1USWA

Crystal structure of ferulic acid esterase from aspergillus niger
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
260
structure length
260
Chain Sequence
ASTQGISEDLYNRLVEMATISQAAYADLCNIPSTIIKGEKIYNAQTDINGWILRDDTSKEIITVFRGTGSDTNLQLDTNYTLTPFDTLPQCNDCEVHGGYYIGWISVQDQVESLVKQQASQYPDYALTVTGHSLGASMAALTAAQLSATYDNVRLYTFGEPRSGNQAFASYMNDAFQVSSPETTQYFRVTHSNDGIPNLPPADEGYAHGGVEYWSVDPYSAQNTFVCTGDEVQCCEAQGGQGVNDAHTTYFGMTSGACTW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERULOYL ESTERASE A
publication title The Crystal Structure of Feruloyl Esterase a from Aspergillus Niger Suggests Evolutive Functional Convergence in Feruloyl Esterase Family
pubmed doi rcsb
source organism Aspergillus niger
molecule tags Hydrolase
total genus 84
structure length 260
sequence length 260
ec nomenclature ec 3.1.1.73: Feruloyl esterase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01764 Lipase_3 Lipase (class 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1uswA00
2G63A 4FLMA 4HXGA 4OU5A 4P93A 4UBJA 4EB0A 5HK8A 1LNSA 5ALIA 1KU6A 3D2CA 2WG1A 5AI4A 5H3HA 4G1FA 2VJDA 2X8BA 5ALJA 5E2IA 1YAHA 4WJLA 4UBOA 6YASA 4CI9A 3D2BA 1FFEA 1AURA 1NX9A 4IH4A 2ZYSA 1VE6A 5C7YA 2WHPA 3QMWA 4H7KA 4C4XA 5K3FB 2BJHA 2WG2A 3M82A 3WMRA 2I03A 4Q3KA 4K6GA 5CT8A 1CUBA 4ITVA 1TIBA 2QOEA 1ETHA 1EB9A 2ZJ7A 3AZOA 3C87A 3IULA 4ROTA 1L7RA 1Y7IA 3EBLA 3V1LA 1ZGCA 3D4LA 4Q3OA 3WL8A 1T2NA 4AX4A 5C8VA 5A2GA 1LPSA 1T4MA 2VATA 4M0EA 4KE9A 4E11A 1E8MA 1VXOA 3WWEA 3T4UA 5D3ZA 4KE6A 1CR6A 1LZLA 4FHZA 4BP9A 5CRIA 1E5TA 5ALMA 1XLUA 3V1MA 1HQDA 2DQYA 4B9EA 5ISMA 4QDXA 3QZUA 1DX6A 2BUAA 1AGYA 5AK3A 1R4ZA 1MN6A 1CUYA 4HRYA 1WB6A 5BWBA 3AILA 4JYMA 1R88A 2HA7A 3I6ZA 2DHEA 2WTMA 2P8SA 1GQRA 2OGTA 1MNQA 5I7UA 4LYDA 2BCEA 3C8DA 3E4DA 1BE0A 4N5HX 2BFNA 1X70A 3H1AA 5AI5A 3STVA 3H2GA 4X6YA 2XMRA 5IH7A 5KWIA 3H04A 2ACKA 3V1NA 5JIBA 2HRQA 3STWA 4WDRA 4B82A 3BJMA 3PICA 3WJ2A 3GA7A 3AIOA 3ICWA 5D3KA 1YS1X 2RI6A 5AM3A 3R3XA 1XLVA 3WYNA 5DTIA 1CLEA 3EF3A 2GBIA 4TVKA 4QZVA 2XQIA 1H2YA 4YPVA 4W63A 3WA6A 3T52A 2ZYRA 4FFWA 2Q0XA 5JATA 2OLEA 2WKWA 3BIWA 2ZVDA 2D5LA 1RP1A 3F96A 2PKYX 4BTLA 4JH0A 2OCGA 5CW2A 3I2IA 2JF0A 1TQHA 3WKBA 2CKMA 2YASA 4U2FA 4P9NA 2QUAA 2OXEA 3FLBA 2XUJA 1N8SA 3AIKA 1TKRA 2BGRA 4EY4A 5K3BA 5CMLA 2RAUA 5E4JA 3LP5A 1J2EA 2HA6A 3ESDA 3ICVA 3G9ZA 5ALHA 4UPDA 3JW8A 1DTEA 1YB6A 4Q05A 4LXHA 1PJAA 4KJXA 5K3CA 5EHXA 4PSCA 1LBTA 2WHQA 1IZ8A 2HA0A 2Y1KA 4MEBA 4HVTA 3ZPXA 1YCDA 5JASA 1FJ2A 3O4HA 1W75A 4NVRA 4XJVA 4UBMA 2C5GA 1HBJA 2ECFA 3H18A 5E4TA 3ESCA 3M3DA 3WWPA 3MUNA 1EX9A 1XZDA 1P0MA 5CT9A 3PFCA 3CN7A 3U0VA 1YA8A 4BCDA 1TRHA 2WUDA 5LYYA 3FVTA 2OPHA 1XRRA 3IBTA 2XLCA 4QLOA 2GYUA 4HTAA 1HDEA 5A7FA 3D7RA 3PFBA 3CXUA 2C5FA 3FYTA 3C5WP 4W1PA 4UHCA 3FVRA 5JANA 1CUVA 1KU0A 1K8QA 2Z8ZA 4AB1A 2PSFA 1VKHA 4EA6A 2XMSA 2HIHA 3C45A 4BRZA 4N8SA 4MEAA 2Z8XA 4ZRDA 2JGJA 1VE7A 4AQDA 4GBGA 4CG1A 2VTVA 3IUQA 5I9IA 5JD5A 3PE6A 5AOAA 4EY5A 4ZV9A 2WM2A 2VQ6A 4Y2SA 5EFZA 1XRQA 1ORVA 1H2XA 5CH5A 4KACA 5FLKA 4G4JA 5IKXA 5A6VA 1ZIXA 3I1YA 4EY6A 2OAEA 5JYCA 3W05A 1AX9A 3I2GA 2XUQA 2XMGA 2HADA 3FCXA 3O4JA 2CZQA 1XZBA 1UWCA 1CUUA 3R3VA 5SYMA 3IUMA 4H7EA 1JMYA 1OILA 1X2BA 2JEZA 3DLTA 4HAIA 3DDUA 4J0JA 2DSNA 3HEAA 3ANSA 4ZWNA 4YK7A 7YASA 3F9CA 2RIPA 3VDXA 3W9UA 1UZAA 5JAPA 2WUGA 2XMBA 1CQZA 3BIXA 1XZMA 2GZSA 1UKCA 4QDTA 3S2ZA 4LIPD 4AMYA 5DYWA 4C87A 5CH8A 3EIOA 1CUXA 1L7AA 4H7DA 3CN9A 4W1QA 4OYLA 4FTWA 4J03A 5HKBA 1K63A 5LKRA 4F0JA 3QMVA 1WOMA 1TK3A 2PPLA 2ZYHA 4F5ZA 3O4GA 2H7CA 1Z68A 1CFJA 5T4FA 5BV7A 2QZPA 2AJBA 2I3DA 3WWDA 1BN6A 4P92A 2X5XA 4JEIA 4CG3A 4EY7A 3AIMA 1EH5A 4ETWA 1TCBA 3W9BA 5A7HA 4FLFA 1XZCA 1D07A 3WA7A 1SOMA 2QKYA 4L9AA 5CT5A 3OPMA 1DQYA 1L7QA 3UMJA 5HZGA 2RHTA 1QFSA 3I6MA 3V9AA 3H2JA 1GPKA 3WK6A 2C4HA 5AKKA 5KWJA 2QJRA 1USWA 4Q1VA 1QIIA 2QT9A 2ROQA 4X91A 1FFAA 3H2IA 4K2AA 4KAAA 5LKAA 1ZD4A 3VVMA 3Q0TA 1VZ3A 3A6ZA 3H2HA 3CCBA 4WFIA 2WIDA 2WIFA 3A2NA 4C89A 1CUWA 5AIAA 2QS9A 1UXOA 4PO3X 2C0QA 2VJCA 5SYNA 3WL5A 2VF2A 1XZHA 1U65A 3AFIA 3EQ8A 1YR2A 2QXTA 2QXUA 4DSAA 1QFMA 4HZGA 4OSEA 4OU4A 1QIEA 5JD4A 3IURA 4N5IX 4B6GA 1RYYA 2WSLA 1XZEA 5EGNA 2ZJFA 1JU4A 1R3DA 5E4YA 1QOZA 5IVHA 4FWBA 1UK8A 4U2EA 3TJMA 2AJDA 4B84A 2PM8A 3O4IA 4XIIA 3O0DA 2HA4A 3WK7A 2UZ0A 1A88A 1AMNA 4BAUA 4RE5A 5HF9A 4BVJA 3I2KA 1R9MA 2H7YA 4B83A 2VJAA 3E3AA 2WUEA 3VJLA 1BEEA 1ZGBA 1CRLA 4H7HA 3ESAA 3JYHA 1LBSA 4QDOA 3KXPA 5FDFA 2GBFA 2JGIA 1CPYA 3VKFA 1VXRA 3PF9A 3QH4A 4KAJA 5CTAA 3TGLA 2B4KA 2XQKA 4MXDA 1O6GA 3S8YA 2EDAA 2JGEA 2FX5A 3R0VA 4BCBA 4MQLA 1THGA 2RONA 1EI9A 1TCCA 3WWOA 2PSJA 3H1BA 2HM7A 3H2KA 2OGZA 4UFNA 1F0NA 1YASA 3ZV7A 1YSCA 3G0CA 4AZ0A 4PV7A 4U2DA 1UOPA 5FP0A 1N1MA 3W06A 2B9VA 3WKAA 5JAHA 3O95A 1BEZA 1LLFA 5LIPA 2WHPB 5AM1A 1P0IA 1CIJA 1Q83A 1DWQA 1MPXA 3B12A 3FSGD 3R3WA 2WJ6A 3DYIA 2HL6A 3IVMA 3OOSA 4BDTA 1AC5A 4WFJA 4QNNA 3BF7A 3VXKA 4E46A 1GPLA 3BE8A 2ZSIA 2IX9A 3AZQA 1DT5A 2XUOA 4ZXFA 1DX4A 1IUNA 2XUKA 4DM7A 3WL6A 1QGED 2WIGA 3QBJA 1EA5A 3KD2A 4MWSA 1XRMA 4J0CA 3A2MA 4X92A 1CUFA 1SCQA 5CXUA 5A7GA 4G4IA 1QJ4A 2I78A 5ALWA 5ALVA 4O08A 5ALLA 2O2IA 2XQFA 4QWWA 4Y2XA 3C43A 