1USZA

Semet afae-3 adhesin from escherichia coli
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
140
structure length
140
Chain Sequence
GSFTPSGTTGTTKLTVTEECQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCNARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPMDNSAWTTDNGVFYKNDVGSWGGTIGIYVDGQQTNTPPGNYTLTLTGGYWAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AFIMBRIAL ADHESIN AFA-III
publication title High Resolution Studies of the Afa/Dr Adhesin Drae and its Interaction with Chloramphenicol
pubmed doi rcsb
source organism Escherichia coli
molecule tags Adhesin
total genus 23
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 1uszA00
1UT2A 2IXQB 1RXLA 1USZA 1UT1A 1USQA 2JKLA 2W5PA 2JKJA 2BCMA 2JKNA 2VERA
chains in the Genus database with same CATH superfamily
1IGYA 3ZL4H 5F3BA 3VI4A 4I48B 1FNLA 4KI5C 1OQXA 3FFDB 3JYBA 4FNQA 3S36X 5EU7E 1TQSA 4OLYH 2NR6C 1E5UI 4G7VL 2FVNA 2CUHA 2H8PA 4ZTPH 4YGVA 1ZVHA 3DUSB 1NIAA 3II2A 2VN4A 1THAA 4HYTB 4BCZA 4X7SH 5HDQH 3U4BH 2C5DC 2JQMA 1MLBA 3HAEB 2DKMA 4IOIB 4XPGH 4YK4B 4PJ8C 1CLOH 2XXMB 4JZOA 4RMBA 1SN0A 3PAZA 5ID1A 4YBQC 2B5IB 1KGYE 3DVNA 3IMRA 4W4OC 4NKMA 1I7RA 2EIZB 2R1XB 4OCRL 2MMXA 2VERA 5B39A 2CIKB 1NFKA 1JNHB 2GAZA 2HG5B 3QHZH 4GUPB 4I18C 5JHBA 4H88L 5DO2C 4Z7WF 5AVVB 2VLLB 2FL5B 3U25A 4YDMA 3Q6FB 3KH3A 4Q97A 1QLRA 5C97A 1YA5A 5KSAB 1E5BA 1UEYA 4YJZL 3CSYB 1DDTA 1HQ4B 3QZBA 1CFNA 4HPOH 4QGYA 5T1LA 3UO1L 3GMQA 2VERN 4FCAA 1HHGA 4XTRC 3VMNA 4NQQA 4HWBH 5EO9B 4XCYB 1F42A 3LD8C 3U6RB 3ARFA 1NAMB 3FQ4A 3VNZA 1YVLA 4HJ0C 3B2DC 4R4NC 3BEVA 1GC1L 3WMSA 4C58B 4FL4B 2LW3A 4K0OA 3HNVH 3DVGB 2Z92A 3QQ4B 5HYIA 2CR0A 5IBLD 1R0AH 3AS3A 1E0OB 1IT9H 4ODSH 5I0WA 4MD4B 4F7TA 3IMTA 3FO9B 1JYWA 5IF0B 4OCMC 4PJDF 1UWXH 2VZUA 3IDJA 2YBGA 5FUOL 5CJ5A 1G9MC 5GSVA 1JPFB 5ADPL 3QPQD 4WV1A 2TSAA 1VFBA 1A8JH 4M62H 4BFRA 2F8OA 3W38A 2JJUA 2O30A 4JCMA 4X42A 2Y7OA 3G5VB 3KPRD 5KS9E 1FFNA 1F4YL 4N6RA 1UQSA 3FCTB 4ACTA 1EEZA 3FN0L 1XEUA 2BZDA 4IOFD 3JV0A 4I85A 4FEMA 4OM1L 4QKTA 3V5HA 3VD1A 2WXJA 2DQUH 2DWTA 3GJEA 3JTSA 1ETB1 4GIOA 4R5TA 3VXMD 4I1PA 4XP4L 4FAAB 5A6MA 1NLDL 4ZUUA 4QY8A 1GJUA 2L0DA 1F3DH 1UZ8B 1H3UA 2J8UB 3QK0A 2EEDA 5E8OA 1KCVL 4HCRH 2QQLL 4CDGC 1S7TB 5J11B 4JJHA 4DEWA 3P30L 3IMSA 1A6AA 1RPKA 1W0WB 2HG0A 4JGUA 5F96L 1JJUA 4ZTEA 5JA9A 3F6LA 5ESAB 1UXWB 2OR9H 2VLKD 5TTRA 2GTWB 1KBKA 4J6RH 4UI2A 1T6WA 3F04A 4UU9A 4AOFA 4LPUA 1LO2H 4QHMA 5IGXL 3TESA 4GUOA 3ILPB 5DZAA 1I8AA 1NBVL 5IZ7A 3N3EA 2UVFA 4JFZL 2JNZA 2GUOB 2YD4A 2ZXEB 4U1LA 4I4WA 2VLKB 5GRXG 4L18A 1R3HB 4PWFA 4L3CB 1B4JL 1AC0A 2WYIA 3LZFH 4FKEA 4LT7A 2B1AH 4YDVB 1JZ2A 3QDGD 1MHCA 3L4VA 1U3HC 5JPMB 1NCBL 2W92A 3FO2B 1YEIL 4QPEA 1OF2A 4G6JH 4MQSB 4PJCB 2H6OA 1BIIB 1A8ZA 1IBGL 1KJ2H 4KTDH 4DPAX 2OYLA 4FXKB 1W2KT 1Z3GL 3VD0A 4FQQB 3JWOH 2XWJB 3UDWA 1K4DB 1JRHL 4PGCB 5E00A 3B8SA 5FKPB 4XAWL 4ZFOA 2WAHA 4F37K 3EJSA 1VCAA 1RY7B 3IMUA 4DSYA 2HFGL 4Q9QH 2RACA 4LKXB 5GIRB 4X4KA 4P59H 4DKDC 3O4LD 1I8MB 4GKSB 3FN9A 4TM9A 4XCEB 5DK2A 3WN5B 1H9VA 4JFWA 4KMTL 4TQPA 5DMYA 1EIBA 3X13B 4F7PA 2VDMH 1MFCL 1IM3B 1F8TH 1FUNA 2APTA 4HJJL 4Z95H 1ZA6A 3VRLF 1BQUA 4JVPA 4AY0A 3KXFD 2H45A 3O4LB 4Y4KD 3CMOL 2UY6A 2Y07H 4HWBA 1FNAA 1KPRB 1T7WA 2CHWA 1OAKH 3NIFE 4P9HC 3FUJA 3KXFB 4P3CL 2WWOA 1FF5A 3E2HC 2XKNA 4A63A 3TEZA 3I50H 5FCSH 1MFUA 5IV2B 3EGXA 1KY6A 1VFUA 1Z0NA 4PS3A 1HIML 3F3HA 1PEWA 1EAOA 2VDOH 3ZE2E 1S7UB 4HD5A 2WQUA 1S8DB 3MRGB 3K6SB 3DX7A 2HLFD 4DJMA 1SOKA 3LNGA 1MKFA 3DVIA 4QLWA 5I26A 3VFTA 3ZYIA 5HDBB 3RIAK 4M8QA 1BA9A 5HDLA 1P5VA 1TKWA 2DPKA 1E7VA 4A38A 1OOWA 3SZKC 1RH8A 1ZY9A 4HV8A 2VC2L 1OAZL 1KCKA 4FRWA 1R24B 1YQVL 4PJ7B 4X7CC 2E9WA 5H2BA 3MHZA 3QHFL 1XAUA 4HF5L 4KUCF 1F13A 4LVHC 1LNUA 2ZSWB 3CFEA 3RU8L 1HOEA 3HI5L 1MVUA 5FX3A 2IH9A 2D7PA 2OXHB 2R39A 4FDWA 3RI5K 1O7VA 3HZMB 4HJTA 5ESQB 5AG9A 5JXAL 1XGQB 1L0XA 1YMME 3P77A 1X4ZA 1QPPA 1RFDL 2X4SB 2IDQA 3FU9A 4HCRA 4MQ7A 3BUIA 1BEYL 1TYEB 4MVBC 3BKJH 1M56B 3O2DH 1BF2A 4ZUWB 4M7KH 4NM4L 3QQDB 5AKVA 3N0AA 5I71C 2F7RA 5D4JA 4OZIB 2RGSA 1NGQH 2XZZA 3NSCA 1J9TA 4PRPB 3WFDL 4AM0B 3FQRB 5CGYD 4YE4H 3ROLB 1ZV5A 1E42A 1OSZB 1RZKL 3W3BA 4MB5A 1EGJH 2HRPH 3INOA 2PXYC 2TRHA 3GGWB 4XMPH 2CDFA 4J39A 3A6CH 4WWOA 2YEQA 3GSUA 2NW3A 1JF1B 2X3BA 4YSRA 4N9GA 4W9GC 3LXCA 1ZRUA 4Y7MA 4JB9H 5HJ3A 2AI0H 3CFDB 5IJCC 3KR3H 5BZDB 5CILL 3ZRSA 3TWYA 1E28A 3HMXL 4M3KB 1MCWW 4A7SA 2XG4B 2JJSC 5D9SB 4YDLB 1XCXA 4NIYE 4HBQA 4X4YB 5C08E 4PWKA 4XE5B 1A7QL 5I15H 5CS7A 4LEOB 1EHXA 3MZGB 4AMWA 5E08L 2P8MA 4G7SB 3ULVF 4WK4B 1QI5A 3NABL 4L3EE 4F9PA 5ACZB 4NFCA 4OSUH 3UC0H 1YN7A 4Y5VA 3MGAA 5E5MA 5A1AA 1EH9A 2LU5A 1HI6A 2B59B 1KJ2A 1MCWM 4PB9L 1J8HD 1IL1B 5E56A 3HNSL 4L1LA 5DZVA 1ZHNA 3C2SA 3CC1A 2FECI 4P3DB 5DSCA 4WTXA 5F1NA 3QFGA 1DVZA 2AABL 2O5XL 4LO9A 5E99L 1KOAA 4H5SA 4UUJA 3G9VA 3F84A 4TNGA 1E7UA 1NCHA 3C08L 4H20L 2WYZA 2ZP9A 3HIZA 2Y72A 5FYKE 2G4EA 2Y3NA 5ALCL 4K8RL 1S5HB 4O2EB 4WO4A 3GINA 4JG9A 3F5WA 2AQQA 4NPKA 4KC3B 4YUEH 4A2EA 1KXQA 1F6AA 2Y5TA 4WUUE 4M43L 4P23D 5TE4H 2NRDA 2A0LC 1TFPA 3BT2L 3QWOA 2H2PC 2XPZA 3EO9L 1OLZA 1J05B 2VW6A 3COOA 