1USWA

Crystal structure of ferulic acid esterase from aspergillus niger
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
260
structure length
260
Chain Sequence
ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPADEGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Feruloyl Esterase a from Aspergillus Niger Suggests Evolutive Functional Convergence in Feruloyl Esterase Family
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
molecule keywords FERULOYL ESTERASE A
total genus 84
structure length 260
sequence length 260
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uswA00
2D5LA 2XUOA 1XROA 2HRRA 3WKCA 1NU6A 2XUHA 4J7AA 4IH9A 4H7IA 3HZOA 5ALTA 4DMHA 1AUOA 1XZBA 4J0HA 3C45A 2GZSA 5J3JA 4AN0A 2C5GA 5DWDA 3R40A 3H04A 5DYYA 4MQMA 5DTJA 2HADA 2D0DA 2BJHA 2WSLA 2PKYX 2XQFA 2ZJ6A 3I2FA 1XQVA 3FYUB 4PQEA 2BUBA 1XLVA 4HZGA 3BIWA 3V9AA 4Q34A 4OYLA 3DEAA 4LXIA 5LZ8A 5AK3A 2ACEA 3BF8A 3FNBA 4OU5A 5CT4A 2GBFA 5FKJA 3D7RA 3O4HA 4KEAA 3AINA 1ZJ5A 5HK8A 1LLFA 1QIMA 2JGEA 3H2GA 4GECA 2BGRA 3HABA 1UFOA 1UKBA 4C4XA 5IVHA 1R9MA 1TQHA 2WUEA 1CQZA 3GA7A 1YCDA 4I4CA 4DSAA 3WQHA 2V97A 3WK8A 3WKAA 2WTNA 1E8NA 3G9UA 3PFBA 2RAUA 4W63A 1ZD4A 2DQYA 3BIXA 1QLWA 4W1QA 4P9NA 5HF6A 5ALLA 2G5PA 1WB6A 3MVEA 3C8DA 4A16A 2AJCA 4GLBA 1VA4A 4ZREA 3RKSA 4HVTA 1ZIYA 4JUIA 4NZZA 4CG2A 1GGVA 1R88A 4ITVA 2WG2A 3K9BA 1TCBA 1FFEA 3UUFA 3WKEA 1QIIA 3I2IA 5FXMA 5JZSA 2HA2A 1J06A 5AI0A 3F96A 5AK6A 1BU8A 3KDAA 2VQ6A 5LZ2A 5BV7A 3DL7A 4LXHA 3DYIA 5AKJA 4OD0A 4ZV7A 4CCYA 4YPVA 2WU3A 2PSHA 3G0DA 1K8QA 5EIHA 4EB0A 1UWCA 1GZ7A 1BN6A 3W9UA 4AO6A 1VZ3A 4UBNA 1ZD3A 3OC0A 3IDAA 4KE7A 1R9NA 2W22A 1G4HA 3A2NA 2DCMA 1CR6A 2BCEA 3D3NA 2H9YA 2CB9A 3ESAA 4X93A 3F9CA 1MJ5A 2PBLA 3BJRA 3LIIA 5T4HA 4GDMA 5D6OA 2OCLA 3X3HA 4J03A 5I9IA 1JI3A 4CIBA 3B12A 4H77A 4Y2VA 1E66A 2W6CX 2GBGA 2RIPA 1D07A 3R3WA 1VA5A 3F8SA 4LKOA 2XE4A 1QIEA 2QJRA 2BUAA 3F67A 1HPLA 4C88A 3C6ZA 4S0XA 5ALNA 3RM3A 4BDTA 4BRZA 2GBIA 2LIPA 3KWFA 4QZVA 2QUBA 2WFZA 3BWXA 2WFLB 1EX9A 4QNNA 1QIDA 4BRSA 3C8HA 3WZLA 4XJVA 3I6YA 1E3QA 4TGLA 1LPNA 2ZJFA 4UBJA 4OB7A 1EDBA 3BDVA 5HFAA 5AICA 3BJMA 1GPNA 5ALVA 1TIBA 2XMZA 1LGYA 4OPMA 2XUPA 3QPCA 1GPLA 1CLEA 4GEGA 4C01A 1WPXA 1XZDA 3HJUA 3H17A 2HIHA 1CIJA 1T4MA 2I3ZA 3WK7A 4Y2QA 2XI4A 4MXDA 5ALOA 2HU7A 3IB3A 1T2NA 5A7FA 4KACA 4GW3A 2ZVDA 4WJLA 3DLTA 5AI4A 1DT5A 3EIOA 3H2IA 5E4JA 4AZ0A 1R3DA 4FOLA 5CT9A 4BVLA 2WM2A 1H2ZA 3W9BA 3C6YA 3FYUC 1Y7IA 5JAHA 3FSGA 1P0PA 3I2HA 4BCCA 4K6GA 4X6YA 2QR5A 3STXA 4B81A 4OCZA 3BE8A 5JD4A 3LLCA 4YX9A 4MEAA 4DNQA 2Q0XA 3WMRA 1DWQA 5KBYA 5AI8A 1O6GA 3FWHA 4WDRA 4JEIA 1NU8A 1XQYA 3HSSA 1XKTA 1UT6A 2RHWA 2WIKA 1Y37A 4PV7A 2HDWA 3F98A 2VT6A 4ARBA 2I3DA 1CUYA 2ZYIA 4B84A 2WIDA 1EB9A 4DMKA 1KEZA 2EDCA 1THTA 1Q84A 3GROA 3FVTA 3FAKA 3IUQA 4OB8A 1H22A 5ALZA 2I78A 1AKNA 1L7RA 1XLWA 5BWBA 1XZEA 5ALDA 1L7AA 5LKRA 4FWBA 2XMDA 1TAHA 3LP5A 1FJ2A 4CFSA 5LLSA 1C7IA 3M3DA 7YASA 3EQ9A 2PM8A 4Y2PA 1YS1X 6YASA 5AP9A 3D0KA 1PFQA 3A70A 3EQ8A 1G5FA 1VOTA 4N8SA 2J3DA 1PJAA 1MT3A 2FUKA 2WQZA 4XWGA 2XMCA 3HYSA 4DSZA 3FVRA 1R1DA 2OCGA 5CT5A 5I7UA 1N1MA 4J0KA 4QEKA 2HFJA 2O7RA 1MX5A 4UHBA 1LPMA 2VSQA 2FJ0A 2CMFA 1CUBA 3D5EA 1MTZA 3K6KA 1CUEA 5C8XA 4RE5A 2Y2UA 4Q1VA 1L7QA 1ZD2P 1BCRA 2HA0A 3FCYA 3QMWA 4J0JA 4QWMA 3PI6A 2PL5A 2HL6A 3RLIA 1GT6A 4BDSA 4H7KA 1SFRA 1AQLA 5HFNA 2GZRA 3QM1A 4B6GA 1U2EA 3E0XA 1WOMA 3I6ZA 1A8SA 3V1NA 4QLOA 1CUZA 4G8CA 5LP1A 4WDQA 3NUZA 4F21A 3C6BA 3B3QA 5A71A 4HS9A 1YR2A 4Q3OA 5ALKA 3KSRA 4C4YA 4K6KA 4PSDA 1ORVA 1IUOA 5EHNA 4H7JA 4EZIA 5ALEA 2QOEA 4L0CA 1LZKA 2C0QA 3G0CA 2XUQA 4G1FA 2JIDA 2WJ4A 3A6ZA 5CT6A 3SX4A 3O0DA 3M82A 4B85A 3QBJA 3DDUA 5DNWA 3DJYA 1W75A 1UK7A 5LZ4A 2HA3A 5FUMA 1LPPA 1FSSA 4EY5A 2V9ZA 1LPSA 4Y2SA 4FLEA 1CUSA 3ANTA 4BE9A 5DLPA 3G9TA 1MX9A 3TRDA 4WFKA 1UOOA 1VLQA 2R8BA 4FNGA 1MNAA 2X8BA 4FBMA 1SCIA 4FLFA 5LKAA 5JZBA 2Y6VA 3I2JA 4BCBA 4H7FA 1USWA 4Y2YA 4Y2XA 4IQ4A 3VKFA 3D2CA 3WA6A 1R50A 4KYVA 5C7YA 2JGIA 5EHQA 2H7XA 3VJLA 2EEPA 4A5SA 2XLBA 3M81A 4X95A 1EDEA 2PSDA 2OCIA 4FBLA 4OUKX 2VJDA 5AM1A 3VVLA 3DOHA 4E46A 3QMMA 4KE9A 5AIBA 1DWOA 3R3ZA 1P0MA 2QXTA 4X6XA 4FFVA 2K2QB 3L1JA 3STWA 4XVCA 3LCRA 3QYJA 4C87A 5ALYA 3Q0TA 3TEJA 4ETWA 5EFZA 3ZLTA 1F6WA 2ONCA 4ZWNA 1HL7A 1CUUA 3ZV7A 4AO8A 4AMYA 5CBKA 2Z5GA 2Z3WA 5ALQA 1A7UA 2DSNA 1JJIA 5D7BA 2V98A 1XQXA 5ALSA 2FX5A 3C6XA 4C6HA 1BN7A 1E8DA 4X00A 4M0EA 2RONA 3C87A 3OG9A 3L1HA 1QIGA 5CURA 3FLAA 1CUWA 2VJAA 4DLNA 4B0OA 5K5EA 5EIEA 1K5PA 2XQKA 1DINA 4X91A 1P0QA 2PUHA 4BE4A 5YASA 1CVLA 5A7HA 1J07A 4BVJA 1UOPA 4U2BA 4ZV9A 5FDFA 4Y7DA 1Z68A 3HACA 3HEAA 2CBGA 5HQ3A 3SWWA 2XUAA 3QZUA 4B9EA 5CH5A 2XMSA 1QFSA 3DKKA 1YA4A 2O2IA 2OAGA 4BBZA 3DOIA 3EBLA 1CUVA 3O95A 3IURA 1DTEA 5AM3A 2PSEA 3H19A 1SCQA 1QFMA 2UZ0A 3E1GA 4MYSA 5C8ZA 1QOZA 1THGA 3BXPA 4Y2UA 2QKYA 3DNMA 4OU4A 4HXFB 3G02A 5ALIA 1K4YA 1CFJA 4QDZA 4AMZA 2XUKA 3QPAA 5LZ9A 2DHCA 3TJMA 2ORYA 3OURA 1DX4A 4BAGA 1ACLA 4DMCA 1XZMA 3G8YA 5CW2A 1BEZA 3IBTA 3ZWQA 2PU7A 4KR0A 3F97A 2Y2VA 2Z8ZA 4AZ3A 1HDEA 2QT9A 5AK4A 2ES4A 5ALRA 4J0GA 3PDCA 5AH0A 2CJPA 3ILSA 