5ALSA 2NW6A 5JD6A 4PSUA 2CMFA 3STUA 1H2ZA 2Z3ZA 2XLBA 3OTQA 1QIKA 1P0QA 5LZ7A 2AJCA 1LPBB 4JNCA 1A8QA 1CUSA 2H1IA 1LPAB 2AXEA 4YASA 4Z49A 3HYSA 3F67A 3VISA 4J7AA 2IITA 3WL7A 5ALTA 1K6EA 2PUJA 2C7BA 4GDMA 3KWFA 3HJUA 2D0DA 4ZGBA 3G9TA 4GECA 1XQYA 4UHHA 1ZD5A 2OQIA 2WU3A 2XMDA 2YYSA 3HLKA 4IH1A 2QRUA 3I28A 3PI6A 5FRDA 1VLQA 2JGMA 1XZGA 5CH3A 1ZJ4A 1UK9A 2J4CA 5AM0A 4IO0A 4IQ4A 4UBIA 5EHZA 3DYVA 2HFJA 2HHAA 2YXPX 4C4YA 4L3WA 4UBLA 4BBZA 2OCLA 3OM8A 1XZLA 4Y2TA 3N0TA 1ZOIA 1H23A 2ACEA 4OD0A 5LZ5A 1OXMA 4Q3LA 4G9GA 1CUJA 4H7JA 1EXWA 1XZAA 1JJBA 2ZSHA 1IUOA 1WM1A 2HRRA 4PSDA 4Y2VA 3N2ZB 4DLNA 5F4ZA 3SC2A 4MYSA 2Y6UA 3O9MA 3BDVA 1ACLA 5AI6A 2PU5A 4LXGA 2PSHA 2QJWA 1MX5A 5ALGA 2AJLI 2BUCA 2Y2UA 1VA5A 2XUHA 2XUDA 5ALFA 4KRYA 4DNPA 1SCKA 4GEGA 2Z3WA 3SX4A 3K2IA 1FFCA 3PDCA 3L1HA 4KR0A 4BE4A 5DNVA 3SK0A 2DFPA 2Z5GA 3QVMA 1AZWA 1BCRA 4W9RA 5JAUA 2DR0A 4D9JA 3KDAA 1XQWA 5JAOA 3D3NA 1JT2A 2QMQA 4H0CA 4OB8A 2HDWA 3WZMA 2VA9A 1DWOA 2EEPA 2WLSA 4DMKA 5FPQA 4AZ3A 5KBYA 1I6WA 1JMKC 3WK8A 1H22A 1CUHA 3M81A 2WG0A 4RGYA 4X7BA 4FKBA 1R1DA 3AINA 5AKJA 4U2BA 4A16A 4IHAA 2ZYIA 4BCCA 2E3JA 3R3UA 5ALUA 1EK1A 5AI8A 1F8UA 4Q34A 3WLAA 3G0BA 2OGSA 4BC0A 5I8PA 3HACA 5D7BA 2VJBA 3L1JA 1XZKA 1XQXA 1PV1A 4Y7DA 3R3YA 4P08A 2OCKA 1S8OA 1G42A 3WK5A 4X97A 4Y2QA 1MAAA 3C5VA 3QYJA 4A23A 3WK4A 2BAGA 1XZFA 4HXEB 2FJPA 2QUBA 4I4CA 3C70A 5ALKA 5DYTA 2EDCA 4DNOA 3KWJA 1X2EA 1XLWA 2PSDA 3PUHA 4BATA 3GZJA 3FYUC 1CQWA 4NZZA 4DNFA 2WILA 5BWCA 2V9ZA 4OUKX 4G8DA 4AMZA 2OCIA 4X3CA 1XROA 3R40A 1JJIA 5LZ2A 1U8EA 2HA2A 4HXFB 3QPAA 1XFDA 1CUDA 4FDMA 3FWHA 3HI4A 3A70A 5JZ9A 2BGNA 4J0GA 3DOIA 2QR5A 2X76A 3VJKA 3C8HA 1W52X 1B6GA 3WKCA 5LZ9A 3W04A 1ZJ5A 1WPRA 1NU6A 3IB3A 4WFKA 2H9YA 3I2JA 4J3JA 4J0HA 4YX9A 2PSEA 2PBLA 1O6FA 1B41A 2JBWA 5HF5A 4BRSA 1G66A 1N5RA 2I3ZA 2XT0A 5HFAA 5AK5A 4KE8A 1YS2X 1JKMA 4H35A 3TEJA 1UFOA 2DCMA 3G9UA 4N8DA 3K6KA 1ZD2P 1MTZA 3BL8A 1GXSA 5CURA 5K3EA 3GBSA 1MT3A 4UBNA 4BZZA 1CUGA 4G4GA 4H7FA 4ARBA 5AM5A 5A62A 3LIIA 1SC9A 3RARA 5ALRA 3FAKA 2VEOA 1EHYA 3QMMA 2OAGA 2PX6A 3WIBA 3WKEA 3WI7A 1J06A 4F21A 4RE6A 5AO9A 3HSSA 5T4HA 1JJFA 1HPLA 5AM2A 1CV2A 2GYVA 1PFQA 5KREA 3GFFA 1MNAA 3X3HA 2R11A 1WHTA 1CVLA 3G8YA 4OB6A 4CCWA 1AUOA 4BP8A 2DHCA 5IVKA 1P0PA 4PW0A 2CB9A 4PQEA 4F60A 4KRXA 2CEKA 1Y7HA 4K5QA 2WQZA 5AKYA 1W76A 4B81A 5ALEA 5HCUA 4B85A 1CUCA 1BRTA 5ESRA 1QTIA 3D0KA 4CIAA 5JADA 1NU8A 2HU7A 1UT6A 1QIMA 3WWCA 2BUBA 4IH9A 2PVSA 3OC0A 2W22A 1E8NA 4G8CA 4TGLA 5FUMA 3DOHA 2WTNA 5EIHA 1E89A 5FV4A 1QZ3A 4LYEA 5AKGA 4PF1A 2RHWA 1Q84A 2HFKA 3DEAA 2VSQA 3EQ9A 1E66A 1XZIA 3R41A 1GPNA 4B0PA 3H17A 3PF8A 2WUFA 2O2HA 4FBMA 4BVKA 1WB5A 4UBKA 2G5PA 3U1TA 1VA4A 2XE4A 5HF6A 4CCYA 1EDDA 5DJ5A 3HZOA 1JU3A 4X71A 5AIBA 3C6BA 5IVDA 5AM4A 1QO9A 1CUAA 4X90A 3UUEA 3IDAA 4J0IA 4CCYB 1WCYA 4INZA 2GYWA 4OYYA 5ALZA 4WDQA 5DYYA 1OCEA 1UKAA 2LIPA 4UHFA 5AKIA 2C58A 5C8ZA 3AJAA 1Q0ZA 3RK4A 5T4EA 4N8EA 2W6CX 4X6UA 4AO6A 4ZI5A 5ALNA 4XWGA 4AN0A 1FSSA 5EIEA 3IIIA 4QEKA 4K6HA 4BC1A 5AKZA 5DWDA 3DNMA 3STTA 4MQMA 4QA9A 3ILSA 4W1RA 3H0CA 5K3AA 4DMFA 4V2IA 4GWLA 4KEAA 5ALXA 4L72A 5AK6A 5K3FA 4OCZA 2FJ0A 4EY8A 5BOVA 1ODTC 3KOOA 3HABA 4MYDA 1CUEA 3VJMA 3W2TA 4DNQA 2O7VA 2HA3A 4KAFA 1W1IA 4WY5A 2CBGA 3RLIA 2K2QB 1E8DA 2WJ4A 5HQ3A 1WPXA 4UHDA 1UK6A 2WHRA 4I3FA 3ZLVA 1QTRA 4G9EA 4BB0A 2Y6VA 1IZ7A 4G5XA 1RWQA 5HQ3B 4CFSA 1TAHA 5AP9A 5HF8A 2XMZA 3V48A 1MO2A 5JZBA 1LPPA 4DGQA 1G4HA 2CJPA 1G5FA 3K9BA 1A7UA 4X95A 5FPPA 3QITA 1C4XA 4FBLA 2GBGA 1XRNA 3ED1A 2QM0A 5CT4A 3TRDA 2J3DA 5C8XA 2XUFA 4PNZA 1BCSA 2QTBA 4QLAA 5LZ4A 1BS9A 3C6XA 1DWPA 3G0IA 5J3JA 2WFMA 3QM1A 4XVCA 1IUPA 5K5EA 3ZLTA 5HKAA 2JEYA 1IMJA 2XB6A 2XUPA 3QPDA 4Y2YA 3STXA 1VJ5A 2ZJ6A 3DL7A 3NGMA 4A5SA 4J0DA 5JALA 5K3DA 2V97A 4UUQA 3H19A 1VOTA 4QE3A 4JUIA 3G02A 3V1KA 3I6YA 3JWEA 4GXNA 3D59A 4AO7A 1ODSA 4H18A 4J0KA 4M0FA 4Y2RA 3Q8WA 1A8UA 4E14A 4E15A 5AI9A 3GROA 3P2MA 3I2HA 3WZLA 1DU4A 4Y2JA 2VAXA 1MJ5A 1K4YA 4AXBA 5AK4A 1ODCA 4M0MA 4I19A 4TPKA 1ZD3A 4OPMA 2DHDA 4C4ZA 1E3QA 5DLPA 2GBCA 1U2EA 3MGAA 4ZV7A 1ORWA 1Q0RA 3SWWA 3BXPA 4GI1A 5CXXA 1UOQA 3YASA 4DMCA 4B0OA 3BF8A 4H77A 1FFBA 2J4FA 4BAGA 4ZREA 2XDWA 3E0XA 3DCNA 2J3QA 2R8BA 1HL7A 4BAZA 3MUOA 5ALYA 1XQVA 4CIBA 2XUAA 2JGFA 5YASA 4H7IA 4DMHA 1DQZA 5LLSA 2XMCA 3IA2A 1QO7A 3DKKA 4U2CA 1R9NA 2HU8A 1U4NA 4DTCA 3UUFA 3WKDA 3D5EA 1UKBA 1QIHA 4X93A 1EVQA 1GKLA 1M33A 3B3QA 5ALDA 1QONA 3DS8A 3ZWQA 2DQZA 4GLBA 1W6RA 5CBKA 4EUSA 3ZLUA 2WIJA 1C7JA 1Y37A 3G9XA 3FBWA 5FKJA 1SCIA 2B61A 2RGUA 3C6ZA 1XKLA 5ALOA 5AKXA 1QIJA 5JZSA 2WU4A 2Y2VA 4L0CA 3CCCA 1YAJA 2HU5A 3FLAA 4GHWA 3G0GA 1IVYA 1LGYA 1ZI9A 4XX1A 4DYHA 4S0XA 5AKHA 1VZ2A 2WFZA 3DL4A 4FNGA 5DNWA 4RNCA 1QLWA 2G5TA 4FNMA 2PUHA 3F97A 1WB4A 1QIDA 3WQHA 3AUKA 1BU8A 2H7XA 4B9AA 5FOQA 1HKHA 1CEXA 3KSRA 5LZ8A 3M83A 2WIKA 1EDEA 1LZKA 4Y2PA 2PU7A 4FLEA 3NUZA 5ALQA 5EIAA 1SFRA 4X85A 4WY8A 4K6KA 3ANTA 4Y9SA 3HRHA 4LHEA 5T4BA 4Y2UA 3HC7A 4Q82A 1GZ7A 2G4LA 3WIOA 3OURA 1BROA 1J1IA 5AOCA 5AH0A 3FNBA 4QDZA 1XZJA 1MX1A 5AKEA 1MX9A 1F6WA 4X00A 1N5MA 2O7RA 1MAHA 3LLCA 4U2GA 2ONCA 5D6OA 3NOXA 2IIVA 5EHNA 3E1GA 2V96A 4UHBA 1W4LA 2B20A 1J07A 2XQGA 