4PUBH 5B39G 5DJDB 2CO1A 2ROYA 3O8XB 3OKDB 5CCKL 1SJXA 1WGVA 5I24A 2HT3D 3QUMB 1XGTA 2XWBB 4JO4H 2IOIA 3I2CH 3KPRA 1MI5D 4AQAB 1GY2A 4AUUA 4U3XA 4E9XA 1C5DA 4NGHL 4XO5A 3ECBA 1KXVA 3MVSA 4KKNA 4E9VA 2GCYB 1N10A 5CU5A 1I9RL 2W07A 1XF2A 3V0DA 3LQAH 3FFOA 5KSBE 3PWPB 3W0WE 3SOBL 4BQ9A 2AXWA 5A2FA 3VXMA 1EHKB 2VLJB 3PGFH 3R8QA 5BJTB 4Y5XB 1QSVA 4NNPL 3LB6C 3BP4A 2FD6L 4G7VH 1HJBC 4KXZH 5HHMD 2O6CA 1D6EA 5DC2A 2YXFA 3IDYC 3SKMA 3ILEA 4TMPA 3GMLB 1QFWL 4O4YL 5GGQL 1TVBB 1FNGB 1FNSL 2FSEA 2ZOUA 1URIA 1FVCB 2JELL 4ZPTA 5HHMB 1SRDA 2P48B 3HRZB 4OCRH 4K7FB 1X5ZA 4WFGE 3G6AB 1D7BA 2ADIB 4H88H 3K7UA 4TS6A 5D7IB 3WTSA 3H7BB 5DJYA 3X3GL 5ADOL 1N3NB 4M6ML 1A3QA 2MTPA 1NWPA 5J6HB 2WZ6A 4J5VA 4HJGB 1S9YB 3RWGA 3KPMB 5BV7H 5LGKA 2OZ4L 3KYOA 4JANB 4W93A 3UO1H 5D7SL 3VWJD 5L88L 3B7RL 5HY9A 5K9KB 3O2DA 2WVVB 3IMVA 5A3ID 4A2GA 2J43A 3QDGA 2E7LA 4GAAA 3O2VH 1GC1H 4NDMB 3U48A 3W9EB 4IRZL 4NO2A 1HH6B 4JHWL 1QFWM 1EGJA 2XPGA 5T3ZE 2IH1B 3GXUB 4FFTA 2WWKO 2YD0A 4JFFD 1HL8A 5C07D 3DMMC 5FUOH 3KLQA 2AQ2A 4BFKA 3O3DA 1WIOA 5I1HL 5ADPH 4WKZB 4DN4L 1EFXD 5KVEE 3APNA 3FH7A 4ZZFA 2YARA 4BA0A 3DKHA 3P9LA 3WKNA 4ZXBD 1F4YH 4EUPH 3H55A 1IO4C 2WMPA 3FU3A 3FN0H 3H9SA 3OD3A 4IK6A 2Q7NA 1FGVL 4L29A 4OM1H 5C2UB 1EFXB 3GMOB 4WI3A 2P80D 4FNRA 5BZZA 4JG0L 4XP4H 5D1XE 3KPLA 1NLDH 4G6FB 4ZXBB 1UXLA 2VDKB 3DURB 4GIPD 4A7GA 1U8CA 1X7TA 4ZMYA 5I73C 3RWJA 1XSKA 3C60B 5GJTL 2FJFB 2YPKA 1OWWA 5HGDB 2I9LB 4Y4KA 4OAWA 4PV9B 3DIVA 3FUDA 2IPKB 1EZVX 3QEUA 4RLDA 4L4VD 1KCVH 2QQLH 5DLML 4JM2D 1CICD 3P30H 5F96H 4YSCA 3T3MB 3VA2C 3IDMB 3J7HA 4K5MA 2ZNXA 3KPPB 4HD9A 5AUMB 4MA1B 1LP9F 2BVEA 3TEWA 3QP3A 1O9ZA 1HYSC 4EDWL 3KM1A 3JV6A 2VR6A 4PIRF 2XWDA 2FEDD 3DHUA 3SKUD 1CI5A 2DBLL 4JM2B 3T2QA 2ZPKL 4MSWB 5IGXH 5TK2A 2KPWA 3H9HA 1U8JB 2OMBA 1NBVH 3K0WA 1A6ZA 5FO7A 4JFZH 5KWYC 3TBVA 4FQHA 4YR6A 5LG1A 4HS6B 4KMQA 1GGIL 1B4JH 3G7TA 2WKOA 3JWNE 3ZIYA 2MNWA 3N43F 4W1TA 3ZQ9A 4X4MA 1T0NB 2XG5B 4XR8C 3BWZA 1QWNA 2W5PA 1TITA 4IU3B 4KAQL 4OIFA 1NCBH 3U46B 4O02L 1RULH 1YEIH 5L8JB 1IGIL 4KRMB 3BPCA 2LQRA 4N2AA 4XBMA 2R7EB 4HLEA 4PY7B 1IBGH 1TVHA 3ZSSA 3NIDB 3M8OL 3F65A 5LWYL 5HTSA 4Q8BA 1NC4D 3NJLA 1Z3GH 4CRPA 4XO9A 2WXKA 4QYOB 1JRHH 5I6OA 1I8LA 1O5DT 1WSST 4XAWH 5C0BA 2VJ8A 4Q7DA 1TU2A 1JPGA 1U8KA 1CFVH 3HE7C 1NGWA 5J3HC 4MJHA 2VZVA 2EUZA 5EBMB 4G2AA 4MLSA 1A6WL 4KMTH 5TDNA 3GB7A 3LQZA 4FG2A 1H3VA 4HAFA 5IEHA 1N0LB 2I9TB 1MFCH 1J48A 4HJJH 1QFHA 4CNIB 1K9TA 3O4OC 4Y88A 3SBWC 1ZVNA 2ZCZA 4BFNA 4JFED 3GNML 4WEUD 4PRAB 2PR4L 3W9DB 2YKKA 3M45A 1NC2D 3FXIC 3B9AA 3HLKA 3EH4B 5CZVH 3U4EB 1CF8L 2V33A 1TZ8A 4PS4L 3IETA 4K8RD 1OTUC 2VISB 4P3CH 4JFEB 1DJYA 1UKQA 2AITA 4KMLB 1ZE3H 4YSQA 1NC2B 4TRPL 5AWNL 5TK4A 1ZXKA 2BSSA 4KJYA 3ZKXB 1HIMH 4Y5YA 3OHMB 1YYLH 1CFSA 1PLGL 2LU4A 5KW9L 4NERA 4PCTA 1UOLA 4P07A 3MOAL 5DMJB 1ED3A 2F9BT 1OPGL 1HQRB 4OLZL 1MCOL 1SDAB 2YAOA 4X6DA 2F6AA 2CU9A 4MS8C 4EUPA 2X4OB 2VC2H 1I9IL 1ZSDA 1OAZH 1AHWC 2YRBA 4M3JA 1R3LB 1YQVH 5DVPA 2VMFA 1HSBB 2ZYRA 3RY5A 4IEFB 3QHFH 1U8QB 4HF5H 3SYCA 4P9ML 3SDXF 4KTEH 4EXPX 2QGBA 4P23A 4JY6B 3MLTB 4M6OL 4FNUA 2IH3B 2IADB 4K9EH 2F7PA 1N8ZA 4HOWA 3S35X 5DEGA 1ACXA 1FFPB 4M7ZC 7PCYA 3UBXI 5JXAH 1FC2D 4FYSA 2K78A 5H4ZA 1RJLB 2HN7B 3S4SG 1RFDH 2NY4D 4ZT1A 2HJFA 2C34A 1BEYH 2QL1A 3FQXA 2ED6A 2BZ7A 4TNWK 1K4CA 3IRZA 3EUUA 4H13C 2WZ0A 1AIFA 4ONHA 1G5AA 3WFDH 3GUTA 1RI8A 4ZAKB 3KYAA 2HJLA 4EI5A 3QG6A 2L4OA 4PP1D 1PY0A 5C7ZA 4XC3L 1RZKH 5JQHC 3QC6X 4HIHA 4AMKL 1KZYA 5KUMA 4ZO7A 1BLIA 3LNHA 2EH7L 2N01B 2ERJB 3CZFA 3EW3B 2J25A 1C16A 4IRSC 4PJEB 4WWNA 1EJ8A 4QT5A 1QAWA 3T4YB 1ET7A 5CILH 3FRUA 4PG9A 4IJ3C 3SOTA 2XU9A 3T0DA 3HMXH 5JHDE 2R69L 5T1JA 3ES6B 2MKWA 3PDDA 4X83A 2C9UA 2IBBA 5DZPA 3ZZ1A 4P46C 3T0EB 1A7QH 4TLSA 4O2CA 2OSYA 1H3WM 4AQ1A 1I4FB 4XNXH 5F0LB 2GUYA 3DUHA 5I66B 4LPWA 4WHTB 3AM8C 4PJ5E 3NCJL 4ZSOE 1FO0B 3RGVC 4E42A 3L1OL 4PB9H 4Z0XA 4DO5A 3HNSH 5ALBH 4ONGL 3MNZB 1E2VA 3GSRB 2GJ6D 1DN0A 2AABH 2O5XH 2Q9OA 5E99H 2EC9U 4Y1TA 3VAEA 4CVUA 1KMGA 3VB9A 2GSIB 5CJXA 1GKEA 1KGWA 43CAB 3VWJA 4HLZH 4IOSA 3CGTA 2WIIB 3IAPA 2AQ3A 5ALCH 3KLAB 1NCNA 1OB0A 4Z3TA 1B4LA 2CLRA 1OHZA 2HJKB 3PF2A 1KGIA 4J3OD 4QXWA 5IVXE 3RQ3A 4L8BB 2XTJD 4M43H 4P99A 3SODB 1CXEA 4U6TA 1SMAA 4JFFA 4N1CA 1J8SA 3ZTNL 1NIFA 1H0DB 2H6PB 3BT2H 3P2BA 5C07A 1AP2A 4JJOA 5LGJB 1JVLA 1EA9C 4ZUVB 2J1WA 5CCKH 2G60L 5B38A 1S46A 2IALA 2EECA 2WINB 2XTJB 2WO3B 2A73B 2A7BA 5E2JA 3EYSL 1CTOA 4NGHH 4XXDB 2WBJD 4UAOB 1DVSA 2Z31D 4OD1L 1WD8A 2G3XA 3QEQB 1I9RH 2DJMA 2X0WA 2BWDA 4ZOBA 3EO0B 1VJSA 1GGCL 2P80A 4JZJA 5FA4A 5T1KD 3GEFA 3SOBH 1Q72L 3ARTA 3L5HA 3UJJL 1BFOB 5AW7B 5I1CL 4Z7QB 4WJ5A 2N7AA 1QTPA 4NNPH 1NFDF 1SHXA 4H4NA 3WMQA 5A40E 4HIEA 3M6DA 4MMZC 4POUB 2DDQL 1HILB 2BFGA 4Z7OE 4WY7L 2MEJB 1T6VN 4LRIC 3BVUA 3EJPA 4PM1A 1CICA 4F5CE 1QFWH 1D5BB 1FVEB 1MWAB 1NEUA 4O4YH 1FNSH 4V1DE 5K1VA 5DHVH 5C0DB 2JELH 3WHXB 3EYQC 4N8PA 5FR3A 3GBML 3MREB 1QSEA 4PGEB 4FF9A 4QNPF 4HZAA 4NPYA 5D7LA 5G5DA 3DLQR 2EDNA 4PGJA 5EUOA 2WVSA 5TH2A 4KY2A 1XBRA 3NSYA 3IJHA 3X3GH 1T1WA 5ADOH 4M6MH 3GHBL 4FFYL 3MXVL 3N40P 3FOMB 1JWSB 4NQVA 1XCTA 2OZ4H 5D7SH 2X2YA 