1USWA

Crystal structure of ferulic acid esterase from aspergillus niger
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
260
structure length
260
Chain Sequence
ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPADEGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Feruloyl Esterase a from Aspergillus Niger Suggests Evolutive Functional Convergence in Feruloyl Esterase Family
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
molecule keywords FERULOYL ESTERASE A
total genus 84
structure length 260
sequence length 260
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uswA00
2QXUA 2O2GA 4L9AA 3A6ZA 1CUFA 3I2IA 3F98A 5ALRA 3I1IA 5JASA 5JATA 5KWJA 2RONA 3WI7A 3RARA 4MJ3A 5FP0A 4MXDA 5JIBA 1K63A 2OGSA 1JMKC 5HF5A 2QUAA 2HU5A 3EBLA 1DX6A 3KOOA 1MNAA 1TQHA 1HPLA 5CBKA 2VT6A 2XUOA 4MEBA 4KRXA 2J4CA 1MX5A 3R40A 1B6GA 2NW6A 2ACEA 1I6WA 5EIAA 5D7BA 4C4ZA 4UUQA 1UT6A 2RAUA 2B9VA 1ZGCA 3WQHA 3WKDA 2K2QB 3IDAA 1LPOA 1YAHA 3OURA 4CCYA 5ALIA 3K6KA 2WJ4A 2VT7A 4QWWA 4GW3A 1WHSA 3PUIA 2WIFA 2Y2VA 1KU0A 2BUBA 2WFZA 4QDXA 1ZI9A 3QMVA 4ZV9A 1ODCA 1UKAA 3S2ZA 5EGNA 2EEPA 1QE3A 1XZMA 4BRSA 1ZICA 2JIDA 3RKSA 4RNCA 3STTA 2QRUA 1W52X 3LP5A 1EDBA 2GYVA 4XIIA 3DYIA 3SK0A 5D3KA 4B80A 5JYCA 5I8PA 1Y37A 3WWEA 4KAFA 3ANSA 2ORYA 2ZYIA 1Q84A 4ZI5A 1LGYA 1USWA 5ALMA 1UK6A 5JD5A 3MUOA 3W05A 3PFBA 5CT9A 2D0DA 1QOZA 1UOOA 2HFJA 3C6ZA 1FJ2A 4ZV7A 5ALYA 2RGUA 1TRHA 1W4LA 2OCGA 3STWA 4U2FA 5AKHA 2Z8XA 4EY5A 2XUHA 1A8UA 3PF9A 1CUEA 5AK6A 1LPPA 3C87A 2WHPA 2PSHA 5LZ7A 1UK8A 3DL4A 4B9AA 2WFMA 3WL6A 4BDTA 2C5GA 3YASA 2ZVDA 4W63A 5I7UA 4HTAA 4H18A 1L7RA 3I2HA 2YASA 4M0EA 1EB8A 3DS8A 5HF6A 1MAHA 2VJBA 1XZJA 2XQKA 4BE9A 3IBTA 1TAHA 2WUDA 4WFJA 5ALTA 2JF0A 3ANTA 1U4NA 1AGYA 2JGEA 5AM4A 5D6OA 1XLVA 3GA7A 2CBGA 2VQ6A 4FHZA 4BC1A 3M82A 3G7NA 5ALEA 2WKWA 1YS2X 2DQZA 5E2IA 5T4BA 4ZGBA 2VAXA 4KRYA 4B81A 3VISA 2H1IA 5JAOA 2ZSIA 4LXGA 1EHYA 1K6EA 4L3WA 2XUGA 2Y1KA 2XQIA 1H2YA 2PSDA 3IB3A 1DT5A 1A7UA 2I3DA 5K3CA 4S0XA 1ODTC 1XZIA 1YA8A 4PF1A 4KAAA 1E8NA 4CIAA 3WYNA 5SYMA 3DLTA 3D5EA 4XWGA 3R3VA 1MTZA 1XRMA 4Q3LA 5ISMA 1W76A 5CXXA 1EDDA 3WK6A 4ZRDA 3STUA 3RK4A 3ESCA 3DOHA 1VXOA 1CLEA 2HA0A 4AQDA 1JMYA 4CI9A 2WG2A 4Q82A 3AIMA 4OSEA 4Y9SA 3C43A 1LBTA 4N5IX 1ODSA 2JBWA 3W04A 4C4XA 2HA7A 3OG9A 1AKNA 4BP8A 4GDMA 4B9EA 5DTIA 1ACLA 2Y6UA 5CH5A 1ZJ4A 1KU6A 1MNQA 3QVMA 5DNUA 5AKZA 3IUNA 1K5PA 2HDWA 1WCYA 2GYUA 3LLCA 3H04A 1AQLA 5LZ8A 4B82A 1XKTA 2X8BA 4GXNA 2IIVA 3E1GA 2WHQA 1GPKA 1EDEA 4K6HA 2ZJ6A 3JYHA 3QITA 2EDAA 3DJYA 3D0KA 4WY8A 5LIPA 1Z68A 2CEKA 2WUEA 4G4GA 1GGVA 3I6YA 3IUJA 4WY5A 2OPHA 1YCDA 5AK3A 4UBKA 2O2HA 1MO2A 5EHNA 1GKKA 1EA5A 5ALVA 1C4XA 5IKXA 1XRLA 4RPCA 5IVDA 4DNOA 1H23A 2XI4A 2HU7A 4X00A 1HL7A 2WU4A 4DNPA 4H77A 2DSNA 5EIEA 3HRHA 5AKLA 4DMHA 3VVLA 4AO8A 2QR5A 3QBJA 2ZJFA 3OM8A 4AO6A 3G9UA 1QFSA 1VE6A 5HF8A 1IMJA 1QIGA 1ZJ5A 2H7CA 2Z8ZA 3IIIA 4QDTA 3WA7A 4EY4A 5FOQA 3PUHA 4MQLA 2XUFA 5HQ3A 4OD0A 3OOSA 3WKAA 5YASA 2CMFA 2V9ZA 1CUGA 3HEAA 4QEKA 2AJDA 4BDSA 1JJBA 5DNVA 3ZLVA 2PU7A 1EK1A 4WJLA 3F8SA 5FDFA 4HXFB 4ZREA 1MX1A 1FFAA 2XMCA 5CT6A 5AM3A 2HL6A 3DKRA 1L7QA 2QUBA 5CH8A 4JYPA 4J0DA 5C7YA 3BDVA 2ACKA 4MEAA 4PW0A 4Y2PA 1G66A 1VZ3A 3O4IA 2B4KA 4A23A 4OPMA 4ITVA 3GBSA 5JADA 3W9UA 2HRQA 3PFCA 1VOTA 1CUHA 1QIEA 2WFLA 1YASA 2WTNA 2CZQA 3BJRA 5CW2A 5CT5A 2XMBA 5C81A 4X85A 3D7RA 1QFMA 2XUIA 1WHTA 1UXOA 2W22A 2OLEA 4W1SA 4G8CA 1ORWA 3TGLA 3PE6A 4B0OA 4FLEA 3IUQA 1WB5A 2VEOA 3D2BA 5K3DA 1VXRA 4HRXA 4H7HA 4MYSA 4LIPD 2H7YA 4PNZA 4ZWNA 1ETHA 4CG1A 2JGIA 3C6YA 4J0KA 3O4HA 2FUKA 1Q0RA 5IH7A 4C87A 3QPAA 1CUAA 5JAUA 4X92A 1UZAA 1BEEA 3B3QA 1ZI6A 1FFBA 2RHTA 1C7IA 5FKJA 2QS9A 5AP9A 2P8SA 4Y2UA 1GXSA 3E0XA 4H0CA 5E4YA 1P0PA 4U2EA 3H2IA 1BCRA 5E4JA 4O08A 4EY8A 2OGZA 5AK4A 2G5TA 4D9JA 3B5EA 4K5QA 3WWDA 3WYDA 3V9AA 3W2TA 4EB0A 3WWPA 5AI6A 5DLPA 5ALQA 2JGLA 1FFEA 4H7IA 3BF8A 3BXPA 4FNMA 3A2LA 1HLGA 1JJFA 4UPDA 1U2EA 2XQJA 7YASA 1LZKA 4FMPA 1UOQA 4FBLA 3WL5A 3K2IA 4B6GA 1QIFA 3G02A 4BZZA 1UK7A 1W1IA 4Y2SA 5CT4A 1W75A 1XZHA 3R41A 2PM8A 1MAAA 1JKMA 4C4YA 1ZOIA 2ZSHA 3E4DA 2QKYA 1SCQA 3G0BA 1ZI8A 4Q3OA 4Q3KA 2ONCA 3KDAA 3V1MA 4OU5A 2WUFA 3G9ZA 5IVHA 3JWEA 4OYYA 4PO3X 4UBIA 1UOPA 3KSRA 4BCBA 4FOLA 2BCEA 5FXMA 3QPCA 2XDWA 4P08A 3OC0A 2WIJA 3F97A 5A2GA 1JU3A 4RE6A 4G8DA 1YSCA 1W6RA 3WK8A 3BJMA 3H1BA 5CTAA 5JZBA 1U8EA 3C45A 1XZDA 5AI5A 2PUJA 4DIUA 2DFPA 4LXIA 2XUDA 2IITA 3HABA 5AKEA 2XQGA 1D07A 4AMZA 4EUSA 3WJ1A 4B0PA 3WZLA 1TCAA 3GFFA 1ZIXA 2RHWA 1FFDA 5AI0A 4FLMA 1JI3A 3C5WP 3FOBA 4INZA 4KR0A 5ALJA 4Y2JA 4M0MA 3G0CA 1IUNA 2OCIA 2O7RA 3D59A 1GT6A 3WZMA 4GWLA 3ED1A 3I6ZA 2QZPA 2XMSA 2XUKA 3I2FA 4W1PA 4AZ0A 4V2IA 2WJ6A 2BUCA 5K3FB 4AMYA 4YX9A 2GBFA 2BKLA 1XKLA 5A6VA 2XMRA 5ESRA 3O9VA 4KE8A 2ROQA 3FVTA 5AM0A 5ALGA 3BWXA 4UHHA 1EXWA 2C7BA 5J3JA 4YK7A 1XZCA 4B83A 2BGRA 3X3HA 4BCCA 4IH9A 2AJLI 2GBIA 2XUPA 1XLWA 5AO9A 3N0TA 2XLCA 1O6FA 2V97A 3I28A 4Y2YA 1QIMA 4MQMA 1WB4A 5AIAA 5HCUA 2FJ0A 3O0DA 3WK4A 1PV1A 1ZIYA 4ROTA 3C6XA 3VDXA 1DQZA 1HQDA 1P0IA 2RIPA 4BAZA 5ALXA 1CR6A 2GBCA 5FUMA 2OAEA 1CQZA 1A88A 