4BATA 2WJ3A 3A2MA 2H7YA 3D4LA 2B9VA 4TPKA 1ODCA 3S8YA 4WCVA 2G4LA 5LIPA 1F8UA 4C89A 4PNZA 3I28A 5ALFA 1HQDA 5ALGA 5AKXA 1FFAA 2JGFA 1CRLA 4G8BA 4HAIA 4X90A 5K3DA 2X76A 4HTAA 1HBJA 1H2XA 4B9AA 3ESBA 3KXPA 4FNMA 3WK9A 4X3CA 3FLBA 1ZIXA 3N0TA 3VJKA 3I1IA 1W1IA 1DU4A 3AUKA 3WYNA 1XRQA 3STYA 3G0BA 1W6RA 3WK6A 1LNSA 1ZD5A 3YASA 3ZPXA 4EY8A 2WLSA 3HRHA 2PVSA 1MU0A 5LYYA 1VE6A 3C43A 1N8SA 4PSCA 3H18A 5AKHA 1WB4A 4G9EA 2OLEA 3WJ1A 5BWCA 5JIBA 3JYHA 1OCEA 2VATA 1XRPA 1CUAA 3VDXA 1WM1A 4J0IA 2GBCA 3C5VA 3WL7A 3W06A 4G9GA 4F0JA 1IUPA 2WFLA 3DD5A 1ZI9A 1UK6A 3W04A 3HI4A 4M0MA 3ZLVA 4K6HA 2ECFA 4U2GA 4CCWA 3SK0A 1CV2A 1MN6A 4EY6A 1XZHA 5AI5A 4AO7A 1J2EA 2QJWA 3LIPA 5CTAA 3HXKA 3AZPA 3FOBA 3SC2A 2YASA 1RYYA 3CCCA 4BP9A 5JD6A 2E3JA 3MGAA 3G0IA 5DNUA 4H7HA 4DIUA 5JYCA 3D59A 1N5RA 3ICVA 3AIOA 1S8OA 4W1PA 3N2ZB 4BCDA 1XZIA 2HRQA 5K3FA 4IH1A 1YSCA 4X7BA 2PSFA 1QGED 2ZYSA 5K3AA 4J3JA 1CUIA 5FLKA 4ROTA 3S2ZA 5AKEA 1JJFA 5AI9A 4KAAA 5IVIA 3WL8A 5AKGA 2WU4A 5T4FA 3BDIA 1SOMA 1AMNA 1A8UA 3AIMA 4UHHA 3QVMA 2VJCA 4EUSA 2XB6A 4F5ZA 1G66A 2WTMA 4IH4A 1XZFA 4RGYA 3E3AA 5JADA 3M83A 3CXUA 2ROQA 2VAXA 3WI7A 4DM7A 2ZYHA 4MYDA 2XMGA 4B7ZA 1FFBA 2WIGA 3O9MA 2OAEA 5EHZA 4G8DA 5AM4A 1ZGBA 3IUMA 1G42A 3WWCA 3GUUA 1Q0ZA 2OQVA 3PUIA 2CZQA 2XMQA 4G4JA 2G63A 4WFIA 1CUFA 2HA5A 4D9JA 1X2BA 4X94A 5T4EA 3IIIA 1ZGCA 2IIVA 5FRDA 1DWPA 4QA9A 5AOCA 2WHPA 5JD5A 3WWOA 4W1SA 5AKZA 4BB0A 3IVMA 2GYVA 1GXSA 2OGSA 5HKAA 4CG1A 3WK4A 5HCUA 2BKLA 2WUFA 4JYMA 4ZRDA 1CUDA 4BAZA 4B83A 3V1LA 1EVEA 5JAUA 3GELA 1WCYA 3H2HA 1F0PA 3WKBA 4NVRA 1ETHA 4FFWA 3DKRA 4Q05A 5AKKA 4UFPA 4N8DA 2BAGA 4B0PA 5C8VA 3AJAA 4X97A 1ODSA 2VT7A 1BE0A 2XUDA 2JF0A 4UUQA 4YASA 4BC1A 4PF1A 1JU3A 4UFNA 2DHDA 5ALUA 1E5TA 4BC0A 3CCBA 3WIBA 1YS2X 4L3WA 4UHDA 1KU6A 3WWDA 1EA5A 4QWWA 2WG0A 5AJHA 1UK8A 1QIHA 4G5XA 4GBGA 4UHCA 2DR0A 3R3VA 1B41A 2O7VA 2XQJA 5E2IA 2C4HA 3WA7A 4RPCA 3W05A 4XX1A 4U2DA 4HXGA 1TRHA 4KE6A 2WG1A 5H3HA 4W1RA 3R3UA 1IMJA 3AZQA 4EA6A 2XUFA 2HA7A 2J4FA 3UMJA 2GYWA 4BTLA 5JALA 2XUJA 4G4GA 3D2BA 3PF8A 3I1YA 3VJMA 5KREA 4E15A 5FOQA 2NW6A 5A6VA 4UHFA 1EI9A 1QIJA 4KRYA 4LXGA 1WB5A 4X71A 4H35A 1ZJ4A 5LZ5A 5DYWA 4DTCA 3WKDA 2J4CA 2XLCA 3G9XA 5E4YA 2XUGA 4QDXA 3NWOA 4DNOA 3ANSA 3ED1A 4MJ3A 2WHQA 2PU5A 1C7JA 2VJBA 1MX1A 4X92A 4O08A 5FV4A 5JATA 1EHYA 4FLMA 3HLKA 2I03A 1KU0A 1BCSA 4QLAA 3VVMA 3WLAA 1I6WA 5CXUA 2O2HA 4Y2TA 5HZGA 2QS9A 1TCCA 3I6MA 3ESDA 2ZYRA 4V2IA 1CEXA 1LPOA 3V1KA 1XZLA 1AURA 1RP1A 5AOBA 1AGYA 3FCXA 1YB7A 5ALXA 2IX9A 5CT8A 5ALPA 2JGLA 1GKKA 5IVKA 4H7EA 3T4UA 4N8EA 3AZOA 4GWLA 4UBMA 4JH0A 3HC7A 1UXOA 4HXEB 3O4GA 5LZ7A 1YAHA 3QITA 1M33A 1DT3A 2VAVA 5A2GA 1EK2A 3I2GA 4N5HX 5HKBA 4FTWA 4U2FA 3IULA 1WHSA 3WK5A 4X6UA 3UUEA 2DFPA 3WL6A 2Y1KA 1E8MA 2VEOA 1O6FA 3P2MA 1XZAA 3AFIA 1GPKA 3D2AA 1QO9A 1LBTA 3MUNA 1JT2A 4OSEA 4BVKA 1A8QA 5JAPA 1X70A 2WHPB 4W9RA 1UOQA 4MQLA 1RWQA 4J0DA 5T4BA 5CH3A 3H2JA 5AOAA 4B82A 2V96A 1TCAA 1XQWA 1PV1A 1Y7HA 4JNCA 3U1TA 2QXUA 4PO3X 1EB8A 1W52X 5ESRA 3W2TA 3G9ZA 3G0GA 3OTQA 3DQZA 4BAUA 4DNFA 1YASA 2ZJ7A 4RNCA 2QUAA 1LZLA 2WIFA 4LYDA 4QDUA 1FFCA 4ZGBA 3WL5A 5EIAA 3FBWA 1AX9A 3KOOA 1YB6A 1QZ3A 2G5TA 1GQRA 2QRUA 4P92A 5DTIA 1VXOA 5A7GA 1HKHA 3FYUA 3EQ7A 4GXNA 1NX9A 2OG1A 4U2CA 4WY8A 2XQGA 1R4ZA 2PUJA 1GQSA 3MUOA 5CH8A 5K3FB 1ZICA 1GKLA 1K6EA 4DYHA 2HM7A 4Y2RA 1XKLA 3R3YA 2H1IA 1VKHA 2QVBA 1EDDA 1YAJA 5AO9A 5A62A 1VJ5A 4MWSA 1AZWA 3OOSA 5JASA 3R41A 4K5QA 1CQWA 1CPYA 5JANA 4HRYA 3Q8WA 4AB1A 1ZOIA 2WHRA 2HU5A 1JMYA 2FJPA 4FKBA 1X2EA 1C4XA 2AJDA 5AIAA 2X5XA 3E4DA 2XMRA 5CRIA 1P0IA 3CN9A 3DS8A 2QMQA 5IVDA 4MWTA 3FYTA 4H7DA 3V1MA 1UK9A 2AJBA 4FMPA 1CUJA 4PSUA 1AC5A 5EGNA 1LBSA 2AJLI 4U2EA 2YH2A 4QDOA 4ZI5A 4ARAA 1IZ8A 1MO2A 2B4KA 3KD2A 4YK7A 4P08A 4Z49A 3IUNA 1W76A 2WUDA 2B20A 5SYNA 3TGLA 1U65A 1CUGA 3U0VA 4UBKA 5D3ZA 5AM5A 3IUJA 3O4IA 2OQIA 2JGKA 1QE3A 2WUGA 1BEEA 3V48A 4UBOA 3STTA 1EK1A 2Z3ZA 3NGMA 2XUIA 1EXWA 2R11A 5DNVA 3FSGD 2BGNA 2WKWA 3DYVA 1UKAA 4Q3LA 4I3FA 4TVKA 1XRLA 4BTVA 3VXKA 2HU8A 1SCKA 2WFMA 2WIJA 3PE6A 1WHTA 1N5MA 1ZI8A 2GYUA 4CI9A 4IO0A 2RI6A 2QM0A 1MAAA 1UKCA 5ISMA 1TKRA 1FFDA 2VTVA 4DMFA 2YYSA 4J0CA 3K2IA 4C4ZA 1Q83A 1XRRA 3R3XA 4P93A 5SYMA 4LYEA 1QJ4A 5EHXA 4EHBA 4Q3KA 5JAOA 5CXXA 1H23A 4UHEA 1EINA 1MAHA 5AI6A 3C5WP 2JBWA 3OPMA 4EBBA 3RK4A 1A88A 4A23A 1K63A 3G7NA 3PUHA 2DHEA 1JU4A 2PX6A 2CEKA 4F60A 4CG3A 3H2KA 2C5FA 2HFKA 3H0CA 1XFDA 2XQIA 3ZI7A 1VZ2A 4Q82A 3KWJA 4GHWA 1QONA 3H1AA 5HQ3B 5ALWA 4BZZA 4UPDA 3STUA 2RGUA 1W4LA 3L1IA 3CN7A 1HLGA 1XZGA 5DYTA 2C7BA 1YA8A 2PPLA 5C81A 4AQDA 4E14A 1H2WA 3H1BA 4BYMA 3PICA 2BUCA 3RARA 1Q0RA 2HA4A 5ALJA 4AX4A 1LPAB 1LPBB 4H18A 1DQZA 1CUCA 2ZSIA 1JKMA 1XZCA 4AXBA 1VE7A 3R0VA 3GZJA 5AKIA 2XMBA 3DCNA 4UBIA 2C58A 1QO7A 1DX6A 2C0PA 2VF2A 3NOXA 3O9VA 2JEYA 1JMKC 2P8SA 5HK9A 2CKMA 3QMVA 1TK3A 2VA9A 4X85A 1BRTA 4KAJA 4LHEA 4L72A 5KWJA 4KAFA 1UZAA 2Y6UA 4DNPA 1CUXA 2RHTA 2JGJA 4MEBA 1J1IA 1U8EA 3AILA 4BZWA 3WWEA 3IA2A 5AKYA 1QTIA 1IUNA 2JGMA 2OGTA 2HHAA 3WJ2A 1XLUA 4K2AA 1ORWA 2OPHA 1SC9A 4N5IX 5AKLA 2WJ6A 5ALMA 2JEZA 3QH4A 5AM0A 4WFJA 3BL8A 2QZPA 2ACKA 