4PTUA 5L88H 4DZBB 4N90E 3UPAA 1U8LA 4XMVA 2KQMA 2PPFA 4V2BA 4HIXL 4W68A 1NL0L 4FTDA 4M02A 5HHOA 3QUYB 5I6LA 2ZWNA 1IEHA 3DGDA 3TNNB 3MUZ1 4MB1A 4JHWH 4B3EA 3WOVA 4TL5A 4X5XA 2VR5A 1DVFA 3BYTA 2DM7A 4A55A 4WHDA 3CSGA 1GY1A 1M7IB 1NC4A 3UTSD 2ALAA 2KUTA 1ADWA 1KCBA 5I1HH 1JN6B 4Q9RL 1FG2A 3ASNB 4XMKH 3T6WA 3MRQA 4OGQC 4DN4H 5L2KD 5CP7B 2DWEB 5E94A 3HMXA 5JIQA 3J07A 5E8PA 3ULSB 1CD8A 2PPDA 3H2QA 1W16A 1TPXC 2PO6D 3SDAD 2DQ6A 1C1EL 1WK0A 3UTSB 2FJGA 3CBKB 2PWGA 4FERA 3UTTE 1WBZA 4RMVA 3DXAD 4GUCA 1FGVH 3KS0J 2OM5A 4J3OH 5MENE 1LWHA 4Y2DD 3B7YA 3WKYA 1MXDA 1TZOA 4UQEA 4O9HL 1G7QA 4JG0H 1GW6A 4JLRA 3CFKA 2PO6B 2Z7ZA 1JMXA 3RYMA 5FS5A 3P4OA 5IB1A 4LLDB 2VR7A 1N19A 5GJTH 4ADJA 5TFSH 1AQ8A 4HISA 2CM5A 3DXAB 3H4FA 3HZVA 5DA0B 3QFJD 3WEAA 3F12B 5A16A 1EHAA 2Y7MA 2H7WA 3LV3B 1ETZB 4Y2DB 5DLMH 5EF2A 1JZ7A 4PLJD 2FO1A 2NCMA 2ADJA 4M8VA 2P5PA 2XVLA 2Y6SD 3L3OA 4QRSB 2GITA 1EMTL 2HT2D 4CVXB 3HR5A 3QEGL 2YD9A 4ZMZA 3MRLB 2W59A 4EDWH 5D7JD 2DQFA 2DBLH 2PW2B 2XQYA 2ZPKH 1I1AA 4ABUA 4EN3D 2E7CA 2Y06L 4JFDA 4JJ5B 2KDGA 1IILE 1WBYA 2CCVA 3MA7A 2IWGA 4NQDA 1WCBA 2FEEI 3NIGE 5EBWB 3SPIA 3ARFC 1QNZL 1GGIH 4L4TB 3FSAA 3AS0A 5D7JB 5C0FB 4JKPL 3S3BB 1E4HA 3RJDA 4C83B 5K9QI 4WFFE 4NQXB 5D71L 4EN3B 3B3IA 5D6DA 4UZGA 2HX8A 2E4TA 3TBCA 4KAQH 3FU6A 3BIAX 3P1VA 4O02H 5DDHB 4TVUA 2HLAB 4B7LA 4FP8L 1IGIH 2OV0A 3MGOA 1BZEA 4OQTL 3KYKL 2PCFB 2YKLL 1RUKH 2AJYL 3J27A 1TDQA 3V2AR 3VMPA 2IAMD 3BJ91 4WV1C 3M8OH 1KTCA 5LWYH 2VM9A 3CMGA 2QHRL 5ACMA 5CZRA 3RVUC 2QHLA 1FSKB 2AGJL 3MFFA 1UACL 4ALAC 1OGAE 1RZQA 3VFUB 4FE9A 1A6TB 4FQJL 1K85A 3H7LA 5FFGA 5DLLA 3ZZLA 4PJGF 3SDCD 2IANE 2CGZA 4GP5B 2E5EA 5DHVA 4MNGA 1IGJA 3RJOA 2B3RA 3AAZB 1AGFB 1WBXA 5IVZA 1E8WA 5JTWA 1A6WH 3ROOB 4JVWA 1IGTB 4BK4A 4EUPG 1XH3B 2MHAB 2Z6FA 4JO5A 2EXYD 3CHSA 4ISVB 3QQ9C 3BKML 5K1JA 3GNMH 1UB6A 5EBGA 2AKRA 2PR4H 1KB9K 2V9TA 5EOCJ 2OZ4A 2D9CA 1FL5B 3PHSA 3OAWA 5HJDA 1WQVT 5DJ2A 2VL5B 1CF8H 3FBKA 4K2UL 4PS4H 5IMLA 1QFOA 3U6XA 3LKOA 1KB5L 2CRIA 1B2YA 2X0UA 4LCIL 4TQEL 4PJFE 4PRNA 5FF6B 3SGEH 5KBLA 4G5ZL 4Q9BA 2WLNA 1QR4A 5AWNH 4TRPH 1AKJD 5K59F 5KVGE 3MV7E 5FHAL 3NFPB 2BP0A 5AW3B 2JCCA 4G8EB 4RAVA 3TO4C 2GJ6A 1M3JA 4LFHG 3QULB 5BRPA 1DUZB 4G8GE 2V8MA 4OZFH 1AKJB 1IGYB 1OPGH 5AG8A 2EYSB 2UZYA 1GZPB 1MCOH 3LZRA 4OLZH 3VI4B 2HWZL 3VXNA 1OE3A 4KU1A 4MCZA 4QO1B 2JI2A 3GK8H 3WIHH 4NUJB 2CE6A 3VXUA 4P2RD 1JF6A 1BQHG 1SDDA 3ERXA 2NY0D 4YGVB 3R4DA 4P9MH 3FAXA 3US1A 1P1ZB 1DJZA 4M6OH 4Z3JA 3IRPX 3JV5A 1PBYA 1OGSA 1EPFA 3DARA 5DQ9A 3B5GA 4PH8A 3FU7B 1HEJC 3KZ8A 4YHLL 3M88A 3ZDZB 2KZKA 4P2RB 1HCYA 1IKFL 3FQ2A 1ZKAA 3DVNB 1S7SA 4L8DA 2NY0B 1CD0A 3UYPB 5E0QA 4NYLB 1GZQA 4ZG1A 4GKZA 1Z9SB 2W9DL 4A2DA 1XTLA 1VEPA 2GAZB 4XGZA 2VRAA 4FX5A 2WBJA 4YHNA 4Z77A 1RJCA 2Z31A 4JRXD 2H0PA 3IE4A 4ZQKA 1QLRB 4OFDA 2YUVA 3G5ZA 4GG6A 1P2CA 4XC3H 1CFNB 5T1LB 4AMKH 3GMQB 1KIUA 5FB8A 3AU0A 3O81A 4K3GA 5F7NC 4F2MB 3UPRB 3MNVB 3QZWA 4MNHA 1N5YL 1GPOL 4JRXB 5I8EB 1SXCA 1P7QD 1ND0A 5C9KA 5SX5H 2R69H 5GZOD 3LX9A 3MOBL 4PJXA 4DGVL 1HX0A 3U0PA 3O9WD 1PMYA 4UWQB 3BQUD 4AQEB 5LJYH 1O6SA 1YPZA 4O02A 1AMXA 1P7QB 2HUHA 2X42A 5IFHL 1WGOA 4ZO9A 4GPVA 4D94A 3NCJH 1M53A 3L1OH 2ENYA 3V4LA 5EA0L 2DRUA 2YBRB 4ONGH 2VABA 4R5XA 4UM9D 1NGZB 3BQUB 4N6QA 1EEZB 5GS2D 5SWSB 2XHNA 1LXMA 2R1WA 2XN1A 3IPBA 3UGUA 3WNJA 4JCWA 5I75C 1WE5A 3GJEB 3OZLA 1RZGA 3MOQA 5FCUL 3VFWA 1S3KL 4NKQB 4C56E 1WHOA 2XCMC 4KWUA 3RUGF 1IFHL 1NMCB 3VYPA 1V05A 3BZFB 3NACL 4YDNA 1ML0A 1C08A 5ACLA 4K3HA 4KKLC 3ABLB 4LAQL 2Y1YA 4MS6A 4YO0B 3VTMA 2NXZC 4G82A 2V5SA 3ZTNH 1A6AB 1A9BB 1MDTA 4H44C 5LO7A 5G4OA 3SKOB 1KPVB 3CN2A 1WS7A 3BH9B 3SBPA 3GTTA 4I87A 4ABQA 3DTDA 4F80A 2BSBA 2FATL 1DL7L 2G60H 5F9OL 2CQVA 4ZMVA 5C0NC 3LSOA 4URTB 1XB8A 5I1LB 1RJYB 2ZOKB 5DHYB 2EP6A 3EYSH 1YRKA 1NH6A 2Q5BA 2NY3D 1KYDA 3SDAA 3WFHA 5JNYA 4IKKA 3BWAA 3KBHE 2BFVL 4PBDA 4P2OD 1WFTA 1EZVY 2JKTM 1WDAA 1QQDB 2VW7A 5I2IB 1X5HA 1GGCH 1EERB 1UC6A 3F2LA 1Q72H 1KWKA 4OV6F 1SFDA 4U6VL 3UJJH 5HPMA 1XD1A 3BKYL 1XIWD 3KBPA 5PAZA 1P6AB 1DCEA 3AC0A 3QFJA 4OZFA 2ZSVA 2L7UA 4WY7H 5JOPE 1AD9B 1O6TA 1AXSB 4M61A 1IE5A 1SOQA 1FFRA 3NH7L 2OTWB 4F9PC 3DECA 2GC4C 3WIHA 4J3XA 3P4MB 1Z0MA 4Y5VC 2HPOA 4R7NB 1V10A 4ZNEA 1WAAA 2XXGA 3QA3B 3DX0A 3H2WA 1X5AA 4ZFOB 3WLBB 5JXED 4K5LA 3JWOC 5JO5B 4Z7UF 5GISL 4FL4C 3MAWA 3I9IA 1TTCA 3NAAL 3EFDL 3MRJB 5CUSL 4FQIL 3SE8L 4FFYH 1XF1A 2C9VA 1M71A 2OQJA 1ASQA 1MAJA 4AI7A 2B1OA 3L81A 4HJ1A 1OEZW 3N42F 2V37A 4F7PB 1ADQL 4NENA 4M6NL 2G5UA 3KNBB 5JYLA 3DROB 1RK1A 4XHQA 4HIXH 5CMAA 5IBLC 2HFFA 2F74B 1NL0H 5E2WL 2J55A 4HLZG 1EEYB 4ZW3A 1V7ML 1G4MA 4E9SA 2WSPA 3DNKA 4AKOA 1D7CA 3FZUD 4M4RA 1Q9KB 5TQ0H 5J13C 3VI3B 4UZSA 3DHPA 4IDLA 3WAKA 2NTSP 1VFOA 3QPQC 1B2WL 1AO7E 1XF4B 1FCGA 2LOEA 2ZT9C 1CLYL 5I19L 3ZE0F 2NQ3A 4CMMA 4P5TA 5GS2H 5JDSB 3LH9A 3QR0A 1DJIA 3VD9A 3V7MA 1TJHL 4B9YA 5D2NB 3HB3B 2R69A 1KXVC 3EYVA 4IOFC 3DBXB 1KBWA 3SDCA 1JF5A 3SPVA 1QPKA 4RFOL 3MV9B 5EU6E 1C1EH 1OAJA 4XN4A 2X4TB 2FQGA 5FLVA 1XO8A 4I13B 3X11A 5K5YA 4OLVL 4O2FB 4RFEA 3F7KA 2V7NA 4XO8A 3F7RA 2NUTA 4O9HH 1JZIA 5JW5A 5IB4A 3EYFB 1MLCA 2W0LA 1MHHB 1BOGA 1KB5B 