3KWJA 4WDRA 4FLFA 4C6HA 1BROA 1R9MA 2G63A 4UBJA 3SWWA 3L1JA 4X71A 4BBZA 3FLAA 3F67A 1VE7A 3FYUC 5AIBA 3WL8A 1P0QA 2BGNA 3SX4A 5D3ZA 1LNSA 3AZPA 2J3QA 1QTRA 1X2EA 1EB9A 3CN7A 4J0CA 4Q05A 2WG1A 4Y7DA 2XUAA 1YB6A 4OCZA 3WMRA 3DDUA 4BRZA 2DR0A 4U2DA 2G4LA 2Z3WA 1TKRA 3V48A 3C8DA 4C89A 4Y2QA 1SCIA 1AURA 5ALLA 3ZPXA 3ILSA 1UKCA 1E3QA 5E4TA 3FYUB 3EQ8A 1NU6A 2H9YA 1QIHA 4X91A 3M83A 3FLBA 4G9GA 1N5MA 3DOIA 4AZ3A 1P0MA 2WU3A 2DHDA 3M81A 3ESAA 3I2KA 4UFPA 3TJMA 4MWSA 4J7AA 3C8HA 3KD2A 1QIJA 1UFOA 1SOMA 1QO7A 1ZD4A 2QOEA 4IHAA 1TCBA 5KBYA 5KWIA 2JGFA 1XQYA 3CXUA 4X90A 1MX9A 3V1LA 1QJ4A 1GZ7A 4U2CA 2CJPA 1XZEA 1EH5A 2ES4A 1YA4A 4H7FA 1ACJA 4X6UA 1CUIA 1DWOA 4BB0A 3WA6A 5LKAA 5I9IA 4GEGA 1DT3A 4BATA 5AI4A 3B12A 1AC5A 1F0PA 3H18A 1H2XA 1F8UA 4OB7A 1WB6A 3CN9A 4Q1VA 2Z3ZA 3STYA 2PBLA 2AXEA 3Q0TA 3G9XA 4G9EA 3ZLUA 4AX4A 3BIWA 1JT2A 5AM1A 2PSEA 5LZ2A 1CUJA 3TRDA 1B41A 2OGTA 3TEJA 4J0IA 1CPYA 1G42A 1VA5A 4J03A 4G1FA 4BP9A 5ALSA 2FJPA 3FNBA 1WM1A 1CUWA 5EIHA 4TPKA 2I03A 3HYSA 5JD6A 1BS9A 2Y2UA 4F5ZA 5ALZA 2EDCA 1DTEA 5LP1A 2ZYSA 4MYDA 1IUPA 3FAKA 4HXEB 2XMGA 1R4ZA 4NMWA 3I2JA 4PV7A 1K4YA 1X2BA 5LYYA 1Q0ZA 1THGA 3PF8A 3A2NA 2E3JA 4GHWA 5AKYA 4UHCA 5BOVA 1BN6A 3WL7A 4FNGA 1MU0A 3LIIA 4BTVA 1OXMA 3S8YA 1WOMA 4Z49A 2J4FA 1Y7IA 5JAPA 5H3HA 3WIBA 4GI1A 4FFVA 2O2IA 4Y2TA 3BDIA 4X94A 1ZD5A 5BV7A 3E3AA 5DTJA 4Y2XA 1RWQA 2GZRA 2HM7A 4X6YA 1CEXA 4IO0A 3GZJA 1HDEA 4G4IA 3FCXA 5AI9A 4E14A 2PX6A 2HA5A 1CQWA 1CUUA 3NWOA 1QGED 3IVMA 4PSDA 3NUZA 5EHQA 3WJ2A 1LBSA 5JAHA 1XZAA 3WWOA 4FWBA 4TGLA 1RP1A 4KE9A 3LS2A 3NGMA 4G4JA 2WG0A 2O7VA 1ORVA 1VKHA 3UUEA 2JGKA 3OPMA 4UHDA 2PKYX 3O95A 5K5EA 1GPLA 3H2JA 3IUMA 2HIHA 2HU8A 1PFQA 3DEAA 4CCWA 3IULA 3VJKA 4QLOA 4Y2VA 4K6KA 1CUCA 4X3CA 1QIIA 4QWMA 3D2CA 1EVQA 1THTA 2JGMA 5CURA 5BWCA 5BWBA 5HK9A 3AILA 4A16A 1S8OA 4CIBA 1E8MA 2QJWA 4EY7A 2WLSA 1IVYA 5AKKA 4HZGA 1DWQA 2R11A 4UBMA 3G0DA 1WPXA 1XROA 3R3YA 1XQWA 1OILA 2QVBA 3T52A 3ICWA 3ICVA 1XFDA 1J1IA 3VVMA 3D3NA 2PU5A 5HKAA 4ETWA 5ALNA 2I78A 3AINA 1DU4A 4QDOA 1LPSA 2X76A 4BAUA 1NX9A 4H7JA 4XVCA 2AJBA 2R8BA 4OB8A 4DGQA 1R3DA 3U1TA 4AN1A 4L72A 3FCYA 4BC0A 4G8BA 4OUKX 4BVJA 2PUHA 2FX5A 3HJUA 4H7DA 5CH3A 1MPXA 3FSGD 2WQZA 3STVA 3H17A 3T4UA 4DTCA 1AMNA 2YH2A 1BRTA 3ZWQA 5A7HA 1R50A 1KEZA 4B84A 1OCEA 1ISPA 3VKFA 3Q8WA 2I3ZA 5CRIA 4C01A 4KYVA 5AKIA 5HF9A 3L1HA 1A8SA 5JANA 4DSZA 3G8YA 5JZSA 1SCKA 5HZGA 3MGAA 2PVSA 1MJ5A 4F21A 2XMDA 1VLQA 2ZYRA 3QZUA 1DX4A 3MVEA 1XRQA 3ZI7A 3FYUA 1CUZA 1CUYA 1LPBB 3D2AA 4BTLA 1F6WA 3V1NA 1UKBA 1BEZA 5JZ9A 3VJLA 4DYHA 4KE7A 5A71A 3WLAA 1AUOA 5AM2A 1H2ZA 1SFRA 4FKBA 4U2BA 4CG2A 1UK9A 2OAGA 5DNWA 1BE0A 3I6MA 1IUOA 1QZ3A 3HC7A 1AZWA 4FBMA 1ZD3A 1CFJA 4WCVA 3WKCA 4F60A 2WIDA 4E15A 1M33A 1CUBA 2VJAA 3A70A 4EHBA 1EX9A 1GKLA 4GLBA 3AIKA 4EZIA 1G5FA 2C58A 4BCDA 3R3UA 1LLFA 3GROA 4QA9A 2C4HA 4EA6A 2QTBA 1XRPA 2XQFA 1QONA 3C5VA 4JH0A 1J2EA 5KREA 4DMCA 1BU8A 5CMLA 4BAGA 1XZLA 3M3DA 2AJCA 4OU4A 1R88A 2XLBA 4QDZA 4QE3A 4DLNA 3H2GA 3H19A 5AKXA 2LIPA 3EQ7A 2WM2A 4NVRA 4Q34A 2VAVA 6YASA 3MUNA 3PI6A 3WK7A 3BL8A 4QNNA 5AOAA 1DWPA 2OQVA 5DYYA 2BUAA 1RYYA 5A62A 4UBLA 2HA4A 3KWFA 4XX1A 4BVKA 1O6GA 4HS9A 4WDQA 3WKBA 1CIJA 2DHCA 1BN7A 2JEZA 4ZXFA 5ALUA 3BIXA 1EINA 3F96A 3FBWA 5FV4A 4UHBA 2UZ0A 4N5HX 4HAIA 4A5SA 4UHFA 1GQSA 4UFOA 5C8ZA 4YASA 3QH4A 2DQYA 4J3JA 3QYJA 3G0IA 4EBBA 4X97A 5AH0A 1QIDA 4P93A 3N2ZB 1H22A 1YS1X 4L0CA 4P92A 1AX9A 3O4GA 5ALPA 1GQRA 2XUJA 3BE8A 3DD5A 4WFIA 3WIOA 2HA6A 1XRRA 3QM1A 1XRNA 5FRDA 1QO9A 4DM7A 3R3XA 4QLAA 1E66A 1T4MA 2VSQA 2WSLA 3AJAA 3I2GA 1TK3A 2JGJA 2D5LA 4GBGA 5FPPA 4WFKA 1JFRA 3PICA 2ECFA 2XMQA 3VJMA 3BF7A 2WFLB 3OTQA 1YB7A 2VJCA 3UUFA 5ALWA 1MN6A 1QTIA 1ZGBA 3HXKA 5DWDA 3F9CA 4PSUA 3O9MA 4LYDA 3C6BA 4KEAA 5A7GA 4J0HA 1JJIA 1Y7HA 1IZ8A 1J07A 1R9NA 4UBNA 3WK5A 5ALFA 3R3WA 1CUDA 2VA9A 3P2MA 5EHZA 5AHXA 2H7XA 5K3EA 1E8DA 1VJ5A 3STXA 5F4ZA 2DHEA 4LHEA 4OYLA 5LZ9A 3H1AA 5AK5A 1X70A 3DKKA 3AIOA 4X7BA 4J0JA 4H7EA 1CV2A 4M0FA 4HVTA 2ZYHA 4U2GA 5JARA 1LPAB 2QXTA 4KJXA 3VXKA 3HZOA 4ARAA 3V1KA 2HA3A 5DJ5A 1XZBA 5DYTA 2C0QA 2CUTA 5AM5A 2RI6A 2CB9A 4ARBA 1CUVA 1N1MA 4LYEA 4FFWA 2YXPX 2WJ3A 2B61A 1QIKA 5T4FA 1N8SA 1XZGA 1HBJA 3NOXA 5DYWA 3RLIA 4AXBA 5K3FA 4C88A 1LPNA 1DINA 4GECA 5A7FA 1E89A 2BAGA 1ZD2P 2V98A 2WHRA 1XQXA 3DL7A 1FFCA 1YAJA 4N8DA 3HI4A 5AJHA 4AB1A 5T4EA 1DQYA 2PSFA 1G4HA 1GPNA 3IURA 4H7KA 4JNCA 1CRLA 4HXGA 3AZQA 4MWTA 1FSSA 4CG3A 2HADA 4HRYA 2HRRA 1LZLA 3WKEA 2V96A 2BJHA 2J3DA 4BVLA 5IVKA 2G5PA 4EY6A 4K6GA 5HFNA 4J0GA 4UHEA 5EFZA 3R3ZA 2WIGA 3RM3A 4TVKA 3JW8A 4IH4A 3C70A 3QMWA 5FLKA 1MT3A 3H2HA 1VZ2A 2IX9A 2HA2A 4LKOA 2HFKA 2XT0A 3EIOA 1TCCA 4DSAA 5HKBA 4JYMA 5LZ4A 1EK2A 4I3FA 2XUQA 1T2NA 2HHAA 3GUUA 3DYVA 3HSSA 3K9BA 2QM0A 1CUXA 3LIPA 2WUGA 4QDUA 3FVRA 5EHXA 3U0VA 1R1DA 1SC9A 2X5XA 4RE5A 2PSJA 3ESBA 1EVEA 4XJVA 4DNQA 3H2KA 5JD4A 1TIBA 3ZLTA 2XE4A 2VF2A 1EI9A 1PJAA 4FDMA 3CCCA 1J06A 3R0VA 2DCMA 2PL5A 3QMMA 5HQ3B 4B7ZA 4BZWA 2VATA 3EQ9A 3AZOA 5K3AA 2OCLA 1BCSA 5LKRA 3UMJA 5CT8A 3G9TA 1CUSA 3D4LA 3W06A 4JEIA 4E46A 2Q0XA 1Q83A 4NZZA 3I1YA 3A2MA 2OCKA 2GYWA 