1EVEA 1R50A 1ZI6A 1C7IA 5JARA 1EDBA 4BTVA 4NMWA 1QIFA 2OG1A 2AJ8A 3OG9A 2FUKA 2QVBA 3QPCA 4DSZA 2XMQA 1EINA 2V98A 4ARAA 3F98A 1LPMA 2C0PA 1UK7A 4MJ3A 3ZI7A 3DJYA 3PUIA 4QWMA 1XRLA 3A2LA 2VAVA 4OB7A 1A8SA 4X94A 4RPCA 5AHXA 2VT7A 3MVEA 2XUIA 1YB7A 2GZRA 1JFRA 1GKKA 2HA5A 3DD5A 3G7NA 1XKTA 3AZPA 2CUTA 3I2FA 1TCAA 1LPNA 4HRXA 4JYPA 2ES4A 3ESBA 1WHSA 3WYDA 4MWTA 5AI0A 3GELA 3HXKA 5DNUA 4UFOA 3IUJA 4QDUA 1QIGA 3R3ZA 2WJ3A 3WJ1A 5LP1A 3BJRA 3FOBA 1HLGA 1KEZA 4FMPA 3RKSA 1FFDA 4LXIA 4W1SA 3LCRA 4GW3A 1AQLA 4C88A 1DINA 1XRPA 5AJHA 1LPOA 1UOOA 3L1IA 4LKOA 1EB8A 5HFNA 3GUUA 1EK2A 3C6YA 5FXMA 1MU0A 4X6XA 5A71A 1GT6A 5AOBA 3DKRA 5DTJA 4BYMA 1ACJA 3STYA 4HS9A 2JGKA 1GGVA 4BDSA 3B5EA 4EHBA 5EI5A 3I1IA 2ORYA 4UFPA 1H2WA 1ZIYA 1DT3A 2BKLA 1BN7A 4FFVA 2PL5A 4FOLA 3BWXA 5ALPA 3D2AA 3F8SA 1CUZA 4EZIA 2YH2A 2VT6A 1K5PA 4UHEA 3WK9A 3FCYA 2O2GA 3FLEA 4AO8A 3G0DA 1JI3A 4BE9A 2XI4A 3FYUA 3FSGA 3DQZA 3LIPA 5HK9A 1QE3A 2WFLA 2XUGA 5IVIA 4KE7A 2OQVA 1ISPA 1F0PA 3NWOA 4BZWA 1THTA 1ZI8A 5AKLA 3FYUB 1YA4A 2JIDA 4C01A 5C81A 4BVLA 2JGLA 4B7ZA 2WFLB 5CT6A 4WCVA 4DIUA 1ZICA 3LS2A 1CUIA 3O9VA 5AICA 5EHQA 3VVLA 3RM3A 4G8BA 3EQ7A 4B80A 3IUNA 4NS4A 1AKNA 2XQJA 4KYVA 4EBBA 1GQSA 4C6HA 4AN1A 3BDIA 4CG2A
chains in the Genus database with same CATH superfamily
1KI4A 1J09A 5E9WA 5J2UF 2O2EA 3H11A 4MR8A 4FLMA 3PITA 3HCRA 4LWOA 1RXVA 4RK1A 1HSOA 1Z18A 1W5FA 2RHCA 1GQQA 4OU5A 2GXQA 3BA6A 2DEUA 4KX3A 5HK8A 3JR3A 1LNSA 4NPAA 3RJ9A 4FGZA 3D2CA 2F1JA 2DLCX 4XSHA 2GHQA 1SH7A 3BQ9A 4EZBA 1B73A 4MUFA 4DCOA 3NGXA 1FUKA 5IN4A 4JI7B 2EKDA 2IC5A 3RC9A 1JEOA 2XRYA 4IJMA 3HXMA 5EKDA 2GF2A 5JJKA 4CIWA 4EEXA 2FVXA 1TKBA 1ZKMA 1JFTA 1NXQA 1GU7A 1S89A 2JJYA 4DS3A 1CZUA 3RIGA 5BSVA 4FI3C 3HB1A 3MOIA 4CI9A 3U7QB 4BPBA 3IIKA 1E3SA 4DOMA 3QEMB 2GPJA 2QGNA 1FFEA 4RCYA 5ELXA 1AURA 1RRMA 1ETUA 4R8RA 4C0LA 2B3DA 2XCRB 2I6TA 3EEBA 5BUSA 2PUVA 5TQ2B 3P4YA 1NP7A 3D3WA 3IS3A 1K7XB 4K0KB 1NW3A 1SUAA 3OIWA 4FD3A 2CHFA 1XOIA 2PHZA 3CW8X 3GN2A 1KK0A 1TUIA 2NZVG 3PHHA 3QMWA 4C2UA 1KSHA 2UUCB 3ANYB 4HFMA 3M82A 4PXAA 2HOQA 4QNRA 3WMRA 4CFZA 4YCAA 1ZD1A 1YK1A 5EWJB 1HI9A 2PJZA 3O3CA 1NLUA 3AESB 3E9RA 4MCIA 1PT5A 2J85A 2ZJ0A 4LOHA 4L78A 1ETHA 4QBIA 1ZQ1A 3CKYA 1N7IA 3JVEA 2NUBA 3NCTA 4O4LB 2FEOA 1UPUA 3AZOA 4HPJB 2IYRA 4AMUA 1G98A 1UJBA 3G59A 4JIGA 4JSRA 5AUPB 3KJFA 3K9NA 3D6AA 4M1QA 4R16A 3I32A 1K8RA 3HR7A 4DE5A 5FT9A 2OFPA 4Z2YA 4DMGA 4B6FA 5IVPA 1L8XA 3ZDXB 4XTRA 4K9NA 4CTOA 5I7SA 1T24A 2WD8A 4FMCF 2CF5A 1XMOB 2QMHA 1M8PA 1L6RA 2BR3A 5ITWA 4RLQA 1E6CA 3LV8A 4XKJA 2WKRA 4BFCA 3CZQA 3MTBA 3DTTA 3S4YA 1AQNA 4OGKA 1OAOA 1CBUA 1US8B 1Z6XA 1PDOA 1V8ZA 3N6RA 3ELYA 1SQ5A 1VBFA 1DFGA 4IPTA 4DT1B 1I5OA 4BLUA 4H31A 2VATA 4DCNA 3LD9A 3PQ2A 1MHTA 4R2WA 2JRCA 1T9GR 4M0EA 3WYCA 1MIOB 1JHAA 3PI7A 4WXMA 4GC5A 4E11A 4DR7B 5C8YF 1QCYA 1U1EA 1VXOA 3M5CA 3T4UA 1T4CA 4TN1A 1P6XA 1M2WA 1RFLA 2HLNA 2IFTA 1YZQA 4GPTA 2EG5A 1CTQA 1CR6A 1POXA 2GD0A 4KI7A 4KVAA 3UK7A 4NL4H 4ZGWA 5JAMA 1Z13A 4BP9A 2JCGA 5DBFA 2VF7A 4LJRA 4XW2A 1T3TA 1OLSB 1SVUA 2R3SA 4NK4A 1G2PA 3E2MA 4KV7A 3RC3A 4ZICA 4LVUA 3W3ZB 3V1MA 2FRDA 1OFUX 2BPOA 4NJEB 4B9EA 1I2CA 2H11A 2Q7XA 1PW5A 4L5IA 3ISVA 3B6EA 1E3EA 1V16A 2ZB4A 3NFRA 2NAPA 1X15A 1JKJB 1DX6A 4NQRA 2QR2A 2PGXA 2YC2C 5FCDA 5I4KA 3RTCA 3RRJA 2H16A 1MN6A 2C4KA 3HVHA 2EWWA 1CQJB 3EH1A 5DF1A 4DREA 4YR7A 3AILA 4JYMA 2W42A 3QTTA 3GJ0A 3TF5A 4UZFA 4NFYA 4Y6PA 4R9VA 1GQRA 2CFOA 2I0FA 2JGDB 4ZALA 2OOSA 2MT9A 2NXCA 4BHTA 5L45A 1H5NA 3CPHA 1U2GC 3P0IA 1S2GA 3MSCA 1M2GA 1RC0A 1U0EA 3OCZA 4Q1BA 5LD2C 2NXEA 1VYTA 1U2DC 3OD5A 1O8BA 2PMKA 3AEQB 4N5HX 4R1QA 5EA2A 3W79A 2W2TA 1NFQA 3VNVA 2A1UA 2BFNA 3B1XA 1OSNA 2QTZA 3H1AA 3STVA 2WWIA 1XO1A 3H2GA 4HP8A 4QREA 1K9SA 5CW1A 3UV3A 3OQHA 2XGSA 1UADA 9LDBA 4KWCA 1AVTA 4KN6A 4KIGA 2ZZNA 3H99A 3AH8A 2HREA 3KJQA 4B82A 3M6UA 3BFPA 3N75A 4CMKA 2J5RA 4XUCA 1OIVA 3PICA 5KOHA 5KOJB 4R83A 5DLEA 3OX1A 4IYRA 4KQ2A 5AJXA 2O2ZA 3ND7A 4LFAB 1G6KA 4G1EB 3RWMB 5ES3A 2XKJE 3S5UA 4EG7A 2HPZA 4YAEA 2E55A 2RGGA 5K0LA 2IF0A 5ICEA 2VYVA 2A9VA 3WYNA 4ZEMA 4ESVA 2ZBUA 1RLJA 2BEUB 4BUZA 3KYBA 4KR7A 2GBIA 5E6RB 1A50B 4ND2A 5KU7A 3LQYA 3GJ7A 5A4DA 2ZUDA 1XNJA 1N33B 1VHLA 1P2DA 4CFYA 4MB2A 4FZRA 3KYDA 2WQ6A 1M6VA 4UVEA 3FVVA 4ZVTA 1GM5A 1E59A 4IHQA 4TTJA 3DD1A 4XWWA 2IYAA 3TXXA 1CIPA 5ADVA 4BNDB 1FLDA 3F4LA 4U8HA 3B38A 1TT5B 3ZHYA 1XD9A 5JATA 2B5OA 2HZ7A 2ORIA 3C24A 3NH9A 1MD9A 5JNLA 3DPIA 2QF7A 1CZLA 1GZUA 4JJ8A 1TXGA 1ULBA 1NUQA 4MMXB 5JCZA 2G40A 3AF2A 2XXAB 1PE0A 4JH0A 1ZUIA 4BTLA 3HHPA 5CW2A 2EKBA 1V5EA 1W48A 3HCOA 3SZGA 3I2IA 1M8JA 4RW0A 2JF0A 1O9GA 4DA9A 1A7JA 1EWVA 2DQSA 4XYEA 2P3LA 1KJYA 4HMPA 3KYIB 2C00A 2C4TA 1LJLA 3HR4A 4YO7A 5ESWA 1VSQA 4RFSA 5HFJA 2IYEA 1KZ4A 2FPGA 2GK4A 3K0CA 4KQ1A 5DM2A 5DCLA 4O33A 5CCDA 4NULA 3TQRA 4PTZA 4BKOA 4EPXA 1GL7A 4W7IA 5A3JA 4C04A 3BT7A 3AIKA 2IPAB 3MIIA 2BGRA 3OP4A 5AW1A 4M21A 2AL7A 5K3BA 3H83A 2B21A 4WEOA 5FPHA 3PC3A 5CIQA 1BGXT 4IF4A 4R8MA 4AVYA 3UMGA 1Z38A 4EUEA 2WWYA 3RVBA 5E4JA 3LP5A 4NYJR 1K2VN 1SCNE 3HN2A 2FOIA 3SBDA 3TD6A 2VNHA 3RDPA 3G9ZA 2NV6A 2IEGA 3KXIA 4TSFA 4Z7OB 1XAGA 4UPDA 3QMPA 3PUYA 3JW8A 4CKYA 1E96A 1M6HA 