 3KQPA 1SIUA 2P9CA 2WU1A 4E6EA 5C35A 3GZNA 1LBIA 4Z7QB 3EDCA 1GQYA 1WZ2A 1XCMA 2RGGA 1EWVA 3TOVA 3RVSA 3EC2A 3NDPA 3NRJA 4PZAA 3FTPA 4FN5A 1K68A 4LRSB 4TMWA 5I5GA 1UXGA 3X2EA 1QTNA 2VL7A 3GWGA 3MWDB 4P83A 4O0MA 3B8HA 5JS6A 2V5VA 3DDHA 4HWOA 1AF7A 4JUFA 1RJGA 1EGMB 2FJPA 2ODEA 4BMSA 5A2GA 4L4SA 1VLJA 4EHIA 3IH5A 5K3FB 5JXIA 1DKLA 1ZLYA 2X5XA 3KYCA 4N49A 3ICCA 1PEAA 3JU3A 2H4WA 2EZ4A 1I7NA 4TYYA 3SXUB 3CE9A 3WL8A 2PKYX 4HO1X 2Y8EA 2XYVA 4TKLA 3ZI7A 4JQSA 4FOSA 3KSMA 4ZAGA 3TVDA 3W90A 5IUNC 4CEIA 2O06A 4JR1A 4NBLA 3A9VA 2IIPA 4JBHA 4D44A 2ZTUA 1QQ7A 3RUEA 1U8FO 2VSYA 4LXUA 4N8SA 4C7OA 1N6NA 1F48A 1CJMA 3OQ6A 4M0DA 4N5HX 5KOJB 1ZQ9A 1T1JA 1VDMA 1BNCA 2ZYUX 3EAFA 3GY0A 2HK6A 2FPXA 4MKIA 4JQCA 4NU8X 4BLPA 1DXOA 3PVZA 5AW2A 1HKUA 3QJ5A 2IEZA 2Q6KA 3C5HA 2ZBFA 4O3FA 1YCHA 1NLUA 4YDHB 5E3HA 1NSTA 3T9EA 5EXDA 4CIAA 1TAHA 3V4FA 4GE0A 4CL8A 3IPRA 1WP9A 1MDBA 2BEKA 4WCFB 4V02A 1RACA 3EH1A 1DADA 4TM7A 5LCXA 4J7CA 3U80A 2C29D 1F8GA 3LP8A 4OB8A 2MINA 1MZVA 2BGRA 2IQ5A 2XOKA 4LSMA 4S12A 1X1EA 1T2AA 4D3FA 2AH5A 4MYCA 1G55A 4RTQA 3IR5A 1FJ2A 2QPTA 4X62B 1P31A 1XZHA 2QUZA 3I8XA 5CTJA 5J2UA 1J21A 2OAGA 5CEJA 2O3SA 2OZPA 2CCJA 2Q5JA 3MCWA 2YKGA 4B3JA 3LDHA 7MDHA 2BBSA 4MV8A 2ZULA 4G56A 4AJPA 1V4BA 4J1TC 4DYHA 2DVMA 1B73A 3HYTA 1BWRA 1Z6AA 1Z6PA 1G4UR 3CWCA 1NE2A 3DFZA 2FMUA 4U7WA 1LK7A 2RJNA 3HDTA 3WNBA 1XZGA 2QUIA 3EDQA 4W8HA 4GX1A 4NMLA 2DE0X 2R7KA 3I62A 4YC7A 2VWQA 3I42A 1GU1A 2W2LD 4DHEA 4IHAA 3AY6A 1OLUA 3GJ6A 5AKIA 1CR4A 1WXDA 2WAAA 4LS3A 1ORVA 5EEHA 1DINA 2I2XB 1PUXA 1MO6A 2RE8A 1IULA 2ZJ6A 4AYWA 1DFGA 2E21A 3BD8A 3FFBA 3SHWA 2VQEB 1U90A 3AM3A 1LPPA 1Q22A 5ED0A 1DTSA 3TN7A 4DCGA 4YMTA 1L5HB 4A6EA 4KPYA 2OZLA 1NPYA 5I45A 2WWIA 3NANA 5TQ0A 3TFWA 2EJTA 5C4MA 2QN7A 4YUZA 1C4XA 4RVGA 3TRIA 3PNBA 3D8SA 3TX2A 2WQ7A 3TNJA 4MRNA 1H2AS 2CWDA 1E32A 4G2TA 3IUNA 1YHNA 3OC6A 2Q5EA 2BONA 1L4HA 3EWNA 4FD2A 3QKSA 2JAPA 4P7FA 3D3WA 5CLIA 3VDMA 3OCZA 3BXOA 4L95C 5HKAA 1YQXA 1ZCJA 5H5JA 4IX1A 1JEDA 3JASB 4AMGA 5HXAA 2YWFA 2YMQA 2GN6A 1L5ZA 2CMGA 1MOQA 3E7XA 2H1OA 4AJ9A 3NWJA 1A7KA 3I6MA 3ZKWA 3BMOA 1I30A 2R8YA 1AXRA 4Y9TA 4Z0TA 5HEKA 3QVWA 3ROXA 1INLA</