5HF8A 2XT0A 2CUTA 1XZKA 3VISA 2J3QA 1JFRA 2DQZA 3C70A 1MPXA 3GBSA 1QIKA 5JZ9A 4Y2JA 2YXPX 1U4NA 2OXEA 5JARA 3WIOA 4E11A 4HRXA 5FP0A 4RE6A 4UFOA 2Z8XA 1XZJA 1IVYA 4KRXA 5K3EA 3EF3A 5K3BA 3OM8A 2XDWA 5AM2A 1MNQA 2BFNA 1ZI6A 4PW0A 4L9AA 3PFCA 4ZXFA 5BOVA 1DQYA 3B5EA 2H7CA 3T52A 5IKXA 5ALHA 3JW8A 4AN1A 2EDAA 1IZ7A 5E4TA 2OCKA 1QTRA 4UBLA 1OILA 3O4JA 4B80A 5D3KA 1CUHA 4NMWA 2OGZA 4OYYA 3STVA 1OXMA 3WWPA 3ZLUA 5FPPA 4DGQA 1WPRA 4XIIA 4KJXA 3BF7A 1VXRA 5HF5A 4QDTA 1EVQA 1E89A 3GFFA 4FDMA 3ICWA 1ODTC 4EY7A 5KWIA 3A2LA 5K3CA 3FLEA 5DJ5A 1XRMA 3DL4A 2AJ8A 2QTBA 4I19A 4INZA 2WILA 4OB6A 4GI1A 1F0NA 4WY5A 4M0FA 4H0CA 1H2YA 4LIPD 5I8PA 4IHAA 3WZMA 2IITA 3AIKA 4Y9SA 4CIAA 2AXEA 5EI5A 5HF9A 2HA6A 1BS9A 3JWEA 5AHXA 4JYPA 4NS4A 1BROA 4QE3A 1XRNA 2ZSHA 4KE8A 4EY4A 5CMLA 5F4ZA 3WYDA 4G4IA 2O2GA 1ACJA 2B61A 3I2KA 4FHZA 5FPQA 1EH5A 1JJBA 1QIFA 3QPDA 1B6GA 5AK5A 3PF9A 2PSJA 1ISPA 5IH7A 3LS2A 4BP8A 4CCYB 3ESCA
chains in the Genus database with same CATH superfamily
4BQFA 3T5PA 2QTNA 1KQFA 3CNLA 1Q57A 4Z86A 1VPLA 2XUOA 3UMBA 3CWZA 1V16A 2ERXA 2Z83A 3RYFA 2WAMA 4EG4A 1NYTA 2ORIA 3WKCA 1AS3A 1HNZB 2VNAA 4PM4A 3SHTA 3EA0A 4BBPA 4HS4A 5FWDA 4L5IA 1G1MA 4UJ3A 2AD5A 3AVXA 3NH9A 1E79A 3RSFA 3LCCA 4LI0A 4MP8A 3ZK7A 5JFGA 4OKIA 2C59A 3FMOB 2VPIA 5ALTA 3TQIA 1DPFA 5B36A 2HMVA 1N9ZA 4M98A 5H59A 1XDZA 2GCNA 1XZBA 4RTQA 3ZD8A 3C45A 3INNA 3GRZA 4KOAA 5EJ9A 4PSAA 3R40A 5ADHA 1H94A 1TMKA 2OZKA 3TZHA 3EXHA 2NIPA 1Z3CA 3LKVA 4KYUA 2CNWA 3ZJ5A 2VZ8A 4QNRA 1NMXA 5EZ5A 4MQMA 4DLWA 1S3GA 1CE8A 4PRKA 1RZRA 1M7HA 4D74A 3VC3A 5I7OA 2OO3A 2BMWA 4CM1A 1C0KA 2PQ0A 1XP8A 5JZVA 2Q4EA 1CULC 1XN1A 1YE8A 2WSLA 1NV8A 4M55A 2PKYX 1M1YB 2AC7A 5B2ZA 5I7EA 2C4KA 4WOCA 3I2FA 4PQEA 2GN8A 4D8TA 2RKBA 5IJWA 5K0FA 5MFPA 1KA9H 3BIWA 4WZBB 2RJ3A 1FLDA 3RPEA 1VP3A 2XCSB 3EQZA 4NJEB 4WVFA 2G9VA 4IWXA 1NJSA 3HKEB 1VSTA 4OYLA 5GZ3A 3DEAA 3ZWXA 4LXIA 5LZ8A 2DUNA 2HLNA 3GRYA 5AK3A 4HAOA 5DEIA 3RVOA 1BQ3A 4UCQA 1W5FA 2V7BA 1GQ2A 2LKCA 3B3FA 4XGQA 4OU5A 4OQ4A 2PDAA 1PVVA 3G79A 3ZV5A 1DC7A 3IQFA 5FKJA 4WK4B 1LWOA 3HM9A 1ZJ5A 1KH1A 1ACMA 4TMKA 3AFNA 2QTGA 2Q99A 2G04A 3VM6A 3VNBA 1IY9A 1PWXA 2QGZA 3WMFA 2RB5A 4DABA 4LFAB 1ZZEA 1LRJA 2REXB 3ASZA 4L8FA 4R2JA 5IVHA 3WGIA 1UBCA 1VJ0A 1A98A 1UKZA 4EG1A 5HKKD 4IFEA 4BVBA 2G6TA 2WUEA 3Q2IA 1XMPA 1QAMA 3MMPA 4ZDWA 5ILOA 4I55A 2IE8A 3TG2A 2FDRA 4F45A 2VYQA 2Q6OA 4PICA 4G9BA 2MSEB 2YXNA 1W49A 2CNBA 4GMFA 4LECA 5IBQA 1ZPDA 1Q5PA 2ODAA 1FP2A 1MAUA 3BHMA 3DLAA 2OXFA 2QY6A 3GOQA 5ILQA 3AR7A 3WKAA 3RLFA 4BMXA 4FT2A 4RLQA 3WRVA 5JS1A 3G9UA 3ENZA 3J7TA 5HE9A 3W2FA 3EFHA 5EIBC 1UUFA 1YCFA 4LVOA 4EW6A 1ABEA 3DW1X 2I6TA 3ZN2A 4BJ6A 1HDXA 2A5JA 2P4HX 3MUEA 5EAIA 3L8GA 1XHLA 2A3NA 4YRMA 3K94A 1QLWA 3EQ6A 2JLSA 1DJOA 4GKBA 3WLTA 2FZVA 3VPHA 1GL3A 4LWQA 4OSPA 1KDVA 5G2OA 4MRSA 3OKPA 1MGOA 4Q3CA 2CL5A 1YBVA 4QXPA 3WHKA 1V9LA 2OA0A 4ND2A 4EAQA 3IP6A 5DTEA 3C8DA 3AYZB 1UDAA 1TJPB 5A1TA 4RZ2A 5E0KB 4OA5A 2UZ1A 5EP4A 1N2CE 4QATA 3EPJA 1ZIYA 5DISB 4BWYA 1GGVA 1KYVA 2OCAA 5D5HA 4J6EA 4ALMA 3CR7A 1F4LA 2QX4A 3CRVA 3D6NB 4KPUB 2A1UB 3B9QA 1RC0A 2JFNA 3K9BA 5FPTA 1DO2A 2A57A 5TC4A 1OW3B 3ER8A 4N48A 2OHXA 1DG3A 1OPRA 4BFYA 4BWFB 4NSNA 2WD7B 1XKQA 1N57A 1SKQA 4M3NA 1RJEA 1QIIA 1W46A 4QUKA 4A8HA 4EUKA 1Z7EA 4MUMA 1R74A 4TV8F 5NLLA 5JECA 2BGWA 5EE9A 1FXSA 2I2DA 3PTLA 1HF3A 4C5BA 3O8RA 2NADA 2PIAA 4HMPA 1YMQA 1J1UA 4RLHA 3MXTA 1AQJA 4WZBA 5C46F 4GPEA 2DPLA 1BU8A 3QXJA 4HWGA 4UE3S 4BJHB 1KZHA 4L74A 1K0FA 3QW4B 1HLDA 2OBYA 2FMFA 1TO2E 2P1RA 2VYFA 3N7AA 3PIRA 1JW9B 3VVCA 4TTAA 1NBHA 4OX9B 1CTQA 3CEMA 4ZI7B 4YPVA 1CR1A 3BE5A 1E6EA 1ZRNA 3MOSA 4OJYA 2HOQA 3ROTA 2YMPA 1K0UA 1PJ2A 4DBZA 3RADC 2XCLA 1D04A 2AKYA 2XNDA 1K8QA 3G0DA 4A73A 4IXDA 4MVJD 5EIHA 3KKEA 2XHEA 3RU2A 2FSPA 4TKUA 3NM5A 3RU3A 3RQIA 4DJTA 4ENRA 3HJAA 3GJYA 1BN6A 3LOPA 5C5IA 2YXBA 2PBRA 1VZ3A 3UA4A 1UXKA 3CZ9A 2ZR7A 3HUFA 3E9YA 4UBNA 4W5WA 1GNRA 1OI4A 3H5LA 3QTLA 2L69A 4MR7A 3ZK9A 4OK3A 4YP6A 2IBTA 2I55A 1PO7A 1A4RA 1VG0B 4YRSA 3S8MA 1U9JA 3D7LA 4CVNA 4LTNA 5CFMA 4TWZA 1EK0A 2BCEA 5K0JA 3D3NA 2H9YA 3FCOA 3IOMA 2UVPA 4JJ4A 3ZS8A 5COQA 3WGGA 4X93A 1QRAA 2JIOA 1JHXA 1FVOA 3ANMA 3UHJA 1ZISA 4QHYA 3CLHA 2V65A 3GRFA 4G25A 4RJTA 2JANA 1ZITA 1Z73A 1UMBA 2PBLA 3LIIA 3VJRA 3T0FA 5LOVA 4A8TA 3BGWA 1SK9A 2EP5A 1FB5A 1QOPB 2J07A 2PH1A 3VSCA 2XIQA 3W5SA 1BKSB 2PX5A 1UWLA 2V3CC 2P3SA 16PKA 4KI7A 1KP2A 4EIWA 4UDYX 1GPWB 2W6PA 4B73A 2O3UA 1GTVA 3OF5A 3R6TA 4H77A 1QGZA 2P79A 1WKCA 2D3WA 4JODA 4Y2VA 5F77A 3BK2A 4G56A 1M5RA 2N1MA 3OIFA 1AKRA 1QGUB 1S2OA 3ND5A 1S02A 4MDEA 5K05A 5FWXA 2Q6LA 2VRCD 3ZHTA 1AS0A 1GRNA 4JS0A 1D07A 1GZHB 2F1OA 3M6LA 5FOVA 2QAGB 1VA5A 3DAPA 2HV9A 3F8SA 3FPSA 1I14A 3HCCA 5BRNA 1T3SA 1U63A 4DG8A 3OU7A 2HJGA 2V7WA 2YW2A 4YECA 5JTTA 2XRZA 1S1MA 2V5AA 3F67A 3C6ZA 4S0XA 3E35A 2V4ZA 4N65A 3HWSA 1IHUA 4O4LF 1RXWA 4BRZA 1TQ2A 3H9EO 4LYFA 4EATA 1CB7A 3U9SA 3KYCB 3LG2A 1YDFA 3L02A 2WFLB 2VDLB 4V1CI 1UFQA 2XTNA 3VTAA 4UDXX 3D6FA 4R6XA 1PR9A 3DJFA 4OJQA 2HWUA 2HO5A 2NAPA 3N2NA 4M21A 4WTOA 3D7SA 3UBMA 5KVVA 3D6JA 4OH1A 4QBKA 4ZICA 4NICA 1Z29A 3QVGB 1JILA 