2GBGA 2WHPB 4X6XA 3QPDA 4AO7A 3O4JA 3SC2A 1WPRA 4BYMA 2Y6VA 5ALHA 2WILA 4JUIA 2PPLA 5ALDA 4X95A 4KACA 3IA2A 2B20A 1JU4A 1VA4A 4DMKA 4UBOA 3H0CA 4H35A 2JEYA 2XB6A 5SYNA 1YR2A 2Z5GA 1L7AA 4X93A 1HKHA 1F0NA 1UWCA 4LXHA 4Y2RA 4G5XA 3DQZA 3CCBA 3FYTA 4W1RA 4IQ4A 4N8SA 1IZ7A 2OXEA 3WWCA 3FWHA 4PSCA 3FSGA 5FPQA 2YYSA 2VJDA 4AN0A 1NU8A 2WTMA 5AOCA 5IVIA 3PDCA 1XZFA 4OB6A 3GELA 4BE4A 1LPMA 1U65A 5HK8A 2AJ8A 3WK9A 5LLSA 1XLUA 5ALOA 2WIKA 1A8QA 4E11A 2BFNA 5AI8A 5AKJA 3W9BA 4UFNA 2VTVA 4NS4A 4N8EA 5K3BA 3HACA 5C8XA 3DNMA 4I4CA 1N5RA 3AFIA 4CFSA 2XMZA 5JALA 2QJRA 4DNFA 4IH1A 1XZKA 3LCRA 2OQIA 5AOBA 4B85A 4QZVA 2W6CX 3AUKA 3HLKA 1XQVA 4KE6A 5CXUA 5AICA 4FTWA 2QT9A 4I19A 5HFAA 5EI5A 2C5FA 5LZ5A 1QLWA 4RGYA 4F0JA 2ZJ7A 1E5TA 3ESDA 1K8QA 2QMQA 3ZV7A 5ALKA 4DMFA 2CKMA 3EF3A 3L1IA 4P9NA 2GZSA 4PQEA 5AKGA 4K2AA 4CCYB 3KXPA 3FLEA 2OG1A 1C7JA 1H2WA 5T4HA 4YPVA 5C8VA 4W1QA 4W9RA 1CVLA 3DCNA 2C0PA 3G0GA 4KAJA
chains in the Genus database with same CATH superfamily
1X39A 2XTNA 5IP5A 1DBPA 1EFPA 1Z6ZA 2QXUA 4LFCB 4L9AA 3JWIA 4JJGA 1LSJA 3L8CA 1IPHA 1ENZA 3VR4A 4PLFA 1FDRA 4XRRA 4DCPA 2F8SA 2PWYA 3NPAA 3F98A 1RC8A 5FEUA 1CEYA 3KKEA 2UYCA 4HEHA 1D03A 4EJ0A 2QP4A 1HYQA 5KWJA 4KHZA 3QWAA 4KQGA 1OU0A 2V0NA 1SUFA 1USGA 3RRJA 5JTTA 1PFUA 3D4PA 5DBEX 1NQ5A 2QENA 3T3DA 4BKMA 4M8NE 2OGSA 4H3SA 4RJIA 1JLKA 4E3WA 2BBTA 2WAAA 4ML3A 3ZDXB 3R0JA 4HFMA 4F11A 5KNBH 1H4TA 3OTGA 4AJKA 3FWKA 5HF5A 3SBDA 2OXRA 1V5FA 1M8FA 3DL2A 2EJUA 1NI4A 4PO8A 4RW0A 3ZHXA 4Q4LA 1TQDA 2JIQA 3KCNA 4ZVSA 2DH6A 1RLTA 3BBLA 5FOXA 3VTFA 1DX6A 2QG4A 3AM3A 3SHFA 221PA 1BAPA 4K9NA 4BNMA 4KV9A 3I9MA 1L8XA 5HMLA 4F4IA 2F1RA 4HCJA 4CDGA 3LC7O 3ZV5A 1U1DA 3TSCA 4EHLA 1U3DA 1TTPB 5E6RB 3CH7A 4L1KA 1GZHB 4X1YA 2QTNA 2FFRA 2PGDA 2R5NA 3O3NB 1U8YA 4MB2A 4OGFA 4ZC8A 2CUNA 2FSVC 4HD8A 1Y6RA 4N6GA 4BJ5A 4ENVA 1SNYA 3MFYA 4OH1A 1QV7A 4LHXA 2AG6A 5JXJA 3W8NA 3R40A 1UXHA 4CIYA 1Q0LA 5BN4B 4BCDA 2E82A 1VCHA 2NW6A 3H3XA 2ACEA 4MKXA 1NDQA 1XF1A 2A7QA 2PZFA 3PC3A 3IVXA 1KQPA 2A14A 5EIAA 4J4HA 3NJ8A 4ZT2A 5F7XA 3KQNA 4UUQA 4ND2A 1UT6A 1T3HA 3D3JA 4OJYA 3ZH9B 4HZUB 4WX2B 4BPRA 2FJUA 1CDZA 1I30A 1VYHA 3LPDA 2YS6A 3RFCA 4BNDB 3ANNA 1Z2AA 3N8HA 4QUHA 4PRYA 5DOZA 1DCTA 2HO5A 2ZE5A 3P9NA 3B6MA 1LPOA 1YAHA 3OURA 3LCCA 3PVCA 4WVLA 5ALIA 2WJ4A 3OLYA 3OMXA 4MLZA 4QWWA 1M1YA 4GW3A 4KO1S 3PUIA 5I4BA 1V6AA 1E5DA 4GL4A 4NCXA 3CC8A 4X1OA 3TSOA 4PN7A 1OC4A 1JIUA 1E1YA 1EHIA 1D3AA 1V1JA 2BUBA 4DG5A 3U5ZB 3T34A 1ZI9A 4RFSA 2DBYA 4YY3B 4ZV9A 1CLUA 3O8RA 5EQJB 3P0EA 1OUMA 4YRRA 4B45A 1UBJS 4TQGA 3O84A 2FWPA 4LVOA 3S2ZA 2IDZA 4LDQA 1B93A 2B8WA 3DULA 1XZMA 4PHGA 4RVUA 4CVNA 5LDHA 3EMKA 3PUJA 4TVOA 1E1RD 3QOFA 2ZM5A 3OZWA 4ZYLA 3PUWA 3BULA 3ZIAA 4PHCA 1SC4A 2C2MA 1K9VF 4E5SA 1GFIA 2GEUA 2XNCA 2W2PA 5E6UA 2HZBA 1JDPA 1GLVA 2FZCA 4YRIA 1W52X 2L17A 2Q45A 1H4SA 4PVCA 3DYIA 3H2YA 4IOKA 5EJGA 5JYCA 2IYQA 1S6YA 4HYQA 4WQMA 3CRRA 1Y37A 4OXNA 4ZVLA 3UT5A 5I8PA 1S01A 2BOVA 4NJEB 4PZZA 2FB9A 3DVQX 4QU8A 5GAJA 4KU4A 2P2NA 1F2VA 3WGNA 4A2WA 5ITVA 1DC4A 3LK7A 3D1JA 2WR8A 4BVEA 4IX1A 1KDPA 5K7SA 1U8XX 2RIRA 1JFTA 3GJ8A 4DIOA 1OI4A 7MHTA 4NFLA 3S1SA 2AEFA 2LDBA 4JB2A 3K2BA 3ZE7A 4R0MA 5JD5A 2D1FA 1S7GA 3MUOA 4PSKA 3PFBA 1AKEA 1E62A 1PL8A 1SOVA 1MD9A 1UOOA 2H65A 2HFJA 2JI6A 3C6ZA 4MVJP 5J47A 2NU6B 1XO1A 5KTYA 2JH8A 2FSPA 2P9CA 5ALYA 3JV7A 2RGUA 2FSVA 3H5OA 1SUCA 3TMYA 1TRHA 5FWYB 4F3RA 3STWA 4M0CA 3WYEA 3NDPA 4N48A 4XWTA 3DFFA 5D87A 2R7AA 2F8LA 2XUHA 4K9QA 4F6RA 2HK6A 3NHYA 5E95A 4LJ4A 2P0YA 4ZT6A 1CUEA 5AK6A 3GAAA 3WSTA 4OUDA 4REQA 4B8YA 1HEIA 2LVBA 3D7LA 3PZBA 1EUYA 5CB4F 4L0QA 1UADA 1T5OA 2GDZA 3CH6A 4Z3KA 4KWCA 5L3QA 1U1CA 4KI7A 2GFQA 2CB0A 3WMXA 2CJYA 1NMXA 2CNDA 2IGTA 2ODEA 3KB6A 3I5XA 4TLMB 3H8WA 3IHWA 2HRDA 2PSHA 4BS9A 4ZP1A 1K8YB 4G5YA 5EFOA 4L15A 2A2ZA 5AOVA 1J5PA 1XTJA 2J6HA 4BDTA 1GSAA 2N0SA 1NW7A 4IGEA 3YASA 1U0GA 3ZE2B 4DDTA 3R6TA 3ZR4B 2C78A 1KQGA 1YK1A 1JDNA 4LY3A 1LK5A 3SJAA 5CVTA 2AZ4A 2GKGA 1ULAA 2YIDA 4H3KB 7AT1A 5ICEA 5I7UA 1NVWQ 1SK8A 2YASA 3I2HA 4M0EA 4YC7A 4CKWB 2XCRB 1HT3A 5K8VA 5HF6A 3OQNA 5HBGA 5BW8A 1UEIA 1QHYA 4ZQGA 4C1NA 3D8NA 1YVPA 3CEAA 1WVGA 1J8YF 1WCIB 2XRYA 4EDHA 3CVWA 1K9SA 4WUTA 4A5OA 1U9ZA 1JFFB 1P60A 3PRKE 1XMOB 2EKLA 2ADOA 4XIJA 4ZU3A 2DRIA 4FGJA 4CEJB 4DKJA 2FZ5A 2HIMA 3ANTA 2NZ2A 1EGQA 4RVFA 3F0TA 1D1SA 1SXIA 4DQDA 4WLFA 3BVPA 2Q9CA 1P4RA 3U3ZA 2IYEA 2HSDA 2VQ6A 4KSBA 3ZLBA 2E37A 3HP7A 3M82A 3AJDA 4KUHA 3WTBA 5HDBB 3C0KA 4CODB 1O6BA 1QANA 2J67A 2ZLBA 2YYYA 5REQB 5JEEA 5E2IA 4X7PA 4IIBA 5T67A 2NUAB 5EJMA 3W3AH 4MKHA 1JH9A 1PYGA 2KQUA 4PZPA 1MW8X 4PIMA 5C8YF 1ZJZA 4P7GA 2O2SA 3ETJA 4YCAA 4G2TA 1ZGHA 3U60B 5BNTA 4YJHA 1WCIA 1CQJA 5BR1A 3SZGA 3ZZ1A 1H6DA 2OBXA 4UUPA 4YN3A 2GHQA 4F9FA 5JAOA 1QK3A 3B6ZA 3G2LA 5JSKA 4MO9A 3KAPA 3JYQA 4OFXA 3S2EA 3LG2A 3IX7A 1R4AA 3D81A 1H66A 1TGVA 2FHPA 1K6EA 2Q3FA 2RGNC 3JQGB 4L3WA 2EXXA 3RTBA 1QUFA 5IM5A 3ZGYA 3ZZNA 4DZZA 2FPLA 3GRYA 3QBEA 2H1FA 4JFAA 5FL7A 5ENVA 3KOWA 3SDZA 4UTNA 2G07A 2TSYB 1NDHA 1GPDG 1T9ZA 2ORWA 3IIJA 3LWBA 5FOSA 1Q20A 1UWVA 3IB3A 4MGKR 2I3DA 3KEQA 4NV0A 3AM1A 1NURA 2GO7A 