1U8IA 4LQFH 2BXYA 4PRHE 5F1SA 4ODWB 4A68A 3LXUX 5G2NA 2CKBB 1IEBB 2DKUA 1SQ2N 5EU5B 5H2BB 4X9BA 1ORSA 2VT0A 3M1BA 5JOFB 2R2HB 3CZUB 3G6JA 4NNXA 5C09D 2OMNA 1B0IA 4R5VA 1EMTH 1M6OB 3GXTA 2FHBA 3QEGH 1R6VA 1L9TA 4R6UA 3PJLA 3MU3A 1KLFB 3GO1L 3KPSD 4OV5A 1KENL 3CNKA 2Y0SA 4ELME 4PJHF 3LIZL 4NZJA 3V8OA 4ES9A 2Y06H 4RGMB 3OWEA 3MYJB 3UYRL 3F6JA 5C0JB 2WTRB 2AZAA 3L45A 3WEBA 2MQ0A 4U2ZA 2AV1A 3RZCD 2ESVE 3DJ9A 7CGTA 2E7LC 5DT1L 3CIAA 1GIGL 1JV2A 3JTBA 2DWXA 5D71H 3UCQA 3BPNB 1EJFA 1LO5B 2NW3B 1A65A 4Z18A 4JQXA 1L9SA 1WRFA 4LIQE 3CDZA 5E95B 1ZK5A 4FP8H 4OUUB 3QZPA 5IR1B 3RZCB 4OQTH 4XCCH 3FPXA 3KYKH 2EDJA 3DWTA 2YKLH 4XPHL 2AJYH 3IFOA 4L1BA 4UQ2A 4GYBA 3NFNB 2JQAA 2LU7A 3HS9A 4GMSL 4A66A 3US0A 4ZS6D 1INEH 2QHRH 4OGZA 4OZHE 1UWYA 3K8KA 4ADIA 4ICWA 1ZS8A 2AGJH 5BVJB 1UACH 1D6VH 4UIMB 4FJYA 3APMA 4FQJH 4MYPA 4LHJB 4ODTL 1H8LA 1GA2A 3VVVA 4ORZC 4DP9X 4E41B 3P4NA 1QUPA 3S4SB 3VFNA 1Y0LA 1I3UA 3CDGA 3JV4A 3AUWB 4NRXB 4BKLB 3TURA 3GXNA 2CZNA 3ATBA 3GSQB 1SNRA 4JFTA 4OZ4B 1QBBA 3MRBA 4PJDB 4Y4KC 1JI2A 2VXSL 2HVBA 4J3OG 1JK8A 2APSA 2ZJSL 1Z5LB 4FFYA 4WO4B 3DTXB 2X4NB 3WEMA 4D9LL 4JRWA 1I3VA 4LCWE 2BNRA 4OCNC 5BS0D 3BN9D 5I1IL 1HL5A 4JN2B 5ANHA 1QEWB 3UCRA 5GZOA 4WGWB 2K70A 3N41F 4K2UH 2GHWB 3GKWL 1JDCA 4N26A 2GIMA 3FQNA 4LCIH 4MJ2A 5T5NF 4G5ZH 4PW9A 3GS0A 4MXQD 3ZDYF 3LVTA 5BS0B 5HI5D 1T7ZA 2HLFC 4NWUL 4F3FB 1XGTB 5J57B 3C75A 1NDMA 5FHAH 1S7WA 2BVOA 1YY9D 2R2EA 5C0CD 1J5IA 3JVFC 4UM9A 3GSXA 3WDJA 1UJ3B 3ECBB 3Q1SL 3T8VA 1XR9B 4Y8DC 5IROA 3UTPD 1SOXA 5AVQB 3IU3A 3MLWL 4UT9L 3D85D 3SQOL 1FRGL 3Q5YA 2IFGA 2EQDA 3ZMEA 3B7TA 3QZWG 2HWZH 3QWRD 3BDBA 1FHGA 2BP8A 3WG7B 3QXDA 1XGUB 4OFYA 4MLIA 2FWLB 3POCA 3PWNB 5AAWC 2K6YA 1DJGA 1A14L 2XZAH 3AW5A 3NPSC 5D1QE 4CSZA 4GW5B 1HDMB 4XBGB 3ARDA 3HZYA 2BVQB 4X2UA 1BMZA 4U31A 4E36A 3MNMA 5AOIA 1BEXA 4YHLH 4AXWB 5E9DA 1UGKA 2XTSA 5GS1C 4U33A 1PKQA 1IKFH 3B5TA 5K93A 3TH2T 5D70L 1DQKA 2RD0A 5AFAA 1DJHA 2UZXA 3VD2A 4N8VB 4MYWB 5EF3A 2FEEL 1JAEA 4QRUA 3WS3B 2DBJA 5CGYC 2VN5A 3QJRB 4Y1AD 2C9QA 5EZLB 3V4VB 3UZQB 3OMAB 2Y4SA 4P2OA 4UB0L 1X4YA 5IBUG 5AAPA 1JGUL 1BSIA 5J6SA 3AQYA 4MDIB 3NESA 3MX0B 1E5CA 3ZHFA 1L9NA 1T4WA 4H0LC 3V10A 3BZDA 5C9JA 5IMMA 2X1PA 1S7QA 4PHXA 1ZJAA 5F93C 5BO0D 1XIWA 4Y1AB 2Y1ZA 1N5YH 4P2AA 1GPOH 1ZPUA 5FW8A 4DPCX 4UZUA 4FMFA 3LN4B 3VXRD 1QSZA 4NO2B 1FLTX 1E4WL 1HH9B 2APBA 3FUIA 4C57C 1GC1C 3QB7C 3MOBH 4IDJL 4A6YL 4FLHA 4DGVH 5I23A 4HEPA 3GI8L 1DE4A 5FW6A 1W8EA 2IV9A 4Y5YC 4RX4D 4X8JA 1E90A 1ES0B 2FJHA 3NZ8A 5IFHH 4NKDA 3Q06A 5KTEL 1EX0A 3ALPA 5D1ZD 4OQTA 4J6IA 3VXRB 5JXEA 4JRYA 1JHKL 3ZUCA 1INDL 2J8OA 1WWBX 5TGBA 2F7QA 5EA0H 3LN5B 2PKDA 5CR1A 5IFJB 2WMPB 4GKNB 1DDHA 1UXMA 1IGML 1VFAA 2Z35A 5D1ZB 3REVA 3GC3A 1EO8L 1S3KH 1U30A 2OULB 2D7QA 3F7VB 4OZFG 1IFHH 4JFHD 5K69A 4P23C 4NOBA 3RWJB 3NACH 1I7TA 2F1EA 4MNQB 2R29A 5ISZD 1RUPL 3G08A 3GIVA 4LAQH 15C8L 4MHHI 4QOKD 1GYUA 1BJ1J 2FWOA 1F6FB 2HT3C 2X7LB 4KXDA 1BZQK 3UBGA 5I16A 5BOJA 2WXLA 4KUCD 4BEIA 1KYAA 4G6AD 1GYAA 2FATH 1DL7H 5F9OH 1JI1A 3L7FB 4JDZB 5A6IA 4MQTB 2DEXX 2EXWD 1P53A 2BFVH 3TO2A 4EZMA 2ZYSA 4Y2OA 5KYYB 3L2NA 1IB5A 4ZZKA 3W37A 5LCVH 3C6SA 3BN3B 3O6FB 4X4ZA 4U6VH 2AXHA 3D48R 1DQML 3BKYH 4DP1X 1HHKA 1PSKL 1TTBA 2FUTA 1PZUB 4LHQB 1HVXA 2J8UE 3OKKA 1LWRA 5E4EC 5ABZA 1NIEA 4PGBA 5DUML 4Q9CA 1A66A 5ECJE 4M5ZL 3VXME 1IAOA 2C3GA 4AQ1C 2C8NA 1MCSA 3NH7H 5C09A 5B3JE 3D18B 4A7VA 1ZIAA 3BOVA 1L0PA 3WJMB 1T1YB 1A64A 1C7SA 5I1AB 4PY8I 1QLFB 2A99A 1RJZB 3DGCR 3LPWA 3MRRA 4WGKA 2FRGP 3KPSA 1IGCH 4I89A 2WWKT 4OCYL 4OCLC 4UM8B 5DRXB 3VFMB 1T03L 3AY2A 5ITFB 5DD1L 4JPKL 5GISH 1TU2B 2DH3A 2NDGA 1JPGB 2VDLL 3EFDH 3LNDA 2XFXB 3ARBD 3QPXL 4NT6A 5CJXC 2C9PA 4FQIH 2VLKE 3OX8B 2YRZA 2JXMB 3IPEA 4P2CG 3DSFL 2YAMA 3VWJC 5EU4B 4QRQB 5I8CB 1HEZA 5A3IC 1WISA 3LQZB 4RBPK 5HDWA 4AT6B 4F33A 4P2QB 1ADQH 3DX8B 4Z7WA 4M6NH 3NP4A 4W9JC 1F4WH 2BPBA 4Y2LA 2WLJA 1EJ6A 3ARBB 5E2WH 2A1WH 1F58L 2BSCA 2VIRB 4LZKA 3EBIA 5LN8A 1V7MH 4AKQA 3P9MB 3TCXA 1RK0A 1T89C 4LHUD 4PJCE 3FC8A 4HCFA 1ET8A 4ZODA 4HPYH 4Y7OC 3HC2A 4ZW8A 5LKNA 3QDGE 1B2WH 2KH2B 1CLYH 2Z0UA 3ETBF 2OMTA 2MOVA 3K2IA 2FK9A 4EIZC 1AR1B 4BFIA 3IKCA 1UM5L 2ZCLL 4KV5E 1TQTA 4I0PB 1TJHH 4Y4HD 3L4ZA 4Q2ZB 4ELKB 5GGUA 1SXAA 1ZE3C 4DKFL 4KRNA 4RFOH 4TSAL 1H3PH 2V4LA 4JZJC 1L9MA 3PJNA 3WIIL 4AC2A 5C3IA 4YFLF 4GO8A 4X9YA 2D9QB 2JKXA 4N9OB 4OLVH 5DRWA 2CDEA 2H5UA 3VWKB 4ZJ9A 4HFWB 3GMNB 3JBG7 4GNKB 5BVPL 2CK0H 1AC6A 1IFGA 3O4LE 4W6XB 4TF4A 1Z6JT 5D96C 4EUPB 4R26L 3RDJA 1CICC 2P43B 2Y7QB 3QAQA 3BVVA 5LGHL 1ACYL 1CQKA 1BXAA 1DYZA 3EO1B 5FLUA 1R47A 3RHWK 4K7PL 1U8OA 4G8IA 4K3EL 1I82A 2OSLA 2HFEB 3KXFE 4RA3A 3TCTA 4AQ8A 3CVDA 3IDIA 3OKYA 3STZA 5KN5B 1N8ZB 1UT1A 3VSUA 2FEDC 2PYED 2Q6WA 5B3SB 1NOFA 1FH2A 1E6JL 1UB5B 1W72L 1A1MB 3CFQA 3GO1H 1KENH 1E6OH 2AFNA 3H3BC 5EZPA 2XWXA 3Q6GL 4JPVH 1E50A 3LIZH 3PIQA 3FQXB 1TTFA 3X12A 2VAAA 1UWXK 4NUGL 4BIKA 5C92A 3UYRH 3DX6B 5HDBE 3D85A 4EI5B 4CVWA 3QG6B 5IT2L 3NPZB 1ZHBB 5DT1H 1TR7A 3QWRA 4ANKA 3UAAA 4PJ7E 3NN8A 1PNCA 1F4HA 4DAGL 1RZKC 3ZHLA 3HC4L 4OZGA 3HNTL 4RWYL 1CE6A 1DVFC 1FYTB 2GABA 2ZXBA 4KNQA 5LCVA 3LVEA 1S9KC 