3P96A 3WZLA 2J9XB 3DHYA 4H3KB 1L7XA 2Q62A 4M9ZA 2UUCB 2G1UA 2BI4A 1U1EA 2IHTA 3KJFA 4I08A 4L4SA 4G8JA 1JEYB 3A26A 3KVRA 1N5KA 1RIIA 2OFXA 4LDQA 3G23A 1JTEA 3GBVA 3QVSA 1RXSA 2P9TA 1ESDA 2PANA 2BHNA 2QPAA 2O20A 3A8TA 1A7JA 1JQ5A 2XSZD 4KKXB 3R8CA 4EJSB 4YV7A 5KTTA 3SOZA 2HMWA 1CY4A 3FWKA 4C4SA 3U3RA 1GPNA 1Q14A 4HTFA 3U4AA 2VNHA 5ALVA 2AG5A 2QTZA 2ZI3A 1W93A 1WP4A 3QPCA 4WN3A 1ECJA 2KYRA 1P75A 4YACA 1U5BB 1SXHA 1KEWA 4BQRA 3GLQA 4EF5A 4K9KA 2FPUA 2DSTA 4CDGA 1I3NA 1FTSA 4GGMX 1HT2E 2HIHA 2JH9A 5J47A 5JR3A 3QSGA 2RHBA 3BQNB 4G1BA 3VKGA 3SQNA 1RJ9B 1BTOA 4OXYA 4CKEA 2YC2C 4NNPA 3A1SA 3FPJA 5GM1A 1GAXA 1DEHA 3CGGA 1WJGA 2MCFA 2IZ6A 4N1AA 3FM9A 4IJUA 4BMSA 1ZJZA 5CNKA 3RUHA 2Q0QA 2IHBA 3DMPA 1WCWA 4TTSA 2RC6A 1T2NA 1UODA 1XWFA 3R6GA 4KACA 4TQUS 1KBQA 4JITA 1QP4A 3HM2A 1IE3A 2JFGA 1AKUA 4LISA 4M46A 5F4BA 2A5FA 3QBTA 2RHLA 1EIWA 3TOZA 4L0DA 4PO8A 4AECA 4F4IA 3DUFA 4GXRA 3EIOA 5CJJA 1UDWA 1XIVA 1FYVA 4LYYA 4DV7B 3HP7A 5CT9A 2HAEA 4M1KA 4BVLA 3IX7A 1G98A 2F64A 3S2YA 2HLDA 2R6GA 3LCVB 4H1WA 3TI9A 3DMYA 3Q85A 2VDRB 1YRQA 4Y9TA 3TAXA 2I1LA 1NC1A 3GT4A 1P2UA 1NI4A 3L6CA 5HILA 1FFWA 4IJQA 1G5HA 4KREA 5AHWA 5BSGA 1ZIOA 2JJ2A 2NUBA 2PH7A 3WSWA 4DIFA 4EFMA 5IJ9B 5JAHA 4BFZA 5GWXA 4YCJA 3FSGA 4TXLA 4UHJA 2CSXA 3II6X 3M3HA 3TL3A 3I2HA 4ZPXA 1NMQA 2D7JA 3MFYA 3NHZA 3SBEA 1X19A 1YJXA 4NR0A 1PG0A 3WG9A 4F6RA 3EF0A 1PR6A 1G6HA 3OCVA 3P71T 2QR5A 3OUTA 3WRXA 1NW6A 3L40A 3ABIA 3MHTA 2V6GA 2AFIB 4YPOA 3KZXA 2O8FB 5TIIA 1X1DA 4IMPA 1FS4A 1EUDA 3QUBA 1E0SA 3BA6A 2VF7A 1EK5A 2QLLA 2XAAA 3P2KA 1QHYA 4H27A 3KKMA 1Q7GA 3ME5A 5EXPA 2EQBA 3LLCA 3UAOA 1MZPA 2XVYA 2B78A 3DLCA 2BN4A 4G85A 1K4KA 2PCLA 4RVHA 3ZG6A 4DNQA 2HQRA 2A5DA 2I65A 1RM4A 1DWQA 1E18A 1GNPA 4YAWA 4GX5A 4IIUA 5I4KA 4PBTA 4CN9A 4I4TF 4O2AB 5E7IA 3F2IA 3PYLA 2CT8A 3G7UA 1AOXA 4HDOB 5AI8A 1AUVA 3I0MA 1LI5A 3DDOA 1ZM9A 3FFTA 2WJYA 3U2QA 4AUEA 1HG1A 3NXKA 2G6BA 5KQRA 1NU8A 3ABSB 3PHJA 1UMCB 1EDOA 2L82A 2RJOA 3BWDD 4R1QA 4WOPA 5BO5A 3I0NA 1R8XA 3LPLA 4DR4B 1KHTA 2RCNA 1VYHA 1WD7A 2O1XA 1ECFA 2FHPA 4I5FA 5E1BA 2YWBA 4BEWA 5B4TA 2B5OA 1JZSA 3ULKA 2IEGA 4K0KB 1KKUA 3CO0S 5BQOA 1IOZA 2W2NA 1IJBA 2OHJA 1I9GA 2C84A 4P38A 1N7JA 4B84A 2YV4A 2N47A 4YHHB 4FGSA 4DRXB 1ZJYA 3C15C 2ZKLA 4LZOA 2FF7A 2NU7A 5J2TF 1KEZA 5A9SA 5K0SA 5GIPE 2O8EA 4YJFA 1G7CA 2E18A 1I6LA 2AOUB 1ZL2A 3JVIA 3WYCA 4R69A 2WB2A 1ZLXA 3FVTA 1QORA 3PI7A 5KNBH 3PVSA 4E6PA 1UJ2A 3KHSA 4XPIB 2Q3BA 5BN5B 1XU9A 2NXEA 2EKQA 3C3JA 4R40A 4JLMA 4HUQA 1A5ZA 4MRRA 2P2CA 2XKJE 1Q6ZA 4C08A 3I37X 4NYIR 3KHKA 4YT4A 2I78A 4R2HA 5E6UB 1K7FB 1S7CA 1WD5A 1XZEA 3CF2A 3HZHA 4LF7B 2B8WA 3ZDYB 3TKAA 1XGKA 2Y0BA 3KUUA 1DP4A 1RQ7A 5ED4A 1L7AA 2ZBVA 4JT8A 1M66A 2IYQA 2J45A 2X4IA 4FWBA 5ADUS 4B3HA 1OZHA 1FJ2A 4PZLA 2OBXA 4QQKA 1T4BA 4BNDB 4CFSA 3NOQA 2QLNA 3RBVA 3N3BC 2W2PA 4DA8A 2F62A 3R7BA 2BBSA 3LUJA 3SS9X 5LLSA 1C7IA 4KPEC 3NRCA 3VU9B 3HXLA 3ZEAA 1E4OA 7YASA 2WAXA 3VU3A 3RTGA 4Q3BA 5D3MB 5G1OA 3ZZNA 3FNRA 3B9BA 1IRIA 1YS1X 4Y2PA 4A3SA 1WUJS 2GK3A 1NW7A 4NDNE 1XU7A 1Z6TA 4L57A 3A70A 4MCIA 2AB0A 1NP3A 4JXKA 1G5FA 1VOTA 3P45A 2H92A 2GWRA 4D9HA 2PLNA 3I9OA 4JBYA 4DDUA 1BX1A 4N8SA 2CUKA 3WQQA 1RACA 2C99A 5KC8A 1MT3A 2WQZA 3KKQA 4YJ3A 3T3OA 3HYSA 1K2WA 2XXAB 2F59A 3C3EA 1WF3A 1TT5B 3LWDA 1JZTA 4JWKA 4GP7A 1N1MA 4J0KA 1FNBA 4JKYA 4MQEB 1NURA 3MOGA 3AX6A 1MX5A 1U8ZA 2J6BA 1QZXA 2F2TA 2VSQA 3EIUA 3GUHA 3P2OA 4NI5A 3MCVA 4ONEA 4CW7A 2CMFA 3UZUA 4Z0TA 4B31A 2PRKA 4RMJA 3VGPA 3FNIA 4M1OA 3O84A 1T0HB 2A86A 2HRCA 2XDQA 3D5EA 1UZUA 1KPHA 1XCGB 1QRTA 1GZUA 3K6KA 2ZIAA 3C0KA 3HV2A 3FKJA 3RRYA 5I48A 1X7DA 2RG1A 3OFND 2I4RA 1FYWA 2EFHB 2GKGA 2H1CA 1WPQA 3LGAA 4FHEA 5IYZB 1E3TA 3JALB 4J8PA 1L7QA 2J9FA 1IBMB 4NCKA 2QJFA 1QH9A 5C8DA 1JNXX 3H5TA 3ZKAA 3DPUA 2I1VB 2PYZA 1TZMA 4D9FA 1TJNA 3CLRD 1MVNA 2HA0A 2OP1A 3FCYA 5UKDA 4EEXA 7MDHA 1IWBB 3ZKWB 1Z7BA 2IPLA 4E5SA 2W8ZA 1A96A 1UDCA 4WI1A 3OZVA 4EYEA 1S2IA 5BMVF 1I7DA 2BGKA 4EGQA 4NV1A 4GDFA 2PKRA 5AJTA 2FFRA 5LMCA 1YHZA 3WLFA 3DF9A 3KJGA 1B76A 3LLVA 4DJ5X 1N5IA 5BT9A 3RJMA 4B6GA 4U7DA 2JD1A 1XNGA 3CBQA 4WBXC 5E3IA 1EUQA 1FJHA 1M72A 1L5QA 1ZA2A 2GXUA 1Z2OX 3FTPA 3I01A 3K7EA 3QEOA 4QLOA 5G4KB 2VRBA 1V96A 3LQQA 1YRWA 3OKFA 1H8EA 4NNJA 3E53A 3HV0A 3AWIA 4CM6A 1L5YA 2WUWE 2VHCA 4ILEA 3QUCA 1S3SA 4F9EA 3LT4A 3PWZA 1N6LA 4BFCA 3KSRA 4H3HB 1XNQB 2MINA 5E1DA 4C4YA 4FZ5A 4PSDA 1ORVA 4X8MA 1GDDA 1U3CA 3D8UA 3D8HA 4CV3A 2VYVD 1V9CA 1BDMA 2A5LA 1Z4KA 3QWHA 1JDSA 1NVWQ 3FKSA 4EZIA 3AVPA 3C3PA 3A6HA 3Q3EA 5ALEA 4C76A 3BL6A 1PDVA 5MN4A 1YULA 4JUBA 1UM9B 5AHOA 3RDPA 3R1IA 2R60A 1P29A 4G1UC 2QENA 1YJBA 4FN4A 2BDEA 4Q19A 3JU3A 2OFPA 3JQAD 3G0CA 3FOAA 3QX8A 1BMTA 1FP4A 3LWBA 1J2TA 1PAUA 3E3OA 4JQCA 3EWAA 1U7XA 5E7MA 3KALA 1LWNA 2IGTA 3Q88A 4TLCA 2IUSA 2MSWA 1NLFA 1H4VB 4XUDA 3SX4A 2HEGA 3KTDA 1AK2A 3MMSA 3ROZA 3GXBA 1XXLA 1QRRA 1SZCA 4JI8B 1L4UA 3MBKA 4L22A 4UAVA 2A6PA 2NOAA 4B85A 5E6SA 5K9ZA 3ND9A 3G8AA 3QENA 4OLJA 3GEDA 1I4OA 1CRZA 3AHIA 3QEJA 3PPXA 4MPJA 3BXZA 3EIHA 3DDUA 2WU8A 3SQWA 2X14A 5EZSA 4U6SA 2DVMA 2BGIA 1XQ9A 1TO6A 1ISGA 1G7SA 4JROA 4V39A 1OYOA 3UWMA 4I3HA 