3O7WA 4QVGA 1C7ZA 2GGSA 4TSFD 1IZYA 2XCTB 3ESQA 2DHQA 3JATA 4JLOA 4LZZA 1YA8A 4O1HA 2AWNA 2BZ0A 3SQDA 4OHXA 4H1VA 1KDYA 3KYDB 4FQ8A 4TL9A 2OO3A 2Z2IA 4YT4A 3C3MA 3EPHA 4UPVA 1PGPA 2VYNA 3WLFA 3GRAA 4IZOA 3PFIA 4REQB 3VU9A 2B6NA 3WYNA 4Q18A 5JQGB 5LU8A 1G291 4WRRA 5SYMA 4K9RA 3URMA 3E7DA 3NCHA 4TLBA 1YB5A 3DLTA 3PQ8A 1BIFA 1G6Q1 1O97D 4LTDA 4IDFA 4MHOA 3IP5A 1FMTA 2AB0A 3C41J 3LUCA 2CFRA 3ZK8A 2YN4A 3Q6MA 4NIMA 1PQUA 4L02A 5E6SB 4UCXA 2B25A 1W4BA 1D8AA 1JG2A 4J0FA 3ICPA 2IDMA 2IH2A 4QX6A 3D6VA 1W76A 3MMPA 5DXJA 2RBEA 4CKCB 1FP4A 2FPIB 3NUGA 3KT3A 4Y9UA 1J0XO 2IOFA 3H11A 3IO3A 3WK6A 4CDMA 3STUA 4HLUC 3FDZA 3DW1X 3ESCA 5K1ZA 3VC1A 3MT0A 1JBKA 1SCNE 1P1RA 3F6EX 3WYBA 4XGQA 3RF7A 2R7LA 2J8ZA 3GFBA 4K6CA 1EWVA 3O8DA 3FPGA 4MUHA 4BBJA 3WFZA 1JMYA 4BUJA 2WG2A 3ER8A 1E3DA 4Q82A 4JQZA 3AIMA 4R1QA 4IKOA 4Y9SA 5DDIP 1C4KA 1KR2A 2ZDHA 2FW7A 1K2WA 5AJTA 1LBTA 4N5IX 3WAJA 4L0DA 3WBBA 5TMPA 3X1DA 4M7RA 1PNQA 1C9EA 1KZ9A 2HSZA 5HRAA 2FN9A 2EERA 3IAHA 1I32A 1YV9A 3ROQA 4C0QC 2JPDA 2LRHA 1KK3A 1D1QA 4TX1A 1THZA 3RF6A 3UO8B 4FSHA 2NX2A 3NHJA 4B9EA 3A37A 4EELA 3AY0A 5DTIA 4EKNB 1KOGA 3F3KA 4KLRA 3T7KA 4JXXA 3FSEA 4B47A 1IWOA 5LNK6 1ZN8A 3BMQB 3PC6A 3DMNA 3QVMA 2OL4A 4PU0A 3RAFC 1N5KA 2KHZA 2WPDD 4K9MA 4L16A 5DN6D 5JH7A 1TECE 3ZKAA 3ZZMA 3U3OA 4BV8A 1SXQA 2ZUDA 4KO2S 4W7SA 4F6CA 2HDWA 3CF2A 2F43A 1TA9A 3DPIA 5IJAA 3TOSA 3BUSA 3H04A 4JUFA 4ZEXA 3IPLA 3NV7A 4RH1A 2AOVA 2AYXA 3HHEA 4C6TA 4B82A 1XKTA 4ZDWA 2X8BA 4BB5A 4GXNA 2JL1A 1SIOA 2PRZA 3E1GA 3IP1A 4RS3A 3VZCA 4EA8A 2C7VA 2ONZA 5TQVA 1US8B 4NRDA 1EDEA 3AF2A 1KRXA 4YLEA 3K1TA 1T0IA 2ZJ6A 1QGDA 1G59A 3RBVA 3RH0A 1YVUA 2P90A 2O05A 3ETEA 3JYHA 3O83A 2EDAA 4B40A 3S1AA 4B6QA 4WY8A 3NWBA 2XKKA 2W6JD 4RL6A 4OYRA 1Z68A 3L7AA 2JIZA 3KYJB 4WACA 1XDDA 3ZCSA 3E5MA 1FMLA 3ETCA 4HYTA 1Z0DA 3VPAA 2XT9A 1QH8A 1G0OA 3OKPA 5DX1A 2ZB4A 2OG2A 1IU9A 2AUNA 5BQ5A 5JDCA 3IH5A 3I30X 3KJXA 1NBMA 5D3QA 3PXUA 4FNOA 2EG9A 5F3DA 2GJ4A 1SOAA 2WNIA 3CLTD 1YQXA 3IUPA 5EMNA 1DO0A 3ZDFA 3NYIA 4QHSA 2FSIA 1X7XB 1SBYA 4J1NA 3H4MA 4XJTA 1C4XA 3X1MA 1C5KA 1II0A 2IE0A 1JR3D 3O31A 3ZWMA 5JC8A 2QTRA 5IKXA 1FJXA 3BA1A 4NYJQ 4AS1A 1ZXLA 2PFKA 2XI4A 1J2JA 3IOEA 4GOND 4IVQA 2A0UA 4HNQA 1UEJA 4MW1A 5F2OA 2CXNA 3RHSA 3S27A 3PNPA 4WLUA 1B42A 2HU7A 1PTKA 2Y1LA 1UBUS 3B89A 4V39A 4WE3A 1VKZA 3ZK7A 1NT4A 4H77A 4B87A 1XPUA 1MG0A 2DSNA 2Y71A 3LLUA 4MV8A 3OWOA 3ZGLA 4ZI7B 3TZLA 3VVLA 1W44A 3H5VA 3QBJA 2RGGA 4K8OA 3QKSB 3A3NA 3RYIA 4CN8A 3KUXA 1GZSA 3I4CA 3PXCX 3DLIA 2HUPA 2IYNA 2RHLA 4QTYA 2Z5FA 3S5UA 3KSZO 1H69A 3UB4A 4FONA 2TMGA 4CV1A 4MRMA 5HF8A 1QIGA 1ZJ5A 2H7CA 2Z8ZA 5U4QA 4HVLA 5F9HA 2BEWB 2UZ1B 4EY4A 3FHLA 3E4CA 4CT4B 3WA7A 1X14A 3VHLB 4EEZA 2ZWVA 1T2AA 1HLPA 2ECQA 3LL7A 4OBWA 4Q4JB 1IONA 1TTQB 1XTVA 3JQAB 3U4AA 3WGMA 4KQKA 5FUWA 1HDCA 4OQNA 5CBPB 5KNBA 3UMRA 1KORA 5I48A 1CF4A 1ISSA 1E9DA 3JSXA 3IQGX 3O9ZA 1LDEA 4FE4A 1HE5A 3DOCA 4EFMA 2L0XA 5AXDA 2CLCX 3TBHA 2FMHA 1CUGA 1YUMA 4QEKA 3PPIA 2NIPA 2AJDA 1FSPA 3UXEA 4XDYA 1OU4A 2Y1XA 3I6IA 4K46A 5DNVA 3SZLA 3SEFA 4EGFA 4PM4A 2REQB 3QYAA 2C2WA 2JFGA 2ALJA 4Q4HA 3E9EA 4OI1A 1NV9A 2JHFA 3ZLVA 4D8UA 1EK1A 4JQYA 2FW1A 4WJLA 1J2UA 3F8SA 2IW3A 2ZAYA 4KDEA 5TQ0B 2EJBA 5EVCA 2PLFA 3CH4B 4MNTA 3NHLA 2NN3C 4X8HA 2AYYA 3U19A 1OY1A 3TLGB 3MGCA 4L5BA 4CMEA 4GKAA 3M89A 4QFBA 5HXAA 1BA3A 5IAAA 4V1CB 4CF7A 1E79D 3MPUA 2DTXA 4OLHA 1KRWA 3P9SA 1FCJA 3BE6A 3NRBA 1QNFA 2W48A 2C04A 2HL6A 3DKRA 3GUCA 1BKYA 2YBEA 1OIVA 4I4LA 5C7YA 2D0OB 1U3WA 1G7TA 1RCFA 3FHOA 4RZSA 5MN6A 3RIHA 3ETGA 4UAGA 1KEWA 2FZWA 3B52X 4IIJF 3FN4A 1TTHA 3KCQA 3GW8A 4I9NA 1GTL1 5EXTA 3HK2A 5I47A 2O07A 2PBFA 1UMCA 2VRCA 4OPMA 3SBEA 5A4DA 2BBSA 3GVIA 1A76A 1E98A 1JBEA 1V3UA 3DLAA 2GXAA 2JCVA 4QXAA 5CXSA 2VAPA 3PFNA 1L1EA 4JOQA 1Z5NA 4HSEA 3HKDA 3LT2A 1W47A 3MUEA 5LJIA 4U7TB 4AYXA 1FQJA 1LDMA 1P2GA 2YC2C 1QIEA 1OHHA 3CHYA 4N1AA 4E12A 4F04A 3C5HA 4MGEA 1NRJB 2N42A 2CJWB 2WTNA 1V3QE 3DP7A 1S3FA 3LCUA 4LYJA 4ZC1A 5JH7B 1NG9A 2XMBA 4EUKA 2AW5A 4B1FA 2X1LA 3DBOB 1J8DA 1XHLA 2IODA 3KE8A 5CP8A 1QFMA 3P4UA 4WESB 3UOAB 4M0KA 1OX4A 5DCWA 3BFPA 1WHTA 3EY4A 2BHSA 3AEQB 2WK1A 2VP3A 1VB5A 2JH3A 3UT6A 1SOUA 4CJXA 5D8DA 3D5TA 3PA6A 3URKA 4FHCA 3BXEA 4JN6B 3TG2A 1U02A 2ZI6A 1ORWA 3EISA 3NXKA 4J1TC 3LGXA 1HDXA 4K88A 1HV8A 2AUTA 1Y7LA 3LNTA 4B0OA 2O3SA 3UPUA 4BFLA 3VQTA 4R1MA 4DWOA 3ZUPA 3IUQA 2FEPA 1JZTA 1PK7A 2X4IA 3H05A 3D2BA 3FFXA 4NBWA 5SY4A 5K3DA 2C31A 3SZUA 5BNZA 1V95A 1QV6A 2WWXA 1PE0A 1LDGA 1E0JA 2DECA 1V4NA 4H7HA 4MYSA 2VF7A 4L76A 1K7EB 4V0NA 1SIWA 2P5YA 1J4AA 2H7YA 3I42A 3W4JA 2DY0A 4E4TA 5KQGA 2Q5LA 3OEEA 4PNZA 4ZWNA 5TMEA 1ETHA 4IL5A 3T61A 1MC5A 3UWKA 3WRXA 3LHFA 4EUEA 2BZSA 5T64A 3GEEA 3LHSA 5LMNB 4CCAA 3C6YA 3CUTA 2Q4DA 4J0KA 3RT7A 4IRXA 1USIA 5EP2A 1GAJA 4EG4A 4FYJA 2GK7A 1Y3HA 3K72B 1MC4A 4X1YB 2V7GA 1T1GA 4ZHQF 3Q5GA 5H1YA 1ZH4A 3A4VA 1YDGA 4M9XA 4AZ3B 2X8AA 4RHUA 1PNVA 3WDSA 1ZINA 1Y8QA 5CGZA 3F74A 2WV9A 3JPWA 3K5PA 2GLXA 4JR1A 5FO0A 1HNWB 5FT9A 1FFBA 2RHTA 5FKJA 2ZVJA 5P8WA 2EZ4A 4ER7A 2G9UA 4N41A 2COUA 3A1SA 1K0FA 1XTTA 3M6VA 1RWBA 4ZOAA 3ZCRA 4TL6A 4EM6A 3DE7X 