5CNKA 4ER5A 1BXZA 2BSXA 4B76A 4DBVO 1FYFA 2WSBA 4E4YA 3F1LA 3IVGA 4KFSA 3VO2A 4EY3A 4Q4LA 5L6MB 1Z3CA 1KSGA 5ED4A 5KNLA 3LVFO 4YBZA 5EHXA 1P74A 1YKSA 3AR4A 5LWHA 5MFZA 2AA3A 2Y1KA 2PL1A 1JDPA 3D64A 3HSKA 4DPKA 4E07A 3NRBA 4MEBA 4PBTA 4QFDA 2H65A 1XTVA 1PNRA 3PGXA 3ZPXA 5A5GA 1ESZA 4QELA 3RODA 5KDDA 5G4LA 5JASA 3RT9A 2IDZA 4MIYA 4D9HA 2OLJA 2JFWA 1UEIA 2DPYA 3R23A 1W75A 2X5OA 4NVRA 5KZMB 2GRUA 3IJ5A 5CVCA 2W90A 4KQIA 2DC1A 3Q2IA 1T0HB 3EGXA 2ECFA 4KXQA 2H51A 3I92A 1R74A 4P6VF 3I39X 3ANLA 5FHQA 4F5DA 1P7PA 1Y7PA 4FGWA 3ILHA 3ESCA 5C51B 5G3YA 2SECE 2O0HA 2BHSA 1YIAA 1Z7WA 1V96A 4E5MA 3WB1A 4U6NA 3R5HA 2BW0A 4K03A 2WTEA 1W0JD 3MUNA 2O59A 1JVSA 4Q12A 1EX9A 4IJ5A 1T35A 2NSJA 3FIJA 3ITNA 2A14A 2FN8A 2R6R1 1IPEA 3MYYA 4C4SA 5JDCA 2R1TA 1TVKB 4YCBA 2AQHA 4M83A 5FFMA 3GAAA 1YJXA 4C0QC 5KKCA 2Q4EA 3K09C 4OFWA 1Q0TA 3IV6A 1ANKA 2VZ9A 4CDRA 2RJ3A 5BWOA 5MN4A 2XYPA 3U60B 1K8YB 4AIRA 3FGNA 1X80B 4G0YA 3OO0A 1QYXA 1G18A 2OP0A 4X1IB 4Y6QA 4JLAA 5GM2A 3A3KA 4R01A 4BX9A 4HGPA 2OPHA 5IBPA 3O1IC 3R0XA 2XXBA 1W5TA 2GWHA 3QU4A 3JYLA 1R0XA 1XRRA 4J76A 4QLOA 2ZUTA 2R6GA 2CD7A 2FWJA 1GTL1 4GT1A 4QULA 1FTQA 2G3YA 1AXGA 1NUSA 4HTAA 1ENPA 1HDEA 3ASVA 5A7FA 4OHUA 4ENWA 2Q21A 4JT8A 3O93A 2C5FA 2H1WA 4PO1A 1TJPB 4UVDA 2F00A 3JYNA 4KNWA 4UTNA 2H00A 4HQ6A 4MUIA 3C5WP 1KP3A 1X1QA 4W1PA 3ROGA 4LZOA 3UYLA 4CMEA 4Z5XA 4IHKA 4UHCA 1CY7A 1QGDA 1M75A 2MR5A 2E4WA 4HDRB 4AJ2A 4MHTA 2I3GA 5ITSA 4OGLA 5JANA 1VBMA 3CH4B 4B31A 4YP9A 1K8QA 2Z8ZA 4OH1A 1ZGZA 4AB1A 3SEQA 1VKHA 3ETDA 3MD9A 1QHXA 3ORFA 4DUGA 2BEWA 2DHQA 3JR7A 4LY3A 1K6MA 2YN4A 1P5RA 3ZC3A 3WFJA 3WO0A 2XDAA 4MW5A 4RELA 4YBRA 1A9YA 2R1ZA 4CLEA 5BSKA 3AHGA 1BVHA 2JGJA 4ND5A 5K2OA 3FG9A 3L7KA 1KETA 4PHFA 1AMOA 1PVOA 3PXBA 2FPRA 2MDTA 4EHKA 5JD5A 3K0AB 1NMZA 4AY4A 4EY5A 3VHRA 3P9ZA 4S2UA 5BUCA 4I50A 4G67A 4CKWB 4G63A 5BXQC 1E9VA 4J75A 4RXUA 4Y2SA 1B8PA 5EFZA 4HATA 5JHHB 5LXTB 5TGDA 3NKLA 2C83A 5D3MA 1WKBA 1DPGA 2K7ZA 3OY2A 4BMYA 1QOQB 2FZWA 4LFCB 4I5FA 5SICE 1NQAO 3LVBA 3QVVA 4RETA 1C1DA 2C8KA 3KVVA 5FLKA 2O48X 4E5DA 4AJPA 3AVUA 3EGDA 4YIHA 1NIJA 4BFSA 1ZBDA 1PLLA 2LVBA 4DC0A 3I1YA 3ZOZA 1S6YA 2JH3A 2IE8A 1VBKA 3KUKA 3LCJA 3TOCA 3W05A 4R2IA 3RPEA 4U8GA 1R16A 3SFTA 1C9JA 1I3MA 2HADA 3H1FA 4WTOA 3FCXA 4G4SP 3GARA 3PIDA 2DP4E 3FFAA 3SKVA 3V3KA 3OT1A 1UWCA 1QCZA 4REOA 1Q3TA 3FNIA 3WGGA 1Y4DE 2H1HA 4ER7A 4ZVNA 3KOYA 4AG3A 1OV6A 1H65A 2JCBA 3U7HB 5BYKA 4H7EA 1JA1A 2PYZA 2UZIR 1MW9X 3RYIB 4DG9A 1OILA 5GJBA 3KP1A 3A1CA 3DV9A 3KU1A 3QKWA 5F73A 3RRNA 4AJJA 4GL2A 2JI4A 4PXSA 2R68A 5DN6D 3CX4A 4PSVA 4J0JA 3NWJA 2DSNA 3CEAA 4ZWNA 5CNIA 3OEEA 3LBFA 1O2DA 2Q27A 1QP7A 7MHTA 1E5LA 2WMDA 3OPVA 1LS1A 4KXWA 4AMGA 4BNUA 4KNYA 3Q1KA 1KAEA 3B9QA 2IXAA 1IAQA 5IDYA 3GLHA 1F2VA 1XZMA 1RLTA 1FNBA 1V71A 3PEUA 2GZSA 1UKCA 3LHFA 3U37A 4EK9A 3FTNA 4QLBA 5L3VA 1Q1EA 3HKDB 3QWIA 4QDTA 1GHTA 1ACMA 2QVCA 1E1CA 2QORA 4LY6A 4AXXA 2WPNA 4JJZA 4PHHA 3AF6A 1JR6A 2XOKD 3ZVNA 1FRNA 2Z58A 2GA9A 1OKKD 2OEPA 3WQSB 5IXJA 10MHA 3E15A 1PFVA 2J6BA 4M22A 2ZBQA 2FV8A 3HYCA 3NC1C 3QKRB 5CH8A 4CIDA 1LBEA 4S1VA 2GM9A 1K06A 3IE0A 1TVCA 1GDHA 2AOTB 1RQRA 1ONBA 4K6FA 1ZZGA 4D5EA 4MK4A 4R6WA 1EWTA 1LDBA 3G5UA 2I2AA 2HH9A 4OYLA 3N87A 3FMOB 1K63A 2PKWA 5LKRA 3GRVA 4F0JA 1Z45A 3QMVA 3MCTA 1WOMA 3SMVA 5BURA 1TK3A 6LDHA 4LF8B 1QH1B 5EJ5A 4X7RA 3L1UA 3W8FA 2VN8A 4DRXB 1UJ4A 3N7AA 3ADDA 4NAHA 3AJ9A 2X0NA 4K26A 4GOXA 4KR3A 1T3GA 3KU4A 1VE3A 2H7CA 3O4GA 1Z68A 3QA9A 1CFJA 4J49A 3X1MA 5C81A 5KYYB 2C5EA 4ZO9A 1P5ZB 1U9CA 1NDUA 2I3DA 3EQ6A 3NT2A 3VZCA 2O8DA 4D9MA 1FUYB 1NBMD 2QXYA 3KVRA 3IQWA 4P92A 4RD2A 4F04A 4LRSB 3X2EA 1H2BA 4I4TA 3HQ4O 4YRJA 4JR0A 1E7MA 1YACA 3L84A 1KNXA 5DT2A 4EY7A 4MS3B 2WYVA 4M9CA 2PT9A 4JGBA 4KXVA 4MQEA 3T5BA 1Z3IX 1DQRA 3FDZA 4NDNE 4XX0A 3OHPA 2ACVA 1VG8A 3EZFA 4KSYA 4NCKA 1CE8A 1R9JA 1T91A 2YXDA 4YT2A 3MWFA 4CWAA 3L7AA 2IOFA 1NTRA 4FN5A 3T8YA 3VR2D 4M9ZA 4US0R 4B17A 3UMJA 3CB2A 4G5SA 1R18A 4BN4A 2RHTA 1VMEA 1YHZA 1ZC3A 2C2WA 4XM0A 1KEKA 3RRYA 2F59A 3R0JA 4A6EA 2FFJA 3KFVA 1RXEA 3IX7A 1IQUA 2JA2A 1E7SA 2QYOA 1XVIA 2ODNA 3WK6A 3HLTA 3MBKA 3SYTA 1HDOA 1PEAA 4LF9B 2OOKA 3KKQA 1XYYA 1DIBA 2GEJA 2VNKA 4W5HA 2NU9B 4KMOA 5JAIA 3AHDA 1F7UA 1TTQB 4J16C 2FPIA 2XNDA 2VNSA 2FHSA 1GOTA 1USWA 2RG7A 2JLQA 4CMGA 5LDGA 1T6NA 1RZRD 2VRWA 3OJFA 4RDCA 5GPBA 3NETA 3O8NA 1ZY2A 3H2IA 4K2AA 5DOZA 4E09A 3I61A 3V8RA 3OE4A 4HNVA 2D1FA 3DWGA 2IH2A 1JLKA 1YFKA 1X1SA 2ZE8A 3ZR4B 3GRRA 1JHMA 2V5VA 3UV6A 5FFNA 2C29D 4JL5A 4LYAA 4YCSA 3UFXB 5HUQA 3ILXA 3HUDA 2OHHA 4NFHA 3AR6A 3W6UA 2GYYA 3Q6NA 1CX9B 5FA6A 3VVMA 1JAIA 4Z8XA 1YZUA 1V4NA 2CXQA 2P68A 3P9NA 4IZIA 2XUZA 3A6ZA 3ESYA 4D79A 3CCBA 4QHTA 4A2CA 1SQFA 4IIJB 1DO0A 2R1UA 3OICA 4CG1A 1WZ2A 2WIFA 5F7XA 1P77A 2ZRFA 4D8XA 1VMAA 4Q9NA 4C4TA 2R86A 2VJLA 2ZSBA 3OLYA 3WL5A 2J3MA 2VF2A 2HF8A 2PUAA 4WW0A 3F71A 5DP1A 4DLPA 1FE8A 1CJTC 3H6GA 3KEQA 2OBYA 5BSRA 4YUWA 2B92A 2R6HA 3SOZA 5I4IA 1EFPB 3T15A 1YR2A 4OI4A 1ZYUA 1DQSA 2D74A 2QXTA 4QPCA 2Q2VA 3LPMA 3TL2A 3HSYA 5BWNA 1JALA 4AWBA 1NUTA 1YV9A 1YKFA 1GPUA 2NPOA 3NH6A 1OH6A 3X43A 3ZDCA 1BE1A 2HIMA 4YRGA 5HMMA 13PKA 3IO5A 4OSEA 3HZRA 4R0NA 2Q5QA 4ALLA 2PGIA 