1CK4A 3EWIA 4P84A 4C1BA 2WP0A 4B5LA 1O6BA 1FYDA 2GGSA 2QX6A 2XDYA 2DM6A 3P7MA 1ADYA 4C4OA 2QN2A 1CF9A 4R8SA 1UAGA 2R8OA 5EXEA 5BOSB 2F55A 2QPLA 3HDJA 4GGPA 2I87A 2IYEA 4NIMA 1UL1X 3FROA 2P9EA 1AF7A 2YHBA 3P2EA 4I66A 3RC2A 1WETA 3GEHA 1UOOA 2UUOA 3IAXA 3OA2A 4K1XA 5JLAA 5BUZA 1C1XB 4NFYA 1VLQA 3U61B 5A0VA 4FNGA 1MNAA 2X8BA 3WLSA 3AR4A 3QELB 5BYJA 3KB6A 4FYWA 3UJHA 5BWNA 3MERA 3N8NA 3KVNA 2ZSAA 1Z4IA 2AN4A 3HZRA 3OHSX 4FBMA 4ZV4A 1ZR4A 4FLFA 3ZU5A 1CY6A 4B2LA 4TKUB 4F86A 2ORED 2WNIA 5ERXA 1RRKA 2A9OA 2KLBA 3T1QA 4FT4A 3SF8A 1M8GA 3BTSA 1GL6A 3ICQB 3U26A 3MTIA 2ATXA 4NL4H 5HIJA 1A9XA 4HV4A 3ZDFA 4Y2YA 2XBLA 4IUDS 4IQ4A 4V0QA 5JBQA 2XW6A 2Q5CA 2ZEJA 2C5HA 2ZTHA 3JQCA 3BXXA 1G17A 3EASA 4GBMA 3D2CA 4YMGA 4GRIA 1N92A 3WA6A 1DAFA 1TEVA 1YRYE 3HCWA 3UFXB 2AF4C 3FUTA 1R50A 3VSDA 5H83A 3FI9A 3RTDA 4ZCMA 3NTVA 1RQGA 2HMUA 3DCIA 3DOUA 5DRTA 3IDOA 4BQQA 3W5JA 2UXBB 1GPUA 2GK4A 2JAPA 1N5LA 2DWCA 4OHOA 1JKFA 3HCPA 4J2HA 2BFEA 3AF3A 4GOLD 3TFOA 2NMVA 1Q7EA 4A5SA 4KFRA 4X1YA 2XLBA 2KJQA 2V6IA 2ZS8A 2IYRA 2QG4A 3M81A 1EDEA 2PSDA 5FAXA 1N6NA 1SUPA 3FHJA 4ALKA 5JS8A 3RYCB 3CNHA 5KYUA 1AUXA 4L8VA 3LF1A 3E5NA 2ZE5A 5EZ6B 2FG7C 3GNQA 5CAEB 4C5AA 1VGQA 3IAM6 2A9KA 2CHUA 4X6LA 1IEQA 1XT6A 5TV2A 2ZXEA 3T7EA 1SKAA 2YWFA 4P98A 1BXRA 4IMIB 2FGKA 3H86A 4TQGA 3PEWA 1MEJA 4GVXA 2Z8YA 4WUVA 1X1QA 4RZSA 2PH3A 3KTAB 5FBWB 1JR3A 2X1VA 4BV8A 1KNXA 5AW7A 1T3LA 4JT9A 2J67A 2ID8A 2JAOA 1S8AA 2QT1A 3EIFA 3DMDA 3O47A 3PITA 4FFVA 2HYDA 4YP1A 4C06A 2R2GA 3VVBA 2PUBA 4KFUA 1QZUA 4Q5IA 4X8LA 2W8BB 1IVSA 3PUYA 3T1VA 2GPYA 3FIUA 4BE7B 3OBIA 3STWA 4F8JA 2OM6A 4XVCA 1WHSB 3MLBA 1RHUA 2VDWB 3LCRA 3P94A 4ND8B 3A36A 3T35A 3CS3A 1SBQA 3EVAA 1RBZA 4PRZA 4W6QA 4XX0B 3UV6A 4DLKA 4EYSA 5KNDA 1XD8A 4KVFA 2P9QA 2WBLC 4ER3A 2JEOA 5H68A 3OD1A 3OPYI 5HSGA 1JMVA 3EDRA 5HOEA 1IH8A 4QPJC 4QYSA 1QS0A 1X7HA 1HXHA 4JR1A 1F8XA 5HE8A 1LLCA 5EKXA 1QF7A 5ERGB 3WVNA 3ENQA 1LJLA 2ONCA 3TK1A 1EXDA 1R4MA 3CIOA 5F7ZA 1NBWB 3ZV7A 1CUUA 2W0MA 5BVGB 2ZQZA 1LX6A 4ED9A 4G2TA 2VYCA 2ZBUA 3GRAA 1JJIA 1W8IA 1KSGA 2V98A 2VNIA 2Y76A 3CW8X 4W9NA 2Z2YA 3C4QA 2EG5A 1NOJA 5CX4A 4LQ4A 3VHLB 4RKWA 2GAJA 1E6MA 3LXUX 4IIXA 2J3HA 3FPEA 4ZOCA 1CR2A 1QFZA 2R7KA 3RVKA 3U5ZB 3B70A 4AWXA 4F8YA 1HEUA 3HSKA 3QLUA 5C4GB 3WY9A 1SCNE 3AJEA 4DLNA 3NBKA 1CNFA 1A2KC 5EIEA 1K5PA 2XQKA 4HEHA 4D4HA 5A4AA 1H9AA 1YIDA 1C81A 5ES3A 2Q0SA 2ZLBA 5KQLA 2PUHA 1W4RA 3B7GA 1G18A 4IG9A 1T0PA 1CVLA 2MMCA 4OTZA 4DFDA 4GRAA 2CLCX 2RH4A 4E0BA 2DPXA 2PQ6A 4TN1A 3PJDA 1P4RA 1YBAA 3OOEA 1QAQA 2YUIA 2WZQA 3CCFA 3LQRA 3NYQA 2PTHA 4PAMA 2P6PA 3A1DA 3W34A 1WW3A 1Z68A 3GGPA 3HACA 3OE7D 4KL8S 1W581 3HEAA 1XMOB 4RKQA 2I2WA 1D9XA 3DZIA 2HK7A 2QQEA 3M8KA 1JG2A 3H99A 3HR8A 2CFCA 5CH5A 4F4FA 1CWUA 3ZOKA 1G8JA 3BULA 3HDHA 3ZUGA 2IS4A 1YA4A 1WG8A 5I4IA 1Z18A 3EBLA 4AF8A 4ER7A 4KN9S 1BH6A 2Q5JA 3NBQA 2KM1A 2COUA 2WAYA 2WD8A 2YQ4A 3AEQA 2B2XA 2II6A 4I6GA 4KK4A 4KQ2A 2NXCA 4E1BA 1HI9A 3JASB 1CHDA 5AM3A 3EBOA 4UD2A 1VBKA 2V8OA 2AXQA 4BLPA 1SULA 1MJFA 3H19A 4D41A 4ISBA 3GWZA 4CQLA 3AEYA 1NYQA 4CDNA 1VGRA 2D2VA 3E1GA 3PK0A 2O8BA 4MYSA 4NULA 1QOZA 3N8GA 4C2BA 4HWOA 4URZR 3RBZA 2VPXA 4C7MA 3FYCA 2SKCA 4D26A 5F7OA 3MRXA 2POQX 1KZ6A 1LS1A 1D1QA 2A8YA 2ODTX 1VHJA 1XEXB 2BCGY 1JJAA 2Q4RA 3FOWA 4OU4A 3TM5A 4HXFB 1QLHA 4QBFA 4BLWA 5A3JA 2W58A 4MMZB 3LK6A 3U4GA 5ALIA 3D0QA 4ZOBA 5FPKA 5F9HA 2CUZA 3F1KA 3KQMA 2JCGA 1II9A 3HBJA 3KLOA 3SPXA 1KGSA 4BNLA 1VKNA 3AHCA 4DXAA 1KZ4A 2MR6A 3AJ8A 3S7TA 3X1WA 1U1FA 1PSWA 5LZ9A 2DHCA 4F8EA 4BX2A 3ELUA 2JLCA 2FZKA 2ORYA 3OO1A 3ZBTA 3AFGA 4BAGA 2JFYA 4MLCA 4R2LA 4DCSA 1ACLA 4FHDA 5C7IO 1OLSB 3PC6A 2KWIA 4PS0A 1K68A 1XZMA 1FLNA 4O63O 1SKYE 3G8YA 3H8SA 2IYZA 2J5XA 2MWMA 2AT1A 2SKEA 3LPAA 3TBFA 3VNAA 4QUAA 3PNLA 3EOAI 4YA6A 4PPQA 5CDFA 2WMDA 4KR0A 1DXOA 4EA7A 1RAEA 3KEMA 2QRNA 4BMNA 4AY4A 1Y8RA 3RT7A 2NZJA 3A1FA 3RASA 5D51S 1SXGA 3TQOA 4D0RA 3RUFA 1HDEA 1Z0ZA 4DG5A 1ZJJA 3H9CA 3K1YA 2I0FA 4Y98A 4DPKA 3AHDA 2IGBA 3U56A 4HDKA 2AHRA 3MFQA 1UM9A 4RZ3A 3KKLA 1B16A 4X63A 5EYPB 2CJPA 1TM3E 5M5BA 3ZVLA 2B1RA 3E3MA 2DLCX 4ENVA 3ILSA 4FYHA 4TTVA 2BV3A 5BSVA 3I09A 5IKPA 3R6DA 2ESRA 5HBGA 1N8TA 3K8OE 3BFJA 4RKFA 3LDFA 1OXTA 1IN5A 2DFVA 3VFDA 4ZGWA 3S8YA 1J2UA 1QHXA 4CEJA 2XCIA 4JLOA 4A92A 5D84A 1RLJA 4XFKA 2LD4A 7REQA 4PO9A 1VP9A 1DIGA 2OHFA 5IAGA 4EABA 2VPZA 3CINA 4WXPA 5AVVA 5LIPA 2QK4A 1F8UA 4IHJA 4IO1A 1JTFA 2CMGA 2C9BA 4X1KA 5MHTA 4B7CA 4W7SA 1G9SA 3E0QA 2ZRGA 3S44A 2OYCA 4CR6A 2R8PA 3VNQA 3WZ2A 4IHKA 1KVQA 2Q1YA 3AXSA 4LJAA 4UATA 5L3QB 4BGDA 7GPBA 2JGFA 1CRLA 2WJHA 5WRFA 4O25A 3O8BA 2X2OA 3HDVA 5KNBA 2NP7A 3LX8A 2JGRA 2WF9A 3EVTA 1WDTA 3K1JA 3OFSA 4MQUA 4PNHA 3WRWA 721PA 1TA4A 4MS1A 2JVJA 3SHWA 1OZAA 4GI5A 1U5CA 4O1IA 1F7UA 4G63A 8ADHA 4B6OA 2BYTA 4R1NA 3GJ5A 3ESBA 1YQQA 3KXPA 4UD6A 5KB3A 1C50A 2JCXA 3QEAZ 3F6YA 8ABPA 2AF3C 1YWGO 3D3EA 4M0DA 3F9RA 2HRZA 5TY0A 3L0PA 4NENA 3RV3A 2IYYA 2EZUA 2HMYB 3B2NA 4HEA6 3TW6A 3N0TA 1FIUA 1Z0JA 1H6BA 3VJKA 2PUGA 3E1SA 2FPXA 3ZC3A 4FMBB 2UXDB 1DU4A 2X9GA 3U7QA 5JT1A 1Y1LA 1OXKB 3K73O 5TS3A 4PG8A 3SR0A 5AW9A 2WJAA 1JG7A 1NRJB 2G9UA 