4KSYA 3MBOA 1JAZA 2JJ2A 3C6QA 3TYXA 1BCRA 4YAGA 2FGJA 1EE2A 1KP3A 4M4SA 1C3JA 5C7IO 4EY8A 2RI0A 3G23A 4ON9A 5AHRA 4JC4A 1VBKA 1YWGO 1FU4A 1NNI1 4ZMRA 3TEFA 4ZFNA 5J1SB 4RFLA 2FRDC 2X9LA 4RF4A 3W2TA 5C5DA 1FQKA 3HB5X 4EB0A 3WWPA 3U7HB 3Q40A 4MWGA 4KG7A 3PFFA 1DS6A 2OHGA 1G6HA 5ECWA 1ZD9A 5FI5A 4X20A 1EGMB 1E6WA 1VMEA 3G2JA 3BF8A 3F1KA 1L4KA 2FKNA 2V6BA 1WO8A 4CV2A 1KI1A 4O4HF 5AVXA 2HTEA 4TYQA 4ZRNA 4F8YA 1RQNA 4LF9B 2BEUB 4WCFB 1A04A 1HLGA 3DBHB 4L8LA 4UPDA 3ENVA 1U2EA 3A6KA 5F5NA 1RADA 3VZQA 1K08A 4BMYA 4FMPA 4BXOB 3QA3E 1L4UA 3AFNA 4N47A 4DIMA 5JYBA 6ADHA 4FBLA 1N2IA 3WL5A 2VJLA 2IHKA 4M98A 4PFJA 4U2KA 4XTCS 4EPWA 1AMUA 1C4OA 1OV6A 1NUHA 1QIFA 1PJLA 2ZJ8A 1U3TA 3O1LA 4INPA 3C3DA 3ZK9A 2DULA 1ZHFA 4Z4QA 3TOXA 2ZZNA 1BQEA 1W1IA 4EG0A 1V35A 4ZI7F 3ZHVA 4WL0A 1ZEJA 1V9CA 4E07A 2G77B 4BNXA 1I2ZA 1MUUA 2PM8A 3BKXA 2HCRA 3UANA 1S7CA 3CX7A 3KL2A 5FNZA 1V8OA 1RPJA 1ZOIA 2AT1A 2R1ZA 5TQ2A 3VSBA 2WY2D 4R4JA 1JSZA 3T1NA 2QKYA 2QLBA 3DE2X 2CNOA 1Q50A 1M1NA 4LWZA 4EJSB 3D6NB 2RC6A 5IUNC 3R9XB 4Z9BA 3EMVA 2WRZA 4P6VF 5KYUA 2RKOA 1ZD8A 2OVFA 3PL1A 2WTAA 1C0KA 5EE3A 4ESHA 3OPNA 4Y6OA 4LV8B 3K96A 4U7DA 1U5CA 2ZS7A 2I0FA 2YQZA 4YMGA 5JMTA 3PVSA 5JNSA 2BRUA 4LMBA 5TXGA 3TQQA 4OYYA 5CW1A 2PLWA 2J0SA 1UOPA 4GWGA 4K05A 1DI0A 4PFSA 4F9EA 3DC7A 3WAGA 5BT9A 4CR7A 3CRQA 1IH8A 4DCGA 1JDJA 1MHPA 4NABA 2X0FA 1GOTA 3C16C 4BJ6A 4PZLA 3DEZA 4NDZA 5E9WA 2VTDA 4GZ5A 1OASA 3GRUA 1GVNB 5B4TA 3CS3A 3GLIE 1EZ4A 3HB7A 3PKIA 1GRNA 4MRSA 2GAOA 2CWWA 3I64A 5FXMA 3JR3A 5KHAA 5JISA 4LI0A 3GEGA 3QPCA 1Y8CA 2A84A 4P08A 3P2EA 3OU6A 2A5FA 3B5JA 1N0HA 5CYGA 3VZBA 1XGKA 1AF7A 2DUWA 2Z5VA 3S6JA 3VR0A 4GVLA 2P4HX 4CTNA 4EUFA 4QLBA 2QN6A 5TSDA 4B8ZA 2YVAA 3KE9A 1M2OA 1M1NB 2C4MA 2VK8A 2GEJA 4JY7A 1RYBA 3EEYA 3NZEA 1M2FA 4MAAA 3WK8A 2XVYA 2XVZA 1Q3TA 3U39A 4J2OA 2Z4TA 3OJXA 4NNOA 4WD3A 3GUYA 3JASB 1NI5A 4YHBA 2B1RA 5ARCA 4F6RB 3CSDA 7ADHA 1OPXA 5IC4A 1JLLB 1GGMA 5EQFA 1AT1A 3WP1B 4RCVA 1QFZA 1RWWA 1XZDA 4XJSA 4PO9A 4RK0A 5DBHX 3IEPA 2BKAA 1PR3A 3ETHA 3ITDA 3L8EA 1XD2A 3SI7A 2OPBA 4UMEA 4A0SA 2BSXA 1ENYA 1YR9A 1CTQA 6REQB 3G6WA 3T99A 3MGKA 1UPXA 2ZWAA 3ZDEA 2ZBUA 1FNBA 4N0DA 3U13A 3MB5A 4R9SA 2VDRB 3GGDA 4FLMA 1EYZA 2DPYA 3CM0A 4DC1A 4BFCA 4IFTA 2ASVA 3RNLA 2ZJBA 1YQDA 3TPFA 4INZA 2VUUA 4YMTA 4CQLA 1P72A 2W71A 4Q3CA 2F64A 4CV0A 1FXWF 4PVDA 1GNPA 4XGNA 3G0CA 1G6KA 2Z57A 3DV0A 2O7RA 5H70A 4MZXA 4HBZA 1NMSA 3I8OA 1GT6A 4XE5A 3WZMA 4ZVPA 1XT6A 2VDVE 1SIUA 3LQFA 1G8YA 1AS2A 2IIPA 3IR6A 4AM8A 2RCNA 3DOOA 2X58A 2HREA 4IIDA 3ZWDA 4CLOA 1G8KA 2XMSA 2XUKA 4FIZA 3Q3GE 4V2IA 5CIWA 3MJFA 4R40A 5G0SA 4QJBA 5K3FB 1C3OB 2B30A 1XEWY 3FG9A 1QO0A 3LUPA 3LPLA 2GBFA 1QHXA 1XKLA 3LKDA 1OOEA 1QWOA 4S12A 5JYDA 2ZEJA 3O9VA 4KE8A 2ROQA 3K1JA 1I7DA 1CHDA 3SFZA 3RAGA 5ALGA 3LLMA 4GQBA 2EATA 4MYCA 2UUOA 3O2NA 4L6AA 3JQFA 5DBGA 3HL4A 4FYMA 5J3JA 3DV9A 3IRUA 5DLEA 5KTMA 1X9HA 1NFFA 1ABEA 4KBYA 5HFJA 1VL5A 1X6VA 3NHSA 1B43A 4K9KA 1VCIA 4PZCA 4ZJZA 1PWEA 2QAGB 2IXGA 4BGIA 2GM3A 2OGUA 2DERA 5KHOC 3FTNA 3U7JA 1P0CA 4WBXC 2BGRA 2BM8A 4LC9A 2PRSA 4R31A 4EF6A 1VPLA 4R84A 1X1DA 2N1BA 4BCCA 2AJLI 4JU9A 3V32A 3JZDA 3LY9A 1DMSA 3BD6A 4N82A 1IL0A 3OETA 1Z17A 3CONA 3KUDA 3EIWA 3QEAZ 2H0RA 2JIPA 2XUPA 1CB0A 1XLWA 1L9KA 4DJJA 3INRA 1NW3A 4GWKA 4HP8A 1KO1A 1JX6A 3I28A 4PGAA 1ULHA 1NBEA 1QIMA 1FP2A 1SVKA 1ZUIA 2NV0A 2O8CA 3PQEA 4JB0A 5CXQA 4OFWA 1WB4A 3AP3A 3FROA 2EFDB 1OXUA 5JWHA 1IWBB 3NX4A 3QOXA 1MABA 2ZIXA 3O0DA 1WUIS 3U7GA 1YTLA 1IE3A 1UINA 2W11A 3BMQA 4FX2A 4KPGA 4I5IA 1PS9A 2ERXA 3UMVA 5CD1A 1P5RA 2C1XA 1HQKA 1P0IA 2RIPA 4PQFA 3UFXB 1M34E 4RTMA 4AKTA 4LZPA 1CR6A 5FOWA 4FHDA 2ID4A 3EXHC 3NGLA 1XDWA 1Q3HA 1RAHA 3IGFA 1A88A 1O2DA 4FLFA 2N47A 3LQ4A 4US0R 1N32B 5G2OA 3IAM1 3SYTA 4B3RB 1KPHA 4YALA 3AF5A 4UBJA 3SWWA 3UJ3X 4O33A 3OEWA 4BE7B 3L77A 5A9TA 3VNQA 3BORA 3WL3A 4OA8A 4BBZA 3CLUD 4RA9A 1G16A 1GNSA 1OWPA 1XQ6A 3CIOA 3FLAA 3NHBA 4JT2A 4LAFA 2WIAA 5FPSA 3HVJA 5HEKA 4OGWA 2FETA 1CR1A 2V6FA 1TEXA 5LNK1 1RI2A 3KTOA 3L7IA 1NC3A 5EY5B 3B2EA 2BGNA 1CY6A 2F7SA 1YDMA 4PAMA 2PEYA 1P1CA 3HVUA 2ZBGA 3JVEA 4OI4A 1DMRA 4PAOA 1Q11A 2WMDA 1OH5A 4EKGA 2YMLA 4R9VA 1SB8A 3KJHA 3DFIA 5K0BA 4YI3A 5L3ZA 1YL6A 4QEDA 4BKOA 4O2LA 4RAQA 4D4HA 3Q3JB 4OAQA 2VDPB 4RA6A 4TWZA 2XUAA 3NFYA 3GJ3A 4L8FA 1PGQA 2D13A 3THWB 4PYKA 3JQ9A 2MYPA 3LOPA 1SEPA 2WZBA 4OCZA 4OQFA 5ADHA 5FD8A 2O57A 2PKWA 1IPFA 3QEMB 2R66A 1BVUA 3F7MA 3R5XA 4LRUA 4TMWA 4WCDA 3L7LA 2X0RA 1M2WA 3O8CA 3KZNA 4MCHA 4TV8A 2SICE 1UMBB 4U2DA 5HSGA 2JIRA 3W5VA 2VDMB 4LOHA 1VCOA 3G0OA 2YHIB 4PX5A 2YRWA 4CDNA 2DR2A 3FVQA 1L5RA 3V48A 1TA0A 2PIDA 3P9PA 4O2BB 3C8DA 3UUWA 4LJ6A 2H59A 2B7CA 3P9ZA 1CWUA 1K3UB 1RLUA 2PKXA 2WSBA 4Y6PA 4YRPA 2OFFA 4D4JA 3B6EA 3H65A 4I1SA 2BGWA 1SCIA 4EYEA 2BGLA 3RGWS 2YIVX 3TIFA 1G2PA 3IKVA 4MVJE 3CWZA 3Q4GA 3ZE8A 3ILSA 3IBFA 3PLAE 4FEGA 1E3QA 2OV2A 1ISGA 3EQ8A 4B6EA 1AA6A 2O2EA 3VR2D 2XZDA 5CLFA 1C7RA 1WKBA 2OV3A 2H48A 3JQAA 3KTDA 3UMSA 2ZCUA 4UMVA 2YXEA 5CNKA 2GH1A 3O5AA 3RVLA 4BGVA 3O73A 1N5MA 4PX9A 1T3LA 2BRUC 3DOIA 5F5XA 1WXXA 2AG8A 3IMGA 4AZVA 4HB3A 1Q74A 1CRPA 1GKYA 1P0MA 