4LOFA 4B9CA 3JVGA 1NGYA 1N68A 4XPHH 5HYSB 1BQHB 4GRMB 4Y4FB 4UNUA 1ZPLA 4UCFA 5KVFE 4JE0A 1A3LL 4GMSH 4HHAB 2LABA 2VLRD 4NRYB 5EOQL 2IBZY 4NAMA 3RWFA 2UV3A 4Z7VF 4W9EC 1BX2B 3UBXA 1LE5A 1XL4A 1NCIA 4BSWA 4MZ3A 1YEHL 2GVYA 3PWJA 4OZIE 2BMKA 1IZKA 4PRPE 2NZ9D 1U93A 3HJ0A 3K2UL 2B77A 1JV5B 4FULA 3KGUA 4K94L 1DEEB 1HFUA 3EHBB 4X5LA 5D2LA 5H94A 3ARUA 4A6YB 2VXSH 2F53B 2FWUA 2ZJSH 2OP4L 5H8DA 4D9LH 3DI3B 1DSYA 4K8RC 5I1IH 2ZF8A 5J1AA 3L3OC 1ADQA 5F1IA 1JNJA 3V6OA 5DMIL 3RWHB 1LK2A 3H9ZA 4BKTC 1TYJA 1SN5A 3KWTA 1I1AC 1SYVB 4EZJA 3KW7A 5JIIA 3AITA 4NWUH 5LQBH 4LDEB 2A4CA 1Q0XL 3JUZA 4LBEB 5E4AA 4JN1L 3VXOA 3VH8B 1U41A 3S3JA 3BX7C 4RRPM 3Q1SH 1MHEA 2IF7A 3R0MA 4WEEA 3D52A 3QW9A 3MLWH 4UT9H 3RX5A 1FRGH 3SQOH 2ED8A 5HYEA 1MJ8H 3L5WB 4AM0Q 2BVPB 5E6ID 3RTQA 1J8HE 4J27A 2VQUA 1LP9B 1NANI 4GQ9L 3SB3A 3LH8A 4WJ5B 1T3FB 1JYXA 2HKAA 5DD6B 3RIAF 3QGVA 4X8CA 4HEPG 4Y19B 5E6IB 1RIHL 1T0OA 4QOKA 1JPEA 2X9YA 3NSXA 4M6AA 2LGNA 1MRDL 2AZUA 3R18A 2DMBA 1NZRA 2NY4C 3TYFB 5IQOA 2ZF9A 1MH5A 3SHSA 1BJ8A 4J12A 4CN6A 3DX1A 3N43B 1O7DC 5F9WB 3IGAB 2VDNB 1CK0L 5D70H 4JPIB 5D7LB 3S5ZA 5EHFA 3AG2B 2OZNA 3WL9A 5EUOB 1FH5L 4Y16D 1HWGB 3ATEA 4L9LA 4PP1C 1T1WB 4UB0H 5C8JA 1JGUH 3EDJA 2P8PA 5BQDA 3PWPE 2IPUK 4XAKE 2H3NA 1XCTB 2VLJE 1MI5E 4MMXA 2C9AA 1S7VB 2EDBA 3LIZA 4PWHA 3LEYL 3VJ6A 3V0VA 1DLHB 1U8LB 1UZ6E 1D5MB 3QIWD 4NBYB 5FA3A 2PWDA 2V5YA 2R59A 3GFUA 1WFNA 2R15A 2OMWB 2X6UA 3C5SA 5BO1L 3E8UL 2EUVA 4FG6D 2C1OB 3FCSA 1C8PA 1TXKA 1KIQA 3QORB 3PL6D 2BCKA 3T0BA 3GI8H 4KK9D 2DQTL 5HHME 3CUPA 4ZFFA 1ZA3A 35C8L 4FJZA 1FG2B 2FX9L 5KTEH 2OBGA 3MRQB 4UBDD 3MRCA 2B08A 4H8VA 4X0KA 1RP9A 5LNDA 5D7IE 1INDH 1QA9A 4UQ3B 3EYOA 3MRFA 3MUGA 2ADFH 4NQUA 4FHKA 3IN2A 4MJ5A 3ZO0A 1T0MB 3DJRA 2PLTA 1IGMH 3MRPB 3PXHA 4GY4A 4HUCA 4GG8B 2YGPA 4JDVB 5I82A 1FVDA 4JGJA 3TLRA 1XGRB 3SD5A 5J1TC 2ODHA 1EO8H 4UTBL 1FJ1A 1FA4A 4J3OC 2DWSA 3CFKB 3W5NA 3OKOA 1X5LA 4YSSA 4Z1PA 1SUJA 5FYKL 4QHPA 1UEMA 2XJKA 3VFRA 4YVUA 4LHUA 2A5UA 2LAAA 1RUPH 4LLYA 5H4YA 4WNQB 1IQWL 3L6FA 2J2ZB 4TNEA 3AWGA 4J4PA 4GI8A 3WNNA 4CU7A 4L9DA 4QXUL 2VMJA 2AJVL 4XO4A 2WN3A 2FNWA 2WBJC 3K5SA 1YN6B 4GEIA 4JRLA 2Z31C 1E8XA 4BK5A 4JGNA 1S7RB 3KLLA 5C07E 2W95A 5HYJB 3DO7B 5HHXL 5DURD 3MBWB 1HYRC 1FWXA 2FB4L 1MF2L 4AVIA 1EDYA 3SDXB 3MA7B 3MTRA 3PUUA 4QHNB 2X9ZA 1ZT4A 1G1CA 1WCBB 1A4KA 4D0BB 1U8HA 3AMLA 1KBPA 2K4AA 4HSQA 5EIVA 4D0CA 3HHSB 1PSKH 1V3LA 4X99B 3BVDB 2OYMA 2PTVA 5LUMA 4UT9A 1P5UB 3FB6B 4GW1B 5DUMH 3TIDB 4M5ZH 1XGZA 3O11B 3T3ME 3F01A 4CSSA 2DIJA 3WY4A 5K1NA 4FKKA 1QG3A 1JYNA 2PYEA 1JPST 2AJ3B 2EIDA 4ODHL 4PD4K 4H25B 5E4OA 3Q8EA 2A3TA 1MN4A 1ZT7B 4L4VE 4HUNB 3MFFB 4OCYH 1T03H 2CKNA 5DD1H 4JPKH 1NOAA 3CN3A 4I5BB 1E9OB 2VDLH 2FBRA 4OCWL 4J23A 3QPXH 5CWSB 5IUCA 5FK9B 1IGJB 3DSFH 4QGTA 5IVZB 2UWEA 1VACA 1BZ8A 4S1DC 2AQ1A 7FABL 2EJ1A 4EZKA 1U4FA 2X6BA 1OAUL 2A6DA 5JYMA 1NSNL 1F58H 5DWPA 5F7DB 2R0WL 4I3SL 1KIPA 3U9PH 1IQDA 3VSTA 4KQ4L 1WAEA 4TYUA 5KZCD 3NIDE 1M6UA 3FL7A 4QXVA 4XH2B 5DJ2B 1LO0L 4HAKA 1CFQA 2GSGB 1KG0B 2BY3A 2QKSA 4ZS7L 3LRSA 2VLRA 3BXNB 1HXMB 5T3ZL 4WUKL 5E4IA 4BQBA 1UM5H 3SDAC 4PRBB 3SE3C 1CDBA 3GSOA 5KZCB 2EC9T 4FA8A 4DKFH 3QWNA 4QRTA 4QHUA 4TSAH 4TUJB 3E38A 4U1KA 2EYRA 4B41A 5IB3B 3WIIH 5KSUB 1C12A 4RAVB 1JZJA 3I75A 5HHPB 4P57A 4NAQA 5FKAA 3ECUA 4YSDA 3C5XA 4KRPD 5IMOB 2UZYB 4CUCA 5BVPH 2W38A 5GGTL 2M8XA 3GBDA 4MCZB 2OI9C 3C8HA 4LCCA 4HUXA 4NP4L 4R26H 3QEHB 1TTAA 3F7YA 4N2GA 4PLJC 2OL3L 4WK2B 4B9FA 4JAMB 4N0UB 4N2MA 5FYLE 5LGHH 3WDHA 4AYSA 1ACYH 3D1MC 2Y6SC 2VR4A 4KRPB 2HT2C 4H1LH 4K7PH 4QDGA 2QEJA 1P4LB 3FUHA 5EEZA 1WC7B 4JFEE 4BFGA 3QXWA 3WTUA 1T1XA 1W6LA 3MPCA 4XNUL 4NFDA 3EJYC 3D0LB 3UBXG 1E6JH 1V5JA 3MBEA 2ZE0A 1PX8A 2YRLA 1ZTXL 1YEWA 3PQYD 1W72H 2A6IB 5DO8A 5A7EA 5HYFA 3QVAA 4PJBA 1FFTB 1NFDB 4XMZA 4XGZB 4NUGH 4JFQB 4UMGA 3P73A 3U83A 1Q9OA 4IIZA 2OW7A 3BEWA 3DV6A 3PQYB 5IT2H 1PY9A 4KH2A 3ZZSA 3DSNB 1U8PA 5C0CB 2XNAA 1RHFA 3KS0H 1SVBA 3L3IA 4FLRA 1FAIL 1E3ZA 1YMMD 4FQXD 3HC4H 1JZ8A 3QZWB 3HNTH 5ETUA 4RWYH 5AD0B 2IAMC 4BBWA 5MP6L 1RLWA 3GEWB 4M48L 5E8NB 4ZFQA 4KJQD 4LP8A 3MRNA 4S1SL 5GZND 3VFPA 2ED7A 1HHJA 1X3DA 1FV1B 2ICES 4N2LA 5I8KL 5FDYA 5IM7B 3WLWD 3U0PB 1A3LH 4FQXB 3T04D 5DF0A 4Z78A 3S8GB 2VYRE 3SDCC 4Z3IA 2OCCB 2DD8H 5I74B 5DFAA 2WBKA 3FT9A 3A6BL 1QVOA 1YEFH 4ZMPA 4TUOB 1YEHH 3ESVF 3EH1A 2DKSA 3FKUS 4N2OA 4N2BA 4Y16A 3ZY7A 4HIPA 2VABB 3TIEB 3K2UH 5LGYA 4FXTA 4LOUD 2EXYC 4UQDA 1QYGH 3CZJA 4QMEA 5KSVA 4OW6A 4K94H 2ARJA 3GIZL 5IBUB 1O7DE 2CGYA 4WU7B 3I84A 5FV2A 5LBVA 3D4CA 4N87A 3ZVVA 4MB3A 4PJEE 1JPTH 3D6GA 3ARGA 1HHHB 2XWCA 2LFGA 3GBLA 1HWHB 5J4MA 2OP4H 5HI3D 2LLLA 2UY7A 2B0SL 3QRLA 1BBDL 2CA3A 1UM6L 5FFOA 2WM0A 5DMIH 2CG9X 5F7EL 4KI5F 4LSSL 3LS4L 5DTFB 3ZK0A 3FFCB 3KPNB 4PJCF 3FDWA 5F7MC 1GS7A 1Q0XH 3DOIA 2QDVA 1EAJA 4JN1H 4HUWB 4NZRL 3CXDL 3WFHB 2CAKA 3D50A 4WUUD 4M8RA 4O51B 1KCRL 2XY2A 4MRCA 5EFIB 1G0XA 2NY2D 1TETL 1YNLL 2Z91B 1RZIA 3LEVL 4KHXL 4JQXC 2EEAA 4PJ9B 4UILL 4MJID 4ZDHA 3FB7B 5TDOB 2GJ6E 2WD0A 4GQ9H 2NY0C 3UROR 4CVZA 4LOVA 2VZ1A 5D72H 5KS9A 2CA4A 4YNYB 2BNQD 2ZSVB 1CD1A 3D30A 2CO6B 1RIHH 4PS7A 2KZ1B 4MJIB 