3ER9A 3DTVA 4I2NA 1N6IA 1SRRA 3OLYA 3WK6A 2QP9X 1TQ6A 1LNSA 1EE2A 3ZPXA 4BNDA 3I1FA 1JAZA 1O89A 5EQFA 1KR5A 1P0FA 1E0KA 1X1EA 2PVSA 2Q5LA 4QXQA 1BS2A 2JIRA 2ZT7A 1MU0A 3R74A 4RTPA 2Z0MA 5DBEX 1VE6A 5JSQA 4OL0A 4PSCA 1SK8A 3ONDA 5AKHA 1SOAA 1E2EA 2XOEA 1T2CA 1D2GA 3W7VA 4YJ3B 5HNKA 5BWCA 3HKDA 4RVUA 4LYJA 2HBYA 2J6HA 3W1EA 1XG5A 2G9QA 5IG2A 1VG8A 2P62A 3VMMA 1KDTA 2EG9A 3IQDB 5BN5A 4CR7A 2O8VA 3L0OA 4RL4A 2JFBA 3WLRA 1H65A 4ZYVA 1FQOA 1WM1A 2H2FA 1E9SA 3K1ZA 1GTZA 3Q15C 4KMOA 2XGJA 3Q98A 1G55A 5HKLA 1DTWA 4QXMA 4RX1A 3ZE0B 4F0JA 3DDCA 1IUPA 1Y4UA 1ZIPA 3DD5A 1U80A 2AC4A 4HH4A 4LV6A 2P90A 4TWAA 1MQ9A 5IDQA 4PYOA 3TRHA 2GR9A 4BB9A 3W04A 4DQLA 4HGYA 5EUQB 5F9MA 1JWBB 2QTVA 2OQ2A 1SIWA 3HI4A 2H2WA 1JIKA 1VL0A 3DBOB 3AUSA 3QF4B 2ECFA 3IL2A 3LW7A 4WPGA 1E99A 4MJXA 3JRNA 4NCXA 4CMBA 2JB9A 1FNDA 5L7TA 4EY6A 4NZOA 1JAXA 2NQ2C 5I47A 3QNUA 1L5NA 3MJ4A 5KNDH 2FWPA 3EH1A 5JQGA 2HO4A 4MP6A 4PLGA 4JX8A 3QV2A 1YZYA 1UFVA 3GVIA 3ORFA 2ZSUA 5D3QA 3VOBA 3AZPA 3ZNQA 2YASA 5BPHA 4NXMB 1GG9A 3CCCA 4BNFA 2EFCB 3UFXA 1IXYA 1P19A 3SQOA 1QB7A 5E6RA 5JD6A 3MGAA 1JKIA 1EFAA 2DGDA 4TSKA 2D5CA 2E2WA 3CNNA 3QVWA 1D2EA 4HKTA 5DNUA 5HZHA 4N39A 3A05A 4CCAA 5MN5A 1G20B 1B8PA 2FP3A 1SQ0A 3I73A 3PEUA 3FRHA 3WFZA 4XYGA 4AJ2A 4DIUA 1T1EA 2VP5A 3D59A 1UBUS 1SXJB 2EFYA 1X7ZB 2IEYA 3E4CA 2YVLA 2EAUA 5DHRA 1LTQA 2FWIA 3LC1O 1S8OA 4BB6A 5AVTA 3JTEA 4BLTA 1D4FA 3A6JA 4JDUA 4KOEC 1BX3A 3A9VA 2F3QA 3RODA 4EKDA 1BE6A 1KJJA 1V43A 3OIVA 2ZPTX 3IQWA 4KH0A 3JSXA 4AMBA 2NZXA 2Q07A 2RHHA 1T43A 2FSSA 1FMTA 2ZYSA 4Z3KA 2ZATA 1CERA 3S2ZA 3GEBA 4F85A 5AI9A 1I3MA 3A37A 2R6CA 4ZT4A 4E5MA 3L5KA 3BX1A 3WL8A 3O9ZA 3SHQA 2HSEA 3PX7A 5K09A 1YQGA 2BC9A 1SOMA 1Z4OA 4L27A 4OGGA 5HW0A 1M2FA 1XMQB 5IKOA 1C8VB 1GGMA 1T25A 2GK6A 2ONZA 1EM8A 1EEXB 4UHHA 1VSQA 3QVMA 4XDHA 4HQKA 3L9XA 5DGCA 1PR1A 1MX3A 3LW8A 4F5ZA 1G6OA 4ZU6X 2ECOA 2Z9CA 4IH4A 2BONA 4BYGA 4O8ZA 1J21A 3OZGA 3JQPA 4RGYA 2GBLA 4D4LA 3M83A 1RYHA 5C3UA 3IT2A 3CXUA 3PLRA 2QMUA 4QJ4A 3OZXA 3T7KA 1PWYE 3QVKA 3WI7A 4AJ4A 4B6QA 5LJIA 1MMFB 2OGUA 2ZYHA 3DZKA 2C2YA 1WABA 2C7GA 3KLNA 1CQXA 1Y8QA 1FFBA 3LUCA 3MT7A 3Q6NA 1Q17A 1BHQ1 2JVKA 3HA5A 2VFAA 2Y1FA 2OAEA 5BSTA 4W8HA 4G8DA 5AM4A 1NRXA 1OLUA 2EKDA 3L77A 1WBBA 1IQ0A 4BO9A 3G2HA 3UTDA 1M83A 1ZWKA 3DVSX 3PNVA 2OQVA 2CZQA 3TLJA 1Z0IA 2F7SA 3D81A 3PEYA 1JEJA 3DH0A 3FMIA 5AHRA 3SOPA 3TCKA 1G3QA 5LQRA 1G3UA 1Z5VA 2ODQA 4IGAA 5EMJA 3S70A 1KWKA 3NAGA 4BX0A 1CUFA 5E1MA 2HA5A 3LNTA 1I4WA 1XDGA 3KSMA 4X94A 3N2IA 4R8RA 5T4EA 2AQKA 1R6UA 1ZK1A 3CA8A 3CZCA 3IIIA 5AW8A 3VZSA 5TGDA 3GDWA 5TS2A 4EW1A 1MIOA 1TYCA 1X7GA 4PAGA 1KI7A 2W7TA 4ZU1X 1GPYA 4DA6A 5G0VA 4YRRA 1HEYA 5CFNA 1PR4A 1P1IA 4JI2B 4AG5A 2BF4A 5TVGA 5AKZA 2WABA 3IVMA 1ZH6A 1G21E 2GYVA 2OV6A 3M49A 2FZ4A 2OGSA 3GXOA 2WICA 4LV5B 4XRGA 2VLBA 2PUDA 3UK2A 3L79A 5IS2A 1KIMA 5HCUA 1I01A 5KOYA 2BKLA 3PFKA 4MI3A 3ZDZB 2OFFA 5I8ZA 5AW0A 2DR3A 1YS9A 2AVDA 2QUJA 4RU1A 5BQXA 4ZRDA 4I6EA 4B4OA 3EDQA 2BFDB 4OY3A 3W8NA 5CBPB 3PG5A 4BAZA 1MJNA 2CLHB 3EC1A 1PG5A 3KTOA 1KXJA 4JUAA 1W87A 1E63A 1H6AA 2X23A 3VOAA 1OGJA 2J46A 4DC0A 4WZ6A 4WK6A 2ZS7A 2D1TA 4RFSA 1ZMBA 4PXSA 1AHHA 9ABPA 1Y4DE 1EZ1A 1QK5A 3NHMA 3GQBB 5DE3A 3KYCA 4B83A 2OZVA 1Q3KA 4L8YA 4TKVB 1I1QB 5JAUA 2FN9A 4IRUB 1F0PA 4QOFA 4XZ3A 4NQZA 1JDJA 5FOUA 3WKBA 4JVLA 1VL2A 2GSDA 4D0LB 1JU9A 1A2BA 2QVGA 3DKRA 3NW9A 4Q05A 1POWA 4TLMB 4F96A 2HR1A 1OBOA 2R5FA 3H3XA 5K4GA 2QTMA 1CQIB 3TMKA 4B35A 4BKUA 2BAGA 1P81A 3HR7A 1VL8A 4GZ5A 4ND4A 5LLTA 1GTL1 3A9CA 4DUGA 1U7ZA 1A5BB 3MLEA 2XTJA 3B2QA 4MO2A 4RDHA 5ESDA 4QFCA 4RY0A 2V5VA 3EIEA 3F5DA 2I2BA 2LGJA 2OCYC 1HZZA 2XUDA 1QWSA 2PV0A 3HH8A 1O96B 3X1ZA 2C2MA 3KU4A 5HX7A 4UFNA 1NM5C 3VQTA 1E69A 3PFGA 5F51A 3MAJA 1K6JA 2AWNA 2IL1A 4J1TC 3N2KB 4XDYA 3CCBA 4C03A 3WIBA 4AJ9A 2IEDA 4G1EB 1KE1A 2RI0A 1YS2X 1DAEA 3VR4H 1KXZA 3M5DA 1ZL0A 1C9MA 4UHDA 5TB5A 3ZCQA 1KFJB 2CXSA 1SH7A 4R98A 1C3OB 3IR7A 4KLZA 1VBFA 2GZDA 1YUMA 4DCVA 4GOMD 4I6JA 4II7A 5AJHA 3RHTA 5TVKA 4CL0A 5IJ0B 1UK8A 4G5XA 5JEEA 2GETA 4C2AA 3E5HA 5FL3A 2M98A 1MOSA 3R3VA 1TE2A 4GLFA 5HCNA 1THZA 4WCFB 3TTVA 3AB3A 1NX6A 3ACBA 3F5QA 3FHTA 4H7PA 1U2RA 4GRDA 1WIWA 4KVAA 1H0RA 4XSGA 4PLYA 1Q77A 1BDIA 1JJVA 2ZW9A 4I9FA 5DM70 1W30A 1ENYA 2ZFUA 1NF9A 4AMGA 4XQEA 2CY0A 2Q1XA 4HXGA 4KE6A 4N47A 3KOWA 2VOEA 4BVEA 3EVEA 1GRCA 4EA6A 5I7RA 2XUFA 4ZXPA 3T9EA 3V7YA 4D3DA 4JXXA 7MHTA 5CJPA 2FMHA 3KT0A 2OMEA 4B3XA 3QSYA 1GGEA 2GVDC 2AZTA 3V33A 3FFBA 4NCJA 1F4VA 3AM4A 1EUCB 4DQKA 2VR1A 5BNWA 1E2DA 2DMRA 5BV2P 1ZDMA 3A2KA 1PLLA 4K3UA 1TM5E 3UJ3X 5AVQA 4DSTA 2BFBB 3F6RA 3CW2A 2YW9A 4N0EA 5EHGA 1XQ1A 2J3MA 1NVGA 2O8DB 1NQVA 2ZIEA 3U9LA 3H83A 4AKSA 4HMOA 1EWYA 1YR3A 1RQ2A 3QX9A 1ST3A 6ABPA 1HNWB 2QTWB 4MKGA 4TMWA 5FOQA 4MIKA 3L7DA 1Q19A 1XPUA 2NW6A 4EA9A 2FW7A 1F9AA 3OIUA 2G17A 3JQBA 421PA 1QIJA 4PPYA 3C2QA 4MR7B 5CVDA 3I9V6 5JO0A 2PR7A 4F2GA 1QHFA 3PQ7A 1ZMOA 4QPPA 4PONA 3NDIA 4HBZA 1B3RA 3P26A 4MUBA 4DTCA 4QGFA 3FNGA 2B2NA 4IM7A 4ZVNA 2Z1DA 3GJTA 3TS1A 3QXSA 2UYGA 3Q7EA 1N8NA 4Y67A 2B0CA 2WHYA 4NK4A 4C6TB 3GLKA 1SXJE 2N42A 4BPBA 3IFSA 3AKEA 3TOSA 5DH9A 