3ZDCA 2AE1A 5IT4A 1HE2A 2TYSB 3M81A 4P4GA 3S2UA 3ZXIA 4KTTE 4YEDA 1ZVVA 4UFPA 4REMA 1W1WA 4CMGA 1G8MA 3MWLA 2ONYA 2WWWA 5CUQA 1V4BA 4YRGA 4MVJD 4U5QA 1KS9A 5LP6B 1FYWA 3B1KA 1SOMA 3H2ZA 1UXJA 2NUAA 3BMXA 5C31A 2BD0A 1O8CA 2PUVA 3CLSC 1DTWA 3ZI0A 1YA6A 1UBFA 1UC9A 2VPWA 5AVJA 1SG9A 1F06A 2J9FB 1X3SA 2JGFA 2JW5A 1WB9A 3HN2A 3NKLA 1XX6A 4D1YA 3RVMA 4QQKA 3N5CA 2XD9A 1OFIA 2C2OA 3P20A 4RK1A 1ZLXA 3B48A 1E60A 1Y3FE 1MIOB 1XKQA 1Y9DA 3V1LA 5IMBA 2PZMA 1DJNA 3L18A 2CJPA 3OLWA 3JVUA 1WF3A 3COPA 4EEKA 1KP2A 2V55B 4FFMA 4MEJA 2XNDD 2HBYA 5T6BA 4XD7A 1G7SA 4MQFB 3SM3A 2EFEB 4PXYA 3UGJA 1F7VA 2EJWA 3EZ7A 4BB0A 4XFJA 1JDSA 4DXHA 2YIMA 3ZDZB 1KMMA 2YWHA 2HZ7A 3B2NA 5BV1A 1CJBA 3DHYA 3AFOA 5AI4A 3B12A 4PY2A 1JEYA 1Z28A 2AI2A 1M5TA 3RJMA 3VDRA 3LBIA 1N77A 4FFSA 2C7GA 3A6LA 1SD5A 5EJIA 1F8UA 1FDSA 1CQIA 2I8CA 2Q8PA 1B1CA 4RX1A 1KI2A 5JWOA 4QTXA 1ZAYA 4BBAA 4DB4A 3HZZA 1RPNA 2C8KA 3GPDG 3V7YA 5FAKA 3GEDA 3Q0TA 5ILQA 3ZLUA 3MOSA 5LMCA 4S24A 4AKHA 2EU8A 4AX4A 4CLXA 2QZSA 2GARA 2JBAB 3FXAA 2PSEA 4YQYA 3SR4A 4BNVA 3C4QA 3GL9A 3MJHA 3AKDA 4RMJA 3ABRB 1T5DX 2FSGA 3ES9A 5HILA 3TCKA 4BKPA 1I14A 3JRNA 4D42A 4EGQA 1UP4A 3IXMA 1E9EA 4OHKA 3WDMA 2PXXA 2XVMA 3SHQA 4BNKA 3OE4A 4IV0A 3U44B 1ID1A 2E4VA 2NO6A 4J0IA 1ZN7A 3TZEA 4C7KA 3MSXA 5DM60 1HDZA 5B7PA 5JVDA 1JG7A 3KSDO 2CFSA 2Q0SA 2FJPA 1EZZA 2PS9A 2WICA 3DG9A 3F49S 4GBJA 4MI3A 3RSZA 5KJEA 3TTUA 3WLPA 3QSYA 2JHCA 2VPTA 2GF0A 3FNBA 3IT1A 5EIHA 2HK9A 4I9HA 4RA6B 4UVHA 4YMIA 2R0QC 1LJ8A 3AKCA 4RESA 1GADO 1PT8A 1UT8A 2NU9B 5DGHA 4BZXA 4W5JA 1BS9A 2KPOA 4QRIA 2Y2UA 2QAJA 2ZGVA 1U5BB 5KWSA 3F5MA 5JTUA 3U1VA 2NU8B 5KCZA 1NZFA 2Q1YA 4PYIA 1RWMA 3FWZA 1ES9A 2FEAA 3TTYA 2FN8A 3VU3A 1BOOA 4J3FA 2XNSA 2FMFA 4HXEB 5KTKA 2FXIA 2B35A 1H8ED 4J2TA 2QM3A 3B6JA 1H6CA 4JV5B 4CM1A 2R4TA 3EWAA 1GTG1 3EGWA 1NA5A 4NFSA 1UMDA 1I4LD 2FP4B 3E6AA 3A6EA 1V1RA 2BN4A 2QK4A 5JQGF 4G5OA 1B7GO 4W5RA 2V3CC 1CJMA 3P96A 3LQ1A 5KX5A 3PF8A 2C9CA 4O1MA 1P7WA 3L9WA 1M34A 2E3JA 4LHSA 4YDQA 3S55A 2Z98A 1QTNA 4KBFA 4GICA 4OMUA 1RJFA 4OO3A 4J07A 3QBTA 4UHCA 5DX8A 3VR6D 1O5TA 4MLDA 4N76A 3ICEA 1HGXA 1FLVA 1NR5A 2QTAA 1X3LA 2VF4X 3C97A 3HUDA 3GFPA 3QVSA 4QARA 1MU0A 3A28A 2IX3A 1XDSA 1P7YA 1L7BA 4LNUA 3MJTA 1R4NB 4IQ0A 3IQZA 4OK5A 5ESXA 2OZKA 2YXDA 4AKSA 1OZHA 4Z49A 2F1OA 4KK4A 2RGYA 4F4DA 1RJDA 1KFEB 2OXCA 3GLRA 1ZK3A 5HUJA 1C29B 1BU5A 4JLKA 2ZCJA 4E32A 4CRWB 3RROA 2SHKA 1IN6A 1IQRA 1JEQB 1MG5A 2A6PA 4GI1A 4MV4A 4ZAYA 5JZVA 3N59A 3SLRA 3OQ1A 4Z2AA 3T0IA 2IS1A 4CM4B 1TZJA 1VL8A 2XD4A 3LZ6A 4AZWA 4EGCB 4D56A 1SGWA 3DAGA 4I4IA 3HFRA 2OXIA 3JWJA 1XEWX 5DTJA 4KKVA 2NXCA 1FF9A 1UKEA 2I6FA 2F9LA 2N1MA 2OE2A 3HDVA 5IC6A 4OY3A 1N6LA 1YUBA 2ODTX 4R8VA 5CG1A 3N3BC 4X6YA 1CEXA 3ONNA 5KJ1A 1Z4OA 3UOGA 2X86A 5I9MA 2WJGA 2R2AA 3L84A 4GPIB 1C0PA 3WGVA 1WPQA 4WI1A 3AEKA 1NATA 1UBOS 3PNBA 4Y6LA 4F2WA 1TQ4A 1W5SA 3U4QA 4OIFA 1QGED 3DMRA 2OZPA 2WU1A 2R4UA 4NCKA 4O2BF 4PRLA 4RF3A 5LSAA 1UKZA 5T7BA 2VK2A 1XUOA 2DWUA 1SAYA 3SJZA 4O4IA 1OZGA 3DZJA 3WNZA 4U1RA 5JDCC 1LBSA 3R0IA 1XZAA 2WUWE 3UK0A 4GGPA 1JJVA 1PWHA 1QKKA 1SQ6A 3WICA 1CRZA 2CMDA 3ESYA 1B8NA 4FD3A 1RP1A 4KE9A 1MRNA 3LS2A 3RSCA 5AW0A 1AY0A 1UXKA 4G4JA 1VMIA 3B9PA 4DV5B 2F3TA 3DGFC 1OVGA 5CVVA 2PMEA 4HVCA 1FVFA 3UUEA 3W9SA 4TTAA 3OPMA 5JLJA 1LDYA 1EWRA 1NSFA 3QHAA 4Q00A 1PKXA 2X2OA 4OLFA 5U9CA 4B4DA 1UL1X 1GPLA 1UAGA 3CUKA 4OKIA 5HMMA 3H2JA 3U3RA 3T7RA 3CEPB 1YJBA 1VSQA 3LUBA 4ZZIA 1KEPA 1IUKA 5BMVB 2PJZA 4EI9A 1A9ZA 4IFIA 4UMFA 1SA0A 4PANA 4YECA 2OFXA 1CY2A 3D7MA 2PX2A 4FOOA 5EHIA 2NZWA 4MUAA 2XECA 4DYDA 2O8BB 3DEJA 5BWLA 2Z30A 2QN8A 3ZWWA 3VDNB 1IRXA 2XEDA 2Z2JA 1TADA 1BQ4A 4QWMA 3DDSA 3D2CA 5L4SA 1THTA 1UPTA 4IIJA 1X80A 1ZD1A 1ZOPA 2MOKA 2C9MA 2J0UA 2Q50A 3P52A 1T8UA 3OTWA 4UCQA 4UEOA 1F51E 2CXQA 2EX1A 2NVOA 3MJEA 4FFNA 1GNLA 1U9CA 3ELUA 1JDBB 3E7PA 5C1PA 1RXVA 4FC6A 4XWYA 1MX3A 5DLDA 1PEAA 4GX2A 4HZIA 1VDZA 1NBME 1BHO1 1FQWA 4GI5A 3PSAA 1E2KA 4I6JA 3ZBPA 4Q9KA 4GZMA 4L8YA 3PHIA 5A9SA 3JD2A 5GONF 4BX3A 1YZQA 1JVSA 2WLSA 3FUXA 4N40A 3OE1A 1RQRA 1IVYA 4LKRA 2HWKA 2JLSA 4NBLA 5AKKA 3RV3A 4KITB 1A96A 3BK7A 4L6IA 4AY6A 4IOLA 1OBFO 5TS2A 3A1UA 2R11A 1YHYA 4I50B 3TXAA 1JEAA 3WGOA 5C37A 4IKEA 2X4DA 2CLMB 3Q3VA 3A6GA 1WW3A 1EAYA 1H42A 1JTFA 1GG2A 1NQWA 1ICIA 3ZE6A 1K1EA 2OSBA 1UBSB 3TCNA 3A1FA 1IXSB 1PLKA 2ZTMA 3AHIA 2XA2A 4WEQA 1NVVR 1IN5A 2C00A 1UFKA 1ONNA 3R3YA 3UJDA 4ID3A 4UEKA 5GMOA 4E5PA 3LF1A 1YOVB 2QVBA 2VHVA 3T7EA 5F7ZA 3QXJA 3ILXA 3ICWA 3V2UA 4R0NA 4JMPA 1YRHA 2AZMA 4D0SA 1J1IA 4DBVO 3ZTTA 3R5HA 4NK5A 2ZPAA 3R24A 3A9SA 3LC2O 3GEHA 3LSYA 4IRMA 3WMEA 5CDFA 4IIUA 2C03A 1E18A 5IUKC 3AINA 3D43A 2R9VA 5MDHA 4I08A 2QZJA 1JB9A 2OYRA 4IGFA 3OQPA 1L1FA 2IDKA 2DBZA 4BAUA 4YMVA 5JC1A 3LXMA 3QYPA 3PC4A 1YHZA 4XVCA 1SO8A 3IBGA 1AGXA 3INYA 3OOYA 3MILA 3O2QB 4IUBS 4M0DA 5J1TB 2ODPA 4OB8A 1XCLA 3HFSA 2XBMA 4YCMA 3H1GA 2H1OA 5BUCA 3U1TA 2GBPA 4X3OA 2XDQA 1NAHA 1RYEA 4L72A 4MQ6A 2JHAA 2YXBA 3UY4A 1Y3BE 1MH1A 3FUWA 2BDTA 3G2MA 1M2KA 4G8BA 5ES3A 2GN8A 3K7EA 3K1AB 1UP6A 5DW0A 2M6SA 1SQFA 2B1JA 2PUHA 5JHHB 3CVOA 2GTHA 3HJUA 4H7DA 3E48A 3EXEB 