2W0FA 5B1CA 1Y6NR 1Z9MA 1R1CA 2W94A 3E9UA 3W0WD 3QO1A 3LZOA 5DQJA 1HINL 3QXTA 3QO0A 1AKPA 2AXFA 2XTJE 5E2TL 2FIKA 1CK0H 4YQXL 5CU9A 1F90L 2BNQB 4JMXA 3V4UL 1D5XB 4H1LA 2Q76B 4RVBA 3K91A 2XVBA 3FRPA 3J8F7 3QEQE 1I8IB 3FT2B 4OGAD 2Z7WA 1J0KA 4TNWF 4ZK8A 1G0DA 4Z7QE 1CVRA 5EN2B 3LEYH 1YAZA 3Q01A 3KLHD 1I7UA 2EADA 5CEYA 1AVAA 2DB8A 4LHUG 4W9CC 5FOJA 3AJ7A 1FGNL 1AHKA 1QI4A 5GZOC 5E8EB 3BGAA 2BOBA 1HESA 4X5PA 3KYMA 3UAEA 3VD5A 4PJGB 2EO1A 4N2FA 3O9WC 5BO1H 1BQKA 5IQ9B 3E8UH 3MRHB 2JIXB 1SJHA 2VQ1B 4U1GC 4NZ8A 2P8LA 2AV7B 3HG4A 2DQTH 4DGWC 3O3UN 4OTXL 35C8H 3P40A 4NQCD 2B39A 3PWVB 1OCRB 2IDUA 3GBNL 4P5TB 3TP4A 2FX9H 2VB5A 4D9QD 4AYID 4U1IA 3S2AA 2JK5A 4L37A 4X7DC 2A74A 5IROC 4F2EA 1BFSA 3EYVB 4AG4L 4I1RA 4A04A 5IVNA 2PWHA 4RSVA 1YPZE 2Y5QA 2FCBA 3O0LA 4G42B 2WLKA 3SDYL 5T3ZD 1G94A 4Y89A 3FTXA 4NQCB 1OW0A 1G7IB 4IIQB 4MA8L 4N2EA 2D0GA 2OSWA 5EZJB 2Z93B 1AGEB 5L2JB 4UTBH 4MDJA 4ZI8A 4JKNA 1A6PA 1GVIA 1RIUL 4F92B 5FYKH 4RRPA 5SX4I 2EYTB 1JZ6A 4BV1A 2GT9A 3U36A 1R4XA 5JZ7D 1JHTB 1YEDB 2UXTA 1IQWH 2KBGA 4WI5A 4QXUH 3BUDA 4X6EA 5DJAB 2WQWA 2GSMB 2AJVH 3RL2B 2GBTA 4YHML 4HZLB 3Q8FA 4OD2A 2NY3C 3GKZA 5DJCB 2KL6A 2TAAA 2LV4A 2EDMA 1KXTA 2JKSA 4NN7C 1TMCB 5FGSA 4P2OC 4JZNA 3M7FB 4BD4A 3UTSE 4AZ8B 5HHXH 3MGTB 5DZOA 2HVJA 4DGUA 1MF2H 3D09A 4IQHA 5L2KE 4UQBA 3GSVA 4N3TA 1IC4L 2VE6A 4N1HB 1XIWC 4BH7A 4XI5D 1IBHA 5K9QG 5MEQB 1PYWA 3O6ML 1PZ5B 1MCLA 4XP1H 4IKNA 4X5RA 3GI9L 4HS8L 3RWIB 1OTTD 1A2YA 3DXAE 2J1XA 1GGBL 4JFVA 4XBPB 3TZVD 2EUXA 1W8OA 2GK0A 1JZGA 2ITDB 2D3VA 2PN5A 3O0RL 2NNAA 1I53A 3KVPA 1KELH 3FS9A 3U2IA 3ZTEA 4TLKA 3V0AC 3GSNL 5JXEC 3LKRB 1DBJL 2AW2A 2W88A 3T0VA 1NBQA 1XAKA 3V4PB 1BW8A 2D7NA 4HU2A 2XQYK 1NLBL 2VM3A 4J3BA 3RBSA 3EBAA 4LLVB 5F9JB 4PP2B 4OJAA 4U1NA 4OCWH 2JKIS 4IJTA 3Q3GA 4FTVD 3PGCA 1EUUA 2G2NA 2YRPA 5EF0A 2XSKA 3IT8D 3CDGB 1KB3A 4X6BB 2W9LA 1XXFC 4RZKA 1NOLA 2MWCA 3D3VB 7FABH 5CUSH 4WGVB 3U4AA 3K6FA 3RNKA 1YMMA 1OAUH 3FZUC 5D2NC 5IW6B 1NSNH 3LKQA 3B1UA 4CKVX 1FHNA 5AOJA 1GZHA 1KLUB 2R0WH 1QUNB 5TPWL 2CHXA 1DSFL 1PCSA 4KQ4H 2WAQA 2KPNA 1EDHA 1XZ0A 3WY2A 1LO0H 3EJJX 3QQ3A 1UZ6F 4D8PA 4JFOA 4FMKA 2YPLD 4ZMNA 2PMZA 2X89D 3L1EA 3OMIB 4ZS7H 2EABA 5IUSA 3I74A 3G6DL 5T3ZH 3TFBA 4WUKH 1DQLL 3U82B 2CM6A 2EVIA 5GSRA 5D4QA 4PGDA 3VFOA 1ITBB 3CZEA 1R5IA 3RUGB 1R5VB 3QDJB 3FCGA 1KN4L 1TO5A 4QJ3B 2ZX7A 5T1MA 2YPLB 4LVOC 2X9XA 4PD4J 4GRLA 3VMOA 2ATAA 3GSXB 5MHSE 4UOW1 1YECL 3L3GA 3QIUD 3FQTA 3IDXL 4XVUD 5C08A 4YHZL 2A4EA 2O61B 4QD2E 4YMPA 3BD3A 3MLSH 4PHZA 1KYOK 3ETTA 5DVOA 3W39B 5GGTH 3Q8CA 4TLUA 2M26A 1M4KA 3AXLB 3QCVL 3QZNA 2WNWA 2XN0A 4F8QA 3PHOA 1T83C 2OL3H 3JYCA 3QIUB 3TT1L 3TOPA 5FDWA 4HGMA 3QZLA 4PFEA 4LEXL 4AC4A 4YGAB 1A9EA 3ARDB 4UTBA 4HJEA 3BUYA 1PU0A 1MCPH 3W82A 2N59A 4CADA 3VGEA 2AVGA 2H2SD 2Y1AA 3QDMD 4XNUH 3DO3A 3HHRB 4W4OA 3PREA 1CB4A 4LVNB 5E9DB 2ICEB 1ZCRA 1KGCE 1IAKB 5IMKB 2Q20A 3QUXD 5ICYA 1HN1A 3ME0A 2WWMD 1XH2A 4LGSB 1HK6A 5CD5D 3QDMB 4JM0A 4WUUA 3VACA 1JGEA 3CQQA 4YLCA 2X4UB 1XF3A 3OR6B 3QUXB 1FFOA 1FAIH 4YS4A 1N59B 4MMYB 4MD5B 5E1AB 3LH2L 3G3LA 4PN6A 2DWDB 2XI9A 4X4XB 3JWNH 1WUZA 1YEJL 3VXQA 4B9IA 3N91A 2JB6B 5MP6H 4M48H 3EXJA 3WE1A 4GW4A 4WSKA 2G9HB 4ZS6C 4MWFA 5I8KH 3T6XA 2CIIA 1PQZA 1M05A 4IMLB 2BNUB 3ZDZE 4P2RE 4FLQA 5KSBA 1DO5A 3N42B 3W0WA 3TWCL 5CEZE 4J8RB 2EDHA 2W81C 2YWZA 4JK0D 4NQSA 1Q9WB 4HJUA 2CJ3A 3MRDA 3FOLB 1CWVA 4X8XA 3JXAA 3RURA 1E65A 2QDWA 1CDIA 3A6BH 3NSJA 1V3KA 5L0QC 3HC3L 3VU1A 3GLAA 1SF5A 1CURA 2WC7A 3PGDA 4WFHE 1SEBB 2HB0A 2D2CC 2MQCA 2BP3A 3HG1B 5E1QA 3V9EA 2AK4D 3F85A 3GIZH 4JRFA 1S6NA 4XPAL 1TIUA 1S7XB 4JRXE 3UL4A 2FTAA 3BN9C 4APXA 4FFVD 4N4YB 4PJ5D 3BCFA 3X14A 1QRNB 4R97B 2O5YL 1MRFL 1UH3A 1BBDH 2B0SH 1HAWA 3D39B 3OHXA 1LEKA 3G04B 5KEZA 2CD0A 3GIVB 1S3RA 4QWWD 4X98B 5DJZA 5SWZB 1Y6KR 4LSSH 3LS4H 4ETQA 5HI5C 2FYYB 3L3JB 4PCSA 4Z8FL 3LKPA 4H1LG 5D5MF 4I0KA 3VGGA 4I1NB 1WJ3A 1YY9C 3BPOB 5DEZA 1WICA 1TLMA 3ARXA 5IW1A 3A67L 5HGHB 3Q5OA 3N04A 4YHPA 3WD5L 2F15A 1BLNA 3OSVA 2YEZA 2JMRA 3CSTA 1ZDQA 3CXDH 3L5IA 4LK4A 4NZRH 4EE2A 1SXSA 5KVGL 4Y2OB 3JUYA 3PNWB 4M5TA 2F68X 4IGBD 4GS7B 1INQA 1TETH 1M7DA 5AW1B 1YNLH 3N85H 1YEKL 2A9NH 4KHXH 5DI8B 1G6RH 4U7SA 1G9NL 3SPJA 4LVEA 3NJIA 1IM9D 4HIQA 1HHKB 3JVGC 2E6JA 3F7LA 1JCKA 3LJ3A 2Q86B 3SKNA 4PJHB 2BK8A 1AGBA 1JZFA 2X1OA 2EC8A 5JR1H 3KCPB 3WJJA 3L3HB 3OGCB 4I2XB 5GGTA 1IIKA 5BRZB 1IAIL 2XWTA 3CXFA 4FG0A 3TGXA 1ZHKA 3F6IA 4ZFGL 5F3HA 2OL3A 1HINH 5D1XA 5SWQA 4M7JL 5E2TH 4N28A 2V5TA 4YQXH 1F90H 2NX5D 3BSZL 2BZCA 3V4UH 2AS5M 2CNZA 3R1GL 3UZVB 1CT8A 4MDRA 1QZNA 4AW7A 2DQJL 1M1XA 3HPJB 2EDOA 3KYNB 5AVXB 3SJVD 4V1DD 3NJVA 4HWEL 2NX5B 4U2YA 2QKIB 4F33B 4EXKA 3QNYA 1EXUA 1DQQA 3OJDA 4TOYL 1AG6A 3AG1B 5C0IB 2HZHA 4PREB 3VXTB 5FO8B 5ESVB 1FGNH 3V6OC 4NS0A 5FECA 4MZ2A 2XKSA 5DJ0A 3OG4B 3TN0D 3SJVB 2X4QB 4HKZB 3RLSA 3OB0K 3VFGL 3TNMA 2IMNA 4YDJA 2F54D 2ICCA 4IKJA 4HUUA 1IAIM 3UTOA 3BZ4A 2WVTA 3P9WB 3SO3C 3IPFA 5D1ZC 5D93C 5DVMA 4DTGL 3SSGA 5ENWA 1VPOL 4JR9L 4OTXH 3IFPB 1JUFA 5F7FA 3RFZB 3GBNH 3TN0B 4FS0A 2Q3XA 1T5XA 3T5WA 2XZCL 2F54B 3EXLA 2EE6A 3BVNA 3Q43A 4X9IA 4AG4H 4DP4X 2UXVA 3PWLB 