3OM0A 3R5XA 4DNOA 4HVLA 4HZUB 3S1AA 1J90A 2E49A 5B6IA 2UZAA 1N7HA 4XH9B 2WHQA 2PU5A 1C7JA 1ENPA 3K6SA 4H59A 5JS6A 1PVOA 1PZMA 3BICA 3TECE 3ZVMA 1ZA1A 4HADA 4O08A 5LB2A 2Y4NA 3RJ9A 3U6BA 3D0OA 3GEGA 4HNAB 1KFEB 5G0TA 1G3RA 3UMCA 1PL6A 1XMXA 4IDHA 3TD6A 4B46A 1DKLA 2ZJYA 3L6RA 2YFKA 2YN2A 3KAPA 2QTCA 2ZWIA 3F7TA 3M2PA 2DH5A 3ZD7A 5CUQA 2UVQA 1DKRA 2XPCA 2EF1A 1IY2A 4YQEA 3DZGA 5C1IA 4WESB 3REOA 4ZK6A 1NFRA 3RSCA 1NFFA 2GZ3A 3FJYA 4RVCA 4JI7B 4R1SA 3I3SR 3EAGA 2RHMA 5AR1A 3GLFE 2X0DA 4FW9A 5CVUA 3HFGA 3UICA 2J59A 3IS3A 1XXHB 1U8YA 1S0UA 3WHLA 1GTSA 2GD1O 3HUTA 3GH3A 1KJ9A 2ZJ2A 5EVJA 5HZGA 1IB6A 5J9FA 5M2QA 2A1UA 1TCCA 1VQ1A 3MWKA 3HVKA 2O9JA 1E7QA 3I72A 3QP9A 4IV8A 2O7QA 3BM5A 2ZI5A 2GBLC 2ZYRA 1JJ7A 1T2UA 4RPKA 2ZK7A 1T1GA 3K05A 2WT8A 3IUBA 4WZZA 3I52A 1W47A 4V2IA 3V1KA 2BFEB 3WGOA 4AY2A 1Y8RB 1AURA 1BMFA 1KOGA 5HJ7A 1AGYA 3A9WA 4RCYA 1YB7A 1BMFD 1KFCB 1QC5A 1V5GA 2EYQA 4PC1A 5JDCC 4Z7OB 5KNCH 5ALXA 3ZDCA 2IX9A 5E95A 2QJTA 2CDRA 3KQQA 5CT8A 1NDHA 3RUPA 3VYUB 4WBNA 3VKWA 1UBGA 3EXFA 2C31A 1INLA 1SVSA 1NP6A 5F5LA 2W5UA 5SZJA 1Y3FE 2X3UA 2Y8EA 1SUFA 1KK0A 5D1HA 4EGFA 3V4PB 1L7OA 1R6VA 2LCQA 3T4UA 3KHUA 1E2HA 3R7LA 1RYEA 4UBMA 4XDZA 1YJCA 3PC2A 1JN0A 4JH0A 1UXOA 1J0DA 2BSXA 2FK7A 2PMFA 4HXEB 3DQQA 2FZCA 1KP9A 3O4GA 1TX4B 2FJUA 4J1TA 2D0OB 3QITA 4OK6A 4U7JA 1M33A 5FO0A 1TTPB 1K7YA 1DT3A 2VAVA 4HHEA 4CV2A 5JSZB 3LI2A 3IEUA 5A2GA 3BRSA 3I2GA 2FOXA 3E2MA 3N6XA 1PZNA 5IN5A 4D3FA 1LBHA 3AO0B 2V54A 3FPBA 5HKBA 3UWDA 5FBRB 4U2FA 3IULA 1ONSA 1X7WA 4G37A 3W8RA 1WHSA 1UJ5A 3L7LA 3G5AA 1QYIA 2ZIFA 3G2QA 2XWPA 3GFSA 5BR1A 2C92A 4ESHA 5KOHB 2W8BA 4N0QA 5JOQA 2B1QA 4FSHA 4G0UA 3OEWA 3RVLA 1WXHA 4BO3A 1T9CA 1NLYA 1XJWA 4FMDF 2IEIA 3W1WA 2FEPA 1LDEA 5DM4A 3CWQA 3OY2A 4UUMA 3PXGA 3T4PA 1SCBA 5JNUA 3A9UA 3KYBA 1JEEA 4F93B 4FGUA 1BJRE 3D2AA 4J16A 1A9XB 1OI3A 3VGJA 2ZYTX 1QO9A 4IIJF 3MUNA 5ED0A 3ON5A 1J6UA 2JFFA 2YHSA 3PIDA 4NAVA 3VU1A 4PQRA 4UEOA 4Z1OA 2PAAA 2ZS9A 4W9RA 1TM4E 1UOQA 2XNKA 4YAFA 3CPHA 4TYQA 1RWQA 1FUIA 4J0DA 3VX3A 3A4VA 3UOWA 3ZXYA 3H2JA 1RXUA 1USGA 2HMAA 3RAPR 1RXVA 1LSUA 1KYQA 3C24A 4CL2A 2GPWA 3PXUA 4M37A 4EPTA 1U02A 5D87A 2V96A 1XQWA 4ZFNA 2X5OA 3U1TA 4NBKA 1U7WA 4PO3X 4CFYA 5ESRA 3GC6A 1I4LD 1IEXA 4E2YA 3F46A 1QTNA 1Z4NA 2H5JA 3LP8A 5A2QA 2FPRA 3G0GA 5FLXA 5BOSA 2YR0A 2Z6AA 2BFFB 2CNDA 3M6MD 3EY4A 2QIPA 3A9SA 2QPTA 4DNFA 1UPFA 2ZJ7A 4B1FA 1Q1GA 1WDMA 4A0HA 2BTQA 3WTBA 4ZT2A 3RFVA 1H8HD 3WNDA 1NT4A 1E62A 4ARZA 1P39A 2BHTA 2WAOA 3EZNA 4EYQA 3C8UA 4LYDA 1SD1A 4NZMA 2EKLA 2WZCA 1V5WA 4IPTA 5DGTA 2CYBA 4B3FX 1FFCA 4PZ0A 5KQPA 2F3PA 4EO9A 5EIAA 1F3LA 2W2KA 3FX2A 5LA6F 1XR3A 5A3VA 1TNDA 1ORRA 1T29A 4RKYA 4QGSA 2QYHA 3KAQA 3V7WA 1KPIA 2PS9A 4H4DA 4GLLA 1G19A 4LJYA 4L5JA 2FFJA 4CYMA 4P7JA 5A7GA 3RCBA 4TV8B 3OF2A 4CQLB 4D96A 2AXPA 4XXHA 3L4BC 4BQNA 1HKHA 1TUBB 2ZBQA 4GXNA 1NX9A 2OG1A 4NMHA 1YQTA 1OIXA 1II8A 1V16B 4ND7A 4U2CA 2XT9A 3J7AC 3N9IA 4OA8A 4JT2A 1Q22A 2C57A 2V0NA 3ZWAA 5K6AC 5LDHA 4PYJA 1WPGA 3L7IA 5KYYA 5CH8A 4J6FA 5K3FB 2IF0A 3ET5A 3B6JA 4YP7A 4UE6A 1ZICA 4ZGGA 1G2OA 4FCTA 1NG1A 4H4CA 3K8YA 4WX2B 2Z1MA 4NV3A 1SHUX 4AJ1A 2W2LA 1YUNA 4ZVQA 5DHTA 5E6SB 4DANA 2EP8A 4EKGA 3R3YA 4EG8A 3OPYB 3UUGA 5EJ6A 5K0ZA 3WGHA 2VRCA 1W8DA 4ERXA 3UAZA 2N9UA 2QGNA 1V4BA 3IV9A 4MUXA 5CBPA 1VKHA 3SVZA 1SBYA 3VR2D 3TMAA 1QMPA 2JCYA 1PQWA 2WMOB 4PCAA 2FUNB 3DAOA 3FVWA 4I81A 3G8BA 3F6SA 1YGPA 1T9BA 2PUVA 1GOTA 1UKYA 2AIRA 2SCUB 4QUGA 1A50B 1Q7TA 3ZCTA 1TK9A 1FS5A 2A14A 3OOSA 3HCDA 5KNLA 1U0OC 2LCIA 1PGQA 4K5QA 4CN8A 1I0ZA 2ISCA 1W5EA 2VTBA 4Z4HA 3DWGA 4JI5B 4JIGA 3BRCA 1F5NA 2GEKA 4AM8A 4IAOA 4G1CA 2O3QA 3Q8WA 4RS3A 4DMMA 4K9QA 1XN4A 3OTWA 4PG6A 2WWVD 2CCJA 3GF4A 1LNQA 1NOKA 2FJPA 3HGTA 2XE7A 3JYPA 3QKIA 4KIUA 2CF5A 4WBSA 1X2EA 3PR1A 1U4SA 5AIAA 2A67A 3UYKA 2VHZA 3EZYA 1XTIA 4B3JA 5LFAA 2YIVX 3IODA 5BP7A 1GUZA 3UF0A 2H5LA 2ZTUA 1NUUA 3AB8A 3HFSA 4LTMA 2CXUA 5I9LA 2FN3A 4I8IA 1G5PA 2YOFA 3NPMA 5EXXA 1EQAA 3FYTA 4E94A 1IOLA 1PG2A 3QX7A 4H2DA 3QNWA 2FN4A 4YAUA 1N2CA 4GYWA 1SAYA 1UK9A 4NBVA 2HSWA 4WXRA 4E5NA 4WFQA 4FMPA 1CUJA 3D8SA 4DQ0A 2CLMB 4QTUB 1AC5A 2DFDA 2PG3A 3B8EA 2AJLI 1LDYA 2HBQA 4RULA 3HGQA 5TR9A 2XXAA 2WM9B 5MF6A 5CPFA 4CLOB 5CK5A 4Q1BA 2HBRA 4EL0A 1OTYA 3K0AB 1JR6A 2GF2A 3UY4A 1QF6A 1D6JA 4YLYA 3FB1A 1VPEA 2XX3A 1VLVA 2A9PA 2QRHA 1GEGA 2FQQA 3D5QA 4XEHA 2ZAYA 4YFVA 2O06A 2IUUA 5KNCA 2X5KO 1T91A 1V2HE 4Z49A 5IWAB 1G20E 1UXHA 1YZNA 3IUNA 3EGIA 3ICOA 4QXAA 2HF9A 1NUHA 3Q6MA 2PKWA 3KYIB 3QIVA 1BXRB 2MSCB 4LJRA 4FZJA 3TGLA 3WBBA 5KTPA 4UBKA 2O4CA 5D3ZA 2Q7DA 3ZDRA 3RBAA 3RT1A 2TRSB 3GJ0A 1IBLB 3O4IA 2WUGA 3GHYA 3QW2A 4R16A 4TMXA 3DA8A 2WD9A 1TZCA 3C3KA 2ZCVA 4WSOA 3AEKB 4G5SA 2UYYA 2DR2A 1EBBA 3MUFA 2Z3ZA 3CEHA 1GPJA 1KVRA 5D5QA 1ORHA 2XUIA 3NV9A 4N9WA 1RCFA 4XQ9A 2R11A 5AD1A 5DNVA 4EGSA 1MIHA 1VIYA 5HEKA 1PTJC 3Q72A 4M22A 2BGNA 5BRAA 4ZOLB 4LRWA 3BDAA 4XPIA 1I9CA 3Q0IA 2D1SA 1UKAA 4Q3LA 2Y67A 3D4NA 1LB1B 4GICA 3IE1A 3GDOA 5HVNA 3PDWA 4EJ2A 5JYDA 4KBYA 4BTVA 2VDPB 4YP9A 5THKA 3TIFA 2J0UA 3WL4A 4J2TA 3PGVA 1NY5A 2HU8A 2NSLA 5ADWA 1SCKA 2IZOA 1JQJC 1ZVJA 4W7IA 4Q9KA 