2YJ3A 2IU0A 5FHQA 3STVA 4OKNA 5K6AA 1E7SA 1M10A 1OYWA 5HBRA 1XQ9A 3H17A 4V0QA 3GN1A 1VIVA 3LH5A 4HEA6 3T4UA 3PWKA 4DTCA 5AW4A 2JJ1A 2QTHA 1EUCB 1E1LA 5ECYA 3ZBTA 1AU9A 4P4UA 2O50A 3P2JA 1UBTS 2R3SA 3LUHA 4PN3A 3AL2A 1N5DA 2J46A 2MMGA 3KOYA 4IV8A 3X43A 3ZWQA 4PC1A 3HJAA 5HJ2A 5A7HA 1R50A 4FQ7A 2VDQB 2WNSA 1XCBA 4LFBB 1TMKA 3EXFA 4DDWA 4CU2A 1LLUA 4TZ6A 1E6KA 2BI4A 4HAUA 4FN4A 2YW9A 3OAAA 1XCJA 4TKZA 1XNHA 1PYOA 3Q8WA 2I3ZA 3SF8A 1MDBA 4DARA 3K3PA 4Y6SA 5AKIA 1QUEA 2ZUFA 2D00A 3NHAA 5HF9A 1DBIA 3ZYZA 1NQVA 1LQUA 3RU3A 2ETXA 4DA0A 3L1HA 5ILOA 1G98A 3OFNA 1H5NA 1TU3A 4DSZA 3G8YA 5JANA 2JDIA 1NBMD 5IYZA 3A6FA 2C83A 1SQ0A 1XK7A 3FRJA 2OFPA 4UCFA 3VYWA 3G9QA 3L07A 1T26A 3MWYW 1T6NA 3MELA 2FPGA 2OECA 5H16A 1HDOA 1LW6E 5HPYB 4OHZA 4CUKA 1N5JA 2ZSKA 3HDJA 3THYA 2Z4SA 3U3JA 3F6CA 1DX4A 1QHHA 2ZIVB 3KWLA 3FYUA 4GNKA 4HQLA 1D6MA 4MYHA 2JFOA 3VAZA 2OOKA 4NOLA 3ZHRA 2VDJA 1VYUA 3KVYA 2PE5A 3OX3A 5DSZA 4EMBA 4KDFA 1F6WA 4N7RA 2ZVPX 3LTNC 8LDHA 2WTBA 2XOKD 3NKVA 2C88A 2QQ5A 2X5NA 3ZCUA 1USKA 1W6UA 1F3OA 2I7CA 1Q1BA 4MX8A 1UKBA 4XZ3A 1V1RB 1PG5A 1DCFA 4D74A 4N4AA 3F6YA 4DMLA 2NTNA 2O7NA 4CMIA 5DPMA 2PMDA 2Q1WA 3H2BA 3TAHA 5BN5A 1JG3A 1W9MA 2PHZA 3ORQA 5JCXA 1AUOA 1JFVA 1NVKA 1KK2A 1I1OA 4ZZ2A 3UMYA 2A3NA 4HNAB 2OAGA 1GITA 5DNWA 6AT1A 4JI8B 1Z7EA 3EOBI 2WVGA 2ZETA 3PQ6A 4D96A 2WSSA 2O06A 1L6IA 4OAOA 3U4DA 3WNVA 3K5IA 3OOJA 1LV7A 2Z3VA 4X63A 2XWPA 5DP2A 2VSOA 1OF1A 4MS1A 4J7XA 2JATA 1ZD3A 1ZSNA 3LXUX 1MV5A 3O4VA 2O1WA 2BLNA 1RXCA 2C1EA 4L2IA 4QPZA 5BNFA 1M6VA 5DEOA 4I1YA 1Z8FA 4EG5A 1XG5A 8ADHA 4LCBA 4KXYA 2J3HA 4E15A 1N5LA 5GGXA 3TDMA 4C7JA 4JXKA 5DOVA 4K86A 3G2IA 1DCMA 2O0LA 1DIHA 1I4EB 3JALA 5FNVB 1XOIA 1JDBC 2FZ4A 2I7TA 4TYPA 3PIIA 2HCJB 4XR9A 5EZYA 4ENPA 3AIKA 2BIFA 3MT9A 1WDKA 2W70A 4UNNA 4EG8A 1TUIA 4EZIA 1NX6A 1SUBA 1IJEA 1ZOSA 2GX6A 1CNFA 1LLFA 2I1WA 3QKUA 4I4TB 4URYR 4BJ3A 3NBUA 4OQPA 1Q92A 5SZKB 3WYFA 1NAIA 4C0JA 5KKAA 1VKRA 1GGJA 2HF9A 1WQ1R 3K30A 4B43A 1Z75A 2G0NA 2I4TA 3PHCA 2QTBA 2PD4A 4RSGA 3W8RA 4N3AA 1KIMA 3KXIA 2XQFA 4DSNA 3IB6A 2XDQB 5MN4A 2F3QA 4JSRA 2FPMA 1PF7E 1CR2A 2NO4A 4M46A 4Z54A 3L6EA 4WZBA 1VKOA 1YJ5A 3ZW7A 1T9KA 5G1NA 1BGWA 2CMHA 2VP6A 4ZAVA 4BAGA 5LQAA 1MOZA 4PAWA 1N3BA 2FX3A 1YFLA 4LZJA 2VH2A 2HMUA 1XTRA 1LVGA 5JNUA 5L3SA 4ISBA 2IZZA 5KQSA 3PK0A 3ZHUA 2AVDA 1LLDA 1M5UA 4F86A 4Q1EA 2R85A 5AKXA 3TAUA 1AV7A 5I8WA 2CMGA 1QFXA 1QF9A 3DD1A 5EEHA 2YOGA 5FI3A 5LD2B 5A2QA 3P0FA 2WC1A 3CBQA 3EQ7A 2NO5A 3VOSA 2UZ4A 3AUSA 4IS2A 5A6SA 2HRZA 3PXXA 3FNIA 5JMPA 3WHPA 1HX7A 1T9CA 1JG6A 1YOVA 2IZ0A 2WYUA 6YASA 1DQNA 1SVLA 2YFYA 4II2A 3AF6A 5DYGA 4UUNA 3D02A 2ZAOA 2GB4A 1NQAO 3GX1A 3BL8A 3DE5X 2C2GA 4RJLA 4UUBA 4TTPA 5HA5A 3T1QA 1L4LA 4E5MA 4IIVA 4W5HA 2FDCA 4YRFA 3OLXA 5GPBA 4F56A 4WBNA 3CW9A 4Q3NA 2Y1WA 4JOBA 3OCCA 5JQWA 1K5GA 2RH5A 3KTFA 3AETB 3TW4A 4CM9A 5IDXA 4WGGA 3ZZ0A 3WLRA 1JKFA 1PSDA 4NC9A 1ZPDA 2HA4A 3KWFA 4UBLA 4BV3A 2EC5A 1DEOA 2WM3A 4RIEA 3WKBA 3W5JA 1WHTB 1SULA 2A58A 2X0JA 2ZJ4A 4HJRA 1CIJA 4IIGA 1RLMA 3D8SA 2APJA 1BN7A 3H5IA 4JOSA 4L2IB 4LMPA 4XPIB 3QWFA 4ZXFA 3VX4A 3BJEA 5ALUA 2BTQA 3KZMA 4NZMA 1XIVA 2PUTA 2OC9A 5FV4A 3U16A 4UHBA 1TXGA 2WF7A 3TPCA 3OUZA 3HJCA 1JPJA 1ULTA 3OEYA 4C7BA 2H54A 4RQAA 4TT8A 3O93A 4NKRA 4DCUA 1GLNA 1AZLA 3SSOA 4WZZA 4IDOA 1O9GA 4ER6A 1J0BA 1N2CE 2NO1A 1AKUA 4NBVA 4G89A 3QH4A 1V5IA 4N9WA 1Z08A 5IT5A 2ECKA 2IPMA 3OP1A 2DQYA 4UDXX 3FF1A 5F78A 1ZNXA 2LWIA 3JVIA 3KLPX 1QIDA 5KHLB 1VDMA 1H22A 1YS1X 4L0CA 1TNDA 3T9CA 3O4GA 3AXTA 1MQSA 3EVGA 4WAUA 1IAQA 2R6JA 3COWA 4L6CA 4YWHA 3V46A 4A2PA 1DUSA 2HA6A 2BKUA 3MCVA 3PHGA 3VH1A 4JVMA 2EJCA 3O2SB 1EPUA 1GNRA 1M6YA 3NJ4A 3KM0A 2QTVB 3KLBA 4X1KA 5L8VA 2DCUA 4JFRA 1AHIA 1OFVA 3MTIA 4HLQB 4TXMA 4JI3B 3H6HA 3TNDA 3TZCA 4BNYA 2WSLA 4EBFA 3GP8A 2Y1DA 3I5MA 4EENA 2FWAA 1QHHB 3DBRB 3TTSA 2DZDA 3D0OA 3MWKA 3W4IA 2JGJA 1SIBE 3NEPX 4KIJA 1QH8B 1OBCA 1M2NA 3UAWA 2HMYB 3RYHA 5B64A 4JELA 1A9YA 3PX2A 1PSZA 2OENG 2BJWA 5KINB 3HM9A 4IXWA 3RYTC 4TKUB 3Q8KA 3PICA 3F2VA 4U7GA 3V2GA 1U7PA 4RTSA 1NKSA 2A0KA 2C8LA 4NWIA 2AZXA 4NE9A 1I1NA 5HKOA 4XWOA 4UC0A 1TKBA 2VHCA 2Y0EA 3IAFA 1QVAA 4HEQA 5F5LA 5KTTA 4BLSA 1RLOA 1UC8A 3TL2A 3Q6NA 1LXCA 3HKCA 2WJIA 3K9QO 1U99A 3FGOA 4FWIB 3UUFA 3PEFA 5D01A 3EXIA 4LY6A 5FX2A 1P80A 5DSTA 3RC7A 1MN6A 4DVJA 1BO6A 3WHLA 1J2YA 3PT9A 2P3QA 5DWDA 4A0QA 2JGNA 3F9CA 4PSUA 3ZW9A 5C1DA 5J58A 4D79A 4GZLA 4TKMA 3O9MA 1GFSA 5KPJA 4IEFB 4MR9B 3V3KA 4G01B 2O54A 3SP1A 5C7LO 1CRWG 4L4ZA 4RDCA 1JAYA 5A7GA 3ZWBA 4BFSA 4Z3OA 5JS2A 1J1ZA 3H84A 5CLHA 4EAAA 2WD7B 1L5MA 1S8FA 3FZYA 4Z0NA 1WJGA 2L18A 5B3KA 2ZB3A 3TLAA 1U28A 5DNEA 1OI7A 3WIUA 4ENTA 2POCA 4GPTA 1J8MF 3JYOA 5EUBA 1NXOA 2W6OA 4JI4B 3U4IA 1Z3IX 2D2EA 2JS7A 3R74A 3MLBA 4MQUA 4YCSA 1TEZA 3FJ1A 3ND5A 4ZICA 3HVIA 2CWDA 2VA9A 5EHZA 5AHXA 1OZFA 4G41A 3ACBA 1OWLA 1WD7A 2ZQ5A 1UPAA 3QFRA 4JJ8A 1LWNA 1WP9A 2H1HA 2YZ2A 3RU2A 1Q7TA 2EYQA 3ZY6A 3OIWA 3C8UA 3P4XA 2NSDA 5THXA 2ZR8A 4UCWA 2NVUB 2DPHA 5BP7A 1Z6TA 4X54A 2JD0A 3OLCX 2JCSA 4ZT4A 3FTPA 2DT5A 1R16A 2R6DA 2RH9B 2ZJ3A 4LHEA 5KUTA 5LZ9A 3EGXA 4Q66C 4ZDKA 4DQXA 3V4FA 4NEQA 4AULA 