3SDYH 2N7BA 3LKNA 1HXYA 1CBVL 4CJ0A 2OMZA 3N41B 2J12B 3V0GA 4MA8H 2NY6D 3FHEA 1WUNT 1HU8A 2X2HA 4NQED 5GJSL 5IVOA 2WBXA 4CMHB 2VR9A 1PPIA 2WLZA 3MMEB 1F02I 3ZDYB 2XTLA 3P3UA 1GYVA 1MIML 1RIUH 3L3DA 2XN2A 2EINB 3EKCA 1SPDA 1IX2A 2D73A 1QFPA 4MCNA 5ILTL 3VI3E 1T4KB 3VGAC 4FABL 2E0PA 5IG7A 2E56A 1MFBL 1PDKB 3DIFA 1IMHC 1G6VK 2OSLB 1JSYA 2QR0A 3SYPA 5MEND 2R2CA 2X89A 2EIJB 3VXSB 4LDLB 1MW2A 5D2NE 4YHMH 1DJXA 5F88A 3O45B 3ZDXF 5SX5K 4L9LC 1NCAL 2OYKA 2EXWC 4PRID 2YFOA 3MV9E 3MKGA 5B7EA 4NHCL 3P2DA 1MUJA 3DK0A 3LDBB 5DJ6A 8CGTA 4G9DA 4KDVA 1WZAA 4G83A 2AQSA 1UUSA 1NANH 4XHJD 4LRNL 4KY1L 4JX0A 4K55A 3W11D 2K7QA 5I17B 5IB2B 4RFNB 1CMOA 4PRIB 3S37L 1FZOB 2WV3A 3HN8A 4ZPVB 2JJTA 2OTPA 3BE1L 3O6MH 4AIZB 1JVKA 3AB0C 3GI9H 4HS8H 4OM0L 3FYEB 2WSKA 5B22A 4OZGB 1GGBH 1RD6A 4WI9A 2HMID 4FZEL 1F56A 2J56A 2JJSA 4LPCA 4PB0L 1SQMA 1WV7T 1P84J 4LGRB 4RAUA 1DBML 1TYRA 2IVFC 1G6RA 2VTFA 3EOAA 1ZSHA 3O0RH 4YIQB 3F8UB 3CVHB 4OBRA 3GZOA 4JFPB 3GSNH 1P7KA 5MEPA 2H6UA 3FUEA 1DBJH 3R19A 1SBSH 2DM4A 3FT3A 2YGNA 3ZQXA 2WPGA 3WEXA 4F15B 1AOZA 1XCQA 4X7EC 3INUH 1J5DA 1GOGA 4UDUB 1EANA 4KKBD 3PWJB 1NBZA 2WLLB 2DQCL 2N1TE 1DN2A 1RHHA 2EEFA 3HE6D 4NI3A 1BAGA 5JW4Q 3HHMA 5I1KL 2Z3FA 1BVKA 4H26A 2X4RA 3PP4L 4OGYL 4OY9A 5EOTB 1UOWA 1ZD6A 1OGAD 5TE6L 3U2SA 1FNEB 1KYFA 2PUQT 3UEQA 2YMXL 4P5KA 4LLMB 1F3JA 5ICXA 2EDKA 2FT6A 3CFUA 3ET9F 3OKMA 2IAND 3VYOA 4KROD 4QF1A 5TPWH 4R2GD 5CR8A 2H26A 4CN4A 4X6CF 5F1IB 4IS6B 3H0TB 2GHZA 3VQLA 3F05A 3IJSB 3MCKB 3QUZD 4Y4HC 2RBLA 3ARRA 3NYKA 1YUHB 5J6GB 3OGOE 1YDPB 1HXKA 3G6DH 4BK5C 3MRIA 2F08A 1DQLH 2IQ9L 2WLIB 4KROB 4PJIF 4R2GB 5CHNA 5MI0B 4E41E 2QVKA 1KLGB 4BH8B 5DUPL 1KCSL 3L3KB 1KN4H 1OGTB 3QUZB 3A22A 2EH8L 1XVSA 4M29A 3UX9B 1TZGL 3C8KA 5JHDA 3M17A 3QJQB 2O72A 2FO8A 3IDXH 1A6VL 4N68A 4YHZH 3ILDA 4PJDE 5C0AD 1NUNB 5C0GB 3K6DA 3OF6D 4N2HA 4LLUA 4X7TA 3ZGHA 3PAUA 3T2NL 3RTQB 1CIUA 3K3QA 1OCOB 5A2AA 5MEOA 5DGQA 4JREB 1OE2A 4G80A 4AVKA 2QT6A 3QCVH 1BG1A 4PJ5A 4GI6A 4TNVK 4ZSOA 2QTVA 3QZOA 3MV7D 3TT1H 1P0SE 5C0AB 4YH6A 4LEXH 5AQ0A 5IJVA 2FQEA 1U21A 4HKBA 4W9DC 1B88A 1X5MA 1E9PA 3HLAB 2EDWA 3BWUC 2L8AA 4XO3A 5IEKB 5BS0E 3IJ9A 3QJZA 4WU5B 2WTPA 2PPEA 2CBPA 5JW3L 1K5NA 1PCXA 1DCLA 2BOCB 4LCYA 3KVDD 2JWYA 3PS6A 1KFGA 2AEQL 3HI1A 4WHCA 4PJ6A 4F7EB 5IVXA 4AYFB 2MTAA 1E9QA 4GQRA 2BSTB 4IGBA 4MZRA 1MVYA 4U6XB 3FTUA 2VSCA 5DUJA 5E1HB 2PP7A 1ZVYA 1IM9A 1E3FA 1I3RA 5H37G 3LH2H 3KWUA 1YQ2A 5EIIB 4ZOEA 5JIPA 1YEJH 2B8OT 4XNZB 4LCUB 4PLKD 2QVMA 4K71B 4L23A 1KYOJ 1Q94B 1H15B 3VGHA 1FL3A 4CA4A 3K74B 3FCSB 3D12B 3UP6A 1VRSA 2BRRL 2GY5A 2KZWA 3CFJA 5FO9B 3UTZB 3S3DB 1VADB 3EFFA 3CUPB 2HX7A 2FBJL 2MOQA 2ZUQC 1TUPA 3HUJF 4B9KC 3NCXA 4Z5RA 4DP2X 1JXKA 4U0RB 4WTQA 2NZ9C 5FC9A 1UASA 3MO1A 3DX4A 1NDGB 1QA9B 2NOYA 5AVSB 3HC3H 4ORGA 5JIDA 2V7HB 3GSNA 4KTYA 3REWA 5EC1A 4F5CA 4MJ5B 3TBSB 2GFBB 3FT4A 2ZP8A 4V1DA 3KJ4B 4JFYA 3S9DB 1FVDB 2OMUA 1WIUA 3R7QA 4Y1AE 2ZAGA 3RBGA 1CL7L 4WI8A 1AD0A 1PGRB 1FNHA 1CFBA 3BZEB 2ZAIA 4ZUTA 5ICUA 3PXLA 5I6NA 3SPHA 5B7FA 2DM2A 2CO7B 1C9SA 2AXJA 1JE6A 1IC7H 2A6KB 2O5YH 4TSBL 1MRFH 5CKGA 4U1MB 2ITEA 3QHTC 3LN9A 4MHHG 5GRZA 32C2A 5I6MA 3MBEC 1AS7A 2VXQL 1AOHA 4MAUL 2EDXA 4J3SA 5AKSA 3ZTJG 1KPUB 2VITA 4Z8FH 3K6NA 1LEIB 4NHUA 5AVTB 4GXVH 4HVBA 1JRHI 5I6XB 3DGGB 1LD9B 3VRLE 3VXRE 1HL4A 3RA7L 4C56D 2FZ3B 1ERNA 5JPNB 1KTLA 1Z2KA 5DJXA 2FLBT 3IDNB 1CCZA 3Q9QA 1NM4A 3A67H 4X7FC 4BQ8A 3WD5H 4GRWF 1YLBB 2P5WB 4AGLA 1A1OA 3UG3A 5KVGH 5IK3A 2XT1B 5FHBL 4N5EC 5JLZA 1ZT4B 3IJYA 2BIMA 4G1EB 4PTTA 5IFAL 3ZE1F 1A0QL 1YEKH 1T20A 4LB8A 1J9SA 2P5EB 1IBZA 2X87A 1XWVA 4AJWA 5BXFA 1CGUA 4MJJA 4MNQE 1EAPB 1JG9A 1KGXA 4NPJA 1JK9B 4XXCA 3IJ8A 5KVDL 4BWTA 1URZA 4YHKL 4WDIA 2CGRL 3UTTA 1OAXL 3BCDA 9CGTA 3JWNG 5HGAA 4DO6A 2W65A 4JFHE 4LDCA 1IAIH 1T5KA 4D7PA 5MENA 1THCA 4WWPA 2Y3AA 5CIPH 5EU7C 3QNZB 1Q1JL 4ZFGH 4HBCL 4H2CA 5ISZE 1HT6A 1P6WA 3AQZA 4M7JH 4Y16C 5GGSA 1E8YA 2DAVA 3BSZH 1J5OL 3HE7A 3PHQB 1A7NH 4QTHB 3GDCA 5DYFA 3H9YA 2DQJH 4IRJD 4QXTB 1AI1L 3U7WL 3AREB 3C5JB 3WV0A 3KPQA 5HHNA 3QIWC 3EJQA 4BRVA 3GZPA 3ARGC 4HWEH 3M86A 1T1ZA 1CDHA 2I60L 3RL1A 5CBAB 3L9EA 3R8BB 4TOYH 3WMPA 4KKPA 2DQGL 1IEAA 1ZLUH 2A83A 4FG6C 1KIRB 3PABB 5IHHA 2WXRA 4XMTA 3VI4F 3PL6C 4FQLL 4HIIB 1AQKH 3PDOA 3VFGH 4KK9C 1TQCC 4B5ZA 1KBBA 4HQQL 4NX0A 3WENA 2E46A 2J73A 4GBXA 2I85A 4LCVA 4UBDC 4AJ0A 4DTGH 2R0LH 1VPOH 4JR9H 5KANI 4RNRA 4PWIA 4JO3L 3NGBC 1HOCA 2XZCH 3UAJD 4UF7C 2BX5A 1MCCA 4QHUB 3HE6A 2CLZA 1HZKA 1GCFA 4FNPA 1C12B 4YL9A 4EVNA 1CBVH 1U8NA 4UYPA 1RKRA 4P2QE 4ATWA 4YHYB 4EIBA 3ULVE 4XWOC 2EE3A 5GJSH 5LBSH 2VW4A 3LZPA 4YPGB 4ELDA 3WTTA 1MEXH 1OGAA 1AHWA 2BHFA 3T0AA 2IG2L 1L9PA 3TL5A 4ODXB 5L4FA 2YA0A 4LCCB 2V2WA 4KUZL 4P4RA 1NAML 2IANA 5ILTH 2V2XA 5CKAA 3BFWA 1HNGA 3G5XB 1UADC 3IFNL 2ZUWA 4XC1L 4JHZA 2ISDA 4FABH 1F6LL 1MFBH 3H85A 3IB4A 4ZW6A 5D8JH 1UVQA 4NC1E 3GUFA 4RWHA 2UYLA 3A24A 1TOXA 1T80A 3CQFA 4HMDA 1I8KB 2MPAL 3T65A 4DKTA 4E0RA 1AZNA 1DR9A 1P4BL 5HDOA 4HH9A 1NCAH 2ZYHA 1HC1A 4PRHD 2H47C 3DUUA 3FTGB 3UOAB 4NHCH 5IB5B 2VDPH 3MV8B 3QYCA 4LRNH 4N8UA 4I3GA 2C7UA 4KY1H 3BLKA 5DR5L 2MCG1 4PJFA 3WIFB 