5CK4A 5I51A 4C3UA 4KTVE 4DDMA 5B3LA 1NKVA 1RYFA 3OESA 1LV8A 4DZTA 1ZI8A 1EJBA 3VAZA 5KQSA 2AR0A 5IUKC 1QG4A 4IO0A 1LSSA 5H81A 4CMKA 4ZARA 1YL6A 2QM0A 1OFTA 1MAAA 3S8EA 2XITA 4US0R 5A03A 4JEMA 5LWHA 1ZBQA 3QVXA 2ZWAA 2KX7A 4PPFA 3RIHA 3K15A 4NU6A 1OXSC 4KHPB 3OKCA 4J3FA 3HNRA 4PWYA 3BB3A 4MA0A 4UNIA 3GX1A 3OCYA 3AKZA 2W4IA 4Z0PA 4WNYA 2M6LA 3IAS1 3R75A 2XMPA 2G88A 4HDMA 4DE5A 4J0CA 3QVJA 2R6DA 2J7PA 3PUWA 3PB3A 2OUIA 2V7VA 3T12A 5BVHB 1KORA 3EVFA 3QGMA 5H5JA 1JIVA 3R3XA 3AHGA 5CVJA 3AERA 2MYPA 4U6NA 1O9BA 4RPGA 3QI2A 4P93A 4QGHA 4TTPA 3LFHA 1JEAA 3TL6A 1YD7A 2YFYA 4YMLA 3PFNA 1KO7A 2RGCA 4PXAA 1R0CA 2SNIE 4I5IA 4RFVA 1NVFA 1GVHA 4NBLA 4NF2A 5IU6A 4JP3A 4O4JB 4A0GA 1H23A 1X8LA 4LYGA 3A9RA 3CRQA 1W48A 1P9NA 1RM0A 2N0SA 2RAPA 3LYHA 2PWBA 3MTQA 4MX8A 3TUIC 4ZZ1A 3BFPA 3L8MA 3EMVA 5AUPB 2QN6A 3O4RA 3AF6A 4DWJA 4ZQGA 4C7VA 4KGVA 4ZC8A 4YHBA 3KZ1E 1HSZA 1QUEA 3OPMA 3QOYA 4EBBA 3EPKA 4GL2A 4WLUA 4IDPA 4UJ5A 1K63A 4UUBA 3W2EA 1YR8A 1KEVA 4XM2A 3OEHA 1Z37A 1VHLA 3L4BA 3OQPA 2PX6A 3OIYA 4YUAA 4Q3AA 3GEEA 3GFRA 1UM8A 4GC9A 3T9AA 4OGKA 2Q8QA 5EESA 5AXBA 4CRWB 4CPDA 3SM9A 5JSUA 2YHIB 3IEPA 3AKCA 3GLTA 4E4YA 1NJ5A 2X2EA 3OPNA 5C2JB 1N2EA 4HZIA 3U81A 3ZQKA 1VZ2A 4HY3A 1W2HA 3O83A 4MV6A 3KWJA 4EJ6A 4R0MA 4GHWA 1KF0A 5KOJB 2D7DA 1EWQA 4FFBA 1QLJA 4XYLA 2Q8NA 4BZZA 4AZSA 3STUA 4EZEA 4YT2A 3UMSA 1W4LA 3EF1A 3Q7RA 3ZH9B 1K1EA 3IB6A 1FTWA 3L1IA 1GO2A 3HB1A 2MSNA 4K05A 2FFQA 3A3OA 3E7XA 5KTKA 1HFJA 1HLGA 1B4DA 1REQA 2VUSA 4P4NA 4Z54A 3QVGA 4EKEA 1VFPA 1YA8A 5IDXA 4CXMA 2PPLA 4ITRC 2GYYA 4DNXA 4E14A 4I1IA 4BXOA 1H2WA 2G72A 2QA5A 3RUEA 3PICA 4G5HA 2H2AA 4MQ4A 2B1GA 4EO4A 2BD0A 4KAXA 1IBCA 4L9RA 1DBQA 3ADKA 4O8CA 4R9RA 3O8NA 1FVHA 1XNJA 1J70A 1QM5A 2HA4A 2VJOA 3MF4A 1L5SA 2WC1A 2ZRMA 4OAOA 5IFKA 4FIZA 1QPBA 2C4TA 2FOLA 4H18A 3SVTA 1X9IA 4HP8A 1CUCA 2OV3A 3JQ8A 3RG2A 1JKMA 1WV0A 1SEVA 4GZMA 2J3KA 3DOFA 2BGTA 5LP6B 4FYXA 4A0QA 3JRWA 4L8GA 3AY6A 1PGJA 1N4DA 3R0VA 4Q4HB 4AJPA 4I46A 3IVCA 3IOCA 4Z7JA 3KJQA 2C58A 3D6MA 1QO7A 3Q7TA 3RUAA 2EGUA 1PBNA 1DX6A 3LD9A 5FUYA 3VKVA 4DG9A 1L5ZA 2XOKA 3I4CA 4UM9B 2C0PA 5IKEA 1UQTA 2O14A 3FIJA 3I5AA 3FDZB 2QX7A 3VC1A 4DJEC 1EFCA 1XMJA 2GJAA 2JEYA 2WNSA 5IBPA 4B6PA 4G84A 5JVDB 3L4KA 5DNEA 2B1JA 4LRUA 4UQOA 3CRW1 4MO9A 3PQFA 2ILTA 1UQRA 3AERB 1QYVA 4PYRA 2Y9MB 1NRIA 3QWIA 3FJOA 2E5FA 3FR7A 1CRQA 1KJZA 1QGDA 1ORTA 3FHOA 4ATNA 3JYQA 4HWSA 4TROA 5EZYF 4X85A 3N6VA 2IHNA 2Z5LA 1TMYA 2EERA 4TX1A 4LMAA 1JDTA 3KAKA 5CW1A 4ZYWA 4E12A 3CYFA 1PEKE 4Q21A 1UZAA 3VR3A 1E6WA 2Y6UA 1T3TA 1X0XA 2OY0A 5H4HA 1KQ3A 5KTRA 4KXWA 4Q47A 5ILGA 4MOWA 2Z2KA 1SEPA 1IU9A 1OFGA 2VYVA 2Z04A 3AILA 3AV3A 4FYIA 5B58C 5I3CA 3GOHA 3NCTA 4MV1A 2TECE 3E9RA 2XCTB 4Q02A 4K9OA 2QN1A 3UFBA 2BKAA 3D64A 1L7EA 2JCSA 4ME6A 1PUXA 5AKYA 4YV1A 5TEVA 2VWGA 5LOVB 1DAIA 1E5QA 3PA6A 5C8YA 3EMBA 3WIEA 4XR4A 3ZU4A 5HOQA 3ORSA 2COEA 2QI9C 1JEOA 2WYUA 4PX2A 6REQB 1JR4A 2OV1A 2YBDA 3I64A 3KG2A 1I1NA 5GMOA 2Y1LA 3R7AA 3CX4A 5HM6A 3O0TA 1ORIA 1E61A 3QEBZ 4D4MA 4P3OA 4LRTB 2WJ6A 3HJGA 3JCZA 5AKLA 3QH4A 1T1SA 5EWJB 5AM0A 1PSZA 3QVLA 1U6JA 4NE2A 3TYXA 4C7KA 3PKIA 1Q0HA 5J2TA 4FFLA 5IZCA 2ACKA 4JHXA 2O8BB 1DADA 4ZAWA 4H16A 3MCZA 3T5CA 2CUTA 5U1PA 2W43A 1XU4A 3B52X 2Q3FA 1XZKA 2IS2A 3VISA 2AQ8A 5LBTA 1IJFA 2PWPA 5JSYA 2R96A 5LPNA 1RFLA 2WFAA 2XAUA 2RHCA 5ICSA 2ZDHA 3PIIA 4H08A 5IAJA 1KETA 2W6MA 1QIKA 1YQ9A 5H8WA 3GHHA 1COWD 3RI3A 3SSMA 3WYAA 4DV0B 1Y5MA 3EFEA 3H6GA 2CJFA 4G97A 2YXPX 4Y2JA 4YJ2F 3KSAC 4ENUA 3LSTA 5BN4A 4PTLA 3ADCA 1NBOA 1Z2NX 1U4NA 5HZMA 4C30A 5JARA 1LVHA 1U04A 2V6JA 3I05A 3PCRB 4HB4A 4YFYA 2PAFA 3BERA 4EG7A 5FP0A 2Q2NA 4V0NA 3KHTA 3K1TA 3NB0A 5GOZA 5DW3A 3RYHB 1M5UA 1SVIA 4OHKA 2DFLA 5LB4A 4HDRB 4CM9A 1OJLA 5T64A 1LLUA 1EWKA 1F20A 1K3UB 2XECA 4HLUC 4ZO8A 4N3BA 2I8LA 3EF3A 4L8LA 1KMHA 5IXYA 2R25B 4ZN6A 5AM2A 1OWPA 3LKZA 1C7QA 3PQ3A 4OKSA 1V25A 3KKKA 4HH3C 1W1UA 4P5PA 2J3LA 1YR9A 3B1VA 5EJGA 3FYHA 4W99A 3WV4A 5L51A 1UP4A 4HDSA 4BNKA 1HR0B 3BOSA 2JGDA 3HWWA 4DCGA 4KMMA 1EA7A 4ZXFA 4OAQA 3WB0A 1DQYA 3B5EA 3KXDA 4QOSA 4WCFC 5SICE 3BK1A 1JXAA 1V5FA 1JHAA 1XE3A 2XZTA 1GUFA 1Z6GA 4UAUA 4HAUA 4NNOA 1BJTA 5KDLA 5CFLA 1U4OA 5ALHA 2CMHA 3IAAA 2L18A 1J8YF 4X64B 2EDAA 3DM9B 4R68A 1F3OA 4DW8A 4QYIA 3LX4A 3NC0C 1DE0A 2OGWA 2QLJA 4LMBA 1L7PA 4MH0R 5M29A 1RCTE 1TW2A 4MPTA 2I2AA 4YTEA 4FE7A 3KKOA 2GLTA 3EMDA 4AJLA 3FMVA 5D3KA 2BM8A 4QARA 1CUHA 4NMWA 4OYYA 4U7TB 1UBRS 3HYCA 2QORA 1ZVKA 4AP5A 1URPA 4WGGA 3BIJA 3M1AA 3PC8C 3VI4B 3AUFA 3VA7A 4IIHA 5CFRA 3QYPA 4B6SA 3H16A 4TM8A 1V41E 3TZLA 2QUIA 4WEOA 3MWYW 2PMEA 1ML3A 2IOHA 1EXMA 3LXMA 3LY7A 3F4BA 1AXGA 3CG0A 3AEKA 4P83A 5TRTA 3P32A 4BLQA 4D43A 2IDKA 3HN7A 2X2FA 3LC7O 2HIGA 1EVQA 1MP0A 2H7VA 3O75A 4R1LA 1KY5A 1Q0LA 1RXYA 4FDMA 2SICE 5I3ZA 4RDCA 5EFOA 5KWIA 2P4UA 2JFPA 3IKJA 5DJ5A 2IPXA 2IS6A 3V34A 3O5AA 3PHCA 2BFPA 3NJ8A 4GOOD 1KYYA 2CDAA 4HQFA 3LNCA 2JPDA 4JJGA 4EFKA 3ZXXA 2BEUB 3BG5A 1AGXA 4FE4A 2ZYAA 4HNHA 4IQ0A 1ADGA 3C3BA 4LF6B 1IXZA 1R4MB 1TCUA 3DC7A 4D0NA 1Z0KA 3PKZA 4DY6A 1NXSA 2J3JA 1H2YA 3JSAA 4H0CA 2IJGX 4O0MA 3W5VA 1C1DB 3CVJA 3HZZA 2O07A