1SXJC 1E4VA 3G5AA 1GDTA 2IEDA 3S1AB 1FLNA 4H7EA 1FRQA 1TLLA 2ZYHA 4TL8A 4U2GA 3RS3A 1WSBA 1K98A 4IS3A 1W4AA 4P4LA 4R8LA 4WADA 4CE6A 4DT1B 2ZIUB 2X9NA 2HA3A 2P1RA 1XZBA 3X1KA 3JYNA 3CO5A 5DYTA 3D64A 3ZU2A 8OHMA 3PS9A 2IEAA 5BUZA 3T9BA 4TYWA 3GFSA 3R2JA 2CUTA 1PQYA 3TPZA 4D92A 2RI6A 5BQ3A 2JK1A 5F33A 2CB9A 4DCJA 5IUJC 1NPYA 3T3EA 3HYCA 2JCBA 4QYMA 3ZGNA 4LYEA 2C61A 2BHRA 2W2TA 4GFDA 3O8BA 1B0PA 3GT4A 2X0KA 1HT0A 2IXTA 3HKEB 3TX2A 3DB2A 5FBLB 2JEOA 1W581 2B61A 4MMXB 5BRJA 4I5EA 5JDIA 4IIXA 1BXKA 4OHWA 3GEMA 2I99A 1HBJA 3N9IA 4TZTA 4ES6A 1JR2A 1K06A 3NOXA 4WASA 2XGSA 1X1EA 3HCOA 5K3FA 2W42A 2FSUA 2I2FA 1DINA 1ZO8A 5D5QA 2AFHB 1J39A 4Q9IA 2BAGA 4CI0B 5KSYA 2E18A 4M1ZA 2IP2A 2ZKIA 4RD6A 4TWJA 1PFVA 1NUTA 1ZKDA 3LO8A 2WHRA 2C5HA 2IRWA 4R0VA 3BL5A 1M1ZA 4JLMA 1TO1E 4C05A 3U1BA 1O9BA 1S9HA 5CIYA 4N8DA 1UBCA 4MB6A 3CZPA 3QUTA 3COSA 4ALIA 1UC4B 1WTAA 2PSFA 3IURA 1TVKA 3FTFA 1YRQA 2ZVQX 4COOA 1BXRB 3CNQS 1ZN9A 3DVAB 3EZXA 1CRLA 4MUBA 3R7FA 4MQBA 1WMSA 1D2MA 4CG3A 4M37A 4OLJA 1F12A 2HADA 4HRYA 3AOGA 4MI9A 1LZLA 4E2FA 4RTPA 3U3MA 1PJCA 1F4VA 3IHTA 1M74A 1EM8A 2PL3A 3OEHD 4I3HA 3LDUA 5L3RA 5LXTF 4A8JC 5KC8A 2J3DA 2CNNA 1YJCA 4XR4A 5TVGA 1YOBA 1CY4A 3AM4A 4ZZ1A 3GVHA 1SA0B 5IVKA 2JFPA 4EYOA 1OR8A 3QEKA 2H57A 2P4UA 3FPSA 4HYYA 1IEXA 5JOQA 4L27A 3Q9UA 4G5QA 5DCYA 2GSWA 3L8FA 2QQ0A 3EGDA 5FO1A 2E5WA 3N2KB 5HRUA 2PIAA 5F35A 1JTVA 1EFUA 4JLAA 4WXMA 4J0GA 4ETNA 1Q17A 2FMIA 4WXRA 2G70A 3TDNA 1WUJS 3W79A 1B14A 5E1DA 4YT8A 3PYXA 1H5UA 4PX3A 3RVBA 1IEWA 1UBMS 4HGYA 2BFFB 4EPRA 1M1UA 4DLPA 4ZGWA 2RKWA 3OOHA 5JI2E 3SE7A 2CNWA 4FCTA 2VDWA 5SZHB 4L51A 2M32A 1UQRA 2AXQA 3H2HA 2VH1A 1Z26A 3FPCA 4COKA 1XNQB 1H9AA 5JT1A 2QSUA 4D5GA 4PPFA 2HFKA 3K16A 4B8WA 2Y0BA 1R66A 4P82A 3EF1A 3LL4A 2K7FA 1KA9H 3ECAA 3AOEC 4C0HA 3A3OA 2Q4EA 4IUDS 1NBWB 3KLMX 3FCOA 2DTDA 4DSAA 5BSVA 4OXIA 1JLHA 3KYBA 3HGMA 2V7VA 1Z7WA 3E1SA 3QJYA 1TMYA 4RKYA 1GT91 3ZWCA 4ENRA 5LZ4A 2Q21A 3NVDA 1OB5A 3MAAC 3PC2A 1T2NA 1FFSA 5KTPA 2P9JA 4RD2A 2ZWIA 2B9EA 1CE8A 3HCFA 3JYPA 4MB0A 5EAIA 3PEEA 3A32A 1KSJA 3V34A 4E2YA 4OJMX 4UZSA 2YWEA 5SZIA 2GPWA 3DDZX 4NMLA 4HNRA 1BWSA 1MBZA 2QM0A 3K9BA 4QXOA 3OPVA 3DO8A 4N9QA 5HTKA 1FSFA 4QDUA 3OZTA 1BXZA 2EWMA 4ITRC 1Y82A 3U0VA 1WUHS 3JQ7B 3RFFA 4O5OA 2BE9A 1SC9A 1AKTA 1T5HX 4G0MA 1TRKA 1VJTA 2Q6VA 4DTIA 3VNRA 4EHNA 4X6LA 4GS5A 3CLHA 4RE5A 2LBPA 5HJEA 3BB4A 5HGXA 3ESBA 1ADCA 4NBTA 2XTJA 4XJVA 4PQRA 3BFKA 5IKOA 3H2KA 2RGWA 5JD4A 3D6MA 5CA1B 1D5WA 1RLJA 3ML1A 3GVXA 1C81A 5JE8A 3W78A 3W90A 1QF6A 1EDOA 3DEYX 2W8ZA 1NUAA 2FPPB 1KPGA 2I1LA 2QUIA 3IPRA 4H0FA 4LQLA 5I5GA 1SXHA 2AXPA 4RENA 3T7DA 4YUZA 1NHGA 1TPZA 5ITZA 4M22A 2R84A 5A3JA 1KJ9A 3I4LA 1IRIA 2X0IA 3DJFA 3KEGA 3THWA 2SKDA 2XXJA 1BW9B 3BHNA 1J06A 2A86A 3EGDB 5G40A 2WPNA 1Z15A 2UYHA 2QMUA 2V6IA 3TLYA 4AG5A 4IIFA 1RJGA 2GK3A 4I9FA 3MBIA 1JFFA 2PL5A 4JBYA 4D44A 2QN1A 2FE1A 4Y2HA 2GVDC 3T35A 4QG7A 5DI3B 1IZZA 5HQ3B 2I76A 2QL9A 5E1BA 1H1TA 4Z7OB 2AOUA 2NU9A 5K01A 5E3IA 2C92A 2V8OA 4JKIA 1H2EA 2QLLA 4WXPA 1L5LA 4PZ0A 4C2AA 3HB0A 5HDQA 1E96A 1QB8A 1FSZA 2EP7A 5THKA 4JJ7A 1SKMA 4Q7QA 4B5KA 5EIBD 1UDRA 3LRPA 2BBOA 2CVQA 3AERA 1S89A 4DQKA 2RKBA 1QJCA 1YNOA 1SUDA 3BWBA 1ZK4A 3BXHA 4J4BA 1S1CA 2AIRA 4KX3A 2ZROA 2Q0XA 5C80A 2G9RA 1Q83A 2WAXA 4OYHA 2IHYA 3L9XA 3BQ9A 1DOHA 3I1YA 4URXR 1UDWA 2XSZA 3KVRA 2VHEA 2GYWA 3T38A 1AQJA 5CNIA 2GBGA 4N0QA 5K05A 2B4AA 4GU5A 1PRYA 4HO1X 1AKYA 3E81A 3ADBA 1P2BA 3EW9A 3QPDA 5ERGB 4BWVA 4DR5B 2X77A 4MDHA 1PWZA 4AROA 2I80A 2IYPA 1WHSB 1IJFA 4N7MA 2WPDA 2B7LA 1Z0JA 2QTZA 4TXJA 3TNFA 3NIBA 4B48A 1KVRA 1E63A 1JU9A 4HFJA 3MZ0A 1VSVA 5ENZA 1AXEA 3OCZA 4Q4AB 3ZD8A 4R7ZA 1LI5A 4U0JA 1IOWA 4X95A 2W5UA 4KACA 5ALDA 4EFDA 1N78A 1R9JA 1Y8QB 1YGYA 4LGVA 2RHMA 1YMUA 5HM8A 5TC4A 3IA2A 2OESA 3MXTA 3GA5A 3WLJA 3UC9A 4NONA 3QTTA 4ZDJA 5EZYF 4HUQB 1ZK2A 3R7NA 1VA4A 2GZ2A 4KO3S 3KQKA 4DMKA 1XMVA 2OCPA 2HK7A 2HUNA 3HG7A 3WB1A 3EFEA 2H7VA 3T95A 3G5UA 4UBOA 4W6QA 5FUXA 2H2FA 2EQ5A 2O8DB 1L8LA 2COKA 4ZEOA 1NMQA 3CW8X 2JEYA 4H35A 1SH7A 4GYWA 2CXXA 3ZXXA 1KDRA 4WZAB 4BMZA 1HH4A 1T2VA 5SYNA 4B7XA 3TW0A 3SYLA 4OOFA 1LFDB 3CU5A 5LUBA 3F47A 3K0AB 4X93A 2FMUA 2IOFK 1MA3A 3AYZB 3MRTA 3CNBA 1ZRHA 3NRCA 4HAYA 5LOVB 4D3FA 1IOVA 2DWCA 3EEIA 3VU0A 3REFA 3GGGA 2HHCA 4G1VA 1F0NA 2OILA 4PBSA 3SS8A 4LXHA 2P1ZA 5H4GA 2QLNA 1U6JA 3QX9A 1X0VA 1ZY2A 4G5XA 3RHFA 3F4BA 2QRZA 3HDHA 2YBDA 3NTQA 4RVDA 3WV5A 1NI4B 3DZKA 4N8SA 4EOGA 1KH2A 4RZHA 2AK3A 1X7YA 3Q8XB 3R5FA 4G0OA 1PGOA 4NOJA 3SVTA 5KOYA 3TX6A 1EUDA 5BVGA 1KJ8A 3MGBA 2M98A 3AYXB 3REGA 4NL4H 4QT4A 2HJVA 4AN0A 1GQOA 2WTMA 1YMVA 2AWOA 4I1IA 5AOCA 1WBDA 5IVIA 1NVBA 4FDTA 4RFSB 2FEOA 2QJFA 4R2IA 4OB6A 2QB5A 3GELA 1KI8A 2FSFA 1LPMA 2YHBA 2I54A 2PR2A 2AJ8A 2IYAA 1UJ5A 2AF3C 3T9EA 5F98A 4AN4A 5KIAA 3F3SA 5AMXA 3MQFA 1FDWA 4AYTA 2WIKA 3ZVLA 2C9ZA 5J23A 1OBOA 2BFNA 4UOQA 1F2UA 2D5IA 1U4OA 4HDSB 4XGIA 3H6KA 3KKMA 4ND4A 4DADA 4JROA 1TJPB 1WXFA 2HCTA 3ADKA 2HMVA 1WXEA 4IOMA 5LBIA 1TKCA 2QLFA 2PH1A 4ZVMA 3S2FA 4DKXA 1W0KA 3T1TA 2ZK7A 2UUAB 5KNBD 1MB3A 1Y48E 1RHJA 2O20A 1IHPA 2QMYA 3KPWA 4IJWA 1QGZA 3AP1A