3KJZA 1SKAA 1JR3A 2CXXA 5JD4A 2Z57A 3MJHA 4Z0PA 2QTWB 3JWPA 5EZ5A 3SPXA 1IB0A 3JQAD 1EZ4A 3CNLA 3N76A 4KIJA 3ZK8A 3K9LA 2CFSA 2C3MA 2JIOA 2H5LA 2BT4A 3UHPA 4YV1A 1UP6A 4A2WA 5TC4A 5HS4A 3VVCA 3WRXC 5ILQA 4LV5B 3ZJVA 3M2TA 5KYWB 5KPJA 4P1ZA 1PZEA 1NUAA 1UK8A 3M8KA 2YFQA 3TJMA 1X77A 1ZN8A 3VBCA 5IS2A 3IV7A 4CEJB 2AJDA 1I7DA 1L5GB 3FHJA 3KTDA 4NBVA 4CRWB 4YTEA 3IIMA 3IP5A 4P7BA 2IYQA 2YKGA 2NO7A 5BQXA 1QK4A 1MEOA 1Q19A 1RI5A 2PS1A 3ECSA 4QYMA 1T9AA 2QMYA 1L4EA 5KTNA 3EIFA 2YN0A 1RKUA 3VPXA 3U19A 3HXTA 2G8LA 1DFIA 3I2KA 1R9MA 3DLIA 2H7YA 1OLUB 1JR4A 4REQA 5BR8B 2HJ9A 2D1QA 3EIHA 1DDGA 5DI3B 5ICMA 3C15C 3K53A 3GLUA 4ID3A 1HQYE 1TMGE 1WDWB 2RARA 1UUFA 4PTLA 2OSVA 3ESAA 3JD3A 1JPVA 4MX8A 5KPDA 1SWVA 5F9HA 1OMOA 3LWZA 3KKPA 4XDGA 2O6HA 5FX2A 1XMJA 2R5FA 3EF1A 3A4YA 3KPWA 4LOAA 3KHUA 5IAAA 3OLQA 4GX5A 4XI9A 3TUIC 5L4LA 2DERA 5E9AA 4K05A 2WOOA 3DE3X 2B99A 1VXRA 2E21A 2P27A 3NWPA 3LDHA 1E9SA 3QH4A 4KAJA 3DB1A 5CTAA 4FOSA 4Z9XA 4DVGA 1N6LA 2B4KA 2IF2A 5JISA 2I4TA 4EPWA 3VOBA 2HPVA 1I10A 1UWKA 5FWAA 2CMHA 4Y9UA 3UQZA 2CBXA 4PEVA 1AQYA 1V1RA 3H0KA 3ROFA 2H2IA 2I6XA 2X4LA 4DLBA 5K99A 3AI7A 5H81A 5BMVA 5TSDA 1KQNA 2VUSA 4FEAA 4NY1A 1O6GA 3VZQA 1UZLA 1P7CA 3QVJA 4GXTA 1I8TA 2CWWA 2EDAA 2VWHA 4Z53A 2F4VB 1U7PA 2ZT5A 5EJ8A 1AO3A 6CHYA 2X8LA 5TMPA 1NOIA 5JR3A 1TM3E 5DGCA 3UEOA 3CG0A 1EI9A 4FUTA 3RVJA 4HDSB 1C9MA 5JT1A 2XIJA 3ND8A 3H1BA 3AV3A 5TMDA 3SY8A 3H2KA 3AR7A 4JJIA 2B1IA 3G7UA 2CJXA 5AVYA 3L6RA 4QVKA 1EUYA 1YQTA 2FSVA 4UW9A 3RHFA 3SEZA 2DH5A 3G0CA 4HUTA 4AZ0A 4EECA 5KSPA 2WM8A 1Z12A 5FI0B 2Q0QA 4PANA 1UFQA 4CCSA 5KTSA 2QQFA 2Q6TA 3BH7A 3A05A 1VP9A 5AQEA 1FP7A 2B4TO 1UOPA 4XOUA 1JQLB 5C34B 1CP2A 1KJQA 1TI7A 3W06A 4EM6A 1PGJA 3MJSA 5JVDA 1XL1A 4EHJA 2Q1SA 1EBFA 1IEVA 3G5MA 2BE9A 3RK1A 2C99A 5JAHA 4C0BA 5JH7F 2XMPA 4IZOA 4FDUA 1T9KA 3U1VA 1SCUA 2D7CA 1BEZA 2H2FA 2Q3CA 2QSJA 4MUXA 2BFMA 3SJBA 2HCJB 3KOMA 2V9CA 4FYWA 4WESB 3LYUA 1S01A 5F9FA 4XGKA 4NU5A 2G0NA 3ZWPA 4LQLA 2CYBA 3BCRA 3ZWWA 4JT2A 4QNMA 2WK1A 5JJLA 1DJMA 3NYIA 4TXLA 2PANA 4LYHA 1GG8A 3TPFA 2XZTA 1CIJA 1Z7YA 1Q83A 2OPBA 2Q8QA 3KQOA 4N47A 1DWQA 1MPXA 2C9BA 3B12A 4UU1A 4JBHA 4LWPA 3VM6A 4GFDA 1PV2A 4L73A 2WJ6A 5BN4A 2RE8A 2FQYA 1E1YA 4E31A 1AC5A 1OW3B 1M5RA 2O1SA 3EIQA 3QV1A 1TYZA 4WFJA 4GNRA 3LT2A 4NNJA 4E46A 3KKEA 3KTAB 1B42A 4C08A 1XP5A 2PMCA 5G2OA 4CKCB 3LL4A 5HKOA 4J1TC 4TQGA 2XUOA 1E4OA 2O1XA 2UZ1A 1NV9A 3BWEA 5AT1A 1DX4A 4ZAFA 1NQOA 1WWKA 3P26A 3A3PA 2HCFA 4YO8A 4NBKA 3WL6A 1W4RA 4RNDB 3FB4A 2FI1A 3WOHA 4Z1OA 1FB5A 1CJKC 2WRZA 4GF5A 3VH4A 4AJOA 1Z2DA 3KD2A 3IPXA 3W2IA 5CVJA 3FRJA 1B0UA 1S7GA 3F3YA 1QG6A 1XGKA 3RK0A 1CRQA 2JVKA 2Y1CA 3H7AA 2G83A 3RUAA 1HFEL 3OQNA 1VI6A 3WYEA 5SZIA 3SFZA 2C4WA 5CXUA 3EXFA 2CJFA 1RXWA 2RHRA 2VPZA 1ILWA 1I32A 3PVZA 4C5BA 3D54D 4G4IA 3L0PA 2CW5A 3DC7A 2GJ4A 3U44A 4RIHA 4WECA 3WX0A 1X86B 3Q2KA 1QJ4A 1E0AA 3DKPA 4XIFA 3HXPA 1HDRA 2Z2IA 1QS0A 5AJVB 4FWTA 4O2BA 5ALWA 5LOVF 3GL9A 2HSWA 3S99A 2O3TA 3CWCA 4HNAA 2VDUE 1J25A 5KNDH 1W8IA 1C7RA 2CMFA 4QXRA 3STUA 4D0SA 1VI5A 1J8YF 1HDGO 4RAQA 2X3FA 2XLBA 5EJGA 1ZJZA 3JRWA 1P0QA 4QPPA 1NYTA 3HCNA 4LZZA 4LMAA 3AM3A 4AF8A 1LPBB 2DM6A 1LSOA 1FX1A 4UE6A 2G5CA 1LPAB 4II2A 2IXEA 4ZCMA 1UMKA 1OOEA 2JC3A 3CO5A 2XNCA 5DEOA 3F0TA 5TJ9A 1T1RA 2FSHA 1W5SA 3IR6A 4C0KA 3PX7A 2VT3A 3DAGA 2QRPA 3KELA 5ALTA 4KXNA 1SXHA 3BSWA 3L82B 3MNFA 4ND6A 1N6NA 3DLCA 2IWHA 2AH5A 2WPDA 3OLCX 5CM8B 3HJUA 4F6LA 2PL9A 1NWCA 5DDIP 2V54A 1I0LA 4P3PA 3Q15C 4R1MA 4TVOA 1XQYA 1BE6A 3EEFA 1ODFA 1X7HA 1KJZA 2XMDA 4M0CA 4YALA 5KQGA 1NVXQ 1WLSA 2QRUA 1KYZA 1A97A 3I28A 2FZEA 1IB6A 2IPMA 2NUPB 3KT3A 1H93A 2OHVA 4GMKA 2ZAOA 3ENQA 2Z04A 3LDGA 1QVVA 1XZGA 3CLHA 1XMPA 4IF6A 2GQ0A 1IRIA 4CGZA 1ZJ4A 2JHGA 1K89A 1IBSA 2W8ZA 1S2OA 3NAQA 1DZ3A 1HE2A 3PKJA 4RVNA 2HUNA 3NCHA 1GZDA 4NJMA 3U7JA 3CVYA 5EJ7A 1SKUA 5EHZA 4UBIA 4KV9A 3FMVA 1O9BA 4DMRA 1L4HA 2BELA 3A6FA 1P44A 2H48A 3DYVA 1OTYA 4H3SA 1RP7A 4EFKA 2HHAA 4W8HA 1PZHA 2D3WA 4L3WA 4X8MA 1PGNA 3E3LA 4A8JC 1PX0A 1U98A 2RI0A 2V4MA 3OM8A 2DKOA 4ZO6A 3GOQA 1OBOA 5FH9A 4YUVA 1IN1A 1XZLA 3IP9A 5CJJA 4Y2TA 4ZD6A 4MKFA 3SQDA 3CNBA 1QSGA 3AUUA 4OV6B 5GOZA 4ZEOA 4WN9A 3VZSA 4XWKA 1KE1A 1I6KA 2Q1WA 4PG6A 2O5RA 1G20E 4UAJA 5LZ5A 2ZJ2A 4AP9A 4GKBA 2HWKA 1A9QA 1I2MA 2ZUUA 3SVLA 2IHUA 2JZCA 4G9GA 3ANNA 4I9NA 4BO5A 1FLVA 3UJ6A 1NN1A 1EXWA 4B4OA 2ID8A 3RUFA 2BFCB 2ZAIA 4LZLA 3UJCA 3WLHA 3FCSB 3M4ZA 1GGEA 5AVRA 1IUOA 1BW9B 4ND8B 2OZLA 2X8JA 3AUTA 2P65A 4OYRA 5BOSA 3E48A 3QF7A 4BJ6A 4LS3A 4LV8B 2NM0A 1WDTA 5F4ZA 1BX0A 2ZJAA 3I23A 3L49A 4IS2A 4LBZA 4PS1A 4HNUA 2GN2A 4Q4HA 3DP9A 5CPBA 3A26A 1RRFA 2N9UA 2X1HA 3MMXA 3OM0A 4NRDA 3UWPA 2QE7A 5HZMA 5K0BA 3AOGA 3T0FA 4QO8A 4WEQA 2UYOA 3UG7A 4E0BA 3GAZA 3PD7A 1ZNXA 2QJWA 3FPSA 4HWPA 4ZVSA 5HKKD 1ZN7A 3H5RA 1P18A 4GLFA 4GZ6A 2ONKA 1JHUA 5JD3A 2AJLI 1K92A 1R4AA 2GJ8A 4Y0VA 2A8YA 5HJEA 2AYYA 3KHTA 4QQFA 3CH6A 1RHMA 5JRDS 4ZHQB 5JXGA 2PVCA 2XUHA 1GCOA 4ZIRA 1G1MA 1HTWA 5ALFA 3GMDA 2XRZA 1KI6A 1FFXB 1NJ5A 2O8EB 3RREA 4UTZA 5LYJF 2GZHA 2PZAA 1QBKC 2Y27A 4PTYA 2JFPA 3K20A 1DSSG 3FKQA 4O4IB 2MSWA 2POCA 2FWIA 2A84A 3FROA 4KRYA 4M1WA 3W7BA 4A0QA 4HEJA 2MHCA 