1UM4L 3S37H 3D51A 2X4PB 3B5HA 3BE1H 3QUHA 4HT1L 1AQHA 2W0KA 3BUBA 1FN4A 2A6JB 3S96A 5F0PB 5GHWL 3Q2NA 1L7IL 3MV7A 4FZEH 2RCSL 4X5WA 1JTOA 2J5LB 2VZ3A 2E59A 2ZOTA 4PB0H 4AKPA 2CDGA 1DBMH 4NSKA 3MCLL 4G8GA 1J5HA 1N2RB 3W1ZA 1XR8B 3UAFA 4P05A 4L8SB 5C0EB 1BBJB 1SN2A 3KWWA 3N0PB 2A74C 2ZXAA 1V3MA 4S2SA 2HTLC 3L9YA 3HC0B 1KNOB 3C6LA 1Q4NX 3E1ZA 3LNFA 4H7VA 5IIEA 3ZTDC 1OP5H 3EGDA 3DYOA 2IQAA 3IMBA 4JDEB 2LAGB 2NY1D 4DUXA 4G3YL 1OW0C 1BREA 2WJ7A 1HTYA 5CIPA 1FZKA 2DQCH 2OXGB 4HKXB 4NB7A 4NNYA 4UQCA 1DQJA 5I1KH 1CLCA 3BSZA 2XY1A 4R96B 2ARJB 3WNIA 3PP4H 4OGYH 2NY1B 3VW3H 5TE6H 4HUVB 3PPSA 1AXTL 3SCMB 4K94C 1FYTE 1QKZH 1E5ZA 2YMXH 1MFMA 4FFZL 3GSWB 3WGVB 4XRCA 1N9PA 5LAXA 3E3QE 4WW2A 1HHIA 1QFWI 3U0WL 1T22A 1R5WA 3PV6A 3BISA 5EEWA 3VG9B 4JFXA 2AERT 3SE4C 4NO0D 1MPAL 1DBAL 1BVLA 1CYWA 4Q56A 5HVHB 2C3WA 1M7UA 3N2JA 4P4KB 1J12A 5F2FA 5DUPH 1KCSH 4LCWD 1CG9B 1NUFA 1QNIA 1TQBC 3BQVA 3E80A 4U3SB 1B90A 4UQ9A 1TZGH 7TAAA 4KRPC 3DDGA 4PAZA 1H9DA 2JF1A 4NO0B 1G7LA 5K39B 1A6VH 1BJMA 2JKNA 5AYUL 5D7KE 1WA0X 3T2NH 2F53E 1FAKT 3GLEA 3V6ZA 4WWKD 2EKSA 4H0GA 4G9FD 3FK3A 3PAYA 4F58L 3VDAA 5AW0B 1N5AA 4LSDA 2NLJA 3S8FB 1B0GA 2QGEA 1EHNA 1J0YA 1ZAGA 3BH8B 2PCXA 2JJVA 3MNWB 5LBSA 2GBAA 5DHEA 4KK5C 1C5CL 2XWRA 4NLHA 3IJEA 3BP5A 1KN2L 4G9FB 4UNTA 5INCA 1YNKL 4WW1B 2K7PA 3BUTA 1TZIB 3NJJA 3RHWF 4C56A 5JW3H 3DBSA 4LASL 4R0LC 3HVNA 1S78C 1QR1B 4LL1A 3N9GL 2AEQH 5D1QD 3TBYA 5IOPB 4L5FE 3D69B 1QO3B 1QW8A 3GMRB 3B9KD 3WELA 3BPLC 4OU3A 5HHQB 4NJ9L 4FQXC 4QRRD 2PW1A 5GGRA 5T33L 4Q14A 1GR7A 4G43A 1LP9E 3DX9B 1X7QB 1ZLWH 4XPFL 3KH4A 1GZHC 3MJ7A 3RTLA 3SDDB 4JBSA 1M7XA 4KO9A 1TSHA 5E8DL 2R2BA 3TJEL 5K9OA 4KJQC 3WLWC 4DHLA 4Y19E 3TONA 3WO4C 1FLRL 2E9GA 2X70B 3EBHA 2ATKB 5F21B 2QVTA 4LIQH 4AENA 1QHOA 2BRRH 2N7SA 2VLME 4NIKB 3A47A 4LLWB 1RL1A 1TEYA 2MFNA 2SEBA 4FA6A 4U4IA 5F6IC 4FFWD 4GRLC 3K72B 2ZXCA 3LPFA 3BAWA 1KTRL 1NJ9B 3MUHL 1XF5A 2Z4QA 3TBTA 4CJ1A 4LOUC 4ZQTA 4DGYL 2EO9A 4U1JB 4Z7VA 4S0HA 1MCEA 4IRJA 3VCLA 4NRZB 1U95A 4EAEA 3TBBA 2OW6A 4ZFZA 1QSFB 3S5LB 2ROXA 2YUWA 4L2YA 1W0VB 3L7EB 2X2JA 2HCZX 2XA3A 4R7DB 4ZUSB 1CL7H 2EXTA 4MFHA 3U0TB 4DEPB 5I28A 5INDA 2ICWB 2AJZA 4R4BB 3ZL2A 3VA6A 2GYSA 1BAWA 4HHWA 4DUVA 4TSBH 3VXPB 5FOBB 5KSAD 4GAFB 4KVPA 4LKCA 3FTZA 5DMKA 4NO5B 2VXQH 3QDHA 2XA8L 2YS4A 4MAUH 2J21A 4LOEA 3RVWC 4FXGA 3TA3B 4MAYA 3E8VA 4Q6IC 3WSQL 5IQNA 4DVBB 3NSFA 5DWUL 1IE4A 1UXSA 4FXLA 2WTOA 2Y2WA 3WFCL 1GOFA 4L3FA 3KCWA 3POHA 3OXSA 2D31B 3TCLB 2NY2C 5F44A 2J7LA 2EE2A 5I76B 4LLAA 3UTQA 5B8CA 3FO1A 5FHBH 1DO6A 2RFXA 3WKPA 2OJZL 1AO7A 3GWJA 4HIJA 4AE1A 5IFAH 4BH7B 1KF9B 2HH0H 3E6FB 5F7WC 5JIHA 4U05A 8FABA 1OKEA 3OSKA 3QIBB 2XN9D 2W60B 1G7PB 2ZKXA 5EO0A 2RAMA 3SD2A 1E4XL 1WS8A 1A2YB 3ABMB 3HS0B 1M3IA 4URKA 1GMIA 2RTTA 5KVDH 1MJJB 3GJFH 3QRBA 4YHKH 5EU6A 1BVOA 3TJHD 2CGRH 1E3XA 3O6LH 1OAXH 2E7BA 3D2UD 1Q9LA 5IY5B 4ZMQA 1JD7A 2XN9B 1H8SA 5AALA 1ZGLB 3SGEI 2BVUA 3T77B 5KG9B 1DEDA 1Q1JH 2ATPB 2V9RA 5CSBA 4M93C 1IIIA 4XX1E 2XOTA 1AIZA 1A4JA 5I1GH 1NGXB 1SJMA 2XV6B 5HYJE 4PRHA 1JWUB 1J5OH 1KT2A 4PPTA 2CUIA 3LXAA 3QUML 3OKNB 3ZYZA 3D2UB 4OGAC 1WAPA 3SDXE 5JORA 3TPKA 1V7NL 3C87A 4R8WL 1BIHA 3U7WH 4CW1A 4XB8A 3KLHC 3HZKB 1D9KB 2FGWH 3VGFA 1DJWA 4APQD 3SIKA 1V8HA 2I60H 4J1UB 5EPMB 5KYUB 1E2ZA 3P3RA 3FQYA 4AH2B 2DQGH 1OB1A 2NUPA 3OHXC 4N5UA 4E5XA 4Q52A 3QRFM 4S1QL 3APFA 4WKXA 4N2IA 3MRMA 4ELMA 3RIKA 3ULUF 4FQLH 2BC4A 2FR4B 2NY7L 4APQB 4HQQH 3CFNA 1DBKL 1BD2B 5AVUB 5HBBA 1XZ0B 2R4SL 3V0WL 3S48A 2RMNA 1JFHA 1VGKA 2HVKB 2ESVA 3ZBMA 1PIFA 1HNYA 4O5LL 1O7SA 3FPYA 3TU6A 2GJRA 3P3YA 3QXAB 2F61A 3DJSA 4GP4B 3HAEH 4A39A 4DFIA 4JO3H 3TF4A 4U6HA 2P24B 3TS8A 1ANUA 4KI5D 3RDTB 2B4CL 3U2JA 5DS1A 5AENA 2BSRB 4OKDA 1SUHA 3OKEA 4OFPA 3TO4A 3CC5B 2D0HA 4KVNL 2QJDA 2E75C 4A7UA 3IFLL 3HVDA 5BZWB 1B0RB 2QVIA 5AOZA 3T4AC 1T21B 2BIQA 4XNMA 4OZHA 3OMNB 5K9JH 1VENA 3GXIA 1LE9A 2CBMA 3QJTB 4L3EB 2CUAA 3K8MA 2IG2H 2MOGA 3HA0A 4PCYA 3SPCA 5JZ7C 1U3YA 4KUZH 3WJJC 1NAMH 1EEQA 3AADB 3SQBA 3K6OA 1Z5YD 4GP8B 1XGPB 5HGBB 5IHUL 2YSSB 5L6YL 1K2DB 3WE6A 1ZWIB 4IK7A 3SY0B 5I0VA 3IE9A 4HP5A 5D1XC 1IM3D 4G72B 4PJ8B 1FG9C 1RUML 3QI9A 4KO5A 5J9PB 2MPAH 2OX5A 3ESNA 1P4BH 1FIGH 4Z76A 3QFDB 1YY8A 1PD1A 1TCRA 4I18B 1I7ZB 1QWHA 2OMXB 4LCWA 3WIAA 3VD4A 1BZ9A 3ME0B 4R4ND 4XE0A 4YSUA 2FE0A 1L3WA 3IDGB 4HK3J 5EBLA 1ONQA 4Z3FA 4DESA 1M2VB 1SYSA 3HFFA 4PV8A 5D6CA 3DPDA 2QPSA 1OTTC 2XYBA 1NWOA 4LNRB 1R9FA 4BZ2L 3EH2A 2DYSB 5KJRL 3LD8B 4F9LA 5DRNB 1F0LA 3TZVC 4E9TA 1SOSA 2DYPD 1GXEA 4X6FB 4EOWL 4PBXA 4RQQA 4N0UE 3LNEA 3T1FA 2VDKL 2RCSH 5JIMA 2ZWYA 1I3GH 4KJPD 3CFIC 1X5JA 2DIBA 3CWGA 4IHBA 1EAQA 3JWNC 4LSUH 3VDBA 5EU3A 3MCLH 4YE0A 1NIDA 2H0JA 2DYPB 3FTVA 2DLGA 4M1DL 4MBOA 2B1HL 1BDYA 2NW2A 3GJFA 2EDDA 1NFDE 1ILUA 3AT0A 4NAJA 1P7HL 4G3YH 4HKJA 3U9UA 5D1QA 3BGMB 3ISYA 5DRZB 2MPVA 3FUNA 2DWYA 3PQYE 4FA7B 3B9KA 4ODBD 1IC0A 2Y25A 2PETA 4JL2A 1AGCB 4PGZA 1CGTA 3FQUB 5CSZB 4YSOA 3H42H 4NFBA 3RVXD 4N3UA 4QNPE 2UX6A 1AXTH 1T2JA 4HFUL 1YJDL 1OXYA 3MKKA 4FFZH 1H5BA 2FQDA 4FOMA 1DUYA 2WKOF 1TZHB 4PRPD 4FNTA 4NO3B 5E6YA 3U0WH 2WANA 2CMRL 2YA1A 2YAPA 2CJUL 4XP5L