1YZKA 3IHLA 4BNWA 1SUIA 1W93A 5CVUA 3PRJA 1JPNA 2Z3WA 3DB2A 4URVR 1TYCA 4DLXA 1MENA 4KDRA 1AZSC 2B30A 1PFKA 1U0FA 3LDUA 4YJGB 1A9PA 5E3IA 4G0VA 4K9QA 4Y6SA 4GXRA 4AKGA 3H8SA 5FR1A 3L1HA 4KR0A 1P91A 1S9DA 3PC8C 1U2PA 5DNVA 3TRHA 4AJIA 3EIEA 4L16A 3CG4A 1ZR2A 4RTMA 1PK7A 1JNXX 2Z5GA 5FLEX 1JKFA 4LF5B 1F48A 1J56A 1KYXA 2ZI7A 1Y48E 3R5SA 4EB6A 1HLFA 1N9KA 2ODPA 2ZPUA 5JYDA 1I24A 1DC8A 1CZNA 5DHUA 4W9RA 5FBKA 3RTEA 4CV1A 1C8KA 1Z06A 4OO3A 1XQWA 3PNQA 1QFZA 1KR5A 3F78A 3DNFA 4WSOA 2AUNA 3TTVA 4V1CA 5JAOA 1F38A 3PJGA 4G0WA 2ZXEA 4GM0A 1KO4A 2BEVA 2VA9A 3BPSA 3T7AA 1ULHA 4I4IA 4GP9A 4QUGA 4Z9BA 3ZCSA 5B58C 2QRQA 4JU9A 1ODKA 2FQQA 5ARDA 1RSZA 1G19A 1I6WA 2AG6A 1WUYA 3T9CA 4ENRA 1IN4A 4GMFA 2IYPA 2OKGA 4PQRA 4W9NC 1H22A 2UZAA 3L0ZA 5KYUA 1H8HA 2VS1A 1CUHA 2N3ZA 2AOVA 3M81A 4WD3A 4TLEA 4YI5A 2AG1A 3TUJC 4G3XA 1PF7E 3AEUB 3IUSA 4TLBA 5I48A 2Q3EA 3PLNA 4OOFA 1WY5A 4O5OA 4A8TA 4MCAA 5J47A 1GG5A 3GOHA 3NTUA 3RTBA 1AQ6A 4W6QA 1U2SA 2CUKA 3I0NA 3M6IA 3RUHA 1Z0UA 1VCNA 4MYUA 3MRXA 1KXZA 2ZYIA 1FVXA 4OEHA 1U6IA 4EYQA 1GKYA 4B6EA 3F7TA 5MGBA 4NOJA 1T5OA 1EK1A 1GNTA 1KMNA 2ZROA 4DCUA 1KEPA 2GLTA 1KVRA 4QTXA 1J0EA 1E1NA 1EGQA 1JIVA 1V3VA 1T0BA 4L4SA 3TQIA 3FJYA 2OGSA 3WLAA 4CKEB 1FXSA 2GPSA 1RYBA 3TH5A 3LC0A 4HAXA 3RC8A 3AERB 3HACA 3KPVA 1ID8A 1V3TA 1OXKB 2REQB 4TL9A 2OXTA 2VF8A 1T1GA 1F9EA 2VJBA 3I73A 4KQKA 4OJQA 3NHAA 3ROEA 5IBCA 2JKZA 4RO0A 5EXDA 4D0GA 5K7SA 3WGUA 1HM5A 4XJXA 4K1XA 4PM4A 2ATXA 4NX2A 1J4AA 4FE3A 3HBMA 2XWPA 4AKEA 4DW8A 3Q9UA 3GLGB 2BGIA 2GVDC 4ARZA 4MGZR 5IXSA 1IWPB 1NW9B 5LD2B 3R3YA 1DBWA 5SY9A 2YY6A 3MG9A 3PJDA 3B53X 3SU8A 3WG9A 3B5IA 3UA4A 3V4OA 1F9AA 1GUZA 3NDJA 1N4DA 2BBOA 3ODPA 4XASA 4KAXA 4B7AA 5LPNA 3O4FA 2IP2A 2XTMA 1KHHA 1W44A 3IUPA 3QYJA 4G5YA 3R9KA 4R2LA 3EVBA 2BAGA 2LPMA 2YJ4A 3DV2A 2ZR9A 1AD2A 1RBYA 2ZE5A 3THRA 1PBTA 5J2TA 1TL7C 4QARA 5DYTA 3KYCB 4IXWA 3UAWA 1IBLB 2IH4A 3KWJA 3F7OA 1HA3A 5JRJA 1O1YA 5EN4A 1KSFX 3CUYA 4P98A 3HR8A 1C29B 2EBUA 2DFVA 3MSXA 2IZOA 7AT1A 5KKNB 1I01A 3OBBA 3PUHA 3UT0A 1QMGA 1ODIA 5ITZA 3A31A 1HO3A 4O1HA 3GZJA 4AM8A 1NXSA 3BMCA 4X3OA 4YWJA 3OQ1A 5EKUA 3W0LB 3DOOA 4PR3A 1YJ8A 2FQWA 1XZNA 1FFSA 4UAVA 3NHYA 3KLBA 4Q3CA 5IP5A 4AMZA 5FORA 1XROA 3R40A 3CLUD 1QQTA 2NO4A 3DE7X 4BS9A 1KK1A 3D9QX 4HDNA 4NZYA 3SKYA 1CS0A 2HA2A 4HXFB 1RIFA 4DSOA 2HF9A 1XFDA 2QU7A 4GOKA 4XFDA 4UKDA 3GFBA 1Y3FE 2JGNA 2QENA 3LKBA 2JASA 4ND4A 3UAGA 1Z29A 5BORA 1RI3A 2Q62A 1FU7A 1UPTA 1EIWA 3NR2A 4FCWA 4MV7A 3T54A 1BFDA 1W52X 3K4PA 3O8QA 2JZOA 1AA6A 5AW3A 4C7OB 2G0TA 3DCYA 3F6CA 4MS1A 3MS2A 3B5JA 3W04A 3PUWA 4PY2A 3CM0A 5EJIA 3GZNB 5CB4B 1KFJB 4J3JA 1FRVA 2X9QA 2R8ZA 2X0KA 4P2GA 3WGYA 3I01M 1E5VA 5FNVB 5DNYB 1C9KA 2PSEA 2GNPA 3HJTA 3JQ9C 3K0FA 4O5AA 2HCRA 2LD4A 4P33A 2JBWA 2D59A 1XTIA 3E53A 2HIGA 4XQGA 1NDQA 3HCPA 5DM4A 1S5PA 4DIDA 1H2RS 1KC3A 3OSZA 3C3JA 1BHO1 1WY7A 4UDYX 3X1KA 1G8YA 2G8NA 2HNBA 2I3ZA 2QT1A 4BRSA 1WABA 3AHIA 3U7GA 4O8ZA 5KVVA 1F1BA 3PFFA 2R48A 3B6IA 4KE8A 16PKA 4QQNA 1I3CA 1YS2X 2I9PA 2P9FA 5CVDA 4HV4A 1JKMA 4E5SA 4BKPA 1UFOA 3GG9A 5H82A 3E5RA 2ZSJA 2X9VA 3VHXB 4ZT4A 4EARA 4N8DA 3T7KA 4J6FA 2NNWB 4WZBA 1MTZA 2PTGA 5CLHA 1AXEA 2Q3LA 1PFYA 4HNHA 5CLFA 1OD6A 4UVHA 3VR3A 2HDOA 3HVJA 2NO5A 3JQAB 4GKKB 1OXXK 4R3NA 5AM5A 1J70A 4UC0A 1GRQA 3TEFA 3VVBA 3CEMA 2IGTA 3RARA 4E1BA 5ALRA 2CD9A 1YB1A 3FAKA 3UKJA 3UJDA 2RGCA 3QMMA 5BWMA 3BXHA 3PGJA 3JPYA 1N6KA 2OHXA 2PXCA 3IH5A 3LQ2A 4A4DA 2PX6A 3THWB 3A4NA 4YMVA 1BJRE 2AXPA 3LF2A 4UCXA 5A0FA 3WKEA 3H9BA 4GPIB 1V0JA 3VSBA 3TKYA 4O3FA 4F85A 4GR9A 2OXIA 3UWSA 1P29A 1T2UA 5CJ2A 2NO1A 1X7XB 1XUOA 4MQ6A 4E32A 3NANA 1SQ6A 1Y1SA 4TSRA 1NMYA 3G49A 4JWKA 4MDHA 4Z4GA 3R8CA 3DE0X 1VIAA 3GQBB 5EGSA 1JSLA 1DAPA 5AO9A 5T4HA 1JJFA 4LKRA 4EGJA 1I33A 2GEVA 3NHRA 4XPIA 3R9XB 2NU7A 3V4VB 4FOOA 1CV2A 2GYVA 1PFQA 5KREA 2NXJA 3QE0A 4UEWA 3LPAA 2J7PA 2I8AA 1L7NA 4Y1EA 1UT5A 2IZ7A 4TMZA 4UVGA 4YFYA 1U7HA 3SGLA 3F46A 3MELA 4JUCA 2JK0A 4P84A 4PX2A 3G8YA 4OB6A 2BDEA 5FWYA 2ZREA 4FPXA 3KSDO 4IZHA 4LGYA 4BP8A 3KSMA 2DHCA 2SHKA 4EEZA 2PH3A 5IVKA 5IKEA 1G21B 3BJIC 1GV0A 1I3LA 1Z4IA 2GHRA 2TRSB 5KVQA 3SG0A 1IOWA 4MVJP 4EF5A 1MVLA 3GR6A 3G82C 3ZVKA 3GJSA 1MTOA 4HVCA 3E22B 2F8TA 2C54A 4R1OA 1AGRA 2ETVA 2ATVA 1DMSA 2FTKE 2VK1A 3L1VA 4WERA 4ZU1X 5BN3B 3JZFA 1DBSA 3N2YA 4MA4A 5FOWA 4BL5A 4IUCS 5AKYA 3H9GA 2DX7A 2IDMA 4PAWA 5JS1A 3K2EA 4OQQA 4Y9RA 1CDOA 3DXFA 3OF5A 5JXIA 3K6JA 1AKTA 5K0NA 4F6CA 2GN4A 1ZRHA 2O23A 3KLNA 4KOEC 3FTFA 1P0FA 4Z1MD 1P1KA 2V3CC 3JTMA 1QTIA 1TW2A 3CLSC 1L5HA 4BMZA 5KNCH 3INRA 3IJPA 3M9LA 1G4UR 5EC8A 1UPCA 3TZKA 4EPYA 5DHSA 2VDQB 3WXMA 3KYJB 3WWCA 4DJFC 3CLKA 1A7AA 2QW8A 2BUBA 5CLIA 5SYAA 4B87A 3JASB 3TX2A 1SCDA 2VAWA 2X5KO 2ZIEA 1C7ZA 2AUTA 3AF4A 2B0JA 3EZ7A 1XJQA 2RBGA 2WYHA 1E8NA 2DGDA 4TUYB 3WBBA 4ZCIA 4FMCB 3KRTA 4G8CA 5FBRB 2FR0A 1ESNA 2VHWA 3D8BA 5M34A 2OQRA 4D8VA 4GM4A 4JLKA 3R0QA 5J4YA 4QU8A 3AF5A 1VJ0A 1YONA 1KEVA 2YWJA 1ZK4A 1QWOA 4MYRA 1DKPA 3GH3A 4QRHA 3MF4A 3LECA 3DBVO 2IDKA 1ZLXA 2FY8A 1GTJ1 3TLYA 3SZRA 4DA0A 2FFQA 2X15A 1Q84A 3NO4A 4C2TA 3SYLA 5LMNB 4XTCS 2FRDC 3UJNA 5FBHA 2BGGA 1FZTA 4EHHA 1ZUWA 1XWIA 3COVA 3EQ9A 3FPGA 3BG5A 1E66A 1GN8A 2LXNA 3KZOA 3R41A 1XAJA 2X0FA 3TOXA 3AF3A 1OYWA 3C0KA 3H87A 3KQWA 4LNUA 2H9AA 3UAYA 6AT1A 1OE0A 1Z33A 4FC6A 1JPUA 4N9WA 3UHOA 3H17A 1RVDA 1UIRA 2V6GA 4BMXA 2WUFA 4CMIA 2O2HA 4FBMA 3P2IA 2FMUA 3EY4A 2BFFB 3GAFA 4FMBB 2G5PA 4HO1X 1S2DA 2G09A 4NENA 5DGTA 4CI0B 2VP5A 3MJVA 4JJFA 3HFSA 4CCYA 2W58A 4KUEA 1TJ4A 1J0DA 4HDCA 2VSOA 1K5GA 2X6TA 4IMJB 3COWA 1UM9B 3IEUA 1XWFA 3C6BA 2GJ9A 3O5AA 2Z1DA 4OAPA 4KGXA 5EP4A 3HPRA 2C7QA 1V11A 1ZSYA 2F3PA 3MJDA 2FMHA 4Y18A 4OK3A 3KQVA 3BCUA 1Z6TA 1XALA 1ZHOA 4X90A 4GVPA 3SX2A 4GE3A 1M54A 1MJGA 4ZQHA 1MXHA 2ZM6B 1ORIA 2RKOA 5C3MA 4TV8A 1PS9A 2VSXA 4K40A 2R5WA 2YDYA 4F1KA 4RWZA 4FC7A 2IUTA 2EJCA 3OCVA 1E4VA 3IFSA 2VOJA 4B3IA 3E9YA 4RZXA 2JLSA 3SM3A 2GYWA 3IESA 4PYJA 1FFWA 1XWWA 2GDZA 3Q0IA 4WLNA 3UMRA 3WIDA 4BJ1A 3T1QA 4CU2A 5LUBA 1UKAA 5E38A 3U7FB 3BYZA 1H9AA 3C6MA 1GY8A 3AX6A 4TWAA 3RF7A 4UHFA 5EQDA 1PJTA 2ZDQA 5AKIA 3ZD6A 3O2NA 3A9CA 4LHSA 4B6PA 1UXJA 1ZD9A 4HADA 2W70A 4MV9A 1MOZA 2Z30A 1DOZA 2AG8A 1RQ2A 2Z5LA 4QOIA 1YK0A 2OKCA 4S1NA 4U7WA 3CONA 2ZTHA 3AOEC 4N8EA 4YP5A 4U7GA 3UAVA 4I1OA 2DR3A 1E61A 2PRZA 2I4OA 2VK4A 1REQB 3OOYA 2OK8A 3R24A 2VWQA 1M66A 5ALNA 3VAZA 4ENVA 5BVHB 1ZOOA 3DGEC 3ZWVA 5J23A 3QYPA 3NQ41 1QV9A 3GFQA 2A4KA 2PX8A 3FUCA 3LX4A 4ZTBA 1ZAYA 4ZQFA 5EE5B 1X7ZA 3WBJA 4HQFA 3WGHA 6Q21A 2JHFA 4DV3B 2Q28A 2JBAB 2VTKA 1THZA 3S2GA 3V7WA 1I4DD 2IOHA 4J94A 4A1OA 1TZBA 4OX9B 2H1CA 4GR5A 1SRRA 1Z4OA 1ZXBA 2OZVA 2XE6A 5DHAA 9ATCA 2GXUA 1AHNA 3U7QA 4MVJE 5IT4A 3DZIA 1NBHA 3H0CA 3NNNA 3KKOA 4P82A 4XLLA 4RMJA 3T4XA 2VQ3A 2J33A 4GWLA 1TTPB 1RPTA 1WZCA 5TQ2A 1A1VA 2E89A 1IBRA 3HKCB 3L0OA 3LX6A 3JPWA 4ITUA 2YFKA 3R6GA 3BGSA 4MIOA 1K6IA 4I8DA 4L72A 3DBOB 3KKZA 5AK6A 1O94C 3MJRA 3QV2A 2V74B 2YV3A 2OORA 5A03A 2A3NA 3G0HA 1NXOA 4OCZA 2FJ0A 1FJXA 3FHLA 2PWYA 3ZCTA 3QUSA 4RZQA 1E7WA 5EWJA 5K20A 3C3KA 3UT6A 1ODTC 1WX1A 1P17A 3DOUA 3AESA 1K8ZB 3ZU2A 4YRFA 5BRAA 3OQMA 2ICAA 3C39A 2XWQA 1E6MA 1G60A 2ZBEA 3QEKA 3S5JA 3VR1A 3HCBA 4J1QA 2YCBA 5EMKA 2R8EA 2NT3A 3LCVB 3UAZA 3NIWA 5JBNA 1ECJA 4O3MA 1GT91 1RJWA 2O7VA 2HJGA 1L5OA 4IW3B 2COEA 1U3WA 5B57C 2L69A 2GAFA 3C48A 3DBLB 4LYGA 4ZVRA 5FTKA 3IKTA 3PTAA 4TYWA 4ENUA 4KN9S 3KETA 5IHXA 5BT8A 1P19A 1RJEA 1IOLA 1E8DA 1M1YB 2WJ4A 4MWZA 4DA4A 1FF9A 2VPPA 5KI6A 1Q7GA 3DEJA 4GBED 2V7VA 3HY3A 3TO5A 1AJEA 1YQGA 1US8A 4LVOA 4MINA 4WJZA 5K0SA 1WEKA 1T34A 1HDIA 3A4IA 4EBFA 3MXOA 3D8SA 4KBGA 5D00A 4WN3A 1TQ6A 1RRCA 2HZBA 2MOKA 2WHRA 5CNJA 3RVPA 1U11A 4IDAA 1QTRA 4G9EA 4BZPA 2P2NA 1NN5A 2Y6VA 1D6MA 2KB0A 3BXXA 1MIOA 2CL6X 5IJWA 3T41A 1RWQA 3AI1A 4YDSA 2P11A 5IANA 3M1AA 3V1YA 3F2VA 1I2DA 4G65A 5IH3A 5GADl 2WVJA 3F3SA 2BWJA 3R20A 5AP9A 4B2PA 1XU7A 1QP0A 2VK2A 1D2NA 121PA 1X1BA 1X92A 4UD6A 5HF8A 4CUKA 4DY4A 3W5AA 1YT5A 1R64A 2B8TA 3LHIA 4WZAB 2ZPAA 3HJCA 3QU5A 1FS4A 5DFAA 3EE6A 2HHLA 2CNWD 3UTCA 4DRYA 1LNZA 2P6OA 2ETXA 2CJPA 1G4HA 1G5FA 1OLSA 1UANA 4OGWA 3ZE2B 1A7UA 3OKAA 4DARA 4ZEVA 2ZIXB 3MGBA 4DV0B 5HTKA 3OM9A 1LFAA 3PXEA 4IO1A 4R1SA 4E5NA 4NJEA 2G4VA 2A9OA 2NQ8A 1XRNA 3CLRC 1P8JA 1YZHA 3KAKA 3MFQA 2BFPA 1IUKA 3NWBA 5EWLB 2R66A 5I8ZA 1JKJA 3WJAA 3EA0A 2FOXA 4MLPA 2GSDA 3LZDA 2YVKA 4I14A 1MC1A 1ZNYA 1CWUA 3PNVA 4LXQA 3WB9A 4YRKA 2ZUEA 3ZY2A 2XCLA 4N01A 1G5HA 1CQJA 1CS4C 4FZJA 4JVLA 4KQEA 4FM9A 2XGGA 1WG8A 1FSPA 2BMVA 2C5SA 1JG7A 3OTIA 3UM9A 3EZXA 3ICQB 2VL7A 3CRW1 1BYUA 1Q0LA 2QTVB 4L28A 1NE7A 2JGDA 4QLAA 4NQZA 2YUTA 3KB2A 3KAPA 1PJLA 4H6XA 1BS9A 1NC3A 2RI1A 4N7MA 4PLCA 1HEYA 4RLFA 1HYHA 1Y3DE 4JI8B 5A1JA 1EVIA 1WXWA 3A8TA 4QOFA 1A71A 1JQEA 3GLRA 3DG9A 4H1TA 4I36A 5THKA 3RVMA 3SNHA 4XVCA 3TJRA 1IUPA 3ZGXA 4WE3A 2CZCA 3JXEA 1M2OB 2O2JA 4PAQA 4MVJH 4L5BA 5SV2A 4EB8A 5KCMA 5H4HA 3RU9A 3LNTA 4YJ2F 2EW2A 3PQ8A 3HA5A 4Y2YA 4CEHB 3L6EA 2ZIWB 1WR8A 1IM5A 1LV8A 3I2YX 3OJLA 4NAVA 3V42A 4R6XA 3UKOA 1USGA 2M2IA 4J0DA 4GBMA 5FFFA 3TE7A 3PTLA 1E79D 1OVMA 3ZBTA 1X1TA 5JALA 3CVXA 2Q1UA 2V97A 4XWYA 3EPKA 2JK1A 4MV1A 3VYTB 4EHAA 1G7RA 4FQ8A 1S8AA 3DO6A 3GWZA 4JLWA 4KG7A 4M7PA 4XQEA 4C76A 2QSYA 3DE6X 5MF6A 3RAFC 2ZTUA 2X2EA 3HVUA 4RKRA 1KYTA 3ZEIA 4JUIA 2BEUA 5J4VA 3FRHA 4AJ4A 2O54A 3EGEA 4S05A 5E6RA 4N3CA 3MJEA 4A7PA 4C43A 3KSAC 1YVEI 1ODSA 4BO7A 3GJQA 5AJUA 821PA 4J0KA 2A5YB 1JXQA 1JG2A 5B2ZA 1BJTA 4MRPA 5IFKA 2YRXA 4QXPA 3U49A 1LWNA 4NPCA 1BVYF 1XELA 1AZTA 2FX2A 5FBQB 4BNDA 2AKEA 1AE1A 1TT5A 2NO9A 3A11A 3QY0A 2YXNA 3SIPA 4A0FA 2VDWB 2PCLA 4NEGA 4LVCA 3CGWA 4BVBA 1H5QA 1JLMA 2FZCA 2QLLA 2E87A 2Z5VA 2GK7A 3FYCA 3P2MA 1A0OA 1FQOA 3I2HA 1N8NA 2M6SA 2IS2A 1IJBA 3TPZA 3QVUA 5ETJA 1I1QB 3KVYA 1D1SA 2C7VA 1TYBE 3X2SA 2VQEB 1YH3A 5I4CA 1KKUA 1K4YA 2PMWB 2R65A 4OQXA 1BA2A 1YB4A 2YNMC 4K86A 5BXYA 2Q45A 2XE8A 1MBZA 3GRYA 2G88A 4I19A 1R4MA 2X1MA 3Q3IA 4RIEA 4TPKA 1P3Y1 1VPLA 1W34A 1Y34E 3P7MA 1IY0A 2YMPA 1E3QA 2GAJA 3LHKA 3N70A 3PXAA 3ETGA 4EX7A 3VAYA 3KKLA 1AV6A 4JQZA 4ZV7A 3FWKA 4FS3A 1ORWA 4RHXA 1VMDA 4L0MA 4Q6BA 1EUZA 1RWNA 3G7SA 1YL6A 3BB3A 4D96A 3BMQA 4NS1A 2WWVD 3QI7A 5IEJA 5CXXA 5BW4A 4FEEA 1IAVA 2QYTA 2WZQA 5JC1A 3MLAA 2HQBA 4PONA 3WP1B 1UOQA 3YASA 4TT3A 2LNDA 3OM1A 4PFJA 1W47A 4NIMA 4B0OA 3SC2B 2HTFA 3BF8A 1Q1GA 3EQ2A 3EZ2A 4KK3A 5JQGF 3EXIB 4KGVA 3L0BA 1OFVA 3BRSA 2M1ZA 4BB6A 5K0ZA 3RVSA 1E2PA 3DHYA 2EFDB 4K2HA 4B3XA 2NSDA 4IL5A 4ZREA 1R6UA 2I65A 3K70C 1ENOA 3E0XA 4FHEA 3R9IA 4E5UA 2EBHX 4EPTA 4IXDA 3DCNA 2HQOA 3GT4A 1U8UA 3ASUA 4LF4B 1EWRA 4IOLA 3T94A 2I6UA 5AW5A 1EUQA 1DUVG 4EGSA 3BWYA 2X22A 4FX2A 1CR0A 1AQUA 1TA0A 3AKCA 4WLEA 3VPDA 4ETIA 4CIBA 1C4OA 1DHTA 2DWQA 2ZTMA 3QENA 2FEAA 3OZCA 1M7GA 2X4GA 1RWVA 4LNHA 3PQ6A 3ZNQA 4B6SA 1D8TA 1E69A 3MS4A 2FUG1 2WYUA 3H16A 5LLSA 2QHXA 2E4VA 4UE2A 2HD4A 5BSUA 1UAAA 1XNRB 1BX3A 1RXUA 2PDAA 2JLBA 4UTXA 1MT0A 3JS5A 3RIXA 4GEKA 2HU8A 5GONF 4X20B 1L3CA 4EHIA 3AK4A 5DW3A 2VPIA 4DTCA 4IHJF 3FNRA 3ZI0A 4ZJYA 2DE0X 2PG3A 1P0CA 1UKBA 3IO3A 4CNQA 2GCIA 2PGNA 1OXSC 4I08A 2TECE 1QIHA 3RADC 2WMNB 4DWWA 1EVQA 1GKLA 1N92A 2FWRA 3G0OA 1TVKA 2BMWA 4I1YA 5M04A 3G79A 4BKQA 3DS8A 2J08A 2ID4A 3E03A 2GPNA 2DQZA 2GB4A 3ZDEA 5CBKA 1X80A 1E3WB 3N5KA 1KDVA 2W2KB 3COPA 4N40A 3EUFA 3ZLUA 1R3UA 3N7UA 3BKXA 4P36A 3SS8A 4OSOA 1QUEA 1Y82A 3FRIA 3T9DA 2VHEA 4PCLA 5FKJA 1SCIA 1E0SA 2ATIA 2AOUB 1Q44A 3OPYI 2AX4A 1Y6GA 2QJFA 2O9JA 2R7NA 3C6ZA 3A9SA 1KWGA 1XKLA 1QZXA 4LDZA 3B13B 4CKXA 2FWAA 3B1JA 4C0JA 1QIJA 2YJ6A 2QGFA 3VSAA 4F9TA 2Q29A 3FFWA 3RJ5A 2I87A 2XOEA 3H1EA 4A0HA 3RGWS 3EMVA 4GHWA 2C31A 4HDRA 2YCLA 3OUZA 3CW2A 2CSUA 4OJKA 2YW9A 1QU3A 3SHOA 1X7YB 4QYXA 1CNEA 4E5KA 1Y8CA 3OTWA 3E8SA 4DYHA 2EFHB 2R4TA 4JP5A 1I2ZA 2IY7A 3KQTA 3M2PA 3V8VA 4C5AA 1VZ2A 2QLTA 3T7DA 2EP8A 4WT7A 4BO4A 5I3ZA 4JENA 2WFZA 5B4UA 2Z98A 5KSYA 1CZKA 1XJCA 4NCBA 4DQXA 2C5AA 1M9NA 4M2LA 5DNWA 4X8HA 2R8YA 1G8SA 3EMBA 5L3RA 3WWYA 2N0SA 2G5TA 3P0HA 1J8MF 4I3GA 2OWDA 4CT4B 4C2BA 2CL5A 5LVAA 3L7NA 4TOIA 2G72A 2PBFA 2C20A 4D8TA 4IVQA 2OVBA 5HSGA 4CMAA 1IJKA 3K0AA 1NVDA 2WSYB 1KIMA 1FFYA 1RLUA 3GCGA 1JQKA 1PQUA 3A4LA 3QQPA 4CKWA 4B9AA 1Z2NX 4RY9A 5LXTA 1HKHA 4JYAB 3KSRA 2HBRA 3GFPA 3KPJA 4BGDA 5BSGA 5IDXA 2A33A 2CK3A 1EDEA 3E7WA 2I1VB 3B8EA 3R09A 4XDYA 3U2QA 2PU7A 1O94D 5ALQA 5EIAA 1SFRA 4ZQIA 2VXYA 2BF4A 3M1YA 1UFKA 3NC0C 4EW6A 4ZKDA 4G5RA 3CSDA 4L3VA 5ILGA 2NUAA 2TYSB 2WJZB 4YJKA 3ZV3A 2AMVA 3M33A 3BICA 3V7NA 1HT2E 3WWZA 2WVHA 5BNTA 4K6KA 3ZW8A 1EXNA 2PD4A 1TM4E 2G67A 2VG8A 4F9GA 2AE1A 2ZZMA 3JD2A 3SHTA 2OV6A 3TNYA 1PNTA 2A5GA 4RORA 4G2TA 4Y2UA 1NPYA 1K2WA 1WO8A 2X6QA 1FX0A 3ZGYA 2ENWA 5CDGA 1M6NA 4FDAA 3ZGZA 3S28A 2K87A 3VOSA 3T1HB 4JR1A 4ASUA 1I1OA 1DKQA 2GH1A 1U80A 3DZFA 3RYIA 1E9BA 1UEXC 1W96A 4UREA 3GLIB 1P2UA 1KDZA 4BLPA 4EVSA 5AH0A 1T1EA 3NBMA 5AUQA 1NXTA 3DUWA 4JLMA 4G6ZA 4M46A 2H3HA 4QDZA 2DLNA 2RJOA 1Z0KA 4I9HA 1P7YA 1MX9A 3G2OA 3ZTWA 2QTCA 4A8JB 1ISJA 4EHLA 3LBHA 1N5MA 4N03A 4G36A 5E2BA 1AK2A 2H5IA 5IT5A 1GGHA 1PQ4A 5IF9A 1AY0A 1LF0A 4CM5A 4OKSA 4ZYZA 4MB0A 3E1GA 1G7SA 4FP9A 4NHOA 4DBZA 2V96A 4MW9A 4N54A 1PYDA 4DEVA 4DJAA 4DWOA 4DR3B 1ZS9A 2CCKA 3HKDA 1M0WA 1UM8A 2B20A 2GO1A 1PHPA 1ZBQA 2XNJA 2XQGA 4I2NA 4CJXA 2DR2A 2ATEA 4ARSA 3BX1A 4MIKA 1ZIOA 1W85B 1ZI6A 2ZLBA 5EE9A 5JARA 5JI2E 1EDBA 2WM3A 3OEYA 4NMWA 3OT4A 5K0TA 2ZWIA 1Q7BA 3LQQA 2HO4A 3JAKB 5JZVA 3G88A 3QKRA 1Q0HA 1V95A 5H7XA 3EPHA 5TJHA 4W5OA 5K51A 3B9BA 3AI3A 4NEHB 2Q3JA 2QVBA 2OENG 3UBTA 2V55B 3OJWA 1K98A 1LQ2A 5CDYA 1QKIA 4LE1A 2P9BA 2XMQA 2JIQA 4KQMA 3M6XA 1CF4A 1V45E 2WFAA 9GPBA 3L41A 1U28A 4V0SA 3ORYA 3QKSB 3W1VA 5ECYA 2B6NA 4HDQB 1QH1A 5FQNA 2O0JA 4V24A 1UK7A 3JWIA 3ZI7A 1HYGA 3AP1A 3PUIA 1XA3A 4PSAA 1G5PA 5HM6A 1XTUA 3TBFA 4WA7A 2YVLA 3IDSA 4WQMA 4OB7A 1FDSA 4JP1A 2YWEA 1L8LA 2CXOA 3D4PA 5AHXA 3V4FA 5KTRA 5KYYA 3PR1A 2PKQP 4RGBA 4PE5B 1YB7A 1WPGA 4ZQCB 1RTTA 1GKKA 1GXSB 3O90A 1T9BA 3BB4A 3X1JA 5CU7A 5C2JB 1MABB 2ECQA 4CHTA 1KOJA 2BI4A 3EIUA 1XN4A 4MS3A 2IS4A 1IIRA 3T3IA 4K81B 4PLGA 3V33A 3NP7A 7GPBA 4J1NA 4H3VA 1P8AA 5BV1A 3AUFA 4FGSA 3OZSA 5B36A 4MHOA 2SNIE 4QTZA 4R5MA 5H9WA 3TTYA 3FUXA 1ESDA 2Q5JA 4HHEA 2SBTA 4K6MA 4QICA 3T5AA 2FSVC 1EJBA 1JUDA 3VGJA 1Y3AA 1ZNZA 2F62A 2V5AA 3FHCB 4RL6A 3SZLA 7REQB 3FCOA 1GO2A 1SEPA 1V3UA 3HXKA 2VH2A 3M0EA 5L7YA 5DNUA 4UFOA 3SE7A 4JGIA 2IXGA 3FDFA 4DANA 2JD0A 2P9GA 1GFSA 1CY6A 3OE7A 4Q0MA 3BREA 1OY1A 3V1UA 1NW4A 1K97A 2FHPA 2TMKA 1U7UA 3DKIA 3ZZTA 2PRKA 2EZUA 4QJ5A 4GMXA 1SVOA 1FFDA 2WW8A 3DZKA 1XXHB 2NU9A 4W1SA 4CHGA 2WWWA 2P6NA 3RVQA 1WHTB 4CTJA 2AEJA 3PNBA 4QEZA 3FPBA 4KXUA 2KI5A 2LUOA 4GGPA 4ALJA 5ICCA 4DADA 4RTQA 2GXAA 4C88A 5HM8A 1XRPA 4MRRA 2QG9A 4LKOA 2UUAB 4RANA 1HK7A 3ZE7A 4A5OA 4U6SA 5M3BA 5JH7B 1YE3A 4YCLA 1BDBA 1EK2A 4P7GA 3UFXA 1PWEA 3QJGA 1U81A 5DV9A 3NDBB 3IUEA 2IHYA 2KJQA 3TLZA 4X6XA 1ZWKA 2ECKA 4Q1EA 5A71A 2CVZA 2JHCA 4DN6A 2BFAA 1GT6A 2AS0A 3MD0A 3AI2A 4IIJA 4MKRA 1K27A 1Z6YA 4WI1A 5AOBA 2IYYA 1XEFA 4BYMA 4MRVA 1ACJA 4AJ9A 4BFWA 4KHPB 1PJSA 1FMLA 1RI4A 2HSJA 1X7GA 4DMMA 3FBTA 4BDSA 3B5EA 4NBTA 3BOSA 1BMDA 5DLQC 5EI5A 5K4AA 3I1IA 3FI0A 4M1KA 3TIXB 3OTOB 2ORYA 3AB8A 3QLVC 3UZUA 3QUBA 4YQYA 1M34B 2DT8A 3P19A 3SIRA 1ONPA 1Y5NA 4NU8X 4M49A 4WKPA 3B9RA 3RS7A 2VUIB 2PUEA 3EVAA 3LCMA 1B23P 2GZDA 4FFVA 1TKAA 4FOLA 1Z2EA 4IDPA 5CFNA 3EHEA 4UUPA 4N5MA 5HYVA 1CUZA 5D86A 3TM5A 1YRLA 2O0KA 4KLZA 4O29A 4N5LA 1SG0A 2KPOA 2IELA 2VDRB 1V47A 3AETA 3IYLW 2I2XB 3OETA 1UXHA 3QUAA 4LX8A 2O3SA 3SM9A 5DWVA 3E70C 3NEPX 1FS5A 1OUMA 2QD2A 3WK9A